High ethanol producing derivatives of Thermoanaerobacter ethanolicus
Ljungdahl, L.G.; Carriera, L.H.
1983-05-24
Derivatives of the newly discovered microorganism Thermoanaerobacter ethanolicus which under anaerobic and thermophilic conditions continuously ferment substrates such as starch, cellobiose, glucose, xylose and other sugars to produce recoverable amounts of ethanol solving the problem of fermentations yielding low concentrations of ethanol using the parent strain of the microorganism Thermoanaerobacter ethanolicus are disclosed. These new derivatives are ethanol tolerant up to 10% (v/v) ethanol during fermentation. The process includes the use of an aqueous fermentation medium, containing the substrate at a substrate concentration greater than 1% (w/v).
Balk, Melike
2009-08-23
A novel anaerobic, thermophilic, Gram-positive, spore-forming, and sugar-fermenting bacterium (strain TLO) was isolated from a geothermal spring in Ayaş, Turkey. The cells were straight to curved rods, 0.4-0.6 microm in diameter and 3.5-10 microm in length. Spores were terminal and round. The temperature range for growth was 40-80 degrees C, with an optimum at 70 degrees C. The pH optimum was between 6.3 and 6.8. Strain TLO has the capability to ferment a wide variety of mono-, di-, and polysaccharides and proteinaceous substrates, producing mainly lactate, next to acetate, ethanol, alanine, H(2), and CO(2). Remarkably, the bacterium was able to grow in an atmosphere of up to 25% of CO as sole electron donor. CO oxidation was coupled to H(2) and CO(2) formation. The G + C content of the genomic DNA was 35.1 mol%. Based on 16S rRNA gene sequence analysis and the DNA-DNA hybridization data, this bacterium is most closely related to Thermoanaerobacter thermohydrosulfuricus and Thermoanaerobacter siderophilus (99% similarity for both). However, strain TLO differs from Thermoanaerobacter thermohydrosulfuricus in important aspects, such as CO-utilization and lipid composition. These differences led us to propose that strain TLO represents a subspecies of Thermoanaerobacter thermohydrosulfuricus, and we therefore name it Thermoanaerobacter thermohydrosulfuricus subsp. carboxydovorans.
Balk, Melike; Heilig, Hans G H J; van Eekert, Miriam H A; Stams, Alfons J M; Rijpstra, Irene C; Sinninghe-Damsté , Jaap S; de Vos, Willem M; Kengen, Servé W M
2009-01-01
A novel anaerobic, thermophilic, Gram-positive, spore-forming, and sugar-fermenting bacterium (strain TLO) was isolated from a geothermal spring in Ayaş, Turkey. The cells were straight to curved rods, 0.4-0.6 microm in diameter and 3.5-10 microm in length. Spores were terminal and round. The temperature range for growth was 40-80 degrees C, with an optimum at 70 degrees C. The pH optimum was between 6.3 and 6.8. Strain TLO has the capability to ferment a wide variety of mono-, di-, and polysaccharides and proteinaceous substrates, producing mainly lactate, next to acetate, ethanol, alanine, H(2), and CO(2). Remarkably, the bacterium was able to grow in an atmosphere of up to 25% of CO as sole electron donor. CO oxidation was coupled to H(2) and CO(2) formation. The G + C content of the genomic DNA was 35.1 mol%. Based on 16S rRNA gene sequence analysis and the DNA-DNA hybridization data, this bacterium is most closely related to Thermoanaerobacter thermohydrosulfuricus and Thermoanaerobacter siderophilus (99% similarity for both). However, strain TLO differs from Thermoanaerobacter thermohydrosulfuricus in important aspects, such as CO-utilization and lipid composition. These differences led us to propose that strain TLO represents a subspecies of Thermoanaerobacter thermohydrosulfuricus, and we therefore name it Thermoanaerobacter thermohydrosulfuricus subsp. carboxydovorans.
A Genetic System for the Thermophilic Acetogenic Bacterium Thermoanaerobacter kivui.
Basen, Mirko; Geiger, Irina; Henke, Laura; Müller, Volker
2018-02-01
Thermoanaerobacter kivui is one of the very few thermophilic acetogenic microorganisms. It grows optimally at 66°C on sugars but also lithotrophically with H 2 + CO 2 or with CO, producing acetate as the major product. While a genome-derived model of acetogenesis has been developed, only a few physiological or biochemical experiments regarding the function of important enzymes in carbon and energy metabolism have been carried out. To address this issue, we developed a method for targeted markerless gene deletions and for integration of genes into the genome of T. kivui The strain naturally took up plasmid DNA in the exponential growth phase, with a transformation frequency of up to 3.9 × 10 -6 A nonreplicating plasmid and selection with 5-fluoroorotate was used to delete the gene encoding the orotate phosphoribosyltransferase ( pyrE ), resulting in a Δ pyrE uracil-auxotrophic strain, TKV002. Reintroduction of pyrE on a plasmid or insertion of pyrE into different loci within the genome restored growth without uracil. We subsequently studied fructose metabolism in T. kivui The gene fruK (TKV_c23150) encoding 1-phosphofructosekinase (1-PFK) was deleted, using pyrE as a selective marker via two single homologous recombination events. The resulting Δ fruK strain, TKV003, did not grow on fructose; however, growth on glucose (or on mannose) was unaffected. The combination of pyrE as a selective marker and the natural competence of the strain for DNA uptake will be the basis for future studies on CO 2 reduction and energy conservation and their regulation in this thermophilic acetogenic bacterium. IMPORTANCE Acetogenic bacteria are currently the focus of research toward biotechnological applications due to their potential for de novo synthesis of carbon compounds such as acetate, butyrate, or ethanol from H 2 + CO 2 or from synthesis gas. Based on available genome sequences and on biochemical experiments, acetogens differ in their energy metabolism. Thus, there is an
Energy Technology Data Exchange (ETDEWEB)
Peteranderl, R.; Canganella, F.; Holzenburg, A.; Wiegel, J. [Univ. of Georgia, Athens, GA (United States)
1993-10-01
Autolysis was induced to form stable, cell wall-free cells of Clostridium thermohydrosulfuricum JW102 and Thermoanaerobacter ethanolicus JW200, using a complex medium containing glycine (0.4% wt/vol) and/or sucrose or glycerol (10% wt/vol) at an optimum temperature of 64{degrees}C. Autoplasts of both bacteria were grown as L-phase colonies on solid medium; more than 50% of these colonies regenerated to the walled form during prolonged incubation. The removal of the cell wall was confirmed by electron microscopy.
Occurrence and Detection of Thermoanaerobacterium and Thermoanaerobacter in Canned Food
Directory of Open Access Journals (Sweden)
Christian Dotzauer
2002-01-01
Full Text Available In order to determine the reason for loss of vacuum in canned food, obligately anaerobic, spore forming thermophilic organisms were isolated from shelf-stable canned food containing vegetables, noodles and potatoes as main ingredients. Thermophilic bacteria from 44 canned food samples that had been stored under anaerobic conditions at 37 °C for at least 7 days were isolated. In addition, organic fertilizer used for the cultivation of some of the foods’ ingredients was examined and anaerobic, thermophilic bacteria could also be isolated from this source. Identification of bacterial strains was carried out by partial and complete 16S-rRNA-gene sequencing. Some of the obtained gene sequences showed a high level of similarity to existing 16S-rRNA gene sequences towards strains of the genera Thermoanaerobacter, Thermoanaerobium and Thermoanaerobacterium respectively, which have not yet been reported to be of importance as food spoilers. In the course of identification of these thermophilic bacteria we developed genera specific PCR-based approaches for detecting isolates belonging to the genera Thermoanaeroacterium and Thermoanaerobacter. Direct capturing of free DNA from contaminated samples using oligonucleotides coupled with paramagentic beads allowed the reduction of the detection time to six hours with a lower limit of 104 cells/mL.
Karume, Ibrahim; Musa, Musa M.; Bsharat, Odey; Takahashi, Masateru; Hamdan, Samir; El Ali, Bassam
2016-01-01
The immobilization of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase (TeSADH) using sol–gel method enables its use to racemize enantiopure alcohols in organic media. Here, we report the racemization of enantiopure phenyl
DEFF Research Database (Denmark)
Yao, Shuo; Just Mikkelsen, Marie
2010-01-01
Thermoanaerobacter mathranii contains four genes, adhA, adhB, bdhA and adhE, predicted to code for alcohol dehydrogenases involved in ethanol metabolism. These alcohol dehydrogenases were characterized as NADP(H)-dependent primary alcohol dehydrogenase (AdhA), secondary alcohol dehydrogenase (Adh....... Overexpressions of AdhE in strain BG1E1 with xylose as a substrate facilitate the production of ethanol at an increased yield. Copyright © 2010 S. Karger AG, Basel...
Musa, Musa M.
2013-01-01
Controlled racemization of enantiopure phenyl-ring-containing secondary alcohols is achieved in this study using W110A secondary alcohol dehydrogenase from Thermoanaerobacter ethanolicus (W110A TeSADH) and in the presence of the reduced and oxidized forms of its cofactor nicotinamide-adenine dinucleotide. Racemization of both enantiomers of alcohols accepted by W110A TeSADH, not only with low, but also with reasonably high, enantiomeric discrimination is achieved by this method. Furthermore, the high tolerance of TeSADH to organic solvents allows TeSADH-catalyzed racemization to be conducted in media containing up to 50% (v/v) of organic solvents. © 2013 The Royal Society of Chemistry.
International Nuclear Information System (INIS)
Watanabe, L.; Arni, R.K.
1996-01-01
Full text. Ethanol fermentations from Saccharomyces sp. are used in industrial ethanol production and are performed at mesophilic temperatures where final ethanol concentrations must exceed 4% (v/v) to make the process industrially economic. In addition, distillation is required to recover ethanol. Thermophilic fermentations are very attractive since they enable separation of ethanol from continuous cultures at process temperature and reduced pressure. Two different ethanol-production pathways have been identified for thermophilic bacteria; type I from Clostridium thermocellum, which contains only NADH-linked primary-alcohol dehydrogeneases, and type II from Thermoanaerobacter brockii which in addition include NADPH-linked secondary-alcohol dehydrogenases. The thermophilic anaerobic bacterium T ethanolicus 39E produces ethanol as the major end product from starch, pentose and herose substrates. The 2 Adh has a lower catalytic efficiency for the oxidation of 1 alcohols, including ethanol, than for the oxidation of secondary (2) alcohols or the reduction of ketones or aldehydes and possesses a significant acetyl-CoA reductive thioesterase activity. Large single crystals (0.7 x 0.3 x 0.3 mn) of this enzyme have been obtained at 40 0 C and diffraction data to 2.7 A resolution has been collected (R merge = 10.44%). Attempts are currently underway to obtain higher resolution data and a search for heavy atom derivatives is currently underway. The crystals belong to the space group P2 1 2 1 2 with cell constants of a a= 170.0 A, b=125.7 A and c=80.5 A. The asymmetric unit contains a tetramer as in the case of the crystals of the secondary alcohol dehydrogenase from Thermoanaerobacter brockii with a V M of 2.85 A 3 /Da. (author)
Musa, Musa M.; Bsharat, Odey; Karume, Ibrahim; Vieille, Claire; Takahashi, Masateru; Hamdan, Samir
2017-01-01
Here, we report the asymmetric reduction of selected phenyl-ring-containing ketones by various single and dual site mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Further expanding the size of the substrate binding pocket in the mutant W110A/I86A not only allowed substrates of the single mutants W110A and I86A to be accommodated within the expanded active site, but also expanded the enzyme's substrate range to ketones bearing two sterically demanding groups (bulky-bulky ketones), which are not substrates for TeSADH single mutants. We also report the regio- and enantioselective reduction of diketones using W110A/I86A TeSADH and single TeSADH mutants. The double mutant exhibited dual stereopreference generating the Prelog products most of the time and the anti-Prelog products in a few cases.
Musa, Musa M.
2017-12-14
Here, we report the asymmetric reduction of selected phenyl-ring-containing ketones by various single and dual site mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Further expanding the size of the substrate binding pocket in the mutant W110A/I86A not only allowed substrates of the single mutants W110A and I86A to be accommodated within the expanded active site, but also expanded the enzyme\\'s substrate range to ketones bearing two sterically demanding groups (bulky-bulky ketones), which are not substrates for TeSADH single mutants. We also report the regio- and enantioselective reduction of diketones using W110A/I86A TeSADH and single TeSADH mutants. The double mutant exhibited dual stereopreference generating the Prelog products most of the time and the anti-Prelog products in a few cases.
Bsharat, Odey; Musa, Musa M.; Vieille, Claire; Oladepo, Sulayman; Takahashi, Masateru; Hamdan, Samir
2017-01-01
Ketones bearing two bulky substituents, named bulky-bulky ketones, were successfully reduced to their corresponding optically enriched alcohols by using various mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Substituted 2-tetralones, in particular, were reduced to 2-tetralols with high conversion and high enantioselectivity. The pharmacological importance of substituted 2-tetralols as key drug-building blocks makes our biocatalytic reduction method a highly essential tool. We showed that changing the position of the substituent on the aromatic ring of 2-tetralones impacts their binding affinity and the reaction maximum catalytic rate. Docking studies with several TeSADH mutants explain how the position of the substituent on the tetralone influences the binding orientation of substituted 2-tetralones and their reaction stereoselectivity.
Bsharat, Odey
2017-01-30
Ketones bearing two bulky substituents, named bulky-bulky ketones, were successfully reduced to their corresponding optically enriched alcohols by using various mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Substituted 2-tetralones, in particular, were reduced to 2-tetralols with high conversion and high enantioselectivity. The pharmacological importance of substituted 2-tetralols as key drug-building blocks makes our biocatalytic reduction method a highly essential tool. We showed that changing the position of the substituent on the aromatic ring of 2-tetralones impacts their binding affinity and the reaction maximum catalytic rate. Docking studies with several TeSADH mutants explain how the position of the substituent on the tetralone influences the binding orientation of substituted 2-tetralones and their reaction stereoselectivity.
DEFF Research Database (Denmark)
Georgieva, Tania I.; Mikkelsen, Marie Just; Ahring, Birgitte Kiær
2008-01-01
was not detoxified, ethanol yield in a range of 0.39-0.42 g/g was obtained. Overall, sugar efficiency to ethanol was 68-76%. The reactor was operated continuously for approximately 143 days, and no contamination was seen without the use of any agent for preventing bacterial infections. The tested microorganism has......Thermophilic ethanol fermentation of wet-exploded wheat straw hydrolysate was investigated in a continuous immobilized reactor system. The experiments were carried out in a lab-scale fluidized bed reactor (FBR) at 70C. Undetoxified wheat straw hydrolysate was used (3-12% dry matter), corresponding...... to sugar mixtures of glucose and xylose ranging from 12 to 41 g/l. The organism, thermophilic anaerobic bacterium Thermoanaerobacter BG1L1, exhibited significant resistance to high levels of acetic acid (up to 10 g/l) and other metabolic inhibitors present in the hydrolysate. Although the hydrolysate...
Andersen, Rasmus Lund; Jensen, Karen Møller; Mikkelsen, Marie Just
2015-01-01
Lignocellosic ethanol production is now at a stage where commercial or semi-commercial plants are coming online and, provided cost effective production can be achieved, lignocellulosic ethanol will become an important part of the world bio economy. However, challenges are still to be overcome throughout the process and particularly for the fermentation of the complex sugar mixtures resulting from the hydrolysis of hemicellulose. Here we describe the continuous fermentation of glucose, xylose and arabinose from non-detoxified pretreated wheat straw, birch, corn cob, sugar cane bagasse, cardboard, mixed bio waste, oil palm empty fruit bunch and frond, sugar cane syrup and sugar cane molasses using the anaerobic, thermophilic bacterium Thermoanaerobacter Pentocrobe 411. All fermentations resulted in close to maximum theoretical ethanol yields of 0.47–0.49 g/g (based on glucose, xylose, and arabinose), volumetric ethanol productivities of 1.2–2.7 g/L/h and a total sugar conversion of 90–99% including glucose, xylose and arabinose. The results solidify the potential of Thermoanaerobacter strains as candidates for lignocellulose bioconversion. PMID:26295944
NCBI nr-aa BLAST: CBRC-OSAT-10-0002 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-10-0002 ref|NP_623489.1| ABC-type dipeptide/oligopeptide/nickel transport systems...peptide/nickel transport systems, permease components [Thermoanaerobacter tengcongensis MB4] NP_623489.1 1.9 30% ...
Karume, Ibrahim
2016-10-04
The immobilization of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase (TeSADH) using sol–gel method enables its use to racemize enantiopure alcohols in organic media. Here, we report the racemization of enantiopure phenyl-ring-containing secondary alcohols using xerogel-immobilized W110A TeSADH in hexane rather than the aqueous medium required by the enzyme. We further showed that this racemization approach in organic solvent was compatible with Candida antarctica lipase B (CALB)-catalyzed kinetic resolution. This compatibility, therefore, allowed a dual enzymatic dynamic kinetic resolution of racemic alcohols using CALB-catalyzed kinetic resolution and W110A TeSADH-catalyzed racemization of phenyl-ring-containing alcohols.
High ethanol tolerance of the thermophilic anaerobic ethanol producer Thermoanaerobacter BG1L1
DEFF Research Database (Denmark)
Georgieva, Tania I.; Mikkelsen, Marie Just; Ahring, Birgitte Kiær
2007-01-01
The low ethanol tolerance of thermophilic anaerobic bacteria, generally less than 2% (v/v) ethanol, is one of the main limiting factors for their potential use for second generation fuel ethanol production. In this work, the tolerance of thermophilic anaerobic bacterium Thermoanaerobacter BG 1L1...... to exogenously added ethanol was studied in a continuous immobilized reactor system at a growth temperature of 70 degrees C. Ethanol tolerance was evaluated based on inhibition of fermentative performance e.g.. inhibition of substrate conversion. At the highest ethanol concentration tested (8.3% v/v), the strain...... was able to convert 42% of the xylose initially present, indicating that this ethanol concentration is not the upper limit tolerated by the strain. Long-term strain adaptation to high ethanol concentrations (6 - 8.3%) resulted in an improvement of xylose conversion by 25% at an ethanol concentration of 5...
Energy Technology Data Exchange (ETDEWEB)
Gao, Jinlan; Li, Xiaolu [State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Peking Union Medical College, Tsinghua University, Beijing 100005, People' s Republic of China (China); Tsinghua-Peking Joint Center for Life Sciences, Center for Structural Biology, School of Life Sciences, Tsinghua University, Beijing 100084, People' s Republic of China (China); Feng, Yue; Zhang, Bo [Tsinghua-Peking Joint Center for Life Sciences, Center for Structural Biology, School of Life Sciences, Tsinghua University, Beijing 100084, People' s Republic of China (China); Miao, Shiying [State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Peking Union Medical College, Tsinghua University, Beijing 100005, People' s Republic of China (China); Wang, Linfang, E-mail: lfwangz@yahoo.com [State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Peking Union Medical College, Tsinghua University, Beijing 100005, People' s Republic of China (China); Wang, Na, E-mail: nawang@tsinghua.edu.cn [Tsinghua-Peking Joint Center for Life Sciences, Center for Structural Biology, School of Life Sciences, Tsinghua University, Beijing 100084, People' s Republic of China (China)
2012-06-22
Highlights: Black-Right-Pointing-Pointer We truncated the signal peptide of OppA{sub TTE0054} to make it express in Escherichia coli as a soluble protein. Black-Right-Pointing-Pointer Crystals of OppA{sub TTE0054} were grown by sitting-drop vapor diffusion method. Black-Right-Pointing-Pointer The crystal of OppA{sub TTE0054} diffracted to 2.25 A. -- Abstract: Di- and oligopeptide- binding protein OppAs play important roles in solute and nutrient uptake, sporulation, biofilm formation, cell wall muropeptides recycling, peptide-dependent quorum-sensing responses, adherence to host cells, and a variety of other biological processes. Soluble OppA from Thermoanaerobacter tengcongensis was expressed in Escherichia coli. The protein was found to be >95% pure with SDS-PAGE after a series of purification steps and the purity was further verified by mass spectrometry. The protein was crystallized using the sitting-drop vapour-diffusion method with PEG 400 as the precipitant. Crystal diffraction extended to 2.25 A. The crystal belonged to space group C222{sub 1}, with unit-cell parameters of a = 69.395, b = 199.572, c = 131.673 A, and {alpha} = {beta} = {gamma} = 90 Degree-Sign .
DEFF Research Database (Denmark)
Klinke, Helene Bendstrup; Thomsen, A.B.; Ahring, Birgitte Kiær
2001-01-01
Alkaline wet oxidation (WO) (using water, 6.5 g/l sodium carbonate, and 12 bar oxygen at 195 degreesC) was used for pre-treating wheat straw (60 g/l), resulting in a hemicellulose-rich hydrolysate and a cellulose-rich solid fraction. The hydrolysate consisted of soluble hemicellulose (9 g....../l), aliphatic carboxylic acids (6 g/l), phenols (0.27 g/l or 1.7 mM), and 2-furoic acid (0.007 g/l). The wet-oxidized wheat straw hydrolysate caused no inhibition of ethanol yield by the anaerobic thermophilic bacterium Thermoanaerobacter mathranii. Nine phenols and 2-furoic acid, identified to be present...
DEFF Research Database (Denmark)
Dabrowski, Slawomir; Brillowska-Dabrowska, Anna; Ahring, Birgitte Kiær
2013-01-01
Apurinic/apyrimidinic (AP) sites in DNA are considered to be highly mutagenic and must be corrected to preserve genetic integrity, especially at high temperatures. The gene encoding a homologue of AP exonuclease was cloned from the thermophilic anaerobic bacterium Thermoanaerobacter tengcongensis......) of fully active and soluble His6-tagged Tte AP enzyme with His6-tag on C-terminal end was obtained in Escherichia coli Rosetta (DE3) pLysS. The active enzyme was purified up to 98% homogeneity in one chromatographic step using metal-affinity chromatography on Ni(2+)-IDA-Sepharose resin. The yield was 90 mg......, pH 8.0 and at low Mg2+ concentration (0.5 mM). Higher Mg2+ concentration (> 1 mM) enhanced 3'-5' exonuclease activity and at Mg2+ concentration > 2.0 mM 3' nuclease activity was observed. Because of the endonuclease activity of Tte AP exonuclease, the enzyme was applied in PCR amplification of long...
DEFF Research Database (Denmark)
Klinke, H.B.; Thomsen, A.B.; Ahring, B.K.
2001-01-01
Alkaline wet oxidation (WO) (using water, 6.5 g/l sodium carbonate, and 12 bar oxygen at 195 degreesC) was used for pre-treating wheat straw (60 g/l), resulting in a hemicellulose-rich hydrolysate and a cellulose-rich solid fraction. The hydrolysate consisted of soluble hemicellulose (9 g....../l), aliphatic carboxylic acids (6 g/l), phenols (0.27 g/l or 1.7 mM), and 2-furoic acid (0.007 g/l). The wet-oxidized wheat straw hydrolysate caused no inhibition of ethanol yield by the anaerobic thermophilic bacterium Thermoanaerobacter mathranii. Nine phenols and 2-furoic acid, identified to be present...
Zhou, Jilai; Shao, Xiongjun; Olson, Daniel G; Murphy, Sean Jean-Loup; Tian, Liang; Lynd, Lee R
2017-05-01
Thermoanaerobacter ethanolicus is a promising candidate for biofuel production due to the broad range of substrates it can utilize and its high ethanol yield compared to other thermophilic bacteria, such as Clostridium thermocellum. Three alcohol dehydrogenases, AdhA, AdhB and AdhE, play key roles in ethanol formation. To study their physiological roles during ethanol formation, we deleted them separately and in combination. Previously, it has been thought that both AdhB and AdhE were bifunctional alcohol dehydrogenases. Here we show that AdhE has primarily acetyl-CoA reduction activity (ALDH) and almost no acetaldehyde reduction (ADH) activity, whereas AdhB has no ALDH activity and but high ADH activity. We found that AdhA and AdhB have similar patterns of activity. Interestingly, although deletion of both adhA and adhB reduced ethanol production, a single deletion of either one actually increased ethanol yields by 60-70%.
DEFF Research Database (Denmark)
Tomás, Ana Faria; Karagöz, Pınar; Karakashev, Dimitar Borisov
2013-01-01
from the liquid fraction of pretreated rapeseed straw, without any dilution or need for additives. However, when the hydrolysate was used undiluted the ethanol yield was only 37% compared to yield of the control, in which pure sugars in synthetic medium were used. The decrease of ethanol yield...... showed that the two strains together could achieve up to 85% of the theoretical ethanol yield based on the sugar composition of the rapeseed straw, which was 14% and 50% higher compared to the yield with the yeast or the bacteria alone, respectively. Biotechnol. Bioeng. © 2012 Wiley Periodicals, Inc.......The newly isolated extreme thermophile Thermoanaerobacter pentosaceus was used for ethanol production from alkaline-peroxide pretreated rapeseed straw (PRS). Both the liquid and solid fractions of PRS were used. T. pentosaceus was able to metabolize the typical process inhibitors present...
Jessen, Jan Eric; Orlygsson, Johann
2012-01-01
Thermophilic bacteria have gained increased attention as candidates for bioethanol production from lignocellulosic biomass. This study investigated ethanol production by Thermoanaerobacter strain J1 from hydrolysates made from lignocellulosic biomass in batch cultures. The effect of increased initial glucose concentration and the partial pressure of hydrogen on end product formation were examined. The strain showed a broad substrate spectrum, and high ethanol yields were observed on glucose (1.70 mol/mol) and xylose (1.25 mol/mol). Ethanol yields were, however, dramatically lowered by adding thiosulfate or by cocultivating strain J1 with a hydrogenotrophic methanogen with acetate becoming the major end product. Ethanol production from 4.5 g/L of lignocellulosic biomass hydrolysates (grass, hemp stem, wheat straw, newspaper, and cellulose) pretreated with acid or alkali and the enzymes Celluclast and Novozymes 188 was investigated. The highest ethanol yields were obtained on cellulose (7.5 mM·g(-1)) but the lowest on straw (0.8 mM·g(-1)). Chemical pretreatment increased ethanol yields substantially from lignocellulosic biomass but not from cellulose. The largest increase was on straw hydrolysates where ethanol production increased from 0.8 mM·g(-1) to 3.3 mM·g(-1) using alkali-pretreated biomass. The highest ethanol yields on lignocellulosic hydrolysates were observed with hemp hydrolysates pretreated with acid, 4.2 mM·g(-1).
Jørgensen, F; Hansen, O C; Stougaard, P
2004-06-01
The ability to convert D-galactose into D-tagatose was compared among a number of bacterial L-arabinose isomerases ( araA). One of the most efficient enzymes, from the anaerobic thermophilic bacterium Thermoanaerobacter mathranii, was produced heterologously in Escherichia coli and characterised. Amino acid sequence comparisons indicated that this enzyme is only distantly related to the group of previously known araA sequences in which the sequence similarity is evident. The substrate specificity and the Michaelis-Menten constants of the enzyme determined with L-arabinose, D-galactose and D-fucose also indicated that this enzyme is an unusual, versatile L-arabinose isomerase which is able to isomerise structurally related sugars. The enzyme was immobilised and used for production of D-tagatose at 65 degrees C. Starting from a 30% solution of D-galactose, the yield of D-tagatose was 42% and no sugars other than D-tagatose and D-galactose were detected. Direct conversion of lactose to D-tagatose in a single reactor was demonstrated using a thermostable beta-galactosidase together with the thermostable L-arabinose isomerase. The two enzymes were also successfully combined with a commercially available glucose isomerase for conversion of lactose into a sweetening mixture comprising lactose, glucose, galactose, fructose and tagatose.
Production of Bioethanol From Lignocellulosic Biomass Using Thermophilic Anaerobic Bacteria
DEFF Research Database (Denmark)
Georgieva, Tania I.
2006-01-01
and xylose and to tolerate the inhibitory compounds present in lignocellulosic hydrolysates is therefore apparent. Several thermophilic anaerobic xylan degrading bacteria from our culture collection (EMB group at BioCentrum-DTU) have been screened for a potential ethanol producer from hemicellulose...... hydrolysates, and out of the screening test, one particular strain (A10) was selected for the best performance. The strain was morphologically and physiologically characterized as Thermoanaerobacter mathranii strain A10. Unlike other thermophilic anaerobic bacteria, the wild-type strain Thermoanaerobacter...... Thermoanaerobacter BG1L1 was further studied. The experiments were carried out in a continuous immobilized reactor system (a fluidized bed reactor), which is likely to be the process design configuration for xylose fermentation in a Danish biorefinery concept for production of fuel ethanol. The immobilization...
DEFF Research Database (Denmark)
Sittijunda, Sureewan; Tomás, Ana Faria; Reungsang, Alissara
2013-01-01
The newly isolated extreme thermophilic ethanologen Thermoanaerobacter pentosaceus was immobilized in different support materials in order to improve its ethanol production ability. In batch fermentation, a maximum ethanol yield of 1.36 mol mol-1 consumed sugars was obtained by T. pentosaceus...... occurred at an HRT of 6 h. The maximum ethanol yield and concentration, 1.50 mol mol-1 consumed sugars and 12.4 g l-1, were obtained with an HRT of 12 h. The latter represented an improvement of 60 % in relation to previously obtained results. This indicates that immobilization of T. pentosaceus...... immobilized on rapeseed straw. Additionally, immobilized T. pentosaceus’ ethanol production was improved by 11 % in comparison to free cells. In continuous mode, it was shown that hydraulic retention time (HRT) affected ethanol yield, and a dramatic shift from ethanol to acetate and lactate production...
Directory of Open Access Journals (Sweden)
Jan Eric Jessen
2012-01-01
Full Text Available Thermophilic bacteria have gained increased attention as candidates for bioethanol production from lignocellulosic biomass. This study investigated ethanol production by Thermoanaerobacter strain J1 from hydrolysates made from lignocellulosic biomass in batch cultures. The effect of increased initial glucose concentration and the partial pressure of hydrogen on end product formation were examined. The strain showed a broad substrate spectrum, and high ethanol yields were observed on glucose (1.70 mol/mol and xylose (1.25 mol/mol. Ethanol yields were, however, dramatically lowered by adding thiosulfate or by cocultivating strain J1 with a hydrogenotrophic methanogen with acetate becoming the major end product. Ethanol production from 4.5 g/L of lignocellulosic biomass hydrolysates (grass, hemp stem, wheat straw, newspaper, and cellulose pretreated with acid or alkali and the enzymes Celluclast and Novozymes 188 was investigated. The highest ethanol yields were obtained on cellulose (7.5 mM·g−1 but the lowest on straw (0.8 mM·g−1. Chemical pretreatment increased ethanol yields substantially from lignocellulosic biomass but not from cellulose. The largest increase was on straw hydrolysates where ethanol production increased from 0.8 mM·g−1 to 3.3 mM·g−1 using alkali-pretreated biomass. The highest ethanol yields on lignocellulosic hydrolysates were observed with hemp hydrolysates pretreated with acid, 4.2 mM·g−1.
Directory of Open Access Journals (Sweden)
Subrata Pal
2014-01-01
Full Text Available Thermoanaerobacter indiensis BSB-33 has been earlier shown to reduce Fe(III and Cr(VI anaerobically at 60°C optimally. Further, the Gram-positive thermophilic bacterium contains Cr(VI reduction activity in both the membrane and cytoplasm. The soluble fraction prepared from T. indiensis cells grown at 60°C was found to contain the majority of Fe(III reduction activity of the microorganism and produced four distinct bands in nondenaturing Fe(III reductase activity gel. Proteins from each of these bands were partially purified by chromatography and identified by mass spectrometry (MS with the help of T. indiensis proteome sequences. Two paralogous dihydrolipoamide dehydrogenases (LPDs, thioredoxin reductase (Trx, NADP(H-nitrite reductase (Ntr, and thioredoxin disulfide reductase (Tdr were determined to be responsible for Fe(III reductase activity. Amino acid sequence and three-dimensional (3D structural similarity analyses of the T. indiensis Fe(III reductases were carried out with Cr(VI reducing proteins from other bacteria. The two LPDs and Tdr showed very significant sequence and structural identity, respectively, with Cr(VI reducing dihydrolipoamide dehydrogenase from Thermus scotoductus and thioredoxin disulfide reductase from Desulfovibrio desulfuricans. It appears that in addition to their iron reducing activity T. indiensis LPDs and Tdr are possibly involved in Cr(VI reduction as well.
Zhang, Fang; Yang, Jing-Hua; Dai, Kun; Chen, Yun; Li, Qiu-Rong; Gao, Fa-Ming; Zeng, Raymond J
2016-02-01
The microbial community compositions of a chemostat enriched in a thermophilic (55 °C) mixed culture fermentation (MCF) for hydrogen production under different operational conditions were revealed in this work by integrating denaturing gradient gel electrophoresis (DGGE), Illumina Miseq high-throughput sequencing, and 16S rRNA clone library sequencing. The results showed that the community structure of the enriched cultures was relatively simple. Clones close to the genera of Thermoanaerobacter and/or Bacillus mainly dominated the bacteria. And homoacetogens and archaea were washed out and not detected even by Illumina Miseq high-throughput sequencing which supported the benefit for hydrogen production. On the other hand, the results revealed that the metabolic shift was clearly associated with the change of dominated bacterial groups. The effects of hydrogen partial pressure (PH2) and pH from 4.0 to 5.5 on the microbial compositions were not notable and Thermoanaerobacter was dominant, thus, the metabolites were also not changed. While Bacillus, Thermoanaerobacter and Propionispora hippei dominated the bacteria communities at neutral pH, or Bacillus and Thermoanaerobacter dominated at high influent glucose concentrations, consequently the main metabolites shifted to acetate, ethanol, propionate, or lactate. Thereby, the effect of microbial composition on the metabolite distribution and shift shall be considered when modeling thermophilic MCF in the future.
Metabolic engineering of ethanol production in Thermoanaerobacter mathranii
Energy Technology Data Exchange (ETDEWEB)
Shou Yao
2010-11-15
Strain BG1 is a xylanolytic, thermophilic, anaerobic, Gram-positive bacterium originally isolated from an Icelandic hot spring. The strain belongs to the species Thermoanaerobacter mathranii. The strain ferments glucose, xylose, arabinose, galactose and mannose simultaneously and produces ethanol, acetate, lactate, CO{sub 2}, and H2 as fermentation end-products. As a potential ethanol producer from lignocellulosic biomass, tailor-made BG1 strain with the metabolism redirected to produce ethanol is needed. Metabolic engineering of T. mathranii BG1 is therefore necessary to improve ethanol production. Strain BG1 contains four alcohol dehydrogenase (ADH) encoding genes. They are adhA, adhB, bdhA and adhE encoding primary alcohol dehydrogenase, secondary alcohol dehydrogenase, butanol dehydrogenase and bifunctional alcohol/acetaldehyde dehydrogenase, respectively. The presence in an organism of multiple alcohol dehydrogenases with overlapping specificities makes the determination of the specific role of each ADH difficult. Deletion of each individual adh gene in the strain revealed that the adhE deficient mutant strain fails to produce ethanol as the fermentation product. The bifunctional alcohol/acetaldehyde dehydrogenase, AdhE, is therefore proposed responsible for ethanol production in T. mathranii BG1, by catalyzing sequential NADH-dependent reductions of acetyl-CoA to acetaldehyde and then to ethanol under fermentative conditions. Moreover, AdhE was conditionally expressed from a xylose-induced promoter in a recombinant strain (BG1E1) with a concomitant deletion of a lactate dehydrogenase. Over-expression of AdhE in strain BG1E1 with xylose as a substrate facilitates the production of ethanol at an increased yield. With a cofactor-dependent ethanol production pathway in T. mathranii BG1, it may become crucial to regenerate cofactor to increase the ethanol yield. Feeding the cells with a more reduced carbon source, such as mannitol, was shown to increase ethanol
Liu, Zhi-Qiang; Zheng, Wei; Huang, Jian-Feng; Jin, Li-Qun; Jia, Dong-Xu; Zhou, Hai-Yan; Xu, Jian-Miao; Liao, Cheng-Jun; Cheng, Xin-Ping; Mao, Bao-Xing; Zheng, Yu-Guo
2015-08-01
High fructose corn syrup (HFCS) is an alternative of liquid sweetener to sucrose that is isomerized by commercial glucose isomerase (GI). One-step production of 55 % HFCS by thermostable GI has been drawn more and more attentions. In this study, a new hyperthermophilic GI from Thermoanaerobacter ethanolicus CCSD1 (TEGI) was identified by genome mining, and then a 1317 bp fragment encoding the TEGI was synthesized and expressed in Escherichia coli BL21(DE3). To improve the activity of TEGI, two amino acid residues, Trp139 and Val186, around the active site and substrate-binding pocket based on the structural analysis and molecular docking were selected for site-directed mutagenesis. The specific activity of mutant TEGI-W139F/V186T was 2.3-fold and the value of k cat/K m was 1.86-fold as compared to the wild type TEGI, respectively. Thermostability of mutant TEGI-W139F/V186T at 90 °C for 24 h showed 1.21-fold extension than that of wild type TEGI. During the isomerization of glucose to fructose, the yield of fructose could maintain above 55.4 % by mutant TEGI-W139F/V186T as compared to 53.8 % by wild type TEGI at 90 °C. This study paved foundation for the production of 55 % HFCS using the thermostable TEGI.
Energy Technology Data Exchange (ETDEWEB)
Liebschner, Dorothee [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); Brzezinski, Krzysztof [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); University of Bialystok, 15-399 Bialystok (Poland); Dauter, Miroslawa [Argonne National Laboratory, Argonne, IL 60439 (United States); Dauter, Zbigniew, E-mail: dauter@anl.gov [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); Nowak, Marta; Kur, Józef; Olszewski, Marcin, E-mail: dauter@anl.gov [Gdansk University of Technology, 80-952 Gdansk (Poland); National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States)
2012-12-01
The N-terminal domain of the PriB protein from the thermophilic bacterium T. tengcongensis (TtePriB) was expressed and its crystal structure has been solved at the atomic resolution of 1.09 Å by direct methods. PriB is one of the components of the bacterial primosome, which catalyzes the reactivation of stalled replication forks at sites of DNA damage. The N-terminal domain of the PriB protein from the thermophilic bacterium Thermoanaerobacter tengcongensis (TtePriB) was expressed and its crystal structure was solved at the atomic resolution of 1.09 Å by direct methods. The protein chain, which encompasses the first 104 residues of the full 220-residue protein, adopts the characteristic oligonucleotide/oligosaccharide-binding (OB) structure consisting of a five-stranded β-barrel filled with hydrophobic residues and equipped with four loops extending from the barrel. In the crystal two protomers dimerize, forming a six-stranded antiparallel β-sheet. The structure of the N-terminal OB domain of T. tengcongensis shows significant differences compared with mesophile PriBs. While in all other known structures of PriB a dimer is formed by two identical OB domains in separate chains, TtePriB contains two consecutive OB domains in one chain. However, sequence comparison of both the N-terminal and the C-terminal domains of TtePriB suggests that they have analogous structures and that the natural protein possesses a structure similar to a dimer of two N-terminal domains.
Directory of Open Access Journals (Sweden)
Bo Liu
Full Text Available BACKGROUND: Although cold shock responses and the roles of cold shock proteins in microorganisms containing multiple cold shock protein genes have been well characterized, related studies on bacteria possessing a single cold shock protein gene have not been reported. Thermoanaerobacter tengcongensis MB4, a thermophile harboring only one known cold shock protein gene (TtescpC, can survive from 50° to 80 °C, but has poor natural competence under cold shock at 50 °C. We therefore examined cold shock responses and their effect on natural competence in this bacterium. RESULTS: The transcriptomes of T. tengcongensis before and after cold shock were analyzed by RNA-seq and over 1200 differentially expressed genes were successfully identified. These genes were involved in a wide range of biological processes, including modulation of DNA replication, recombination, and repair; energy metabolism; production of cold shock protein; synthesis of branched amino acids and branched-chain fatty acids; and sporulation. RNA-seq analysis also suggested that T. tengcongensis initiates cell wall and membrane remodeling processes, flagellar assembly, and sporulation in response to low temperature. Expression profiles of TtecspC and failed attempts to produce a TtecspC knockout strain confirmed the essential role of TteCspC in the cold shock response, and also suggested a role of this protein in survival at optimum growth temperature. Repression of genes encoding ComEA and ComEC and low energy metabolism levels in cold-shocked cells are the likely basis of poor natural competence at low temperature. CONCLUSION: Our study demonstrated changes in global gene expression under cold shock and identified several candidate genes related to cold shock in T. tengcongensis. At the same time, the relationship between cold shock response and poor natural competence at low temperature was preliminarily elucidated. These findings provide a foundation for future studies on genetic
Electromagnetic physical modeling. 10; Denji yudoho no model jikken. 10
Energy Technology Data Exchange (ETDEWEB)
Noguchi, K; Endo, M; Yoshimori, M [Waseda University, Tokyo (Japan). School of Science and Engineering; Saito, A [Mitsui Mineral Development Engineering Co. Ltd., Tokyo (Japan)
1996-10-01
The model experiment of a borehole electromagnetic (EM) method was carried out using the prepared waterproof sensor and materials with conductivity of 10{sup 0}-10{sup 2}S/m as medium. The 2-layered structure ground model was prepared by filling a water tank with saturated brine of nearly 20S/m up to 30cm. Square wave current was sent from an amplifier to a transmitter coil, and electro motive force induced in a receiver coil was measured. Although numerical simulation is widely used for EM method, analog model experiment is also effective. For the receiver coil installed in brine, preventive measures from short-circuit and water were prepared. Electro motive force was measured at receiver intervals of 1cm and at 0-10cm in depth using a bar carbon model immersed in brine by 5cm in depth under resistivity contrast of 1000 times. In addition, to reduce the resistivity contrast between brine and body, the model experiment was carried out using immersed thin metallic sheet structure with conductivity similar to that of ore under resistivity contrast of 250 times. The effect of medium on both models was thus clarified. 4 refs., 10 figs.
NCBI nr-aa BLAST: CBRC-TTRU-01-0941 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0941 ref|ZP_05380337.1| Na+/Picotransporter [Thermoanaerobacter mathranii subsp. math...ranii str. A3] gb|EET63018.1| Na+/Picotransporter [Thermoanaerobacter mathranii subsp. mathranii str. A3] ZP_05380337.1 0.013 23% ...
NCBI nr-aa BLAST: CBRC-EEUR-01-0292 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-0292 ref|ZP_01453909.1| Abortive infection protein [Thermoanaerobacter... ethanolicus X514] gb|EAU58431.1| Abortive infection protein [Thermoanaerobacter ethanolicus X514] ZP_01453909.1 0.40 36% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0902 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0902 ref|NP_622433.1| hypothetical protein TTE0780 [Thermoanaerobacter... tengcongensis MB4] gb|AAM24037.1| hypothetical protein TTE0780 [Thermoanaerobacter tengcongensis MB4] NP_622433.1 4.7 28% ...
2010-05-04
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10... amends Sec. 39.13 by adding the following new AD: 2010-09-12 McDonnell Douglas Corporation: Amendment 39... to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10-30F (KC-10A...
Energy Technology Data Exchange (ETDEWEB)
Maekawa, Nobuhiro; Yamashita, Toshifumi
2003-08-14
This Letter demonstrates that, as in flipped SU(5) models, doublet-triplet splitting is accomplished by a missing partner mechanism in flipped SO(10) models. The gauge group SO(10){sub F}xU(1){sub V'{sub F}} includes SU(2){sub E} gauge symmetry, which plays an important role in solving the supersymmetric (SUSY) flavor problem by introducing non-abelian horizontal gauge symmetry and anomalous U(1){sub A} gauge symmetry. The gauge group can be broken into the standard model gauge group by VEVs of only spinor fields; such models may be easier to derive than E{sub 6} models from superstring theory.
Examining a renormalizable supersymmetric SO(10) model
Energy Technology Data Exchange (ETDEWEB)
Chen, Zhi-Yong; Zhang, Da-Xin [Peking University, School of Physics and State Key Laboratory of Nuclear Physics and Technology, Beijing (China)
2017-10-15
We examine a renormalizable SUSY SO(10) model without fine-tuning. We show how to construct MSSM doublets and to predict proton decay. We find that in the minimal set of Yukawa couplings the model is consistent with the experiments, while including 120{sub H} to fit the data there are inconsistencies. (orig.)
2010-06-23
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, and MD-10-10F Airplanes... certain McDonnell Douglas Model DC-10-10, DC-10-10F, and MD-10-10F airplanes. That NPRM was published in... amends Sec. 39.13 by adding the following new AD: 2010-13-06 McDonnell Douglas Corporation: Amendment 39...
NCBI nr-aa BLAST: CBRC-DNOV-01-1963 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1963 ref|NP_622305.1| ABC-type nitrate/sulfonate/taurine/bicarbonate t...ransport systems, permease components [Thermoanaerobacter tengcongensis MB4] gb|AAM23909.1| ABC-type nitrate/sulfonate/taurine/bicarb...onate transport systems, permease components [Thermoanaerobacter tengcongensis MB4] NP_622305.1 0.013 26% ...
A Numerical Model to Assess Soil Fluxes from Meteoric 10Be Data
Campforts, B.; Govers, G.; Vanacker, V.; Vanderborght, J.; Smolders, E.; Baken, S.
2015-12-01
Meteoric 10Be may be mobile in the soil system. The latter hampers a direct translation of meteoric 10Be inventories into spatial variations in erosion and deposition rates. Here, we present a spatially explicit 2D model that allows us to simulate the behaviour of meteoric 10Be in the soil system. The Be2D model is then used to analyse the potential impact of human-accelerated soil fluxes on meteoric 10Be inventories. The model consists of two parts. A first component deals with advective and diffusive mobility of meteoric 10Be within the soil profile including particle migration, chemical leaching and bioturbation, whereas a second component describes lateral soil (and meteoric 10Be) fluxes over the hillslope. Soil depth is calculated dynamically, accounting for soil production through weathering and lateral soil fluxes from creep, water and tillage erosion. Model simulations show that meteoric 10Be inventories can indeed be related to erosion and deposition, across a wide range of geomorphological and pedological settings. However, quantification of the effects of vertical mobility is essential for a correct interpretation of the observed spatial patterns in 10Be data. Moreover, our simulations suggest that meteoric 10Be can be used as a tracer to unravel human impact on soil fluxes when soils have a high retention capacity for meteoric meteoric 10Be. Application of the Be2D model to existing data sets shows that model parameters can reliably be constrained, resulting in a good agreement between simulated and observed meteoric 10Be concentrations and inventories. This confirms the suitability of the Be2D model as a robust tool to underpin quantitative interpretations of spatial variability in meteoric 10Be data for eroding landscapes.
2010-02-08
...-0032; Directorate Identifier 2009-NM-213-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas...: McDonnell Douglas Corporation: Docket No. FAA-2010-0032; Directorate Identifier 2009-NM-213-AD. Comments Due... applies to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10-30F (KC-10A...
A flipped SO(10) model from Z{sub 6}-I orbifold
Energy Technology Data Exchange (ETDEWEB)
Shimojo, Masafumi [Fukui National Coll. of Technology, Sabae (Japan)
1994-08-01
We look for flipped SO(10) and flipped SU(5) models obtained from heterotic superstrings compactified on Z{sub 6}-I orbifold with one Wilson line. We obtain twelve/fifteen independent Wilson lines which give SO(10)/SU(5) models. While we cannot construct an SU(5) model whose sum of X-charge vanishes, we find only one chiral and modular anomaly-free spectrum with three generations of sixteen dimensional representations of SU(10) which may be matter fields. For the SO(10) model, we derive effective Yukawa couplings and examine the structure of mass matrices. We also comment on the breaking mechanism of the gauge group SO(10).
2010-01-19
...-0043; Directorate Identifier 2009-NM-128-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas... directive (AD) for certain McDonnell Douglas Model DC-10-10, DC-10-10F, and MD-10-10F airplanes. This... adding the following new AD: McDonnell Douglas Corporation: Docket No. FAA-2010-0043; Directorate...
Supersymmetric SO(10) models inspired by deconstruction
International Nuclear Information System (INIS)
Huang Chaoshang; Jiang Jing; Li Tianjun
2004-01-01
We consider 4-dimensional N=1 supersymmetric SO(10) models inspired by deconstruction of 5-dimensional N=1 supersymmetric orbifold SO(10) models and high-dimensional non-supersymmetric SO(10) models with Wilson line gauge symmetry breaking. We discuss the SO(10)xSO(10) models with bi-fundamental link fields where the gauge symmetry can be broken down to the Pati-Salam, SU(5)xU(1), flipped SU(5)xU(1)' or the Standard Model like gauge symmetry. We also propose an SO(10)xSO(6)xSO(4) model with bi-fundamental link fields where the gauge symmetry is broken down to the Pati-Salam gauge symmetry, and an SO(10)xSO(10) model with bi-spinor link fields where the gauge symmetry is broken down to the flipped SU(5)xU(1)' gauge symmetry. In these two models, the Pati-Salam and flipped SU(5)xU(1)' gauge symmetry can be further broken down to the Standard Model gauge symmetry, the doublet-triplet splittings can be obtained by the missing partner mechanism, and the proton decay problem can be solved. We also study the gauge coupling unification. We briefly comment on the interesting variation models with gauge groups SO(10)xSO(6) and SO(10)xflippedSU(5)xU(1)' in which the proton decay problem can be solved
Model testing of a 10-kg high explosive blast attenuation maze
International Nuclear Information System (INIS)
Bacigalupi, C.M.; Burton, W.A.
1981-01-01
The basement area of the proposed High Explosive Applications Facility (HEAF) at the Lawrence Livermore National Laboratory includes 10-kg HE assembly and process cells, and a 10-kg corridor for the transport of up to 10 kg of HE from the receiving dock to the cells and to the experimental firing tanks. Previous model experiments developed a process cell-maze configuration that attenuated the effects of an accidental 10-kg detonation to acceptable levels (maximum of 10 to 11 psi reflected). This document reports 1/8-scale model tests conducted to confirm the maze design and to determine the blast pressures in adjacent areas in the final HEAF building configuration. In addition, pressure/time information was obtained at selected points in the model expansion chamber to provide the architect-engineer with information for structural design
2010-07-07
...-0672; Directorate Identifier 2010-NM-047-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas...: McDonnell Douglas Corporation: Docket No. FAA-2010-0672; Directorate Identifier 2010-NM-047-AD. Comments Due... applies to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-30, DC-10-30F (KDC-10), DC-10...
2010-10-14
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-30, DC-10-30F (KDC-10... following new airworthiness directive (AD): 2010-21-13 McDonnell Douglas Corporation: Amendment 39-16473... November 18, 2010. Affected ADs (b) None. Applicability (c) This AD applies to McDonnell Douglas...
2010-10-01
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10... adding the following new AD: 2010-20-14 McDonnell Douglas Corporation: Amendment 39-16449. Docket No. FAA... the airplanes identified in paragraphs (c)(1) and (c)(2) of this AD. (1) McDonnell Douglas Corporation...
2010-11-05
...-1044; Directorate Identifier 2010-NM-033-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas..., 2007) and adding the following new AD: McDonnell Douglas Corporation: Docket No. FAA-2010-1044.... Applicability (c) This AD applies to all McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...
ORF Sequence: NC_003869 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [Thermoanaerobacter tengcongensis MB4] MNQIIECVPNVSEGRDQEKISELIKEVVSTEGVKLLDYSSDKDHNRTVITFVGDKEGVKEAAFKLIKK...ASEIIDMRYHKGEHPRIGAVDVVPFVPVKNVTMEECVQIARELGERVGKELNIPVYLYEEAATTPERKNLENIRRGEYEGFFEKIKQPEWKPDFGPSEMNPKSGAIVI
New Model Exhaust System Supports Testing in NASA Lewis' 10- by 10-Foot Supersonic Wind Tunnel
Roeder, James W., Jr.
1998-01-01
In early 1996, the ability to run NASA Lewis Research Center's Abe Silverstein 10- by 10- Foot Supersonic Wind Tunnel (10x10) at subsonic test section speeds was reestablished. Taking advantage of this new speed range, a subsonic research test program was scheduled for the 10x10 in the fall of 1996. However, many subsonic aircraft test models require an exhaust source to simulate main engine flow, engine bleed flows, and other phenomena. This was also true of the proposed test model, but at the time the 10x10 did not have a model exhaust capability. So, through an in-house effort over a period of only 5 months, a new model exhaust system was designed, installed, checked out, and made ready in time to support the scheduled test program.
Single-step ethanol production from lignocellulose using novel extremely thermophilic bacteria.
Svetlitchnyi, Vitali A; Kensch, Oliver; Falkenhan, Doris A; Korseska, Svenja G; Lippert, Nadine; Prinz, Melanie; Sassi, Jamaleddine; Schickor, Anke; Curvers, Simon
2013-02-28
Consolidated bioprocessing (CBP) of lignocellulosic biomass to ethanol using thermophilic bacteria provides a promising solution for efficient lignocellulose conversion without the need for additional cellulolytic enzymes. Most studies on the thermophilic CBP concentrate on co-cultivation of the thermophilic cellulolytic bacterium Clostridium thermocellum with non-cellulolytic thermophilic anaerobes at temperatures of 55°C-60°C. We have specifically screened for cellulolytic bacteria growing at temperatures >70°C to enable direct conversion of lignocellulosic materials into ethanol. Seven new strains of extremely thermophilic anaerobic cellulolytic bacteria of the genus Caldicellulosiruptor and eight new strains of extremely thermophilic xylanolytic/saccharolytic bacteria of the genus Thermoanaerobacter isolated from environmental samples exhibited fast growth at 72°C, extensive lignocellulose degradation and high yield ethanol production on cellulose and pretreated lignocellulosic biomass. Monocultures of Caldicellulosiruptor strains degraded up to 89-97% of the cellulose and hemicellulose polymers in pretreated biomass and produced up to 72 mM ethanol on cellulose without addition of exogenous enzymes. In dual co-cultures of Caldicellulosiruptor strains with Thermoanaerobacter strains the ethanol concentrations rose 2- to 8.2-fold compared to cellulolytic monocultures. A co-culture of Caldicellulosiruptor DIB 087C and Thermoanaerobacter DIB 097X was particularly effective in the conversion of cellulose to ethanol, ethanol comprising 34.8 mol% of the total organic products. In contrast, a co-culture of Caldicellulosiruptor saccharolyticus DSM 8903 and Thermoanaerobacter mathranii subsp. mathranii DSM 11426 produced only low amounts of ethanol. The newly discovered Caldicellulosiruptor sp. strain DIB 004C was capable of producing unexpectedly large amounts of ethanol from lignocellulose in fermentors. The established co-cultures of new Caldicellulosiruptor
2010-10-05
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-30, DC-10-30F, DC-10-30F (KC-10A and KDC-10...-13 McDonnell Douglas Corporation: Amendment 39-16448; Docket No. FAA-2010-0553; Directorate.... Applicability (c) This AD applies to McDonnell Douglas Corporation Model DC- 10-30, DC-10-30F, DC-10-30F (KC-10A...
Meteoric 10Be as a tool to investigate human induced soil fluxes: a conceptual model
Campforts, Benjamin; Govers, Gerard; Vanacker, Veerle; De Vente, Joris; Boix-Fayos, Carolina; Minella, Jean; Baken, Stijn; Smolders, Erik
2014-05-01
The use of meteoric 10Be as a tool to understand long term landscape behavior is becoming increasingly popular. Due its high residence time, meteoric 10Be allows in principle to investigate in situ erosion rates over time scales exceeding the period studied with classical approaches such as 137Cs. The use of meteoric 10Be strongly contributes to the traditional interpretation of sedimentary archives which cannot be unequivocally coupled to sediment production and could provide biased information over longer time scales (Sadler, 1981). So far, meteoric 10Be has successfully been used in geochemical fingerprinting of sediments, to date soil profiles, to assess soil residence times and to quantify downslope soil fluxes using accumulated 10Be inventories along a hill slope. However, less attention is given to the potential use of the tracer to directly asses human induced changes in soil fluxes through deforestation, cultivation and reforestation. A good understanding of the processes governing the distribution of meteoric 10Be both within the soil profile and at landscape scale is essential before meteoric 10Be can be successfully applied to assess human impact. We developed a spatially explicit 2D-model (Be2D) in order to gain insight in meteoric 10Be movement along a hillslope that is subject to human disturbance. Be2D integrates both horizontal soil fluxes and vertical meteoric 10Be movement throughout the soil prolife. Horizontal soil fluxes are predicted using (i) well studied geomorphical laws for natural erosion and soil formation as well as (ii) human accelerated water and tillage erosion. Vertical movement of meteoric 10Be throughout the soil profile is implemented by inserting depth dependent retardation calculated using experimentally determined partition coefficients (Kd). The model was applied to different environments such as (i) the Belgian loess belt, characterized by aeolian deposits enriched in inherited meteoric 10Be, (ii) highly degraded and stony
Two Higgs doublets in SO(10) model
International Nuclear Information System (INIS)
Asatryan, G.M.
1989-01-01
An SO(10) grand unification model is suggested with two light Higgs doublets, whose vacuum expectation values are connected with the SU(2) L xU(1) Y electroweak group breaking. Taking into account the naturality condition associated with absence of flavor changing neutral currents, a certain form of the quark mass matrices. As a result, the proton lifetime in the SO(10) model turns to be strongly restrained
Cosmological implications of a class of SO(10) models
International Nuclear Information System (INIS)
Mangano, G.; Rosa, L.
1996-01-01
The cosmological implications of a class of SO(10) models are discussed. In particular we show how a good prediction for neutrino masses is obtained in order to fit with the MSW mechanism to explain the solar neutrino flux deficit and with the predicted amount of the dark matter hot component. A possible scenario for baryogenesis is also considered. (orig.)
The practical implementation of a scatter model for portal imaging at 10
International Nuclear Information System (INIS)
Partridge, Mike; Evans, Philip M.
1998-01-01
A detailed validation of a physical model for scattered radiation in portal images at 10 MV is presented. The ratio of the signal due to scattered radiation to the signal due to primary radiation (SPR) in an electronic portal image is defined. A simple physical model for SPR on the central axis (SPR*) was presented by Swindell and Evans for 6 MV and validated for field sizes up to 320 cm 2 . In this paper, the model is extended to 10 MV and validated for field sizes up to 625 cm 2 . The model is first compared with Monte Carlo modelled data for field areas A from 40 to 320 cm 2 , scatterer thicknesses d of 5 to 35 cm water and scatterer to detector distances L 2 of 40 to 100 cm. The physical model has one free parameter, which is fitted empirically using these data. Second, experimental measurements are performed with A from 40 to 625 cm 2 , d from 4.6 to 27.4 cm and L 2 fixed at 100 cm. The root mean square (rms) difference between the physical model and the Monte Carlo calculations was less than 0.001 for all L 2 greater than 60 cm. Agreement between experimentally measured and physically modelled data amounts to a radiological thickness error of at best 0.7 mm in 273.6 mm and at worst 0.4 in 45.6 mm. The model performs equally well at all field sizes tested. This study shows that the Swindell and Evans SPR* model is accurate at 10 MV for L 2 greater than 60 cm for all A up to 625 cm 2 . (author)
Does a General Temperature-Dependent Q10 Model of Soil Respiration Exist at Biome and Global Scale?
Institute of Scientific and Technical Information of China (English)
Hua CHEN; Han-Qin TIAN
2005-01-01
Soil respiration (SR) is commonly modeled by a Q10 (an indicator of temperature sensitivity)function in ecosystem models. Q10is usually treated as a constant of 2 in these models, although Q10 value of SR often decreases with increasing temperatures. It remains unclear whether a general temperaturedependent Q10 model of SR exists at biome and global scale. In this paper, we have compiled the long-term Q10 data of 38 SR studies ranging from the Boreal, Temperate, to Tropical/Subtropical biome on four continents.Our analysis indicated that the general temperature-dependent biome Q10 models of SR existed, especially in the Boreal and Temperate biomes. A single-exponential model was better than a simple linear model in fitting the average Q10 values at the biome scale. Average soil temperature is a better predictor of Q10 value than average air temperature in these models, especially in the Boreal biome. Soil temperature alone could explain about 50% of the Q10 variations in both the Boreal and Temperate biome single-exponential Q10 model. Q10 value of SR decreased with increasing soil temperature but at quite different rates among the three biome Q10 models. The k values (Q10 decay rate constants) were 0.09, 0.07, and 0.02/℃ in the Boreal, Temperate, and Tropical/Subtropical biome, respectively, suggesting that Q10 value is the most sensitive to soil temperature change in the Boreal biome, the second in the Temperate biome, and the least sensitive in the Tropical/Subtropical biome. This also indirectly confirms that acclimation of SR in many soil warming experiments probably occurs. The k value in the "global" single-exponential Q10 model which combined both the Boreal and Temperate biome data set was 0.08/℃. However, the global general temperature-dependent Q10model developed using the data sets of the three biomes is not adequate for predicting Q10 values of SR globally.The existence of the general temperature-dependent Q10 models of SR in the Boreal and
Metabolic engineering to improve ethanol production in Thermoanaerobacter mathranii
DEFF Research Database (Denmark)
Yao, Shuo; Mikkelsen, Marie Just
2010-01-01
acquired the capability to utilize glycerol as an extra carbon source in the presence of xylose, and utilization of the more reduced substrate glycerol resulted in a higher ethanol yield. Electronic supplementary material The online version of this article (doi:10.1007/s00253-010-2703-3) contains...
Measuring Information Security Performance with 10 by 10 Model for Holistic State Evaluation.
Directory of Open Access Journals (Sweden)
Igor Bernik
Full Text Available Organizations should measure their information security performance if they wish to take the right decisions and develop it in line with their security needs. Since the measurement of information security is generally underdeveloped in practice and many organizations find the existing recommendations too complex, the paper presents a solution in the form of a 10 by 10 information security performance measurement model. The model-ISP 10×10M is composed of ten critical success factors, 100 key performance indicators and 6 performance levels. Its content was devised on the basis of findings presented in the current research studies and standards, while its structure results from an empirical research conducted among information security professionals from Slovenia. Results of the study show that a high level of information security performance is mostly dependent on measures aimed at managing information risks, employees and information sources, while formal and environmental factors have a lesser impact. Experts believe that information security should evolve systematically, where it's recommended that beginning steps include technical, logical and physical security controls, while advanced activities should relate predominantly strategic management activities. By applying the proposed model, organizations are able to determine the actual level of information security performance based on the weighted indexing technique. In this manner they identify the measures they ought to develop in order to improve the current situation. The ISP 10×10M is a useful tool for conducting internal system evaluations and decision-making. It may also be applied to a larger sample of organizations in order to determine the general state-of-play for research purposes.
Measuring Information Security Performance with 10 by 10 Model for Holistic State Evaluation.
Bernik, Igor; Prislan, Kaja
Organizations should measure their information security performance if they wish to take the right decisions and develop it in line with their security needs. Since the measurement of information security is generally underdeveloped in practice and many organizations find the existing recommendations too complex, the paper presents a solution in the form of a 10 by 10 information security performance measurement model. The model-ISP 10×10M is composed of ten critical success factors, 100 key performance indicators and 6 performance levels. Its content was devised on the basis of findings presented in the current research studies and standards, while its structure results from an empirical research conducted among information security professionals from Slovenia. Results of the study show that a high level of information security performance is mostly dependent on measures aimed at managing information risks, employees and information sources, while formal and environmental factors have a lesser impact. Experts believe that information security should evolve systematically, where it's recommended that beginning steps include technical, logical and physical security controls, while advanced activities should relate predominantly strategic management activities. By applying the proposed model, organizations are able to determine the actual level of information security performance based on the weighted indexing technique. In this manner they identify the measures they ought to develop in order to improve the current situation. The ISP 10×10M is a useful tool for conducting internal system evaluations and decision-making. It may also be applied to a larger sample of organizations in order to determine the general state-of-play for research purposes.
Slab1.0: A three-dimensional model of global subduction zone geometries
Hayes, Gavin P.; Wald, David J.; Johnson, Rebecca L.
2012-01-01
We describe and present a new model of global subduction zone geometries, called Slab1.0. An extension of previous efforts to constrain the two-dimensional non-planar geometry of subduction zones around the focus of large earthquakes, Slab1.0 describes the detailed, non-planar, three-dimensional geometry of approximately 85% of subduction zones worldwide. While the model focuses on the detailed form of each slab from their trenches through the seismogenic zone, where it combines data sets from active source and passive seismology, it also continues to the limits of their seismic extent in the upper-mid mantle, providing a uniform approach to the definition of the entire seismically active slab geometry. Examples are shown for two well-constrained global locations; models for many other regions are available and can be freely downloaded in several formats from our new Slab1.0 website, http://on.doi.gov/d9ARbS. We describe improvements in our two-dimensional geometry constraint inversion, including the use of ‘average’ active source seismic data profiles in the shallow trench regions where data are otherwise lacking, derived from the interpolation between other active source seismic data along-strike in the same subduction zone. We include several analyses of the uncertainty and robustness of our three-dimensional interpolation methods. In addition, we use the filtered, subduction-related earthquake data sets compiled to build Slab1.0 in a reassessment of previous analyses of the deep limit of the thrust interface seismogenic zone for all subduction zones included in our global model thus far, concluding that the width of these seismogenic zones is on average 30% larger than previous studies have suggested.
Energy deposition model for low-energy electrons (10-10 000 eV) in air
International Nuclear Information System (INIS)
Roldan, A.; Perez, J.M.; Williart, A.; Blanco, F.; Garcia, G.
2004-01-01
An energy deposition model for electrons in air that can be useful in microdosimetric applications is presented in this study. The model is based on a Monte Carlo simulation of the single electron scattering processes that can take place with the molecular constituents of the air in the energy range 10-10 000 eV. The input parameters for this procedure have been the electron scattering cross sections, both differential and integral. These parameters were calculated using a model potential method which describes the electron scattering with the molecular constituent of air. The reliability of the calculated integral cross section values has been evaluated by comparison with direct total electron scattering cross-section measurements performed by us in a transmission beam experiment. Experimental energy loss spectra for electrons in air have been used as probability distribution functions to define the electron energy loss in single collision events. The resulting model has been applied to simulate the electron transport through a gas cell containing air at different pressures and the results have been compared with those observed in the experiments. Finally, as an example of its applicability to dosimetric issues, the energy deposition of 10 000 eV by means of successive collisions in a free air chamber has been simulated
Be2D: A model to understand the distribution of meteoric 10Be in soilscapes
Campforts, Benjamin; Vanacker, Veerle; Vanderborght, Jan; Govers, Gerard
2016-04-01
Cosmogenic nuclides have revolutionised our understanding of earth surface process rates. They have become one of the standard tools to quantify soil production by weathering, soil redistribution and erosion. Especially Beryllium-10 has gained much attention due to its long half-live and propensity to be relatively conservative in the landscape. The latter makes 10Be an excellent tool to assess denudation rates over the last 1000 to 100 × 103 years, bridging the anthropogenic and geological time scale. Nevertheless, the mobility of meteoric 10Be in soil systems makes translation of meteoric 10Be inventories into erosion and deposition rates difficult. Here we present a coupled soil hillslope model, Be2D, that is applied to synthetic and real topography to address the following three research questions. (i) What is the influence of vertical meteoric Be10 mobility, caused by chemical mobility, clay translocation and bioturbation, on its lateral redistribution over the soilscape, (ii) How does vertical mobility influence erosion rates and soil residence times inferred from meteoric 10Be inventories and (iii) To what extent can a tracer with a half-life of 1.36 Myr be used to distinguish between natural and human-disturbed soil redistribution rates? The model architecture of Be2D is designed to answer these research questions. Be2D is a dynamic model including physical processes such as soil formation, physical weathering, clay migration, bioturbation, creep, overland flow and tillage erosion. Pathways of meteoric 10Be mobility are simulated using a two step approach which is updated each timestep. First, advective and diffusive mobility of meteoric 10Be is simulated within the soil profile and second, lateral redistribution because of lateral soil fluxes is calculated. The performance and functionality of the model is demonstrated through a number of synthetic and real model runs using existing datasets of meteoric 10Be from case-studies in southeastern US. Brute
Abad, Cesar C C; Barros, Ronaldo V; Bertuzzi, Romulo; Gagliardi, João F L; Lima-Silva, Adriano E; Lambert, Mike I; Pires, Flavio O
2016-06-01
The aim of this study was to verify the power of VO 2max , peak treadmill running velocity (PTV), and running economy (RE), unadjusted or allometrically adjusted, in predicting 10 km running performance. Eighteen male endurance runners performed: 1) an incremental test to exhaustion to determine VO 2max and PTV; 2) a constant submaximal run at 12 km·h -1 on an outdoor track for RE determination; and 3) a 10 km running race. Unadjusted (VO 2max , PTV and RE) and adjusted variables (VO 2max 0.72 , PTV 0.72 and RE 0.60 ) were investigated through independent multiple regression models to predict 10 km running race time. There were no significant correlations between 10 km running time and either the adjusted or unadjusted VO 2max . Significant correlations (p 0.84 and power > 0.88. The allometrically adjusted predictive model was composed of PTV 0.72 and RE 0.60 and explained 83% of the variance in 10 km running time with a standard error of the estimate (SEE) of 1.5 min. The unadjusted model composed of a single PVT accounted for 72% of the variance in 10 km running time (SEE of 1.9 min). Both regression models provided powerful estimates of 10 km running time; however, the unadjusted PTV may provide an uncomplicated estimation.
Starobinsky-like inflation and neutrino masses in a no-scale SO(10) model
Energy Technology Data Exchange (ETDEWEB)
Ellis, John [Theoretical Particle Physics and Cosmology Group,Department of Physics, King’s College London, WC2R 2LS London (United Kingdom); Theoretical Physics Department, CERN,CH-1211 Geneva 23 (Switzerland); Garcia, Marcos A.G. [Physics and Astronomy Department, Rice University,6100 Main Street, Houston, TX 77005 (United States); Nagata, Natsumi [Department of Physics, University of Tokyo,Bunkyo-ku, Tokyo 113-0033 (Japan); Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics and Astronomy,Texas A& M University, College Station, 77843 Texas (United States); Olive, Keith A. [William I. Fine Theoretical Physics Institute, School of Physics and Astronomy, University of Minnesota,116 Church Street SE, Minneapolis, MN 55455 (United States)
2016-11-08
Using a no-scale supergravity framework, we construct an SO(10) model that makes predictions for cosmic microwave background observables similar to those of the Starobinsky model of inflation, and incorporates a double-seesaw model for neutrino masses consistent with oscillation experiments and late-time cosmology. We pay particular attention to the behaviour of the scalar fields during inflation and the subsequent reheating.
Starobinsky-Like Inflation and Neutrino Masses in a No-Scale SO(10) Model
Ellis, John
2016-11-08
Using a no-scale supergravity framework, we construct an SO(10) model that makes predictions for cosmic microwave background observables similar to those of the Starobinsky model of inflation, and incorporates a double-seesaw model for neutrino masses consistent with oscillation experiments and late-time cosmology. We pay particular attention to the behaviour of the scalar fields during inflation and the subsequent reheating.
Improvement of PM10 prediction in East Asia using inverse modeling
Koo, Youn-Seo; Choi, Dae-Ryun; Kwon, Hi-Yong; Jang, Young-Kee; Han, Jin-Seok
2015-04-01
Aerosols from anthropogenic emissions in industrialized region in China as well as dust emissions from southern Mongolia and northern China that transport along prevailing northwestern wind have a large influence on the air quality in Korea. The emission inventory in the East Asia region is an important factor in chemical transport modeling (CTM) for PM10 (particulate matters less than 10 ㎛ in aerodynamic diameter) forecasts and air quality management in Korea. Most previous studies showed that predictions of PM10 mass concentration by the CTM were underestimated when comparing with observational data. In order to fill the gap in discrepancies between observations and CTM predictions, the inverse Bayesian approach with Comprehensive Air-quality Model with extension (CAMx) forward model was applied to obtain optimized a posteriori PM10 emissions in East Asia. The predicted PM10 concentrations with a priori emission were first compared with observations at monitoring sites in China and Korea for January and August 2008. The comparison showed that PM10 concentrations with a priori PM10 emissions for anthropogenic and dust sources were generally under-predicted. The result from the inverse modeling indicated that anthropogenic PM10 emissions in the industrialized and urbanized areas in China were underestimated while dust emissions from desert and barren soil in southern Mongolia and northern China were overestimated. A priori PM10 emissions from northeastern China regions including Shenyang, Changchun, and Harbin were underestimated by about 300% (i.e., the ratio of a posteriori to a priori PM10 emission was a factor of about 3). The predictions of PM10 concentrations with a posteriori emission showed better agreement with the observations, implying that the inverse modeling minimized the discrepancies in the model predictions by improving PM10 emissions in East Asia.
Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test
International Nuclear Information System (INIS)
Komine, Kuniaki; Konno, Mutsuo
1999-01-01
NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)
PALM-USM v1.0: A New Urban Surface Model Integrated into the PALM Large-eddy Simulation Model
Czech Academy of Sciences Publication Activity Database
Resler, Jaroslav; Krč, Pavel; Belda, Michal; Juruš, Pavel; Benešová, N.; Lopata, J.; Vlček, O.; Damašková, D.; Eben, Kryštof; Derbek, P.; Maronga, P.; Kanani-Sühring, F.
2017-01-01
Roč. 10, č. 10 (2017), s. 3635-3659 ISSN 1991-959X Grant - others:UrbanAdapt(XE) EHP-CZ02-OV-1-036-2015; Ga MŠk(CZ) LM2015070 Program:CZ02 Biodiverzita a ekosystémové služby / Monitorování a integrované plánování a kontrola v životním prostředí/ Adaptace na změnu klimatu Institutional support: RVO:67985807 Keywords : urban modelling * PALM * LES * surface energy balance * radiative transfer * model evaluation * infrared camera Subject RIV: DG - Athmosphere Sciences, Meteorology OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.458, year: 2016
VALDRIFT 1.0: A valley atmospheric dispersion model with deposition
Energy Technology Data Exchange (ETDEWEB)
Allwine, K.J.; Bian, X.; Whiteman, C.D.
1995-05-01
VALDRIFT version 1.0 is an atmospheric transport and diffusion model for use in well-defined mountain valleys. It is designed to determine the extent of ddft from aedal pesticide spraying activities, but can also be applied to estimate the transport and diffusion of various air pollutants in valleys. The model is phenomenological -- that is, the dominant meteorological processes goveming the behavior of the valley atmosphere are formulated explicitly in the model, albeit in a highly parameterized fashion. The key meteorological processes treated are: (1) nonsteady and nonhomogeneous along-valley winds and turbulent diffusivities, (2) convective boundary layer growth, (3) inversion descent, (4) noctumal temperature inversion breakup, and (5) subsidence. The model is applicable under relatively cloud-free, undisturbed synoptic conditions and is configured to operate through one diumal cycle for a single valley. The inputs required are the valley topographical characteristics, pesticide release rate as a function of time and space, along-valley wind speed as a function of time and space, temperature inversion characteristics at sunrise, and sensible heat flux as a function of time following sunrise. Default values are provided for certain inputs in the absence of detailed observations. The outputs are three-dimensional air concentration and ground-level deposition fields as a function of time.
Round Robin Posttest analysis of a 1/10-scale Steel Containment Vessel Model Test
Energy Technology Data Exchange (ETDEWEB)
Komine, Kuniaki [Nuclear Power Engineering Corp., Tokyo (Japan); Konno, Mutsuo
1999-07-01
NUPEC and U.S. Nuclear Regulatory Commission (USNRC) have been jointly sponsoring 'Structural Behavior Test' at Sandia National Laboratory (SNL) in Cooperative Containment Research Program'. As one of the test, a test of a mixed scaled SCV model with 1/10 in the geometry and 1/4 in the shell thickness. Round Robin analyses of a 1/10-scale Steel Containment Vessel (SCV) Model Test were carried out to obtain an adequate analytical method among seven organizations belonged to five countries in the world. As one of sponsor, Nuclear Power Engineering Corporation (NUPEC) filled the important role of a posttest analysis of SCV model. This paper describes NUPEC's analytical results in the round robin posttest analysis. (author)
MicrobesFlux: a web platform for drafting metabolic models from the KEGG database
Directory of Open Access Journals (Sweden)
Feng Xueyang
2012-08-01
Full Text Available Abstract Background Concurrent with the efforts currently underway in mapping microbial genomes using high-throughput sequencing methods, systems biologists are building metabolic models to characterize and predict cell metabolisms. One of the key steps in building a metabolic model is using multiple databases to collect and assemble essential information about genome-annotations and the architecture of the metabolic network for a specific organism. To speed up metabolic model development for a large number of microorganisms, we need a user-friendly platform to construct metabolic networks and to perform constraint-based flux balance analysis based on genome databases and experimental results. Results We have developed a semi-automatic, web-based platform (MicrobesFlux for generating and reconstructing metabolic models for annotated microorganisms. MicrobesFlux is able to automatically download the metabolic network (including enzymatic reactions and metabolites of ~1,200 species from the KEGG database (Kyoto Encyclopedia of Genes and Genomes and then convert it to a metabolic model draft. The platform also provides diverse customized tools, such as gene knockouts and the introduction of heterologous pathways, for users to reconstruct the model network. The reconstructed metabolic network can be formulated to a constraint-based flux model to predict and analyze the carbon fluxes in microbial metabolisms. The simulation results can be exported in the SBML format (The Systems Biology Markup Language. Furthermore, we also demonstrated the platform functionalities by developing an FBA model (including 229 reactions for a recent annotated bioethanol producer, Thermoanaerobacter sp. strain X514, to predict its biomass growth and ethanol production. Conclusion MicrobesFlux is an installation-free and open-source platform that enables biologists without prior programming knowledge to develop metabolic models for annotated microorganisms in the KEGG
SOLAR WIND IMPLANTATION MODEL FOR 10Be IN CALCIUM-ALUMINUM INCLUSIONS
International Nuclear Information System (INIS)
Bricker, Glynn E.; Caffee, Marc W.
2010-01-01
We propose a model for the incorporation of 10 Be within calcium-aluminum inclusions (CAIs) in primitive carbonaceous meteorites. In this model, 10 Be is produced by energetic particle reactions in the proto-solar atmosphere of a more active proto-Sun characterized by energetic particle fluxes higher than contemporary particle fluxes. This 10 Be is incorporated into the solar wind that is then implanted into CAI precursor material. This production mechanism is operational in the contemporary solar system implanting 10 Be in lunar materials. The contemporary production rate of 10 Be at the surface of the Sun is ∼0.1 10 Be cm -2 s -1 . Scaling up the contemporary 10 Be production in the proto-Sun by a factor of 10 5 would increase the production rate to 10 410 Be cm -2 s -1 . Using this enhanced production value in conjunction with refractory mass inflow rates at 0.06 AU from the proto-Sun we model 10 Be concentrations in CAI precursors. We calculate the content of solar-wind-implanted 10 Be would have been of the order of 10 1210 Be g -1 in CAIs, consistent with initial 10 Be content found from boron-beryllium isotopic systematics in CAIs.
Standard model fermions and K(E10
Directory of Open Access Journals (Sweden)
Axel Kleinschmidt
2015-07-01
Full Text Available In recent work [1] it was shown how to rectify Gell-Mann's proposal for identifying the 48 quarks and leptons of the Standard Model with the 48 spin-12 fermions of maximal SO(8 gauged supergravity remaining after the removal of eight Goldstinos, by deforming the residual U(1 symmetry at the SU(3 × U(1 stationary point of N=8 supergravity, so as to also achieve agreement of the electric charge assignments. In this Letter we show that the required deformation, while not in SU(8, does belong to K(E10, the ‘maximal compact’ subgroup of E10 which is a possible candidate symmetry underlying M theory. The incorporation of infinite-dimensional Kac–Moody symmetries of hyperbolic type, apparently unavoidable for the present scheme to work, opens up completely new perspectives on embedding Standard Model physics into a Planck scale theory of quantum gravity.
10 CFR 431.385 - Cessation of distribution of a basic model of an electric motor.
2010-01-01
... basic model of an electric motor. (a) In the event that a model of an electric motor is determined non... a model of an electric motor to be in noncompliance, then the manufacturer or private labeler shall... 10 Energy 3 2010-01-01 2010-01-01 false Cessation of distribution of a basic model of an electric...
2010-12-21
... Airworthiness Directives; DASSAULT AVIATION Model Falcon 10 Airplanes; Model FAN JET FALCON, FAN JET FALCON.... (1) DASSAULT AVIATION Model Falcon 10 airplanes, Model FAN JET FALCON, FAN JET FALCON SERIES C, D, E... airplanes Inspection threshold (whichever occurs later) Inspection interval Model FAN JET FALCON, FAN JET...
7 CFR 272.10 - ADP/CIS Model Plan.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false ADP/CIS Model Plan. 272.10 Section 272.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... benefit computation (including but not limited to all household members' names, addresses, dates of birth...
Macatangay, Ronald; Bagtasa, Gerry; Sonkaew, Thiranan
2017-09-01
The Weather Research and Forecasting (WRF v. 3.7) model was applied to model PM10 data in Chiang Mai city for 10-days during a high haze event utilizing updated land use categories from the Moderate Resolution Imaging Spectroradiometer (MODIS). A higher resolution meteorological lateral boundary condition (from 1 degree to 0.25 degree) was also used from the NCEP GDAS/FNL Global Tropospheric Analyses and Forecast Grid system. A 3-category urban canopy model was also added and the Thompson aerosol-aware microphysics parameterization scheme was used to model the aerosol number concentrations that were later converted to PM10 concentrations. Aerosol number concentration monthly climatology was firstly used as initial and lateral boundary conditions to model PM10 concentrations. These were compared to surface data obtained from two stations of the Pollution Control Department (PCD) of Thailand. The results from the modeled PM10 concentrations could not capture the variability (r = 0.29; 0.27 for each site) and underestimated a high PM10 spike during the period studied. The authors then added satellite data to the aerosol climatology that improved the comparison with observations (r = 0.45; 43). However, both model runs still were not able to capture the high PM10 concentration event. This requires further investigation.
Oyster Creek cycle 10 nodal model parameter optimization study using PSMS
International Nuclear Information System (INIS)
Dougher, J.D.
1987-01-01
The power shape monitoring system (PSMS) is an on-line core monitoring system that uses a three-dimensional nodal code (NODE-B) to perform nodal power calculations and compute thermal margins. The PSMS contains a parameter optimization function that improves the ability of NODE-B to accurately monitor core power distributions. This functions iterates on the model normalization parameters (albedos and mixing factors) to obtain the best agreement between predicted and measured traversing in-core probe (TIP) reading on a statepoint-by-statepoint basis. Following several statepoint optimization runs, an average set of optimized normalization parameters can be determined and can be implemented into the current or subsequent cycle core model for on-line core monitoring. A statistical analysis of 19 high-power steady-state state-points throughout Oyster Creek cycle 10 operation has shown a consistently poor virgin model performance. The normalization parameters used in the cycle 10 NODE-B model were based on a cycle 8 study, which evaluated only Exxon fuel types. The introduction of General Electric (GE) fuel into cycle 10 (172 assemblies) was a significant fuel/core design change that could have altered the optimum set of normalization parameters. Based on the need to evaluate a potential change in the model normalization parameters for cycle 11 and in an attempt to account for the poor cycle 10 model performance, a parameter optimization study was performed
2012-11-20
... Aerospace, Model BD-500-1A10 and BD-500-1A11 Airplanes; Sidestick Controllers AGENCY: Federal Aviation... conditions for the Bombardier Aerospace Model BD-500-1A10 and BD-500-1A11 airplanes. These airplanes will... on the comments we receive. Background On December 10, 2009, Bombardier Aerospace applied for a type...
A realistic pattern of fermion masses from a five-dimensional SO(10) model
International Nuclear Information System (INIS)
Feruglio, Ferruccio; Patel, Ketan M.; Vicino, Denise
2015-01-01
We provide a unified description of fermion masses and mixing angles in the framework of a supersymmetric grand unified SO(10) model with anarchic Yukawa couplings of order unity. The space-time is five dimensional and the extra flat spatial dimension is compactified on the orbifold S 1 /(Z 2 ×Z 2 ′ ), leading to Pati-Salam gauge symmetry on the boundary where Yukawa interactions are localised. The gauge symmetry breaking is completed by means of a rather economic scalar sector, avoiding the doublet-triplet splitting problem. The matter fields live in the bulk and their massless modes get exponential profiles, which naturally explain the mass hierarchy of the different fermion generations. Quarks and leptons properties are naturally reproduced by a mechanism, first proposed by Kitano and Li, that lifts the SO(10) degeneracy of bulk masses in terms of a single parameter. The model provides a realistic pattern of fermion masses and mixing angles for large values of tan β. It favours normally ordered neutrino mass spectrum with the lightest neutrino mass below 0.01 eV and no preference for leptonic CP violating phases. The right handed neutrino mass spectrum is very hierarchical and does not allow for thermal leptogenesis. We analyse several variants of the basic framework and find that the results concerning the fermion spectrum are remarkably stable.
2013-02-15
...; Special Conditions No. 25-477-SC] Special Conditions: Bombardier Aerospace, Model BD-500-1A10 and BD-500... special conditions. SUMMARY: These special conditions are issued for the Bombardier Aerospace Model BD-500...: Background On December 10, 2009, Bombardier Aerospace applied for a type certificate for their new Model BD...
Use of extremophilic bacteria for second generation bioethanol production
DEFF Research Database (Denmark)
Tomás, Ana Faria; Karakashev, Dimitar Borisov; Angelidaki, Irini
production from food crops, such as corn (starch) or sugar cane (sucrose) is already an established process, with the USA and Brazil supplying 86% of the market. The major challenge remains in the use of different waste sources – agricultural, forestry, animal and household waste - as a feedstock....... The recalcitrance of these materials and their diverse sugar composition make the industrial yeast strains currently used unsuitable for a second generation bioethanol production process. One of the alternative strategies is the use of extreme thermophilic microorganisms. Currently, selected members from the genera...... Clostridium, Thermoanaerobacter, Geobacillus and Thermoanaerobacterium are among the best candidates. A new strain of Thermoanaerobacter, closely related to T. italicus and T. mathranii, has achieved 0.43 gethanol/gxylose, which is 83% of the theoretical yield of ethanol based on xylose and the highest value...
Land-Use Portfolio Modeler, Version 1.0
Taketa, Richard; Hong, Makiko
2010-01-01
-on-investment. The portfolio model, now known as the Land-Use Portfolio Model (LUPM), provided the framework for the development of the Land-Use Portfolio Modeler, Version 1.0 software (LUPM v1.0). The software provides a geographic information system (GIS)-based modeling tool for evaluating alternative risk-reduction mitigation strategies for specific natural-hazard events. The modeler uses information about a specific natural-hazard event and the features exposed to that event within the targeted study region to derive a measure of a given mitigation strategy`s effectiveness. Harnessing the spatial capabilities of a GIS enables the tool to provide a rich, interactive mapping environment in which users can create, analyze, visualize, and compare different
Salivary Gland Dysplasia in Fgf10 Heterozygous Mice: A New Mouse Model of Xerostomia
May, A.J.; Chatzeli, L.; Proctor, G.B.; Tucker, A.S.
2017-01-01
Xerostomia, or chronic dry mouth, is a common syndrome caused by a lack of saliva that can lead to severe eating difficulties, dental caries and oral candida infections. The prevalence of xerostomia increases with age and affects approximately 30% of people aged 65 or older. Given the large numbers of sufferers, and the potential increase in incidence given our aging population, it is important to understand the complex mechanisms that drive hyposalivation and the consequences for the dentition and oral mucosa. From this study we propose the Fgf10 +/- mouse as a model to investigate xerostomia. By following embryonic salivary gland development, in vivo and in vitro, we show that a reduction in Fgf10 causes a delay in branching of salivary glands. This leads to hypoplasia of the glands, a phenotype that is not rescued postnatally or by adulthood in both male and female Fgf10 +/- mice. Histological analysis of the glands showed no obvious defect in cellular differentiation or acini/ductal arrangements, however there was a significant reduction in their size and weight. Analysis of saliva secretion showed that hypoplasia of the glands led to a significant reduction in saliva production in Fgf10 +/- adults, giving rise to a reduced saliva pellicle in the oral cavity of these mice. Mature mice were shown to drink more and in many cases had severe tooth wear. The Fgf10 +/- mouse is therefore a useful model to explore the causes and effects of xerostomia. PMID:26321752
Salivary Gland Dysplasia in Fgf10 Heterozygous Mice: A New Mouse Model of Xerostomia.
May, A J; Chatzeli, L; Proctor, G B; Tucker, A S
2015-01-01
Xerostomia, or chronic dry mouth, is a common syndrome caused by a lack of saliva that can lead to severe eating difficulties, dental caries and oral candida infections. The prevalence of xerostomia increases with age and affects approximately 30% of people aged 65 or older. Given the large numbers of sufferers, and the potential increase in incidence given our aging population, it is important to understand the complex mechanisms that drive hyposalivation and the consequences for the dentition and oral mucosa. From this study we propose the Fgf10 +/- mouse as a model to investigate xerostomia. By following embryonic salivary gland development, in vivo and in vitro, we show that a reduction in Fgf10 causes a delay in branching of salivary glands. This leads to hypoplasia of the glands, a phenotype that is not rescued postnatally or by adulthood in both male and female Fgf10 +/- mice. Histological analysis of the glands showed no obvious defect in cellular differentiation or acini/ductal arrangements, however there was a significant reduction in their size and weight. Analysis of saliva secretion showed that hypoplasia of the glands led to a significant reduction in saliva production in Fgf10 +/- adults, giving rise to a reduced saliva pellicle in the oral cavity of these mice. Mature mice were shown to drink more and in many cases had severe tooth wear. The Fgf10 +/- mouse is therefore a useful model to explore the causes and effects of xerostomia.
Fiscal impacts model documentation. Version 1.0
International Nuclear Information System (INIS)
Beck, S.L.; Scott, M.J.
1986-05-01
The Fiscal Impacts (FI) Model, Version 1.0 was developed under Pacific Northwest Laboratory's Monitored Retrievable Storage (MRS) Program to aid in development of the MRS Reference Site Environmental Document (PNL 5476). It computes estimates of 182 fiscal items for state and local government jurisdictions, using input data from the US Census Bureau's 1981 Survey of Governments and local population forecasts. The model can be adapted for any county or group of counties in the United States
String flipped SO(10) model from Z4 orbifold
International Nuclear Information System (INIS)
Sato, H.; Shimojo, M.
1993-01-01
We search all possible string grand-unified-theory models obtained from heterotic superstrings compactified on a Z 4 orbifold with one Wilson line. It is shown that there is an essentially unique anomaly-free flipped SO(10) model with three generations plus one mirror conjugate generation of matter fields. We derive effective Yukawa interactions and examine the structure of mass matrices as well as a possible scenario of string coupling unification. The four-generation Z 4 orbifold model is a phenomenologically viable model beyond the minimal supersymmetric standard one
Network modeling of PM10 concentration in Malaysia
Supian, Muhammad Nazirul Aiman Abu; Bakar, Sakhinah Abu; Razak, Fatimah Abdul
2017-08-01
Air pollution is not a new phenomenon in Malaysia. The Department of Environment (DOE) monitors the country's ambient air quality through a network of 51 stations. The air quality is measured using the Air Pollution Index (API) which is mainly recorded based on the concentration of particulate matter, PM10 readings. The Continuous Air Quality Monitoring (CAQM) stations are located in various places across the country. In this study, a network model of air quality based on PM10 concen tration for selected CAQM stations in Malaysia has been developed. The model is built using a graph formulation, G = (V, E) where vertex, V is a set of CAQM stations and edges, E is a set of correlation values for each pair of vertices. The network measurements such as degree distributions, closeness centrality, and betweenness centrality are computed to analyse the behaviour of the network. As a result, a rank of CAQM stations has been produced based on their centrality characteristics.
Modeling extreme PM10 concentration in Malaysia using generalized extreme value distribution
Hasan, Husna; Mansor, Nadiah; Salleh, Nur Hanim Mohd
2015-05-01
Extreme PM10 concentration from the Air Pollutant Index (API) at thirteen monitoring stations in Malaysia is modeled using the Generalized Extreme Value (GEV) distribution. The data is blocked into monthly selection period. The Mann-Kendall (MK) test suggests a non-stationary model so two models are considered for the stations with trend. The likelihood ratio test is used to determine the best fitted model and the result shows that only two stations favor the non-stationary model (Model 2) while the other eleven stations favor stationary model (Model 1). The return level of PM10 concentration that is expected to exceed the maximum once within a selected period is obtained.
Superstring-inspired SO(10) GUT model with intermediate scale
Sasaki, Ken
1987-12-01
A new mechanism is proposed for the mixing of Weinberg-Salam Higgs fields in superstring-inspired SO(10) models with no SO(10) singlet fields. The higher-dimensional terms in the superpotential can generate both Higgs field mixing and a small mass for the physical neutrino. I would like to thank Professor C. Iso for hospitality extended to me at the Tokyo Institute of Technology.
Improved Statistical Model Of 10.7-cm Solar Radiation
Vedder, John D.; Tabor, Jill L.
1993-01-01
Improved mathematical model simulates short-term fluctuations of flux of 10.7-cm-wavelength solar radiation during 91-day averaging period. Called "F10.7 flux", important as measure of solar activity and because it is highly correlated with ultraviolet radiation causing fluctuations in heating and density of upper atmosphere. F10.7 flux easily measureable at surface of Earth.
A review of depolarization modeling for earth-space radio paths at frequencies above 10 GHz
Bostian, C. W.; Stutzman, W. L.; Gaines, J. M.
1982-01-01
A review is presented of models for the depolarization, caused by scattering from raindrops and ice crystals, that limits the performance of dual-polarized satellite communication systems at frequencies above 10 GHz. The physical mechanisms of depolarization as well as theoretical formulations and empirical data are examined. Three theoretical models, the transmission, attenuation-derived, and scaling models, are described and their relative merits are considered.
Funding Models of Community Colleges in 10 Midwest States
Kenton, Carol Piper; Schuh, John H.; Huba, Mary E.; Shelley, Mack C., II
2004-01-01
The extent to which community colleges in 10 Midwest states relied on 12 current funds revenue sources between 1990 and 2000 is presented in this study. Four models of funding were identified and evaluated. All models generated revenue in excess of the change in the Higher Education Price Index (HEPI), a measure of inflation over the period…
Phenomenological analysis of supersymmetric σ-models on coset spaces SO(10)/U(5) and E6/[SO(10)xU(1)
International Nuclear Information System (INIS)
Nyawelo, T.S.
2004-12-01
We discuss some phenomenological aspects of gauged supersymmetric σ-models on homogeneous coset-spaces E 6 /[SO(10)xU(1)] and SO(10)/U(5) which are some of the most interesting for phenomenology. We investigate in detail the vacuum configurations of these models, and study the resulting consequences for supersymmetry breaking and breaking of the internal symmetry. Some supersymmetric minima for both models with gauged full isometry groups E 6 and SO(10) are physically problematic as the Kaehler metric becomes singular ad hence the kinetic terms of the Goldstone boson multiplets vanish. This leads us to introduce recently proposed soft supersymmetry-breaking mass terms which displace the minimum away from the singulax point. A non-singular Kaehler metric breaks the linear subgroup SO(10)xU(1) of the E 6 model spontaneously. The particle spectrum of all these different models is computed. (author)
Eddy-resolving 1/10° model of the World Ocean
Ibrayev, R. A.; Khabeev, R. N.; Ushakov, K. V.
2012-02-01
The first results on simulating the intra-annual variability of the World Ocean circulation by use of the eddy-resolving model are considered. For this purpose, a model of the World Ocean with a 1/10° horizontal resolution and 49 vertical levels was developed (a 1/10 × 1/10 × 49 model of the World Ocean). This model is based on the traditional system of three-dimensional equations of the large-scale dynamics of the ocean and boundary conditions with an explicit allowance for water fluxes on the free surface of the ocean. The equations are written in the tripolar coordinate system. The numerical method is based on the separation of the barotropic and baroclinic components of the solution. Discretization in time is implemented using explicit schemes allowing effective parallelization for a large number of processors. The model uses the sub-models of the boundary layer of the atmosphere and the submodel of sea-ice thermodynamics. The model of the World Ocean was developed at the Institute of Numerical Mathematics of the Russian Academy of Sciences (INM RAS) and the P.P. Shirshov Institute of Oceanogy (IO RAS). The formulation of the problem of simulating the intra-annual variability of thermohydrodynamic processes of the World Ocean and the parameterizations that were used are considered. In the numerical experiment, the temporal evolution of the atmospheric effect is determined by the normal annual cycle according to the conditions of the international Coordinated Ocean-Ice Reference Experiment (CORE-I). The calculation was carried out on a multiprocessor computer with distributed memory; 1601 computational cores were used. The presented analysis demonstrates that the obtained results are quite satisfactory when compared to the results that were obtained by other eddy-resolving models of the global ocean. The analysis of the model solution is, to a larger extent, of a descriptive character. A detailed analysis of the results is to be presented in following works
A non Supersymmetric SO(10) Grand Unified Model for All the Physics below $M_{GUT}$
Altarelli, Guido
2013-01-01
We present a renormalizable non supersymmetric Grand Unified SO(10) model which, at the price of a large fine tuning, is compatible with all compelling phenomenological requirements below the unification scale and thus realizes a minimal extension of the SM, unified in SO(10) and describing all known physics below $M_{GUT}$. These requirements include coupling unification at a large enough scale to be compatible with the bounds on proton decay; a Yukawa sector in agreement with all the data on quark and lepton masses and mixings and with leptogenesis as the origin of the baryon asymmetry of the Universe; an axion arising from the Higgs sector of the model, suitable to solve the strong CP problem and to account for the observed amount of Dark Matter. The above constraints imposed by the data are very stringent and single out a particular breaking chain with the Pati-Salam group at an intermediate scale $M_I\\sim10^{11}$ GeV.
Holgersen, Kristine; Kvist, Peter Helding; Markholst, Helle; Hansen, Axel Kornerup; Holm, Thomas Lindebo
2014-02-01
In inflammatory bowel disease a defective mucosal barrier, a dysregulated immune response and an excessive reactivity against the gut microbiota are assumed to cause a breakdown of the intestinal homeostasis and lead to chronic inflammation. Piroxicam treatment is a method for induction of colitis in IL-10 k.o. mice, which integrates a dysfunction of both the intestinal barrier and the immune system. However, the translational value of this model has not been thoroughly clarified. To characterise the piroxicam-accelerated colitis (PAC) IL-10 k.o. model with respect to clinical features, pathogenic mechanisms and its ability to respond to existing therapies. The PAC IL-10k.o. model was established on a C57BL/6J background and the clinical manifestations, immunological mechanisms and efficacy of ampicillin and anti-IL-12/23p40 treatment were assessed. The PAC IL-10 k.o. mice developed weight loss and diarrhoea, and colonoscopy revealed a thickened granulomatous mucosa. Histological evaluation of ileum and colon showed Crohn's disease-like changes with pronounced hyperplasia and focal transmural inflammation. Ileitis was also observed in piroxicam treated wild type mice. The total number of neutrophils, monocytes and natural killer cells was elevated in the blood compared to IL-10 k.o. and wild type mice, indicating a role of the innate immune system in the pathogenesis. These findings were supported by analyses of the intestinal cytokine profile. Ampicillin and anti-IL-12/23p40 treatment significantly suppressed disease in the model. The PAC IL-10 k.o. model resembles several features of Crohn's disease and could be a useful in vivo model in preclinical research. © 2013 Elsevier B.V. All rights reserved.
Vissers, Joost L. M.; van Esch, Betty C. A. M.; Hofman, Gerard A.; Kapsenberg, Martien L.; Weller, Frank R.; van Oosterhout, Antoon J. M.
2004-01-01
Background: Human studies have demonstrated that allergen immunotherapy induces memory suppressive responses and IL-10 production by allergen-specific T cells. Previously, we established a mouse model in which allergen immunotherapy was effective in the suppression of allergen-induced asthma
Random forest meteorological normalisation models for Swiss PM10 trend analysis
Grange, Stuart K.; Carslaw, David C.; Lewis, Alastair C.; Boleti, Eirini; Hueglin, Christoph
2018-05-01
Meteorological normalisation is a technique which accounts for changes in meteorology over time in an air quality time series. Controlling for such changes helps support robust trend analysis because there is more certainty that the observed trends are due to changes in emissions or chemistry, not changes in meteorology. Predictive random forest models (RF; a decision tree machine learning technique) were grown for 31 air quality monitoring sites in Switzerland using surface meteorological, synoptic scale, boundary layer height, and time variables to explain daily PM10 concentrations. The RF models were used to calculate meteorologically normalised trends which were formally tested and evaluated using the Theil-Sen estimator. Between 1997 and 2016, significantly decreasing normalised PM10 trends ranged between -0.09 and -1.16 µg m-3 yr-1 with urban traffic sites experiencing the greatest mean decrease in PM10 concentrations at -0.77 µg m-3 yr-1. Similar magnitudes have been reported for normalised PM10 trends for earlier time periods in Switzerland which indicates PM10 concentrations are continuing to decrease at similar rates as in the past. The ability for RF models to be interpreted was leveraged using partial dependence plots to explain the observed trends and relevant physical and chemical processes influencing PM10 concentrations. Notably, two regimes were suggested by the models which cause elevated PM10 concentrations in Switzerland: one related to poor dispersion conditions and a second resulting from high rates of secondary PM generation in deep, photochemically active boundary layers. The RF meteorological normalisation process was found to be robust, user friendly and simple to implement, and readily interpretable which suggests the technique could be useful in many air quality exploratory data analysis situations.
Business Model Canvas & Elevator pitch : 29-10-2013
Eelco Bakker
2013-01-01
Presentatie bij de Workshop Business Model Canvas: de bouwstenen en het gebouw van de onderneming - workshopprogramma ViB050. In het kader van het programma Teach the Teacher. Gehouden op 29-10-2013..
2013-12-12
... Inc., Models BD-500-1A10 and BD- 500-1A11 Series Airplanes; Electronic Flight Control System: Control... Inc. Models BD-500-1A10 and BD-500-1A11 series airplanes. These airplanes will have a novel or unusual... comments, data, or views. The most helpful comments reference a specific portion of the special conditions...
The results of a non-linear mathematical model for the kinetics of 10B after BPA-F infusion in BNCT
International Nuclear Information System (INIS)
Ryynaenen, P.; Savolainen, S.; Hiismaeki, P.; Kangasmaeki, A.
2001-01-01
The aim of this study was to create a model for the kinetics of 10 B in glioma patients after p-boronophenylalanine fructose complex (BPA-F) infusion in order to predict the 10 B concentration in blood during the neutron irradiations in BNCT. The more specific aim was to create a flexible model that would work with variable infusion duration and variable amounts of infused BRA, by forehand carrying out only 1 to 2 kinetic studies per different trials. Previously used bi-exponential fitting and open compartmental model are capable, but, however, heavy kinetic studies are needed before they are reliable enough. A model probe with a memory effect based on phenomenological findings was created. The model development was based on the data from 10 glioblastoma multiforme patients from the Brookhaven National Laboratory BNCT trials. These patients received i.v. 290 mg BPA/kg body weight as a fructose complex during two hours. Blood samples were collected during and after the infusion. The accuracy of the model was verified with distinctive fitting of 10 new glioma patient data from the Finnish BNCT-trials. The 10 B- concentration in whole blood samples was determined by ICP-AES method. In the study it is concluded that the constructed non-linear model is flexible and capable in describing the kinetics of 10 B concentration in blood after a single infusion of BPA-F. (author)
NCBI nr-aa BLAST: CBRC-DMEL-02-0080 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0080 ref|NP_622419.1| Ribose/xylose/arabinose/galactoside ABC-type transport systems...inose/galactoside ABC-type transport systems, permease components [Thermoanaerobacter tengcongensis MB4] NP_622419.1 0.92 33% ...
Campforts, Benjamin; Vanacker, Veerle; Vanderborght, Jan; Baken, Stijn; Smolders, Erik; Govers, Gerard
2016-04-01
Meteoric 10Be allows for the quantification of vertical and lateral soil fluxes over long time scales (103-105 yr). However, the mobility of meteoric 10Be in the soil system makes a translation of meteoric 10Be inventories into erosion and deposition rates complex. Here, we present a spatially explicit 2D model simulating the behaviour of meteoric 10Be on a hillslope. The model consists of two parts. The first component deals with advective and diffusive mobility of meteoric 10Be within the soil profile, and the second component describes lateral soil and meteoric 10Be fluxes over the hillslope. Soil depth is calculated dynamically, accounting for soil production through weathering as well as downslope fluxes of soil due to creep, water and tillage erosion. Synthetic model simulations show that meteoric 10Be inventories can be related to erosion and deposition across a wide range of geomorphological and pedological settings. Our results also show that meteoric 10Be can be used as a tracer to detect human impact on soil fluxes for soils with a high affinity for meteoric 10Be. However, the quantification of vertical mobility is essential for a correct interpretation of the observed variations in meteoric 10Be profiles and inventories. Application of the Be2D model to natural conditions using data sets from the Southern Piedmont (Bacon et al., 2012) and Appalachian Mountains (Jungers et al., 2009; West et al., 2013) allows to reliably constrain parameter values. Good agreement between simulated and observed meteoric 10Be concentrations and inventories is obtained with realistic parameter values. Furthermore, our results provide detailed insights into the processes redistributing meteoric 10Be at the soil-hillslope scale.
Therapeutic efficacy of fibroblast growth factor 10 in a rabbit model of dry eye.
Zheng, Wenjing; Ma, Mingming; Du, Ergang; Zhang, Zhengwei; Jiang, Kelimu; Gu, Qing; Ke, Bilian
2015-11-01
The aim of the present study was to investigate the therapeutic efficacy of fibroblast growth factor 10 (FGF10) in the promotion of healing, survival and expression of mucin in corneal epithelial cells in a rabbit dry eye model. A total of 12 healthy female New Zealand white rabbits were divided randomly into three groups. The lacrimal glands were injected with saline either alone (normal control group) or with concanavalin A (Con A), with either topical phosphate‑buffered saline (PBS; PBS control group) or 25 µg/ml FGF10 (FGF10 treatment group). Lacrimal gland inflammation, tear function, corneal epithelial cell integrity, cell apoptosis and mucin expression were subsequently assessed. Lacrimal gland tissue biopsies were performed in conjunction with histology and electron microscopy observations. Tear meniscus height (TMH) and tear meniscus area (TMA) were measured using Fourier domain‑optical coherence tomography. Tear membrane break‑up time (TBUT) was also assessed and corneal fluorescein staining was performed. The percentages of apoptotic corneal and conjunctival (Cj) epithelial cells (ECs) were counted using a terminal deoxynucleotidyl transferase‑mediated dUTP nick end labeling method. The mRNA expression levels of Muc1 were determined using reverse transcription‑quantitative polymerase chain reaction analyses. The TMH and TMA values of the PBS and treatment groups were found to be significantly reduced, compared with those of the normal control group 3 days after Con A injection. However, the TMH and TMA of the FGF10 treatment group were higher, compared with those of the PBS group 3 and 7 days after treatment, respectively. Furthermore, the FGF10 treatment group exhibited prolonged TBUT, reduced corneal fluorescein staining and repaired epithelial cell ultrastructure7 days after treatment. The percentages of apoptotic corneal‑ and Cj‑ECs in the FGF10 treatment group were significantly reduced, compared with those in the PBS group. FGF10
A mouse dry eye model induced by topical administration of the air pollutant particulate matter 10.
Li, Juan; Tan, Gang; Ding, Xiaoyan; Wang, Yahong; Wu, Anhua; Yang, Qichen; Ye, Lei; Shao, Yi
2017-12-01
To introduce a novel dry eye mouse model induced by topical administration of the air pollutant particulate matter 10 (PM 10 ). A total of 60 male BALB/c mice were used in this study and divided into two groups: group A (PBS eye drops, n=30) and group B (PM 10 eye drop group, n=30). Each treatment was dosed four times a day, every time 50ul with the concentration of 5mg/ml PM10, for 14 consecutive days in the right eye. The clinical manifestations of dry eye were measured before therapy and 4, 7 and 14days post-treatment respectively, which included the tear volume, tear break-up (BUT) time, corneal fluorescein staining, rose bengal staining, Lissamine Green staining and inflammatory index. Eye samples were collected on D14 and examined by histologic light microscopy, transmission electron microscopy (TEM) and scanning electron microscopy (SEM), corneal cytokeration 10 (K10) immunnostaining, and tumor necrosis factor-α (TNF-α), NF-κB-p65 and NF-κB Western Blot analysis. At 0d, 7d and 14d, there were no statistical changes in tear volume, BUT after treatment (P>0.05) with PBS in group A. In group B, all items showed statistical differences at each time point (Plevels of K10 and reduced number of goblet cells in the conjunctival fornix in group B. PM 10 significantly increased the levels of TNF-α, NF-κB-p65 and NF-κB in the cornea. PM 10 can damage the tear film function and cause the destruction of the structural organization of ocular surface in mice. Topical administration of PM 10 in mice induces ocular surface changes that are similar to those of dry eye in humans, representing a novel model of DES. Copyright © 2017. Published by Elsevier Masson SAS.
Guo, Xiaopeng; Ren, Dongfang; Guo, Xiaodan
2018-06-01
Recently, Chinese state environmental protection administration has brought out several PM10 reduction policies to control the coal consumption strictly and promote the adjustment of power structure. Under this new policy environment, a suitable analysis method is required to simulate the upcoming major shift of China's electric power structure. Firstly, a complete system dynamics model is built to simulate China's evolution path of power structure with constraints of PM10 reduction considering both technical and economical factors. Secondly, scenario analyses are conducted under different clean-power capacity growth rates to seek applicable policy guidance for PM10 reduction. The results suggest the following conclusions. (1) The proportion of thermal power installed capacity will decrease to 67% in 2018 with a dropping speed, and there will be an accelerated decline in 2023-2032. (2) The system dynamics model can effectively simulate the implementation of the policy, for example, the proportion of coal consumption in the forecast model is 63.3% (the accuracy rate is 95.2%), below policy target 65% in 2017. (3) China should promote clean power generation such as nuclear power to meet PM10 reduction target.
Energy Technology Data Exchange (ETDEWEB)
Ankola, D D; Ravi Kumar, M N V [Strathclyde Institute of Pharmacy and Biomedical Sciences, University of Strathclyde, 27 Taylor Street, Glasgow, G4 0NR (United Kingdom); Durbin, E W [Department of Physics, Case Western Reserve University, 10900 Euclid Avenue, Cleveland, OH 44106 (United States); Buxton, G A [Department of Sciences, Robert Morris University, 6001 University Boulevard, Moon Township, PA 15108 (United States); Schaefer, J; Bakowsky, U, E-mail: mnvrkumar@strath.ac.uk [Department of Pharmaceutics and Biopharmacy, Philipps Universitt, 35037 Marburg (Germany)
2010-02-10
Combination therapy will soon become a reality, particularly for those patients requiring poly-therapy to treat co-existing disease states. This becomes all the more important with the increasing cost, time and complexity of the drug discovery process prompting one to look at new delivery systems to increase the efficacy, safety and patient compliance of existing drugs. Along this line, we attempted to design nano-scale systems for simultaneous encapsulation of cyclosporine A (CsA) and coenzyme Q10 (CoQ10) and model their encapsulation and release kinetics. The in vitro characterization of the co-encapsulated nanoparticles revealed that the surfactant nature, concentration, external phase volume, droplet size reduction method and drug loading concentration can all influence the overall performance of the nanoparticles. The semi-quantitative solubility study indicates the strong influence of CoQ10 on CsA entrapment which was thought to be due to an increase in the lipophilicity of the overall system. The in vitro dissolution profile indicates the influence of CoQ10 on CsA release (64%) to that of individual particles of CsA, where the release is faster and higher (86%) on 18th day. The attempts to model the encapsulation and release kinetics were successful, offering a possibility to use such models leading to high throughput screening of drugs and their nature, alone or in combination for a particular polymer, if chi-parameters are understood.
A simple rain attenuation model for earth-space radio links operating at 10-35 GHz
Stutzman, W. L.; Yon, K. M.
1986-01-01
The simple attenuation model has been improved from an earlier version and now includes the effect of wave polarization. The model is for the prediction of rain attenuation statistics on earth-space communication links operating in the 10-35 GHz band. Simple calculations produce attenuation values as a function of average rain rate. These together with rain rate statistics (either measured or predicted) can be used to predict annual rain attenuation statistics. In this paper model predictions are compared to measured data from a data base of 62 experiments performed in the U.S., Europe, and Japan. Comparisons are also made to predictions from other models.
IDC Use Case Model Survey Version 1.0.
Energy Technology Data Exchange (ETDEWEB)
Carr, Dorthe B.; Harris, James M.
2014-12-01
This document contains the brief descriptions for the actors and use cases contained in the IDC Use Case Model Survey. REVISIONS Version Date Author/Team Revision Description Authorized by V1.0 12/2014 IDC Re- engineering Project Team Initial delivery M. Harris
Energy confinement in the T-10 tokamak and canonic profile models
International Nuclear Information System (INIS)
Dnestrovskii, Yu.N.; Pereverzev, G.V.
1988-01-01
A classification of experimental results on electron cyclotron resonance heating (ECRH) is that T-10 tokamak is presented. Analysis of the experiments is consistent with two energy balance models. The first is based on the idea of profile consistency of the plasma current and pressure. The on-axis and off-axis ECRH as well as the heat wave propagation in T-10 can be reasonably represented in this way. In addition, this model allows the L to H mode transition to be described as the bifurcation of the solutions of a set of non-linear equations. The second model is based on the idea of a thermal pinch produced by a toroidal electric field. The electron temperature profiles under ohmic heating as well as under ECRH can be described by this model. Furthermore, this approach explains the cause of the confinement degradation under non-ohmic plasma heating (L-mode). (Author)
A prognostic pollen emissions model for climate models (PECM1.0
Directory of Open Access Journals (Sweden)
M. C. Wozniak
2017-11-01
Full Text Available We develop a prognostic model called Pollen Emissions for Climate Models (PECM for use within regional and global climate models to simulate pollen counts over the seasonal cycle based on geography, vegetation type, and meteorological parameters. Using modern surface pollen count data, empirical relationships between prior-year annual average temperature and pollen season start dates and end dates are developed for deciduous broadleaf trees (Acer, Alnus, Betula, Fraxinus, Morus, Platanus, Populus, Quercus, Ulmus, evergreen needleleaf trees (Cupressaceae, Pinaceae, grasses (Poaceae; C3, C4, and ragweed (Ambrosia. This regression model explains as much as 57 % of the variance in pollen phenological dates, and it is used to create a climate-flexible phenology that can be used to study the response of wind-driven pollen emissions to climate change. The emissions model is evaluated in the Regional Climate Model version 4 (RegCM4 over the continental United States by prescribing an emission potential from PECM and transporting pollen as aerosol tracers. We evaluate two different pollen emissions scenarios in the model using (1 a taxa-specific land cover database, phenology, and emission potential, and (2 a plant functional type (PFT land cover, phenology, and emission potential. The simulated surface pollen concentrations for both simulations are evaluated against observed surface pollen counts in five climatic subregions. Given prescribed pollen emissions, the RegCM4 simulates observed concentrations within an order of magnitude, although the performance of the simulations in any subregion is strongly related to the land cover representation and the number of observation sites used to create the empirical phenological relationship. The taxa-based model provides a better representation of the phenology of tree-based pollen counts than the PFT-based model; however, we note that the PFT-based version provides a useful and climate-flexible emissions
Directory of Open Access Journals (Sweden)
Jacopo Lucchetti
Full Text Available Oxidative stress and mitochondrial impairment are the main pathogenic mechanisms of Amyotrophic Lateral Sclerosis (ALS, a severe neurodegenerative disease still lacking of effective therapy. Recently, the coenzyme-Q (CoQ complex, a key component of mitochondrial function and redox-state modulator, has raised interest for ALS treatment. However, while the oxidized form ubiquinone10 was ineffective in ALS patients and modestly effective in mouse models of ALS, no evidence was reported on the effect of the reduced form ubiquinol10, which has better bioavailability and antioxidant properties. In this study we compared the effects of ubiquinone10 and a new stabilized formulation of ubiquinol10 on the disease course of SOD1(G93A transgenic mice, an experimental model of fALS. Chronic treatments (800 mg/kg/day orally started from the onset of disease until death, to mimic the clinical trials that only include patients with definite ALS symptoms. Although the plasma levels of CoQ10 were significantly increased by both treatments (from <0.20 to 3.0-3.4 µg/mL, no effect was found on the disease progression and survival of SOD1(G93A mice. The levels of CoQ10 in the brain and spinal cord of ubiquinone10- or ubiquinol10-treated mice were only slightly higher (≤10% than the endogenous levels in vehicle-treated mice, indicating poor CNS availability after oral dosing and possibly explaining the lack of pharmacological effects. To further examine this issue, we measured the oxidized and reduced forms of CoQ9/10 in the plasma, brain and spinal cord of symptomatic SOD1(G93A mice, in comparison with age-matched SOD1(WT. Levels of ubiquinol9/10, but not ubiquinone9/10, were significantly higher in the CNS, but not in plasma, of SOD1(G93A mice, suggesting that CoQ redox system might participate in the mechanisms trying to counteract the pathology progression. Therefore, the very low increases of CoQ10 induced by oral treatments in CNS might be not sufficient to
Modelling the long-range transport of secondary PM 10 to the UK
Malcolm, A. L.; Derwent, R. G.; Maryon, R. H.
The fine fraction of airborne particulate matter (PM 10) is known to be harmful to human health. In order to establish how current air quality standards can best be met now and in the future, it is necessary to understand the cause of PM 10 episodes. The UK Met Office's dispersion model, NAME, has been used to model hourly concentrations of sulphate aerosol for 1996 at a number of UK locations. The model output has been compared with measured values of PM 10 or sulphate aerosol at these sites and used to provide attribution information. In particular two large PM 10 episodes in March and July 1996 have been studied. The March episode has been shown to be the result of imported pollution from outside the UK, whereas the July case was dominated by UK emissions. This work highlights the need to consider trans-boundary pollution when setting air quality standards and when making policy decisions on emissions.
DEFF Research Database (Denmark)
Andersen, Johannes
2014-01-01
efter en 10+10+10 timers model. Ifølge lektor og samfundsforsker Johannes Andersen ved Institut for statskundskab på Aalborg Universitet, er antallet af stress ramte danskere steget fra 5 procent i 1989 til mere end 12 procent i 2010. Således tyder noget på, at danskerne ikke får den fornødne hvile....
Impaired IL-10 transcription and release in animal models of Gaucher disease macrophages.
Kacher, Yaacov; Futerman, Anthony H
2009-01-01
A number of studies have shown altered cytokine levels in serum from Gaucher disease patients, including changes in levels of the anti-inflammatory cytokine, interleukin-10 (IL-10). However, the source of IL-10, or the mechanisms leading to changes in IL-10 serum levels are not known. We now show that mouse macrophages treated with an active site-directed inhibitor of glucocerebrosidase, or macrophages from a mouse model of Gaucher disease, the L444P mouse, release significantly less IL-10 than their untreated counterparts, but that TNFalpha release is unaffected. These changes are due to reduced transcription of IL-10 mRNA in macrophages. The reduction in IL-10 secretion observed in animal models of Gaucher disease macrophages may be of relevance to explain the increase in inflammation that is often observed in Gaucher disease.
Directory of Open Access Journals (Sweden)
G. Bisht
2017-12-01
Full Text Available A fully coupled three-dimensional surface and subsurface land model is developed and applied to a site along the Columbia River to simulate three-way interactions among river water, groundwater, and land surface processes. The model features the coupling of the Community Land Model version 4.5 (CLM4.5 and a massively parallel multiphysics reactive transport model (PFLOTRAN. The coupled model, named CP v1.0, is applied to a 400 m × 400 m study domain instrumented with groundwater monitoring wells along the Columbia River shoreline. CP v1.0 simulations are performed at three spatial resolutions (i.e., 2, 10, and 20 m over a 5-year period to evaluate the impact of hydroclimatic conditions and spatial resolution on simulated variables. Results show that the coupled model is capable of simulating groundwater–river-water interactions driven by river stage variability along managed river reaches, which are of global significance as a result of over 30 000 dams constructed worldwide during the past half-century. Our numerical experiments suggest that the land-surface energy partitioning is strongly modulated by groundwater–river-water interactions through expanding the periodically inundated fraction of the riparian zone, and enhancing moisture availability in the vadose zone via capillary rise in response to the river stage change. Meanwhile, CLM4.5 fails to capture the key hydrologic process (i.e., groundwater–river-water exchange at the site, and consequently simulates drastically different water and energy budgets. Furthermore, spatial resolution is found to significantly impact the accuracy of estimated the mass exchange rates at the boundaries of the aquifer, and it becomes critical when surface and subsurface become more tightly coupled with groundwater table within 6 to 7 meters below the surface. Inclusion of lateral subsurface flow influenced both the surface energy budget and subsurface transport processes as a result
Bisht, Gautam; Huang, Maoyi; Zhou, Tian; Chen, Xingyuan; Dai, Heng; Hammond, Glenn E.; Riley, William J.; Downs, Janelle L.; Liu, Ying; Zachara, John M.
2017-12-01
A fully coupled three-dimensional surface and subsurface land model is developed and applied to a site along the Columbia River to simulate three-way interactions among river water, groundwater, and land surface processes. The model features the coupling of the Community Land Model version 4.5 (CLM4.5) and a massively parallel multiphysics reactive transport model (PFLOTRAN). The coupled model, named CP v1.0, is applied to a 400 m × 400 m study domain instrumented with groundwater monitoring wells along the Columbia River shoreline. CP v1.0 simulations are performed at three spatial resolutions (i.e., 2, 10, and 20 m) over a 5-year period to evaluate the impact of hydroclimatic conditions and spatial resolution on simulated variables. Results show that the coupled model is capable of simulating groundwater-river-water interactions driven by river stage variability along managed river reaches, which are of global significance as a result of over 30 000 dams constructed worldwide during the past half-century. Our numerical experiments suggest that the land-surface energy partitioning is strongly modulated by groundwater-river-water interactions through expanding the periodically inundated fraction of the riparian zone, and enhancing moisture availability in the vadose zone via capillary rise in response to the river stage change. Meanwhile, CLM4.5 fails to capture the key hydrologic process (i.e., groundwater-river-water exchange) at the site, and consequently simulates drastically different water and energy budgets. Furthermore, spatial resolution is found to significantly impact the accuracy of estimated the mass exchange rates at the boundaries of the aquifer, and it becomes critical when surface and subsurface become more tightly coupled with groundwater table within 6 to 7 meters below the surface. Inclusion of lateral subsurface flow influenced both the surface energy budget and subsurface transport processes as a result of river-water intrusion into the
Sullivan, Kieran T; Pasch, Lauri A; Lawrence, Erika; Bradbury, Thomas N
2015-12-01
The purpose of the present study was to test a relational spillover model of physical aggression whereby physical aggression affects marital outcomes due to its effects on how spouses ask for and provide support to one another. Newlywed couples (n = 172) reported levels of physical aggression over the past year and engaged in interactions designed to elicit social support; marital adjustment, and stability were assessed periodically over the first 10 years of marriage. Multilevel modeling revealed that negative support behavior mediated the relationship between physical aggression and 10-year marital adjustment levels whereas positive support behavior mediated the relationship between physical aggression and divorce status. These findings emphasize the need to look beyond conflict when explaining how aggression affects relationships and when working with couples with a history of physical aggression who are seeking to improve their relationships. (c) 2015 APA, all rights reserved).
A protocol for the intercomparison of marine fishery and ecosystem models: Fish-MIP v1.0
Tittensor, Derek P.; Eddy, Tyler D.; Lotze, Heike K.; Galbraith, Eric D.; Cheung, William; Barange, Manuel; Blanchard, Julia L.; Bopp, Laurent; Bryndum-Buchholz, Andrea; Büchner, Matthias; Bulman, Catherine; Carozza, David A.; Christensen, Villy; Coll, Marta; Dunne, John P.; Fernandes, Jose A.; Fulton, Elizabeth A.; Hobday, Alistair J.; Huber, Veronika; Jennings, Simon; Jones, Miranda; Lehodey, Patrick; Link, Jason S.; Mackinson, Steve; Maury, Olivier; Niiranen, Susa; Oliveros-Ramos, Ricardo; Roy, Tilla; Schewe, Jacob; Shin, Yunne-Jai; Silva, Tiago; Stock, Charles A.; Steenbeek, Jeroen; Underwood, Philip J.; Volkholz, Jan; Watson, James R.; Walker, Nicola D.
2018-04-01
Model intercomparison studies in the climate and Earth sciences communities have been crucial to building credibility and coherence for future projections. They have quantified variability among models, spurred model development, contrasted within- and among-model uncertainty, assessed model fits to historical data, and provided ensemble projections of future change under specified scenarios. Given the speed and magnitude of anthropogenic change in the marine environment and the consequent effects on food security, biodiversity, marine industries, and society, the time is ripe for similar comparisons among models of fisheries and marine ecosystems. Here, we describe the Fisheries and Marine Ecosystem Model Intercomparison Project protocol version 1.0 (Fish-MIP v1.0), part of the Inter-Sectoral Impact Model Intercomparison Project (ISIMIP), which is a cross-sectoral network of climate impact modellers. Given the complexity of the marine ecosystem, this class of models has substantial heterogeneity of purpose, scope, theoretical underpinning, processes considered, parameterizations, resolution (grain size), and spatial extent. This heterogeneity reflects the lack of a unified understanding of the marine ecosystem and implies that the assemblage of all models is more likely to include a greater number of relevant processes than any single model. The current Fish-MIP protocol is designed to allow these heterogeneous models to be forced with common Earth System Model (ESM) Coupled Model Intercomparison Project Phase 5 (CMIP5) outputs under prescribed scenarios for historic (from the 1950s) and future (to 2100) time periods; it will be adapted to CMIP phase 6 (CMIP6) in future iterations. It also describes a standardized set of outputs for each participating Fish-MIP model to produce. This enables the broad characterization of differences between and uncertainties within models and projections when assessing climate and fisheries impacts on marine ecosystems and the
A protocol for the intercomparison of marine fishery and ecosystem models: Fish-MIP v1.0
Directory of Open Access Journals (Sweden)
D. P. Tittensor
2018-04-01
Full Text Available Model intercomparison studies in the climate and Earth sciences communities have been crucial to building credibility and coherence for future projections. They have quantified variability among models, spurred model development, contrasted within- and among-model uncertainty, assessed model fits to historical data, and provided ensemble projections of future change under specified scenarios. Given the speed and magnitude of anthropogenic change in the marine environment and the consequent effects on food security, biodiversity, marine industries, and society, the time is ripe for similar comparisons among models of fisheries and marine ecosystems. Here, we describe the Fisheries and Marine Ecosystem Model Intercomparison Project protocol version 1.0 (Fish-MIP v1.0, part of the Inter-Sectoral Impact Model Intercomparison Project (ISIMIP, which is a cross-sectoral network of climate impact modellers. Given the complexity of the marine ecosystem, this class of models has substantial heterogeneity of purpose, scope, theoretical underpinning, processes considered, parameterizations, resolution (grain size, and spatial extent. This heterogeneity reflects the lack of a unified understanding of the marine ecosystem and implies that the assemblage of all models is more likely to include a greater number of relevant processes than any single model. The current Fish-MIP protocol is designed to allow these heterogeneous models to be forced with common Earth System Model (ESM Coupled Model Intercomparison Project Phase 5 (CMIP5 outputs under prescribed scenarios for historic (from the 1950s and future (to 2100 time periods; it will be adapted to CMIP phase 6 (CMIP6 in future iterations. It also describes a standardized set of outputs for each participating Fish-MIP model to produce. This enables the broad characterization of differences between and uncertainties within models and projections when assessing climate and fisheries impacts on marine ecosystems
2010-07-27
... Model Falcon 10 Airplanes; Model FAN JET FALCON, FAN JET FALCON SERIES C, D, E, F, and G Airplanes.... Since that NPRM was issued, we have determined that Model FAN JET FALCON SERIES C, D, E, F, and G..., Model FAN JET FALCON, FAN JET FALCON SERIES C, D, E, F, and G airplanes, and Model MYSTERE-FALCON 20-C5...
String flipped SO(10) model from [ital Z][sub 4] orbifold
Energy Technology Data Exchange (ETDEWEB)
Sato, H. (Department of Physics, Hyogo University of Education, Yashiro-cho, Hyogo 673-14 (Japan)); Shimojo, M. (Department of Electronics and Information Engineering, Fukui National College of Technology, Sabae, Fukui 916 (Japan))
1993-12-15
We search all possible string grand-unified-theory models obtained from heterotic superstrings compactified on a [ital Z][sub 4] orbifold with one Wilson line. It is shown that there is an essentially unique anomaly-free flipped SO(10) model with three generations plus one mirror conjugate generation of matter fields. We derive effective Yukawa interactions and examine the structure of mass matrices as well as a possible scenario of string coupling unification. The four-generation [ital Z][sub 4] orbifold model is a phenomenologically viable model beyond the minimal supersymmetric standard one.
Modelling street level PM10 concentrations across Europe: source apportionment and possible futures
Directory of Open Access Journals (Sweden)
G. Kiesewetter
2015-02-01
Full Text Available Despite increasing emission controls, particulate matter (PM has remained a critical issue for European air quality in recent years. The various sources of PM, both from primary particulate emissions as well as secondary formation from precursor gases, make this a complex problem to tackle. In order to allow for credible predictions of future concentrations under policy assumptions, a modelling approach is needed that considers all chemical processes and spatial dimensions involved, from long-range transport of pollution to local emissions in street canyons. Here we describe a modelling scheme which has been implemented in the GAINS integrated assessment model to assess compliance with PM10 (PM with aerodynamic diameter 10 across Europe. Furthermore, we analyse the predicted evolution of PM10 concentrations in the European Union until 2030 under different policy scenarios. Significant improvements in ambient PM10 concentrations are expected assuming successful implementation of already agreed legislation; however, these will not be large enough to ensure attainment of PM10 limit values in hot spot locations such as Southern Poland and major European cities. Remaining issues are largely eliminated in a scenario applying the best available emission control technologies to the maximal technically feasible extent.
Biomass for energy or materials? A Western European MARKAL MATTER 1.0 model characterization
International Nuclear Information System (INIS)
Gielen, D.J.; Gerlagh, T.; Bos, A.J.M.
1998-12-01
The structure and input data for the biomass module of the MATTER 1.0 model, a MARKAL energy and materials systems engineering model for Western Europe, is discussed. This model is used for development of energy and materials strategies for greenhouse gas emission reduction. Preliminary biomass results are presented in order to identify key processes and key parameters that deserve further analysis. The results show that the production of biomaterials is an attractive option for the reduction of greenhouse gas emissions. Biomaterials can substitute materials which require a lot of energy for production or they can substitute fossil fuel feedstocks. Increased biomaterials production will result in increasing amounts of waste biomass which can be used for energy production. An increase of the use of biomass for the production of materials needs more attention in the forthcoming BRED analysis. 93 refs
Zhao, Wenjiao; Lu, Guihua; Liu, Li; Sun, Zhishan; Wu, Mingxin; Yi, Wenyan; Chen, Haiyan; Li, Yanhui; Tang, Lilong; Zeng, Jianping
2018-03-04
BACKGROUND The aim of this study was to compare the use of the standard 12-lead electrocardiogram (ECG) with the SAN-Atrial-AVN-His (SAAH) ECG (Model PHS-A10), a new automated and integrated signals recognition system that detects micro-waveforms within the P, QRS, and T-wave, in a pig model of acute myocardial infarction (MI). MATERIAL AND METHODS Six medium-sized domestic Chinese pigs underwent general anesthesia, and an angioplasty balloon was placed and dilated for 120 minutes in the first diagonal coronary artery arising from the left anterior descending (LAD) coronary artery. A standard ECG and a SAAH ECG (Model PHS-A10) were used to evaluate: 1) the number of wavelets in ST-T segment in lead V5; 2) the duration of the repolarization initial (Ri), or duration of the wavelets starting from the J-point to the endpoint of the wavelets in the ST interval; 3) the duration of the repolarization terminal (Rt), of the wavelets, starting from the endpoint of the wavelets in the ST interval to the cross-point of the T-wave and baseline; 4) the ratio Ri: Rt. RESULTS Following coronary artery occlusion, duration of Ri and Ri/Rt increased, and Rt decreased, which was detected by the SAAH ECG (Model PHS-A10) within 12 seconds, compared with standard ECG that detected ST segment depression at 24 seconds following coronary artery occlusion. CONCLUSIONS The findings from this preliminary study in a pig model of acute MI support the need for clinical studies to evaluate the SAAH ECG (Model PHS-A10) for the early detection of acute MI.
McCoy, Alene T; Bartels, Michael J; Rick, David L; Saghir, Shakil A
2012-07-01
TK Modeler 1.0 is a Microsoft® Excel®-based pharmacokinetic (PK) modeling program created to aid in the design of toxicokinetic (TK) studies. TK Modeler 1.0 predicts the diurnal blood/plasma concentrations of a test material after single, multiple bolus or dietary dosing using known PK information. Fluctuations in blood/plasma concentrations based on test material kinetics are calculated using one- or two-compartment PK model equations and the principle of superposition. This information can be utilized for the determination of appropriate dosing regimens based on reaching a specific desired C(max), maintaining steady-state blood/plasma concentrations, or other exposure target. This program can also aid in the selection of sampling times for accurate calculation of AUC(24h) (diurnal area under the blood concentration time curve) using sparse-sampling methodologies (one, two or three samples). This paper describes the construction, use and validation of TK Modeler. TK Modeler accurately predicted blood/plasma concentrations of test materials and provided optimal sampling times for the calculation of AUC(24h) with improved accuracy using sparse-sampling methods. TK Modeler is therefore a validated, unique and simple modeling program that can aid in the design of toxicokinetic studies. Copyright © 2012 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Alejandro Ivan Aguirre-Salado
2017-07-01
Full Text Available We implemented a spatial model for analysing PM 10 maxima across the Mexico City metropolitan area during the period 1995–2016. We assumed that these maxima follow a non-identical generalized extreme value (GEV distribution and modeled the trend by introducing multivariate smoothing spline functions into the probability GEV distribution. A flexible, three-stage hierarchical Bayesian approach was developed to analyse the distribution of the PM 10 maxima in space and time. We evaluated the statistical model’s performance by using a simulation study. The results showed strong evidence of a positive correlation between the PM 10 maxima and the longitude and latitude. The relationship between time and the PM 10 maxima was negative, indicating a decreasing trend over time. Finally, a high risk of PM 10 maxima presenting levels above 1000 μ g/m 3 (return period: 25 yr was observed in the northwestern region of the study area.
Xia, Zhiye; Xu, Lisheng; Chen, Hongbin; Wang, Yongqian; Liu, Jinbao; Feng, Wenlan
2017-06-01
Extended range forecasting of 10-30 days, which lies between medium-term and climate prediction in terms of timescale, plays a significant role in decision-making processes for the prevention and mitigation of disastrous meteorological events. The sensitivity of initial error, model parameter error, and random error in a nonlinear crossprediction error (NCPE) model, and their stability in the prediction validity period in 10-30-day extended range forecasting, are analyzed quantitatively. The associated sensitivity of precipitable water, temperature, and geopotential height during cases of heavy rain and hurricane is also discussed. The results are summarized as follows. First, the initial error and random error interact. When the ratio of random error to initial error is small (10-6-10-2), minor variation in random error cannot significantly change the dynamic features of a chaotic system, and therefore random error has minimal effect on the prediction. When the ratio is in the range of 10-1-2 (i.e., random error dominates), attention should be paid to the random error instead of only the initial error. When the ratio is around 10-2-10-1, both influences must be considered. Their mutual effects may bring considerable uncertainty to extended range forecasting, and de-noising is therefore necessary. Second, in terms of model parameter error, the embedding dimension m should be determined by the factual nonlinear time series. The dynamic features of a chaotic system cannot be depicted because of the incomplete structure of the attractor when m is small. When m is large, prediction indicators can vanish because of the scarcity of phase points in phase space. A method for overcoming the cut-off effect ( m > 4) is proposed. Third, for heavy rains, precipitable water is more sensitive to the prediction validity period than temperature or geopotential height; however, for hurricanes, geopotential height is most sensitive, followed by precipitable water.
Studi Model Benchmark Mcnp6 Dalam Perhitungan Reaktivitas Batang Kendali Htr-10
Jupiter S.Pane, Zuhair, Suwoto, Putranto Ilham Yazid
2016-01-01
STUDI MODEL BENCHMARK MCNP6 DALAM PERHITUNGAN REAKTIVITAS BATANG KENDALI HTR-10. Dalam operasi reaktor nuklir, sistem batang kendali memainkan peranan yang sangat penting karena didesain untuk mengendalikan reaktivitas teras dan memadamkan reaktor. Nilai reaktivitas batang kendali harus diprediksi secara akurat melalui eksperimen dan perhitungan. Makalah ini mendiskusikan model Benchmark dalam perhitungan reaktivitas batang kendali reaktor HTR-10. Perhitungan dikerjakan dengan program transpo...
A New Integrated Weighted Model in SNOW-V10: Verification of Categorical Variables
Huang, Laura X.; Isaac, George A.; Sheng, Grant
2014-01-01
This paper presents the verification results for nowcasts of seven categorical variables from an integrated weighted model (INTW) and the underlying numerical weather prediction (NWP) models. Nowcasting, or short range forecasting (0-6 h), over complex terrain with sufficient accuracy is highly desirable but a very challenging task. A weighting, evaluation, bias correction and integration system (WEBIS) for generating nowcasts by integrating NWP forecasts and high frequency observations was used during the Vancouver 2010 Olympic and Paralympic Winter Games as part of the Science of Nowcasting Olympic Weather for Vancouver 2010 (SNOW-V10) project. Forecast data from Canadian high-resolution deterministic NWP system with three nested grids (at 15-, 2.5- and 1-km horizontal grid-spacing) were selected as background gridded data for generating the integrated nowcasts. Seven forecast variables of temperature, relative humidity, wind speed, wind gust, visibility, ceiling and precipitation rate are treated as categorical variables for verifying the integrated weighted forecasts. By analyzing the verification of forecasts from INTW and the NWP models among 15 sites, the integrated weighted model was found to produce more accurate forecasts for the 7 selected forecast variables, regardless of location. This is based on the multi-categorical Heidke skill scores for the test period 12 February to 21 March 2010.
International Nuclear Information System (INIS)
1993-07-01
The Accelerator System Model (ASM) is a computer program developed to model proton radiofrequency accelerators and to carry out system level trade studies. The ASM FORTRAN subroutines are incorporated into an intuitive graphical user interface which provides for the open-quotes constructionclose quotes of the accelerator in a window on the computer screen. The interface is based on the Shell for Particle Accelerator Related Codes (SPARC) software technology written for the Macintosh operating system in the C programming language. This User Manual describes the operation and use of the ASM application within the SPARC interface. The Appendix provides a detailed description of the physics and engineering models used in ASM. ASM Version 1.0 is joint project of G. H. Gillespie Associates, Inc. and the Accelerator Technology (AT) Division of the Los Alamos National Laboratory. Neither the ASM Version 1.0 software nor this ASM Documentation may be reproduced without the expressed written consent of both the Los Alamos National Laboratory and G. H. Gillespie Associates, Inc
Probes of Yukawa unification in supersymmetric SO(10) models
Energy Technology Data Exchange (ETDEWEB)
Westhoff, Susanne
2009-10-23
This work is composed as follows: In Chapter 1, the disposed reader is made familiar with the foundations of flavourphysics and Grand Unification, including group-theoretical aspects of SO(10). In Chapter 2, we introduce a specific supersymmetric GUT model based on SO(10) and designed to probe down-quark-lepton Yukawa unification. Within this framework we explore the effects of large atmospheric neutrino mixing in bottom-strange transitions on the mass difference and CP phase in B{sub s}- anti B{sub s} meson mixing. Chapter 3 is devoted to corrections to Yukawa unification. We derive constraints on Yukawa corrections for light fermions from K- anti K and B{sub d}- anti B {sub d} mixing. As an application we study implications of neutrino mixing effects in CP-violating K and B{sub d} observables on the unitrity triangle. Finally, in Chapter 4, we discuss effects of large tan {beta} in B{yields}(D){tau}{nu} decays with respect to their potential to discover charged Higgs bosons and to discriminate between different GUT models of flavour.
Renormalization group running of fermion observables in an extended non-supersymmetric SO(10) model
Energy Technology Data Exchange (ETDEWEB)
Meloni, Davide [Dipartimento di Matematica e Fisica, Università di Roma Tre,Via della Vasca Navale 84, 00146 Rome (Italy); Ohlsson, Tommy; Riad, Stella [Department of Physics, School of Engineering Sciences,KTH Royal Institute of Technology - AlbaNova University Center,Roslagstullsbacken 21, 106 91 Stockholm (Sweden)
2017-03-08
We investigate the renormalization group evolution of fermion masses, mixings and quartic scalar Higgs self-couplings in an extended non-supersymmetric SO(10) model, where the Higgs sector contains the 10{sub H}, 120{sub H}, and 126{sub H} representations. The group SO(10) is spontaneously broken at the GUT scale to the Pati-Salam group and subsequently to the Standard Model (SM) at an intermediate scale M{sub I}. We explicitly take into account the effects of the change of gauge groups in the evolution. In particular, we derive the renormalization group equations for the different Yukawa couplings. We find that the computed physical fermion observables can be successfully matched to the experimental measured values at the electroweak scale. Using the same Yukawa couplings at the GUT scale, the measured values of the fermion observables cannot be reproduced with a SM-like evolution, leading to differences in the numerical values up to around 80%. Furthermore, a similar evolution can be performed for a minimal SO(10) model, where the Higgs sector consists of the 10{sub H} and 126{sub H} representations only, showing an equally good potential to describe the low-energy fermion observables. Finally, for both the extended and the minimal SO(10) models, we present predictions for the three Dirac and Majorana CP-violating phases as well as three effective neutrino mass parameters.
Modelling street level PM10 concentrations across Europe: source apportionment and possible futures
Kiesewetter, G.; Borken-Kleefeld, J.; Schöpp, W.; Heyes, C.; Thunis, P.; Bessagnet, B.; Terrenoire, E.; Fagerli, H.; Nyiri, A.; Amann, M.
2015-02-01
Despite increasing emission controls, particulate matter (PM) has remained a critical issue for European air quality in recent years. The various sources of PM, both from primary particulate emissions as well as secondary formation from precursor gases, make this a complex problem to tackle. In order to allow for credible predictions of future concentrations under policy assumptions, a modelling approach is needed that considers all chemical processes and spatial dimensions involved, from long-range transport of pollution to local emissions in street canyons. Here we describe a modelling scheme which has been implemented in the GAINS integrated assessment model to assess compliance with PM10 (PM with aerodynamic diameter dispersion calculations, and a traffic increment calculation wherever applicable. At each monitoring station fulfilling a few data coverage criteria, measured concentrations in the base year 2009 are explained to the extent possible and then modelled for the past and future. More than 1850 monitoring stations are covered, including more than 300 traffic stations and 80% of the stations which exceeded the EU air quality limit values in 2009. As a validation, we compare modelled trends in the period 2000-2008 to observations, which are well reproduced. The modelling scheme is applied here to quantify explicitly source contributions to ambient concentrations at several critical monitoring stations, displaying the differences in spatial origin and chemical composition of urban roadside PM10 across Europe. Furthermore, we analyse the predicted evolution of PM10 concentrations in the European Union until 2030 under different policy scenarios. Significant improvements in ambient PM10 concentrations are expected assuming successful implementation of already agreed legislation; however, these will not be large enough to ensure attainment of PM10 limit values in hot spot locations such as Southern Poland and major European cities. Remaining issues are
Deracemization of Secondary Alcohols by using a Single Alcohol Dehydrogenase
Karume, Ibrahim
2016-03-01
© 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. We developed a single-enzyme-mediated two-step approach for deracemization of secondary alcohols. A single mutant of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase enables the nonstereoselective oxidation of racemic alcohols to ketones, followed by a stereoselective reduction process. Varying the amounts of acetone and 2-propanol cosubstrates controls the stereoselectivities of the consecutive oxidation and reduction reactions, respectively. We used one enzyme to accomplish the deracemization of secondary alcohols with up to >99% ee and >99.5% recovery in one pot and without the need to isolate the prochiral ketone intermediate.
Land Surface Model (LSM 1.0) for Ecological, Hydrological, Atmospheric Studies
National Aeronautics and Space Administration — The NCAR LSM 1.0 is a land surface model developed to examine biogeophysical and biogeochemical land-atmosphere interactions, especially the effects of land surfaces...
Geant4.10 simulation of geometric model for metaphase chromosome
Energy Technology Data Exchange (ETDEWEB)
Rafat-Motavalli, L., E-mail: rafat@um.ac.ir; Miri-Hakimabad, H.; Bakhtiyari, E.
2016-04-01
In this paper, a geometric model of metaphase chromosome is explained. The model is constructed according to the packing ratio and dimension of the structure from nucleosome up to chromosome. A B-DNA base pair is used to construct 200 base pairs of nucleosomes. Each chromatin fiber loop, which is the unit of repeat, has 49,200 bp. This geometry is entered in Geant4.10 Monte Carlo simulation toolkit and can be extended to the whole metaphase chromosomes and any application in which a DNA geometrical model is needed. The chromosome base pairs, chromosome length, and relative length of chromosomes are calculated. The calculated relative length is compared to the relative length of human chromosomes.
Geant4.10 simulation of geometric model for metaphase chromosome
International Nuclear Information System (INIS)
Rafat-Motavalli, L.; Miri-Hakimabad, H.; Bakhtiyari, E.
2016-01-01
In this paper, a geometric model of metaphase chromosome is explained. The model is constructed according to the packing ratio and dimension of the structure from nucleosome up to chromosome. A B-DNA base pair is used to construct 200 base pairs of nucleosomes. Each chromatin fiber loop, which is the unit of repeat, has 49,200 bp. This geometry is entered in Geant4.10 Monte Carlo simulation toolkit and can be extended to the whole metaphase chromosomes and any application in which a DNA geometrical model is needed. The chromosome base pairs, chromosome length, and relative length of chromosomes are calculated. The calculated relative length is compared to the relative length of human chromosomes.
Goyal, Radha; Khare, Mukesh
2011-05-01
Assessment of indoor air quality (IAQ) in classrooms of school buildings is of prime concern due to its potential effects on student's health and performance as they spend a substantial amount of their time (6-7 h per day) in schools. A number of airborne contaminants may be present in urban school environment. However, respirable suspended particulate matter (RSPM) is of great significance as they may significantly affect occupants' health. The objectives of the present study are twofold, one, to measure the concentrations of PM(10) (building located near a heavy-traffic roadway (9,755 and 4,296 vehicles/hour during weekdays and weekends, respectively); and second, to develop single compartment mass balance-based IAQ models for PM(10) (NVIAQM(pm10)), PM(2.5) (NVIAQM(pm2.5)), and PM(1.0) (NVIAQM(pm1.0)) for predicting their indoor concentrations. Outdoor RSPM levels and classroom characteristics, such as size, occupancy level, temperature, relative humidity, and CO(2) concentrations have also been monitored during school hours. Predicted indoor PM(10) concentrations show poor correlations with observed indoor PM(10) concentrations (R (2) = 0.028 for weekdays, and 0.47 for weekends). However, a fair degree of agreement (d) has been found between observed and predicted concentrations, i.e., 0.42 for weekdays and 0.59 for weekends. Furthermore, NVIAQM(pm2.5) and NVIAQM(pm1.0) results show good correlations with observed concentrations of PM(2.5) (R(2) = 0.87 for weekdays and 0.9 for weekends) and PM(1.0) (R(2) = 0.86 for weekdays and 0.87 for weekends). NVIAQM(pm10) shows the tendency to underpredict indoor PM(10) concentrations during weekdays as it does not take into account the occupant's activities and its effects on the indoor concentrations during the class hours. Intense occupant's activities cause resuspension or delayed deposition of PM(10). The model results further suggests conductance of experimental and physical simulation studies on dispersion of
Regression trees modeling and forecasting of PM10 air pollution in urban areas
Stoimenova, M.; Voynikova, D.; Ivanov, A.; Gocheva-Ilieva, S.; Iliev, I.
2017-10-01
Fine particulate matter (PM10) air pollution is a serious problem affecting the health of the population in many Bulgarian cities. As an example, the object of this study is the pollution with PM10 of the town of Pleven, Northern Bulgaria. The measured concentrations of this air pollutant for this city consistently exceeded the permissible limits set by European and national legislation. Based on data for the last 6 years (2011-2016), the analysis shows that this applies both to the daily limit of 50 micrograms per cubic meter and the allowable number of daily concentration exceedances to 35 per year. Also, the average annual concentration of PM10 exceeded the prescribed norm of no more than 40 micrograms per cubic meter. The aim of this work is to build high performance mathematical models for effective prediction and forecasting the level of PM10 pollution. The study was conducted with the powerful flexible data mining technique Classification and Regression Trees (CART). The values of PM10 were fitted with respect to meteorological data such as maximum and minimum air temperature, relative humidity, wind speed and direction and others, as well as with time and autoregressive variables. As a result the obtained CART models demonstrate high predictive ability and fit the actual data with up to 80%. The best models were applied for forecasting the level pollution for 3 to 7 days ahead. An interpretation of the modeling results is presented.
Loder, Andrew J; Zeldes, Benjamin M; Garrison, G Dale; Lipscomb, Gina L; Adams, Michael W W; Kelly, Robert M
2015-10-01
n-Butanol is generated as a natural product of metabolism by several microorganisms, but almost all grow at mesophilic temperatures. A synthetic pathway for n-butanol production from acetyl coenzyme A (acetyl-CoA) that functioned at 70°C was assembled in vitro from enzymes recruited from thermophilic bacteria to inform efforts for engineering butanol production into thermophilic hosts. Recombinant versions of eight thermophilic enzymes (β-ketothiolase [Thl], 3-hydroxybutyryl-CoA dehydrogenase [Hbd], and 3-hydroxybutyryl-CoA dehydratase [Crt] from Caldanaerobacter subterraneus subsp. tengcongensis; trans-2-enoyl-CoA reductase [Ter] from Spirochaeta thermophila; bifunctional acetaldehyde dehydrogenase/alcohol dehydrogenase [AdhE] from Clostridium thermocellum; and AdhE, aldehyde dehydrogenase [Bad], and butanol dehydrogenase [Bdh] from Thermoanaerobacter sp. strain X514) were utilized to examine three possible pathways for n-butanol. These pathways differed in the two steps required to convert butyryl-CoA to n-butanol: Thl-Hbd-Crt-Ter-AdhE (C. thermocellum), Thl-Hbd-Crt-Ter-AdhE (Thermoanaerobacter X514), and Thl-Hbd-Crt-Ter-Bad-Bdh. n-Butanol was produced at 70°C, but with different amounts of ethanol as a coproduct, because of the broad substrate specificities of AdhE, Bad, and Bdh. A reaction kinetics model, validated via comparison to in vitro experiments, was used to determine relative enzyme ratios needed to maximize n-butanol production. By using large relative amounts of Thl and Hbd and small amounts of Bad and Bdh, >70% conversion to n-butanol was observed in vitro, but with a 60% decrease in the predicted pathway flux. With more-selective hypothetical versions of Bad and Bdh, >70% conversion to n-butanol is predicted, with a 19% increase in pathway flux. Thus, more-selective thermophilic versions of Bad, Bdh, and AdhE are needed to fully exploit biocatalytic n-butanol production at elevated temperatures. Copyright © 2015, American Society for
Ng, Kar Yong; Awang, Norhashidah
2018-01-06
Frequent haze occurrences in Malaysia have made the management of PM 10 (particulate matter with aerodynamic less than 10 μm) pollution a critical task. This requires knowledge on factors associating with PM 10 variation and good forecast of PM 10 concentrations. Hence, this paper demonstrates the prediction of 1-day-ahead daily average PM 10 concentrations based on predictor variables including meteorological parameters and gaseous pollutants. Three different models were built. They were multiple linear regression (MLR) model with lagged predictor variables (MLR1), MLR model with lagged predictor variables and PM 10 concentrations (MLR2) and regression with time series error (RTSE) model. The findings revealed that humidity, temperature, wind speed, wind direction, carbon monoxide and ozone were the main factors explaining the PM 10 variation in Peninsular Malaysia. Comparison among the three models showed that MLR2 model was on a same level with RTSE model in terms of forecasting accuracy, while MLR1 model was the worst.
Simpkin, W. E.
1982-01-01
An approximately 0.25 scale model of the transition section of a tandem fan variable cycle engine nacelle was tested in the NASA Lewis Research Center 10-by-10 foot wind tunnel. Two 12-inch, tip-turbine driven fans were used to simulate a tandem fan engine. Three testing modes simulated a V/STOL tandem fan airplane. Parallel mode has two separate propulsion streams for maximum low speed performance. A front inlet, fan, and downward vectorable nozzle forms one stream. An auxilliary top inlet provides air to the aft fan - supplying the core engine and aft vectorable nozzle. Front nozzle and top inlet closure, and removal of a blocker door separating the two streams configures the tandem fan for series mode operations as a typical aircraft propulsion system. Transition mode operation is formed by intermediate settings of the front nozzle, blocker door, and top inlet. Emphasis was on the total pressure recovery and flow distortion at the aft fan face. A range of fan flow rates were tested at tunnel airspeeds from 0 to 240 knots, and angles-of-attack from -10 to 40 deg for all three modes. In addition to the model variables for the three modes, model variants of the top inlet were tested in the parallel mode only. These lip variables were: aft lip boundary layer bleed holes, and Three position turning vane. Also a bellmouth extension of the top inlet side lips was tested in parallel mode.
Energy Technology Data Exchange (ETDEWEB)
Lynd, Lee R. [Dartmouth College, Thayer School of Engineering; Guss, Adam M. [ORNL; Himmel, Mike [National Renewable Energy Laboratory (NREL); Beri, Dhananjay [Dartmouth College, Thayer School of Engineering; Herring, Christopher [Mascoma Corporation; Holwerda, Evert [Dartmouth College, Thayer School of Engineering; Murphy, Sean J. [Dartmouth College, Thayer School of Engineering; Olson, Daniel G. [Dartmouth College, Thayer School of Engineering; Paye, Julie [Dartmouth College, Thayer School of Engineering; Rydzak, Thomas [ORNL; Shao, Xiongjun [Dartmouth College, Thayer School of Engineering; Tian, Liang [Dartmouth College, Thayer School of Engineering; Worthen, Robert [Dartmouth College, Thayer School of Engineering
2016-11-01
Recent advances are addressed pertaining to consolidated bioprocessing (CBP) of plant cell walls to ethanol using two thermophilic, saccharolytic bacteria: the cellulose-fermenting Clostridium thermocellum and the hemicellulose- fermenting ermoanaerobacterium saccharolyticum. On the basis of the largest comparative dataset assembled to date, it appears that C. thermocellum is substantially more effective at solubilizing unpretreated plant cell walls than industry-standard fungal cellulase, and that this is particularly the case for more recalcitrant feedstocks. e distinctive central metabolism of C. thermocellum appears to involve more extensive energy coupling (e.g., on the order of 5 ATP per glucosyl moiety) than most fermentative anaerobes. Ethanol yields and titers realized by engineered strains of T. saccharolyticum meet standards for industrial feasibility and provide an important proof of concept as well as a model that may be emulated in other organisms. Progress has also been made with C. thermocellum, although not yet to this extent. e current state of strain development is summarized and outstanding challenges for commercial application are discussed. We speculate that CBP organism development is more promising starting with naturally occurring cellulolytic microbes as compared to starting with noncellulolytic hosts.
Protein structure modeling for CASP10 by multiple layers of global optimization.
Joo, Keehyoung; Lee, Juyong; Sim, Sangjin; Lee, Sun Young; Lee, Kiho; Heo, Seungryong; Lee, In-Ho; Lee, Sung Jong; Lee, Jooyoung
2014-02-01
In the template-based modeling (TBM) category of CASP10 experiment, we introduced a new protocol called protein modeling system (PMS) to generate accurate protein structures in terms of side-chains as well as backbone trace. In the new protocol, a global optimization algorithm, called conformational space annealing (CSA), is applied to the three layers of TBM procedure: multiple sequence-structure alignment, 3D chain building, and side-chain re-modeling. For 3D chain building, we developed a new energy function which includes new distance restraint terms of Lorentzian type (derived from multiple templates), and new energy terms that combine (physical) energy terms such as dynamic fragment assembly (DFA) energy, DFIRE statistical potential energy, hydrogen bonding term, etc. These physical energy terms are expected to guide the structure modeling especially for loop regions where no template structures are available. In addition, we developed a new quality assessment method based on random forest machine learning algorithm to screen templates, multiple alignments, and final models. For TBM targets of CASP10, we find that, due to the combination of three stages of CSA global optimizations and quality assessment, the modeling accuracy of PMS improves at each additional stage of the protocol. It is especially noteworthy that the side-chains of the final PMS models are far more accurate than the models in the intermediate steps. Copyright © 2013 Wiley Periodicals, Inc.
Ten dimensional SO(10) G.U.T. models with dynamical symmetry breaking
International Nuclear Information System (INIS)
Hanlon, B.E.; Joshi, G.C.
1993-01-01
To date, considerations on SO (10) models within Coset Space Dimensional Reduction (CSDR) have been diagonalized to the standard model or rely upon imaginative applications of Wilson lines so as to avoid the problem of the nonexistence of an intermediate Higgs mechanism. However, there is an alternative approach involving four fermion condensates, breaking symmetries by a dynamical mechanism. Indeed, dynamical symmetry breaking has been the direction taken in some SU(5) models within this framework in order to avoid the problems of electroweak symmetry breaking at the compactification scale. This paper presents realistic models which utilize this mechanism. It is shown that the appropriate fermionic representations can emerge from CSDR and the construction of such condensates within the constraints of this scheme is presented. By introducing discrete symmetries onto the internal manifold a strong breaking of the SO(10) G.U.T. is produced and, more importantly, eliminate Higgs fields of geometrical origin. 31 refs
Development and validation of a 10-year-old child ligamentous cervical spine finite element model.
Dong, Liqiang; Li, Guangyao; Mao, Haojie; Marek, Stanley; Yang, King H
2013-12-01
Although a number of finite element (FE) adult cervical spine models have been developed to understand the injury mechanisms of the neck in automotive related crash scenarios, there have been fewer efforts to develop a child neck model. In this study, a 10-year-old ligamentous cervical spine FE model was developed for application in the improvement of pediatric safety related to motor vehicle crashes. The model geometry was obtained from medical scans and meshed using a multi-block approach. Appropriate properties based on review of literature in conjunction with scaling were assigned to different parts of the model. Child tensile force-deformation data in three segments, Occipital-C2 (C0-C2), C4-C5 and C6-C7, were used to validate the cervical spine model and predict failure forces and displacements. Design of computer experiments was performed to determine failure properties for intervertebral discs and ligaments needed to set up the FE model. The model-predicted ultimate displacements and forces were within the experimental range. The cervical spine FE model was validated in flexion and extension against the child experimental data in three segments, C0-C2, C4-C5 and C6-C7. Other model predictions were found to be consistent with the experimental responses scaled from adult data. The whole cervical spine model was also validated in tension, flexion and extension against the child experimental data. This study provided methods for developing a child ligamentous cervical spine FE model and to predict soft tissue failures in tension.
Assessing soil fluxes using meteoric 10Be: development and application of the Be2D model
Campforts, Benjamin; Govers, Gerard; Vanacker, Veerle; Baken, Stijn; Smolders, Erik; Vanderborght, Jan
2015-04-01
Meteoric 10Be is a promising and increasingly popular tool to better understand soil fluxes at different timescales. Unlike other, more classical, methods such as the study of sedimentary archives it enables a direct coupling between eroding and deposition sites. However, meteoric 10Be can be mobilized within the soil. Therefore, spatial variations in meteoric 10Be inventories cannot directly be translated into spatial variations in erosion and sedimentation rates: a correct interpretation of measured 10Be inventories requires that both lateral and vertical movement of meteoric 10Be are accounted for. Here, we present a spatially explicit 2D model that allows to simulate the behaviour of meteoric 10Be in the soil system over timescales of up to 1 million year and use the model to investigate the impact of accelerated erosion on meteoric 10Be inventories. The model consists of two parts. A first component deals with advective and diffusive mobility within the soil profile, whereas a second component describes lateral soil (and meteoric 10Be) fluxes over the hillslope. Soil depth is calculated dynamically, accounting for soil production through weathering and lateral soil fluxes. Different types of erosion such as creep, water and tillage erosion are supported. Model runs show that natural soil fluxes can be well reconstructed based on meteoric 10Be inventories, and this for a wide range of geomorphological and pedological conditions. However, extracting signals of human impact and distinguishing them from natural soil fluxes is only feasible when the soil has a rather high retention capacity so that meteoric 10Be is retained in the top soil layer. Application of the Be2D model to an existing data set in the Appalachian Mountains [West et al.,2013] using realistic parameter values for the soil retention capacity as well as for vertical advection resulted in a good agreement between simulated and observed 10Be inventories. This confirms the robustness of the model. We
Energy Technology Data Exchange (ETDEWEB)
NONE
1993-07-01
The Accelerator System Model (ASM) is a computer program developed to model proton radiofrequency accelerators and to carry out system level trade studies. The ASM FORTRAN subroutines are incorporated into an intuitive graphical user interface which provides for the {open_quotes}construction{close_quotes} of the accelerator in a window on the computer screen. The interface is based on the Shell for Particle Accelerator Related Codes (SPARC) software technology written for the Macintosh operating system in the C programming language. This User Manual describes the operation and use of the ASM application within the SPARC interface. The Appendix provides a detailed description of the physics and engineering models used in ASM. ASM Version 1.0 is joint project of G. H. Gillespie Associates, Inc. and the Accelerator Technology (AT) Division of the Los Alamos National Laboratory. Neither the ASM Version 1.0 software nor this ASM Documentation may be reproduced without the expressed written consent of both the Los Alamos National Laboratory and G. H. Gillespie Associates, Inc.
Gauge hierarchy in an SO(10) supersymmetric grand unified model
International Nuclear Information System (INIS)
Zhiyong, Z.
1982-01-01
An SO(10) supersymmetric grand unified model is constructed in which the gauge hierarchy problem may be solved. Using Higgs superfields belonging to the SO(10) representations 16, 10 and 54, it is found that if SO(10) is broken down to SU(3)sub(c)xSU(2)sub(L)xU(1) via SO(6)xSO(4)approximately equal to SU(4)sub(c)xSU(2)sub(L)xSU(2)sub(R) at unification mass scales without supersymmetry breaking, the gauge hierarchy puzzle might be carried away. It is also shown that the colour-triplet Higgs, which mediates proton decay, is superheavy by an incredibly accurate, but 'natural' adjustment of parameters in the potential. (author)
Gravity model improvement using GEOS 3 /GEM 9 and 10/. [and Seasat altimetry data
Lerch, F. J.; Wagner, C. A.; Klosko, S. M.; Laubscher, R. E.
1979-01-01
Although errors in previous gravity models have produced large uncertainties in the orbital position of GEOS 3, significant improvement has been obtained with new geopotential solutions, Goddard Earth Model (GEM) 9 and 10. The GEM 9 and 10 solutions for the potential coefficients and station coordinates are presented along with a discussion of the new techniques employed. Also presented and discussed are solutions for three fundamental geodetic reference parameters, viz. the mean radius of the earth, the gravitational constant, and mean equatorial gravity. Evaluation of the gravity field is examined together with evaluation of GEM 9 and 10 for orbit determination accuracy. The major objectives of GEM 9 and 10 are achieved. GEOS 3 orbital accuracies from these models are about 1 m in their radial components for 5-day arc lengths. Both models yield significantly improved results over GEM solutions when compared to surface gravimetry, Skylab and GEOS 3 altimetry, and highly accurate BE-C (Beacon Explorer-C) laser ranges. The new values of the parameters discussed are given.
Vionnet, V.; Guyomarc'h, G.; Naaim Bouvet, F.; Martin, E.; Durand, Y.; Bellot, H.; Bel, C.; Puglièse, P.
2013-05-01
Blowing snow events control the evolution of the snow pack in mountainous areas and cause inhomogeneous snow distribution. The goal of this study is to identify the main features of blowing snow events at an alpine site and assess the ability of the detailed snowpack model Crocus to reproduce the occurrence of these events in a 1D configuration. We created a database of blowing snow events observed over 10 years at our experimental site. Occurrences of blowing snow events were divided into cases with and without concurrent falling snow. Overall, snow transport is observed during 10.5% of the time in winter and occurs with concurrent falling snow 37.3% of the time. Wind speed and snow age control the frequency of occurrence. Model results illustrate the necessity of taking the wind-dependence of falling snow grain characteristics into account to simulate periods of snow transport and mass fluxes satisfactorily during those periods. The high rate of false alarms produced by the model is investigated in detail for winter 2010/2011 using measurements from snow particle counters.
Hu, Yi-Chun; Chen, Su-Ru; Chen, I-Hui; Shen, Hsi-Che; Lin, Yen-Kuang; Chang, Wen-Yin
2015-06-01
Preparing new graduate nurses (NGNs) to achieve standards of nursing competence is challenging; therefore, this study developed and evaluated the effects of a 10-minute preceptor (10MP) model for assisting NGNs in their professional development and increasing their retention in hospitals. A repeated-measures design study, with an intervention and a two-group comparison, was conducted. A total of 107 NGNs participated in the study. At day 7, work stress and work experience were moderately high for the NGNs in both the 10MP and traditional preceptor model (TPM) groups. The preceptorship program showed significant differences between groups (p = 0.001) regarding work stress at months 2 and 3 and work experience at months 1, 2, and 3. The 10MP group reported lower turnover intention and higher satisfaction with the preceptors than the TPM group. The 10MP model is effective at improving training outcomes and facilitating the professional development of NGNs. Copyright 2015, SLACK Incorporated.
Displaced calibration of PM10 measurements using spatio-temporal models
Directory of Open Access Journals (Sweden)
Daniela Cocchi
2007-12-01
Full Text Available PM10 monitoring networks are equipped with heterogeneous samplers. Some of these samplers are known to underestimate true levels of concentrations (non-reference samplers. In this paper we propose a hierarchical spatio-temporal Bayesian model for the calibration of measurements recorded using non-reference samplers, by borrowing strength from non co-located reference sampler measurements.
Ağaç, Kübra; Koçak, Kasım; Deniz, Ali
2015-04-01
A time series approach using autoregressive model (AR), moving average model (MA) and seasonal autoregressive integrated moving average model (SARIMA) were used in this study to simulate and forecast daily PM10 concentrations in Kagithane Creek Valley, Istanbul. Hourly PM10 concentrations have been measured in Kagithane Creek Valley between 2010 and 2014 periods. Bosphorus divides the city in two parts as European and Asian parts. The historical part of the city takes place in Golden Horn. Our study area Kagithane Creek Valley is connected with this historical part. The study area is highly polluted because of its topographical structure and industrial activities. Also population density is extremely high in this site. The dispersion conditions are highly poor in this creek valley so it is necessary to calculate PM10 levels for air quality and human health. For given period there were some missing PM10 concentration values so to make an accurate calculations and to obtain exact results gap filling method was applied by Singular Spectrum Analysis (SSA). SSA is a new and efficient method for gap filling and it is an state-of-art modeling. SSA-MTM Toolkit was used for our study. SSA is considered as a noise reduction algorithm because it decomposes an original time series to trend (if exists), oscillatory and noise components by way of a singular value decomposition. The basic SSA algorithm has stages of decomposition and reconstruction. For given period daily and monthly PM10 concentrations were calculated and episodic periods are determined. Long term and short term PM10 concentrations were analyzed according to European Union (EU) standards. For simulation and forecasting of high level PM10 concentrations, meteorological data (wind speed, pressure and temperature) were used to see the relationship between daily PM10 concentrations. Fast Fourier Transformation (FFT) was also applied to the data to see the periodicity and according to these periods models were built
DEVELOPING INDUSTRIAL ROBOT SIMULATION MODEL TUR10-K USING “UNIVERSAL MECHANISM” SOFTWARE COMPLEX
Directory of Open Access Journals (Sweden)
Vadim Vladimirovich Chirkov
2018-02-01
Full Text Available Manipulation robots are complex spatial mechanical systems having five or six degrees of freedom, and sometimes more. For this reason, modeling manipulative robots movement, even in the kinematic formulation, is a complex mathematical task. If one moves from kinematic modeling of motion to dynamic modeling then there must be taken into account the inertial properties of the modeling object. In this case, analytical constructing of such a complex object mathematical model as a manipulation robot becomes practically impossible. Therefore, special computer-aided design systems, called CAE-systems, are used for modeling complex mechanical systems. The purpose of the paper is simulation model construction of a complex mechanical system, such as the industrial robot TUR10-K, to obtain its dynamic characteristics. Developing such models makes it possible to reduce the complexity of designing complex systems process and to obtain the necessary characteristics. Purpose. Developing the simulation model of the industrial robot TUR10-K and obtaining dynamic characteristics of the mechanism. Methodology: the article is used a computer simulation method. Results: There is obtained the simulation model of the robot and its dynamic characteristics. Practical implications: the results can be used in the mechanical systems design and various simulation models.
Rashighi, Mehdi; Agarwal, Priti; Richmond, Jillian M; Harris, Tajie H; Dresser, Karen; Su, Mingwan; Zhou, Youwen; Deng, April; Hunter, Chris A; Luster, Andrew D; Harris, John E
2014-01-01
Vitiligo is an autoimmune disease of the skin that results in disfiguring white spots. There are no FDA-approved treatments for vitiligo, and most off-label treatments yield unsatisfactory results. Vitiligo patients have increased numbers of autoreactive, melanocyte-specific CD8+ T cells in the skin and blood, which are directly responsible for melanocyte destruction. Here we report that gene expression in lesional skin from vitiligo patients reveals an IFN-γ-specific signature, including the chemokine CXCL10. CXCL10 is elevated in both vitiligo patient skin and serum and CXCR3, its receptor, is expressed on pathogenic T cells. To address the function of CXCL10 in vitiligo, we employed a mouse model of disease that also exhibits an IFN-γ-specific gene signature, expression of CXCL10 in the skin, and upregulation of CXCR3 on antigen-specific T cells. Mice that receive Cxcr3−/− T cells develop minimal depigmentation, as do mice lacking Cxcl10 or treated with CXCL10 neutralizing antibody. CXCL9 promotes autoreactive T cell global recruitment to the skin but not effector function while, in contrast, CXCL10 is required for effector function and localization within the skin. Surprisingly, CXCL10 neutralization in mice with established, widespread depigmentation induces reversal of disease, evidenced by repigmentation. These data identify a critical role for CXCL10 in both the progression and maintenance of vitiligo, and thereby support inhibiting CXCL10 as a targeted treatment strategy. PMID:24523323
Kobayashi, Kenichiro; Otsuka, Shigenori; Apip; Saito, Kazuo
2016-08-01
This paper presents a study on short-term ensemble flood forecasting specifically for small dam catchments in Japan. Numerical ensemble simulations of rainfall from the Japan Meteorological Agency nonhydrostatic model (JMA-NHM) are used as the input data to a rainfall-runoff model for predicting river discharge into a dam. The ensemble weather simulations use a conventional 10 km and a high-resolution 2 km spatial resolutions. A distributed rainfall-runoff model is constructed for the Kasahori dam catchment (approx. 70 km2) and applied with the ensemble rainfalls. The results show that the hourly maximum and cumulative catchment-average rainfalls of the 2 km resolution JMA-NHM ensemble simulation are more appropriate than the 10 km resolution rainfalls. All the simulated inflows based on the 2 and 10 km rainfalls become larger than the flood discharge of 140 m3 s-1, a threshold value for flood control. The inflows with the 10 km resolution ensemble rainfall are all considerably smaller than the observations, while at least one simulated discharge out of 11 ensemble members with the 2 km resolution rainfalls reproduces the first peak of the inflow at the Kasahori dam with similar amplitude to observations, although there are spatiotemporal lags between simulation and observation. To take positional lags into account of the ensemble discharge simulation, the rainfall distribution in each ensemble member is shifted so that the catchment-averaged cumulative rainfall of the Kasahori dam maximizes. The runoff simulation with the position-shifted rainfalls shows much better results than the original ensemble discharge simulations.
International Nuclear Information System (INIS)
Gu, Pei-Hong
2014-01-01
We propose an SO(10) × SO(10)' model to simultaneously realize a seesaw for Dirac neutrino masses and a leptogenesis for ordinary and dark matter-antimatter asymmetries. A (16 × 1-bar 6-bar ') H scalar crossing the SO(10) and SO(10)' sectors plays an essential role in this seesaw-leptogenesis scenario. As a result of lepton number conservation, the lightest dark nucleon as the dark matter particle should have a determined mass around 15 GeV to explain the comparable fractions of ordinary and dark matter in the present universe. The (16 × 1-bar 6-bar ') H scalar also mediates a U(1) em × U(1)' em kinetic mixing after the ordinary and dark left-right symmetry breaking so that we can expect a dark nucleon scattering in direct detection experiments and/or a dark nucleon decay in indirect detection experiments. Furthermore, we can impose a softly broken mirror symmetry to simplify the parameter choice
Applications of CIVA NDE 10 on Eddy Current Modeling
International Nuclear Information System (INIS)
Nurul Ain Ahmad Latif; Ilham Mukhriz Zainal Abidin; AABdul Razak Hamzah
2011-01-01
CIVA NDE 10 is the simulation software and used as the platform to develop the models dedicated to Eddy Current testing (ET). It has various application in semi analytical modeling approaches. The focus of this paper is to simulate the signals response on the 40 % external groove of the Inconel 600 heat exchanger tubes with outside diameter of 22.22 mm. The inspection were simulated using 17 mm outside diameter differential probe with 100 kHz and 500 kHZ testing frequency. All the simulation results were validated using the experimental results integrated in the CIVA software. The configurations of the probe and tube consisting the flaw show the good agreement between the experimental and the simulated data. (author)
Anaerobic thermophilic culture-system
Energy Technology Data Exchange (ETDEWEB)
Ljungdahl, L G; Wiegel, J K.W.
1981-04-14
A mixed culture system of Thermoanaerobacter ethanolicus and Clostridium thermocellum is employed for anaerobic, thermophilic ethanol fermentation of cellulose. By cellulase action, monosaccharides are formed which inhibit the growth of C. thermocellum, but are fermented by T. ethanolicus. Thus, at a regulated pH-value of 7.5, this mixed culture system of micro organisms results in a cellulose fermentation with a considerably higher ethanol yield.
Energy Technology Data Exchange (ETDEWEB)
Plisson, Christophe, E-mail: Christophe.2.plisson@gsk.com [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Salinas, Cristian [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Weinzimmer, David; Labaree, David; Lin, Shu-Fei; Ding, Yu-Shin [Yale University PET Center, Yale University School of Medicine, PO Box 208048 New Haven, CT (United States); Jakobsen, Steen [Aarhus PET Centre, Aarhus Sygehus, Norrebrogade 44, DK-8000 Aarhus C (Denmark); Smith, Paul W. [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Eiji, Kawanishi [Medicinal Chemistry Research Laboratories II, Research Division, Mitsubishi Tanabe Pharma Corporation, Saitama 335-8505 (Japan); Carson, Richard E. [Yale University PET Center, Yale University School of Medicine, PO Box 208048 New Haven, CT (United States); Gunn, Roger N.; Rabiner, Eugenii A. [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom)
2011-08-15
Introduction: The aim of this study was to evaluate a newly reported positron emission tomography (PET) radioligand [{sup 11}C]MP-10, a potent and selective inhibitor of the central phosphodiesterase 10A enzyme (PDE10A) in vivo, using PET. Methods: A procedure was developed for labeling MP-10 with carbon-11. [{sup 11}C]MP-10 was evaluated in vivo both in the pig and baboon brain. Results: Alkylation of the corresponding desmethyl compound with [{sup 11}C]methyl iodide produced [{sup 11}C]MP-10 with good radiochemical yield and specific activity. PET studies in the pig showed that [{sup 11}C]MP-10 rapidly entered the brain reaching peak tissue concentration at 1-2 min postadministration, followed by washout from the tissue. Administration of a selective PDE10A inhibitor reduced the binding in all brain regions to the levels of the cerebellum, demonstrating the saturability and selectivity of [{sup 11}C]MP-10 binding. In the nonhuman primate, the brain tissue kinetics of [{sup 11}C]MP-10 were slower, reaching peak tissue concentrations at 30-60 min postadministration. In both species, the observed rank order of regional brain signal was striatum>diencephalon>cortical regions=cerebellum, consistent with the known distribution and concentration of PDE10A. [{sup 11}C]MP-10 brain kinetics were well described by a two-tissue compartment model, and estimates of total volume of distribution (V{sub T}) were obtained. Blocking studies with unlabeled MP-10 revealed the suitability of the cerebellum as a reference tissue and enabled the estimation of regional binding potential (BP{sub ND}) as the outcome measure of specific binding. Quantification of [{sup 11}C]MP-10 binding using the simplified reference tissue model with cerebellar input function produced BP{sub ND} estimates consistent with those obtained by the two-tissue compartment model. Conclusion: We demonstrated that [{sup 11}C]MP-10 possesses good characteristics for the in vivo quantification of the PDE10A in the
Callén, M S; Iturmendi, A; López, J M; Mastral, A M
2014-02-01
In order to perform a study of the carcinogenic potential of polycyclic aromatic hydrocarbons (PAH), benzo(a)pyrene equivalent (BaP-eq) concentration was calculated and modelled by a receptor model based on positive matrix factorization (PMF). Nineteen PAH associated to airborne PM10 of Zaragoza, Spain, were quantified during the sampling period 2001-2009 and used as potential variables by the PMF model. Afterwards, multiple linear regression analysis was used to quantify the potential sources of BaP-eq. Five sources were obtained as the optimal solution and vehicular emission was identified as the main carcinogenic source (35 %) followed by heavy-duty vehicles (28 %), light-oil combustion (18 %), natural gas (10 %) and coal combustion (9 %). Two of the most prevailing directions contributing to this carcinogenic character were the NE and N directions associated with a highway, industrial parks and a paper factory. The lifetime lung cancer risk exceeded the unit risk of 8.7 x 10(-5) per ng/m(3) BaP in both winter and autumn seasons and the most contributing source was the vehicular emission factor becoming an important issue in control strategies.
Directory of Open Access Journals (Sweden)
Cynthia Van der Hauwaert
Full Text Available Renal proximal tubular epithelial cells play a central role in renal physiology and are among the cell types most sensitive to ischemia and xenobiotic nephrotoxicity. In order to investigate the molecular and cellular mechanisms underlying the pathophysiology of kidney injuries, a stable and well-characterized primary culture model of proximal tubular cells is required. An existing model of proximal tubular cells is hampered by the cellular heterogeneity of kidney; a method based on cell sorting for specific markers must therefore be developed. In this study, we present a primary culture model based on the mechanical and enzymatic dissociation of healthy tissue obtained from nephrectomy specimens. Renal epithelial cells were sorted using co-labeling for CD10 and CD13, two renal proximal tubular epithelial markers, by flow cytometry. Their purity, phenotypic stability and functional properties were evaluated over several passages. Our results demonstrate that CD10/CD13 double-positive cells constitute a pure, functional and stable proximal tubular epithelial cell population that displays proximal tubule markers and epithelial characteristics over the long term, whereas cells positive for either CD10 or CD13 alone appear to be heterogeneous. In conclusion, this study describes a method for establishing a robust renal proximal tubular epithelial cell model suitable for further experimentation.
Directory of Open Access Journals (Sweden)
Lihao Gu
2017-11-01
Full Text Available Royal jelly (RJ is a natural product which the honeybee secretes as a special diet for a queen bee. It is one of the natural products in which various functionalities, such as antibacterial effects, immunomodulating properties, and estrogen-like action, were reported. We investigated the effect of the RJ extract on the moisturizing effect by topical application in humans. The stratum corneum moisture was increased significantly after four weeks by using the RJ extract lotion compared to placebo lotion. RJ extract contained a characteristic ingredient, 10-hydroxy-2-decenoic acid (10H2DA and 10-hydroxydecanoic acid (10HDAA, etc. However, the mechanism of stratum corneum moisture and its contributing ingredient have not yet been elucidated. We have investigated the effects of 10H2DA and 10HDAA on the free amino acids content in the stratum corneum using a cultured human three-dimensional epidermis model. Additionally, the effect of 10H2DA and 10HDAA on the amounts of filaggrin (FLG and aquaporin 3 (AQP3 were investigated at the mRNA level and by immunohistochemistry using a cultured human epidermis model. It was determined that 10H2DA increases the free amino acids in the stratum corneum of the cultured human epidermis model, and that it increased FLG on both the mRNA and protein levels. On the other hand, these actions are not observed by treatment of 10HDAA. The mRNA and protein level of AQP3 did not increase with 10H2DA or 10HDAA use. It was thought that the increase in the amount of FLG and the increase in the free amino acids of the epidermis and the stratum corneum, respectively, by 10H2DA were participating in the moisturizing function of the stratum corneum by the continuous use of RJ extract lotion.
Energy Technology Data Exchange (ETDEWEB)
Gu, Pei-Hong, E-mail: peihong.gu@sjtu.edu.cn [Department of Physics and Astronomy, Shanghai Jiao Tong University, 800 Dongchuan Road, Shanghai 200240 (China)
2014-12-01
We propose an SO(10) × SO(10)' model to simultaneously realize a seesaw for Dirac neutrino masses and a leptogenesis for ordinary and dark matter-antimatter asymmetries. A (16 × 1-bar 6-bar '){sub H} scalar crossing the SO(10) and SO(10)' sectors plays an essential role in this seesaw-leptogenesis scenario. As a result of lepton number conservation, the lightest dark nucleon as the dark matter particle should have a determined mass around 15 GeV to explain the comparable fractions of ordinary and dark matter in the present universe. The (16 × 1-bar 6-bar '){sub H} scalar also mediates a U(1){sub em} × U(1)'{sub em} kinetic mixing after the ordinary and dark left-right symmetry breaking so that we can expect a dark nucleon scattering in direct detection experiments and/or a dark nucleon decay in indirect detection experiments. Furthermore, we can impose a softly broken mirror symmetry to simplify the parameter choice.
Luhar, Ashok K.; Galbally, Ian E.; Keywood, Melita
Launceston is one of the Australian cities most affected by particle pollution due to the use of woodheaters in the winter months, with frequent exceedences of the national standard, the National Environment Protection Measure for Ambient Air Quality (or Air NEPM in short), of 50 micrograms per cubic metre for daily PM 10 (particulate matter with an aerodynamic diameter of 10 μm or less). The main objective of the present study was to determine the woodheater carrying capacity for Launceston—the number of woodheaters that can operate in the city without exceeding the Air NEPM. For this purpose, a prognostic meteorological and air pollution model called TAPM is used, coupled to a gridded woodheater PM 10 emissions inventory. The latter was derived using information on dwelling density, the percentage of dwellings with woodheaters, woodheater emission rates and their diurnal and seasonal variations, and the proportions of compliant/non-compliant woodheaters and open fireplaces. The model simulations are performed for the year 1998, and the concentrations are scaled for previous and subsequent years using trends in woodheater numbers and types. The modelled number of exceedences of the Air NEPM for the period 1997-2004 is in good agreement with the observations. The modelling indicates that the PM 10 Air NEPM would be met in Launceston when the total number of woodheaters is 20% of the total number of dwellings, of which 76%, 18%, 6% would be compliant woodheaters, non-compliant woodheaters and open fireplaces, respectively. With the present trends in the regional woodheater profile, this should occur in the year 2007.
Coenzyme Q10 partially restores pathological alterations in a macrophage model of Gaucher disease.
de la Mata, Mario; Cotán, David; Oropesa-Ávila, Manuel; Villanueva-Paz, Marina; de Lavera, Isabel; Álvarez-Córdoba, Mónica; Luzón-Hidalgo, Raquel; Suárez-Rivero, Juan M; Tiscornia, Gustavo; Sánchez-Alcázar, José A
2017-02-06
Gaucher disease (GD) is caused by mutations in the GBA1 gene which encodes lysosomal β-glucocerebrosidase (GCase). In GD, partial or complete loss of GCase activity causes the accumulation of the glycolipids glucosylceramide (GlcCer) and glucosylsphingosine in the lysosomes of macrophages. In this manuscript, we investigated the effects of glycolipids accumulation on lysosomal and mitochondrial function, inflammasome activation and efferocytosis capacity in a THP-1 macrophage model of Gaucher disease. In addition, the beneficial effects of coenzyme Q 10 (CoQ) supplementation on cellular alterations were evaluated. Chemically-induced Gaucher macrophages were developed by differentiateing THP-1 monocytes to macrophages by treatment with phorbol 12-myristate 13-acetate (PMA) and then inhibiting intracellular GCase with conduritol B-epoxide (CBE), a specific irreversible inhibitor of GCase activity, and supplementing the medium with exogenous GlcCer. This cell model accumulated up to 16-fold more GlcCer compared with control THP-1 cells. Chemically-induced Gaucher macrophages showed impaired autophagy flux associated with mitochondrial dysfunction and increased oxidative stress, inflammasome activation and impaired efferocytosis. All abnormalities were partially restored by supplementation with CoQ. These data suggest that targeting mitochondria function and oxidative stress by CoQ can ameliorate the pathological phenotype of Gaucher cells. Chemically-induced Gaucher macrophages provide cellular models that can be used to investigate disease pathogenesis and explore new therapeutics for GD.
Measurement of velocity deficit at the downstream of a 1:10 axial hydrokinetic turbine model
Energy Technology Data Exchange (ETDEWEB)
Gunawan, Budi [ORNL; Neary, Vincent S [ORNL; Hill, Craig [St. Anthony Falls Laboratory, 2 Third Avenue SE, Minneapolis, MN 55414; Chamorro, Leonardo [St. Anthony Falls Laboratory, 2 Third Avenue SE, Minneapolis, MN 55414
2012-01-01
Wake recovery constrains the downstream spacing and density of turbines that can be deployed in turbine farms and limits the amount of energy that can be produced at a hydrokinetic energy site. This study investigates the wake recovery at the downstream of a 1:10 axial flow turbine model using a pulse-to-pulse coherent Acoustic Doppler Profiler (ADP). In addition, turbine inflow and outflow velocities were measured for calculating the thrust on the turbine. The result shows that the depth-averaged longitudinal velocity recovers to 97% of the inflow velocity at 35 turbine diameter (D) downstream of the turbine.
Modeling the homogenization kinetics of as-cast U-10wt% Mo alloys
Energy Technology Data Exchange (ETDEWEB)
Xu, Zhijie, E-mail: zhijie.xu@pnnl.gov [Computational Mathematics Group, Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Joshi, Vineet [Energy Processes & Materials Division, Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Hu, Shenyang [Reactor Materials & Mechanical Design, Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Paxton, Dean [Nuclear Engineering and Analysis Group, Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Lavender, Curt [Energy Processes & Materials Division, Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Burkes, Douglas [Nuclear Engineering and Analysis Group, Pacific Northwest National Laboratory, Richland, WA 99352 (United States)
2016-04-01
Low-enriched U-22at% Mo (U–10Mo) alloy has been considered as an alternative material to replace the highly enriched fuels in research reactors. For the U–10Mo to work effectively and replace the existing fuel material, a thorough understanding of the microstructure development from as-cast to the final formed structure is required. The as-cast microstructure typically resembles an inhomogeneous microstructure with regions containing molybdenum-rich and -lean regions, which may affect the processing and possibly the in-reactor performance. This as-cast structure must be homogenized by thermal treatment to produce a uniform Mo distribution. The development of a modeling capability will improve the understanding of the effect of initial microstructures on the Mo homogenization kinetics. In the current work, we investigated the effect of as-cast microstructure on the homogenization kinetics. The kinetics of the homogenization was modeled based on a rigorous algorithm that relates the line scan data of Mo concentration to the gray scale in energy dispersive spectroscopy images, which was used to generate a reconstructed Mo concentration map. The map was then used as realistic microstructure input for physics-based homogenization models, where the entire homogenization kinetics can be simulated and validated against the available experiment data at different homogenization times and temperatures.
Directory of Open Access Journals (Sweden)
Mohammad Hassan Ehrampoush
2017-12-01
Conclusion: According to higher concentration of PM10 compared to WHO standard values particularly in spring, necessary actions and solutions should be taken for the pollution reduction. This study indicated that Kriging model has a better efficiency for spatial analysis of suspended particles, compared to IDW method.
Dutton, Kirsten; Abbas, Leila; Spencer, Joanne; Brannon, Claire; Mowbray, Catriona; Nikaido, Masataka; Kelsh, Robert N; Whitfield, Tanya T
2009-01-01
In humans, mutations in the SOX10 gene are a cause of the auditory-pigmentary disorder Waardenburg syndrome type IV (WS4) and related variants. SOX10 encodes an Sry-related HMG box protein essential for the development of the neural crest; deafness in WS4 and other Waardenburg syndromes is usually attributed to loss of neural-crest-derived melanocytes in the stria vascularis of the cochlea. However, SOX10 is strongly expressed in the developing otic vesicle and so direct roles for SOX10 in the otic epithelium might also be important. Here, we examine the otic phenotype of zebrafish sox10 mutants, a model for WS4. As a cochlea is not present in the fish ear, the severe otic phenotype in these mutants cannot be attributed to effects on this tissue. In zebrafish sox10 mutants, we see abnormalities in all otic placodal derivatives. Gene expression studies indicate deregulated expression of several otic genes, including fgf8, in sox10 mutants. Using a combination of mutant and morphant data, we show that the three sox genes belonging to group E (sox9a, sox9b and sox10) provide a link between otic induction pathways and subsequent otic patterning: they act redundantly to maintain sox10 expression throughout otic tissue and to restrict fgf8 expression to anterior macula regions. Single-cell labelling experiments indicate a small and transient neural crest contribution to the zebrafish ear during normal development, but this is unlikely to account for the strong defects seen in the sox10 mutant. We discuss the implication that the deafness in WS4 patients with SOX10 mutations might reflect a haploinsufficiency for SOX10 in the otic epithelium, resulting in patterning and functional abnormalities in the inner ear.
Miryounesi, Mohammad; Nayernia, Karim; Mobasheri, Maryam Beigom; Dianatpour, Mahdi; Oko, Richard; Savad, Shahram; Modarressi, Mohammad Hossein
2014-10-01
In vitro generation of germ cells introduces a novel approach to male infertility and provides an effective system in gene tracking studies, however many aspects of this process have remained unclear. We aimed to promote mouse embryonic stem cells (mESC) differentiation into germ cells and evaluate its effectiveness with tracking the expression of the Tsga10 during this process. mESCs were differentiated into germ cells in the presence of Retinoic Acid. Based on developmental schedule of the postnatal testis, samples were taken on the 7th, 12th, and 25th days of the culture and were subjected to expression analysis of a panel of germ cell specific genes. Expression of Tsga10 in RNA and protein levels was then analyzed. Transition from mitosis to meiosis occurred between 7th and 12th days of mESC culture and post-meiotic gene expression did not occur until the 25th day of the culture. Results showed low level of Tsga10expression in undifferentiated stem cells. During transition from meiotic to post-meiotic phase, Tsga10 expression increased in 6.6 folds. This finding is in concordance with in vivo changes during transition from pre-pubertal to pubertal stage. Localization of processed and unprocessed forms of the related protein was similar to those in vivo as well. Expression pattern of Tsga10, as a gene with critical function in spermatogenesis, is similar during in vitro and in vivo germ cell generation. The results suggest that in vitro derived germ cells could be a trusted model to study genes behavior during spermatogenesis.
2010-08-05
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 9-10 Series Airplanes, DC-9-30 Series... existing airworthiness directive (AD), which applies to all McDonnell Douglas Model DC-9-10 series..., 2010). That AD applies to all McDonnell Douglas Corporation Model DC-9-10 series airplanes, DC-9-30...
International Nuclear Information System (INIS)
Kang, Y.W.; Matthews, P.; Nassiri, A.; Kustom, R.L.
1994-01-01
A double-sided planar mm-wave linear accelerating cavity, structure has been investigated. An 80-cell constant impedance structure working with 2π/3-mode traveling wave was chosen as an accelerator section. A 10x scale model of the structure has been fabricated and the basic electrical performances have been tested. The nodal shift measurement technique with a rectangular detuning plunger was used to measure the phase advance between the cells with a vector network analyzer
2012-02-07
..., and the FAA must issue a finding of regulatory adequacy pursuant to Sec. 611 of Public Law 92-574, the ``Noise Control Act of 1972.'' The FAA issues special conditions, as defined in 14 CFR 11.19, in... novel or unusual design features: The Model LJ-200-1A10 airplane flight deck design incorporates a...
The chemistry–climate model ECHAM6.3-HAM2.3-MOZ1.0
Directory of Open Access Journals (Sweden)
M. G. Schultz
2018-05-01
Full Text Available The chemistry–climate model ECHAM-HAMMOZ contains a detailed representation of tropospheric and stratospheric reactive chemistry and state-of-the-art parameterizations of aerosols using either a modal scheme (M7 or a bin scheme (SALSA. This article describes and evaluates the model version ECHAM6.3-HAM2.3-MOZ1.0 with a focus on the tropospheric gas-phase chemistry. A 10-year model simulation was performed to test the stability of the model and provide data for its evaluation. The comparison to observations concentrates on the year 2008 and includes total column observations of ozone and CO from IASI and OMI, Aura MLS observations of temperature, HNO3, ClO, and O3 for the evaluation of polar stratospheric processes, an ozonesonde climatology, surface ozone observations from the TOAR database, and surface CO data from the Global Atmosphere Watch network. Global budgets of ozone, OH, NOx, aerosols, clouds, and radiation are analyzed and compared to the literature. ECHAM-HAMMOZ performs well in many aspects. However, in the base simulation, lightning NOx emissions are very low, and the impact of the heterogeneous reaction of HNO3 on dust and sea salt aerosol is too strong. Sensitivity simulations with increased lightning NOx or modified heterogeneous chemistry deteriorate the comparison with observations and yield excessively large ozone budget terms and too much OH. We hypothesize that this is an impact of potential issues with tropical convection in the ECHAM model.
The chemistry-climate model ECHAM6.3-HAM2.3-MOZ1.0
Schultz, Martin G.; Stadtler, Scarlet; Schröder, Sabine; Taraborrelli, Domenico; Franco, Bruno; Krefting, Jonathan; Henrot, Alexandra; Ferrachat, Sylvaine; Lohmann, Ulrike; Neubauer, David; Siegenthaler-Le Drian, Colombe; Wahl, Sebastian; Kokkola, Harri; Kühn, Thomas; Rast, Sebastian; Schmidt, Hauke; Stier, Philip; Kinnison, Doug; Tyndall, Geoffrey S.; Orlando, John J.; Wespes, Catherine
2018-05-01
The chemistry-climate model ECHAM-HAMMOZ contains a detailed representation of tropospheric and stratospheric reactive chemistry and state-of-the-art parameterizations of aerosols using either a modal scheme (M7) or a bin scheme (SALSA). This article describes and evaluates the model version ECHAM6.3-HAM2.3-MOZ1.0 with a focus on the tropospheric gas-phase chemistry. A 10-year model simulation was performed to test the stability of the model and provide data for its evaluation. The comparison to observations concentrates on the year 2008 and includes total column observations of ozone and CO from IASI and OMI, Aura MLS observations of temperature, HNO3, ClO, and O3 for the evaluation of polar stratospheric processes, an ozonesonde climatology, surface ozone observations from the TOAR database, and surface CO data from the Global Atmosphere Watch network. Global budgets of ozone, OH, NOx, aerosols, clouds, and radiation are analyzed and compared to the literature. ECHAM-HAMMOZ performs well in many aspects. However, in the base simulation, lightning NOx emissions are very low, and the impact of the heterogeneous reaction of HNO3 on dust and sea salt aerosol is too strong. Sensitivity simulations with increased lightning NOx or modified heterogeneous chemistry deteriorate the comparison with observations and yield excessively large ozone budget terms and too much OH. We hypothesize that this is an impact of potential issues with tropical convection in the ECHAM model.
Effects of homogeneous geometry models in simulating the fuel balls in HTR-10
International Nuclear Information System (INIS)
Wang Mengjen; Liang Jenqhorng; Peir Jinnjer; Chao Dersheng
2012-01-01
In this study, the core geometry of HTR-10 was simulated using four different models including: (1) model 1 - an explicit double heterogeneous geometry, (2) model 2 - a mixing of UO 2 kernel and four layers in each TRISO particle into one, (3) model 3 - a mixing of 8,335 TRISO particles and the inner graphite matrix in each fuel ball into one, and (4) model 4 - a mixing of the outer graphite shell, 8,335 TRISO particles, and the inner graphite matrix in each fuel ball into one. The associated initial core computations were performed using the MCNP version 1.51 computer code. The experimental fuel loading height of 123 cm was employed for each model. The results revealed that the multiplication factors ranged from largest to smallest with model 1, model 2, model 3, and model 4. The neutron spectrum in the fuel region of each models varied from the hardest to the softest are model 1, model 2, model 3, and model 4 while the averaged neutron spectrum in fuel ball from hardest to softest are model 4, model 3, model 2, and model 1. In addition, the CPU execution times extended from longest to shortest with model 1, model 2, model 3, and model 4. (author)
The 10-D chiral null model and the relation to 4-D string solutions
International Nuclear Information System (INIS)
Behrndt, K.
1994-12-01
The chiral null model is a generalization of the fundamental string and gravitational wave background. It is an example of a conformally invariant model in all orders in α' and has unbroken supersymmetries. In a Kaluza-Klein approach we start in 10 dimensions and reduce the model down to 4 dimensions without making any restrictions. The 4-D field content is given by the metric, torsion, dilaton, a moduli field and 6 gauge fields. This model is self-dual and near the singularities asymptotically free. The relation to known IWP, Taub-NUT and rotating black hole solutions is discussed. (orig.)
Callén, M S; López, J M; Mastral, A M
2010-08-15
The estimation of benzo(a)pyrene (BaP) concentrations in ambient air is very important from an environmental point of view especially with the introduction of the Directive 2004/107/EC and due to the carcinogenic character of this pollutant. A sampling campaign of particulate matter less or equal than 10 microns (PM10) carried out during 2008-2009 in four locations of Spain was collected to determine experimentally BaP concentrations by gas chromatography mass-spectrometry mass-spectrometry (GC-MS-MS). Multivariate linear regression models (MLRM) were used to predict BaP air concentrations in two sampling places, taking PM10 and meteorological variables as possible predictors. The model obtained with data from two sampling sites (all sites model) (R(2)=0.817, PRESS/SSY=0.183) included the significant variables like PM10, temperature, solar radiation and wind speed and was internally and externally validated. The first validation was performed by cross validation and the last one by BaP concentrations from previous campaigns carried out in Zaragoza from 2001-2004. The proposed model constitutes a first approximation to estimate BaP concentrations in urban atmospheres with very good internal prediction (Q(CV)(2)=0.813, PRESS/SSY=0.187) and with the maximal external prediction for the 2001-2002 campaign (Q(ext)(2)=0.679 and PRESS/SSY=0.321) versus the 2001-2004 campaign (Q(ext)(2)=0.551, PRESS/SSY=0.449). Copyright 2010 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Callen, M.S.; Lopez, J.M.; Mastral, A.M.
2010-01-01
The estimation of benzo(a)pyrene (BaP) concentrations in ambient air is very important from an environmental point of view especially with the introduction of the Directive 2004/107/EC and due to the carcinogenic character of this pollutant. A sampling campaign of particulate matter less or equal than 10 microns (PM10) carried out during 2008-2009 in four locations of Spain was collected to determine experimentally BaP concentrations by gas chromatography mass-spectrometry mass-spectrometry (GC-MS-MS). Multivariate linear regression models (MLRM) were used to predict BaP air concentrations in two sampling places, taking PM10 and meteorological variables as possible predictors. The model obtained with data from two sampling sites (all sites model) (R 2 = 0.817, PRESS/SSY = 0.183) included the significant variables like PM10, temperature, solar radiation and wind speed and was internally and externally validated. The first validation was performed by cross validation and the last one by BaP concentrations from previous campaigns carried out in Zaragoza from 2001-2004. The proposed model constitutes a first approximation to estimate BaP concentrations in urban atmospheres with very good internal prediction (Q CV 2 =0.813, PRESS/SSY = 0.187) and with the maximal external prediction for the 2001-2002 campaign (Q ext 2 =0.679 and PRESS/SSY = 0.321) versus the 2001-2004 campaign (Q ext 2 =0.551, PRESS/SSY = 0.449).
Assessment of the assessment: Evaluation of the model quality estimates in CASP10
Kryshtafovych, Andriy
2013-08-31
The article presents an assessment of the ability of the thirty-seven model quality assessment (MQA) methods participating in CASP10 to provide an a priori estimation of the quality of structural models, and of the 67 tertiary structure prediction groups to provide confidence estimates for their predicted coordinates. The assessment of MQA predictors is based on the methods used in previous CASPs, such as correlation between the predicted and observed quality of the models (both at the global and local levels), accuracy of methods in distinguishing between good and bad models as well as good and bad regions within them, and ability to identify the best models in the decoy sets. Several numerical evaluations were used in our analysis for the first time, such as comparison of global and local quality predictors with reference (baseline) predictors and a ROC analysis of the predictors\\' ability to differentiate between the well and poorly modeled regions. For the evaluation of the reliability of self-assessment of the coordinate errors, we used the correlation between the predicted and observed deviations of the coordinates and a ROC analysis of correctly identified errors in the models. A modified two-stage procedure for testing MQA methods in CASP10 whereby a small number of models spanning the whole range of model accuracy was released first followed by the release of a larger number of models of more uniform quality, allowed a more thorough analysis of abilities and inabilities of different types of methods. Clustering methods were shown to have an advantage over the single- and quasi-single- model methods on the larger datasets. At the same time, the evaluation revealed that the size of the dataset has smaller influence on the global quality assessment scores (for both clustering and nonclustering methods), than its diversity. Narrowing the quality range of the assessed models caused significant decrease in accuracy of ranking for global quality predictors but
Kreyling, Daniel; Wohltmann, Ingo; Lehmann, Ralph; Rex, Markus
2018-03-01
systematic error is small and does not accumulate during the course of a simulation. In the context of a 10-year simulation, the ozone layer simulated by SWIFT shows a stable annual cycle, with inter-annual variations comparable to the ATLAS model. The application of Extrapolar SWIFT requires the evaluation of polynomial functions with 30-100 terms. Computers can currently calculate such polynomial functions at thousands of model grid points in seconds. SWIFT provides the desired numerical efficiency and computes the ozone layer 104 times faster than the chemistry scheme in the ATLAS CTM.
A two-stage constitutive model of X12CrMoWVNbN10-1-1 steel during elevated temperature
Zhu, Luobei; He, Jianli; Zhang, Ying
2018-02-01
In order to clarify the competition between work hardening (WH) caused by dislocation movements and the dynamic softening result from dynamic recovery (DRV) and dynamic recrystallization (DRX), a new two-stage flow stress model of X12CrMoWVNbN10-1-1 (X12) ferrite heat-resistant steel was established to describe the whole hot deformation behavior. And the parameters were determined by the experimental data operated on a Gleeble-3800 thermo- mechanical simulation. In this constitutive model, a single internal variable dislocation density evolution model is used to describe the influence of WH and DRV to flow stress. The DRX kinetic dynamic model can express accurately the contribution of DRX to the decline of flow stress, which was established on the Avrami equation. Furthermore, The established new model was compared with Fields-Bachofen (F-B) model and experimental data. The results indicate the new two-stage flow stress model can more accurately represent the hot deformation behavior of X12 ferrite heat-resistant steel, and the average error is only 0.0995.
Directory of Open Access Journals (Sweden)
P. Jančík
2013-10-01
Full Text Available The goal of the article is to present analysis of metallurgical industry contribution to annual average PM10 concentrations in Moravian-Silesian based on means of the air pollution modelling in accord with the Czech reference methodology SYMOS´97.
Evaluation of 6 and 10 Year-Old Child Human Body Models in Emergency Events.
Gras, Laure-Lise; Stockman, Isabelle; Brolin, Karin
2017-01-01
Emergency events can influence a child's kinematics prior to a car-crash, and thus its interaction with the restraint system. Numerical Human Body Models (HBMs) can help understand the behaviour of children in emergency events. The kinematic responses of two child HBMs-MADYMO 6 and 10 year-old models-were evaluated and compared with child volunteers' data during emergency events-braking and steering-with a focus on the forehead and sternum displacements. The response of the 6 year-old HBM was similar to the response of the 10 year-old HBM, however both models had a different response compared with the volunteers. The forward and lateral displacements were within the range of volunteer data up to approximately 0.3 s; but then, the HBMs head and sternum moved significantly downwards, while the volunteers experienced smaller displacement and tended to come back to their initial posture. Therefore, these HBMs, originally intended for crash simulations, are not too stiff and could be able to reproduce properly emergency events thanks, for instance, to postural control.
Chaos in non-diagonal spatially homogeneous cosmological models in spacetime dimensions <=10
Demaret, Jacques; de Rop, Yves; Henneaux, Marc
1988-08-01
It is shown that the chaotic oscillatory behaviour, absent in diagonal homogeneous cosmological models in spacetime dimensions between 5 and 10, can be reestablished when off-diagonal terms are included. Also at Centro de Estudios Cientificos de Santiago, Casilla 16443, Santiago 9, Chile
International Nuclear Information System (INIS)
Ryynaenen, Paeivi M.; Kortesniemi, Mika; Coderre, Jeffrey A.; Diaz, Aidnag Z.; Hiismaeki, Pekka; Savolainen, Sauli E.
2000-01-01
Purpose: To create simple and reliable models for clinical practice for estimating the blood 10 B time-concentration curve after p-boronophenylalanine fructose complex (BPA-F) infusion in patients during neutron irradiation in boron neutron capture therapy (BNCT). Methods and Materials: BPA-F (290 mg BPA/kg body weight) was infused i.v. during two hours to 10 glioblastoma multiforme patients. Blood samples were collected during and after the infusion. Compartmental models and bi-exponential function fit were constructed based on the 10 B blood time-concentration curve. The constructed models were tested with data from six additional patients who received various amounts of infused BPA-F and data from one patient who received a one-hour infusion of 170 mg BPA/kg body weight. Results: The resulting open two-compartment model and bi-exponential function estimate the clearance of 10 B after 290 mg BPA/kg body weight infusion from the blood with satisfactory accuracy during the first irradiation field (1 ppm, i.e., 7%). The accuracy of the two models in predicting the clearance of 10 B during the second irradiation field are for two-compartment model 1.0 ppm (8%) and 0.2 ppm (2%) for bi-exponential function. The models predict the average blood 10 B concentration with an increasing accuracy as more data points are available during the treatment. Conclusion: By combining the two models, a robust and practical modeling tool is created for the estimation of the 10 B concentration in blood after BPA-F infusion
LANL* V1.0: a radiation belt drift shell model suitable for real-time and reanalysis applications
International Nuclear Information System (INIS)
Koller, Josep; Reeves, Geoffrey D.; Friedel, Reiner H.W.
2008-01-01
Space weather modeling, forecasts, and predictions, especially for the radiation belts in the inner magnetosphere, require detailed information about the Earth's magnetic field. Results depend on the magnetic field model and the L* (pron. L-star) values which are used to describe particle drift shells. Space wather models require integrating particle motions along trajectories that encircle the Earth. Numerical integration typically takes on the order of 10 5 calls to a magnetic field model which makes the L* calculations very slow, in particular when using a dynamic and more accurate magnetic field model. Researchers currently tend to pick simplistic models over more accurate ones but also risking large inaccuracies and even wrong conclusions. For example, magnetic field models affect the calculation of electron phase space density by applying adiabatic invariants including the drift shell value L*. We present here a new method using a surrogate model based on a neural network technique to replace the time consuming L* calculations made with modern magnetic field models. The advantage of surrogate models (or meta-models) is that they can compute the same output in a fraction of the time while adding only a marginal error. Our drift shell model LANL* (Los Alamos National Lab L-star) is based on L* calculation using the TSK03 model. The surrogate model has currently been tested and validated only for geosynchronous regions but the method is generally applicable to any satellite orbit. Computations with the new model are several million times faster compared to the standard integration method while adding less than 1% error. Currently, real-time applications for forecasting and even nowcasting inner magnetospheric space weather is limited partly due to the long computing time of accurate L* values. Without them, real-time applications are limited in accuracy. Reanalysis application of past conditions in the inner magnetosphere are used to understand physical
LANL* V1.0: a radiation belt drift shell model suitable for real-time and reanalysis applications
Energy Technology Data Exchange (ETDEWEB)
Koller, Josep [Los Alamos National Laboratory; Reeves, Geoffrey D [Los Alamos National Laboratory; Friedel, Reiner H W [Los Alamos National Laboratory
2008-01-01
Space weather modeling, forecasts, and predictions, especially for the radiation belts in the inner magnetosphere, require detailed information about the Earth's magnetic field. Results depend on the magnetic field model and the L* (pron. L-star) values which are used to describe particle drift shells. Space wather models require integrating particle motions along trajectories that encircle the Earth. Numerical integration typically takes on the order of 10{sup 5} calls to a magnetic field model which makes the L* calculations very slow, in particular when using a dynamic and more accurate magnetic field model. Researchers currently tend to pick simplistic models over more accurate ones but also risking large inaccuracies and even wrong conclusions. For example, magnetic field models affect the calculation of electron phase space density by applying adiabatic invariants including the drift shell value L*. We present here a new method using a surrogate model based on a neural network technique to replace the time consuming L* calculations made with modern magnetic field models. The advantage of surrogate models (or meta-models) is that they can compute the same output in a fraction of the time while adding only a marginal error. Our drift shell model LANL* (Los Alamos National Lab L-star) is based on L* calculation using the TSK03 model. The surrogate model has currently been tested and validated only for geosynchronous regions but the method is generally applicable to any satellite orbit. Computations with the new model are several million times faster compared to the standard integration method while adding less than 1% error. Currently, real-time applications for forecasting and even nowcasting inner magnetospheric space weather is limited partly due to the long computing time of accurate L* values. Without them, real-time applications are limited in accuracy. Reanalysis application of past conditions in the inner magnetosphere are used to understand
DEFF Research Database (Denmark)
Püthe, Christoph; Kuvshinov, Alexey; Khan, Amir
2015-01-01
We present a newmodel of the radial (1-D) conductivity structure of Earth's mantle. This model is derived frommore than 10 yr of magnetic measurements from the satellites ørsted, CHAMP, SAC-C and the Swarm trio as well as the global network of geomagnetic observatories. After removal of core...
López-Montero, Teresa; López-Vicente, Manuel; Navas, Ana
2013-04-01
Soil moisture variability and the depth of water stored in the arable layer of the soil are important topics in agricultural research and rangeland management. Additionally, runoff triggers soil detachment and sediment delivery, and thus is one of the most important factors in the soil erosion dynamic. Overland flow generation and accumulation are non-linear and scale-dependent processes and the development of prediction models helps researchers evaluate different scenarios at different temporal and spatial scales. In this study, we present the DR2-SAGA 1.0 module to the scientific community. The DR2 (Distributed Rainfall-Runoff) water balance model computes the depth of water stored within the soil profile (Waa) distinguishing five scenarios of the upslope contributing area, infiltration processes and climatic parameters, and assesses the soil moisture status (SMS) throughout the year for an average monthly rainfall event. The SAGA program is a free Geographical Information System (GIS) with support for vector and, specially, raster data. Its foundation is its Application Programming Interface (API), which provides data object models and basic definitions for the programming of scientific modules. Module libraries contain the scientific methods and are developed using C++ code. The new module was run in a medium size mountain Mediterranean catchment (246 ha; Spanish Central Pre-Pyrenees) at high spatial resolution (5 x 5 meters of cell size). The Estaña Lakes Catchment is affected by karstic processes which explain the presence of 15 endorheic sub-catchments and three fresh-water lakes. Additionally, this area is ungauged and offers the opportunity to test the performance of the new module in a non-conventional landscape. DR2-SAGA 1.0 demands 16 inputs and generates monthly and annual maps of initial and effective runoff depth, Waa and SMS. One user-friendly tab was created with SAGA 2.0.8 for each input and output file. The new module also includes a water
International Nuclear Information System (INIS)
Kiger, W.S. III; Newton, T.H.; Palmer, M.R.
2000-01-01
Separate compartmental models have been derived for the concentration of 10 B resulting from BPA-F infusion in the central vascular space (i.e., blood or, more appropriately, plasma) and in glioblastoma multiforme and normal brain. By coupling the model for the temporal variation of 10 B concentration in the central vascular space with that for tissue, the dynamic behavior of the 10 B concentration and the resulting dosimetry in the relevant tissues and blood may be predicted for arbitrary infusion schedules. This coupled model may be used as a tool for identifying the optimal time for BNCT irradiation and optimal BPA-F infusion schedule (i.e., temporal targeting) in humans without the need for expensive and time-consuming pharmacokinetic studies for every infusion schedule considered. This model was used to analyze the concentration profiles resulting from a wide range of infusion schedules and their implications for dosimetry. (author)
GARUSO - Version 1.0. Uncertainty model for multipath ultrasonic transit time gas flow meters
Energy Technology Data Exchange (ETDEWEB)
Lunde, Per; Froeysa, Kjell-Eivind; Vestrheim, Magne
1997-09-01
This report describes an uncertainty model for ultrasonic transit time gas flow meters configured with parallel chords, and a PC program, GARUSO Version 1.0, implemented for calculation of the meter`s relative expanded uncertainty. The program, which is based on the theoretical uncertainty model, is used to carry out a simplified and limited uncertainty analysis for a 12`` 4-path meter, where examples of input and output uncertainties are given. The model predicts a relative expanded uncertainty for the meter at a level which further justifies today`s increasing tendency to use this type of instruments for fiscal metering of natural gas. 52 refs., 15 figs., 11 tabs.
Nieto, Paulino José García; Antón, Juan Carlos Álvarez; Vilán, José Antonio Vilán; García-Gonzalo, Esperanza
2014-10-01
The aim of this research work is to build a regression model of the particulate matter up to 10 micrometers in size (PM10) by using the multivariate adaptive regression splines (MARS) technique in the Oviedo urban area (Northern Spain) at local scale. This research work explores the use of a nonparametric regression algorithm known as multivariate adaptive regression splines (MARS) which has the ability to approximate the relationship between the inputs and outputs, and express the relationship mathematically. In this sense, hazardous air pollutants or toxic air contaminants refer to any substance that may cause or contribute to an increase in mortality or serious illness, or that may pose a present or potential hazard to human health. To accomplish the objective of this study, the experimental dataset of nitrogen oxides (NOx), carbon monoxide (CO), sulfur dioxide (SO2), ozone (O3) and dust (PM10) were collected over 3 years (2006-2008) and they are used to create a highly nonlinear model of the PM10 in the Oviedo urban nucleus (Northern Spain) based on the MARS technique. One main objective of this model is to obtain a preliminary estimate of the dependence between PM10 pollutant in the Oviedo urban area at local scale. A second aim is to determine the factors with the greatest bearing on air quality with a view to proposing health and lifestyle improvements. The United States National Ambient Air Quality Standards (NAAQS) establishes the limit values of the main pollutants in the atmosphere in order to ensure the health of healthy people. Firstly, this MARS regression model captures the main perception of statistical learning theory in order to obtain a good prediction of the dependence among the main pollutants in the Oviedo urban area. Secondly, the main advantages of MARS are its capacity to produce simple, easy-to-interpret models, its ability to estimate the contributions of the input variables, and its computational efficiency. Finally, on the basis of
Gas-evolution oscillators. 10. A model based on a delay equation
Energy Technology Data Exchange (ETDEWEB)
Bar-Eli, K.; Noyes, R.M. [Univ. of Oregon, Eugene, OR (United States)
1992-09-17
This paper develops a simplified method to model the behavior of a gas-evolution oscillator with two differential delay equations in two unknowns consisting of the population of dissolved molecules in solution and the pressure of the gas.
Gas-evolution oscillators. 10. A model based on a delay equation
International Nuclear Information System (INIS)
Bar-Eli, K.; Noyes, R.M.
1992-01-01
This paper develops a simplified method to model the behavior of a gas-evolution oscillator with two differential delay equations in two unknowns consisting of the population of dissolved molecules in solution and the pressure of the gas
Keshtpoor, M.; Carnacina, I.; Blair, A.; Yablonsky, R. M.
2017-12-01
Storm surge caused by Extratropical Cyclones (ETCs) has significantly impacted not only the life of private citizens but also the insurance and reinsurance industry in Great Britain. The storm surge risk assessment requires a larger dataset of storms than the limited recorded historical ETCs. Thus, historical ETCs were perturbed to generate a 10,000-year stochastic catalog that accounts for surge-generating ETCs in the study area with return periods from one year to 10,000 years. Delft3D-Flexible Mesh hydrodynamic model was used to numerically simulate the storm surge along the Great Britain coastline. A nested grid technique was used to increase the simulation grid resolution up to 200 m near the highly populated coastal areas. Coarse and fine mesh models were calibrated and validated using historical recorded water elevations. Then, numerical simulations were performed on a 10,000-year stochastic catalog. The 50-, 100-, and 500-year return period maps were generated for Great Britain coastal areas. The corresponding events with return periods of 50-, 100-, and 500-years in Humber Bay and Thames River coastal areas were identified, and simulated with the consideration of projected sea level rises to reveal the effect of rising sea levels on the inundation return period maps in two highly-populated coastal areas. Finally, the return period of Storm Xaver (2013) was determined with and without the effect of rising sea levels.
DEFF Research Database (Denmark)
Wendt, Fabian F.; Yu, Yi-Hsiang; Nielsen, Kim
2017-01-01
This is the first joint reference paper for the Ocean Energy Systems (OES) Task 10 Wave Energy Converter modeling verification and validation group. The group is established under the OES Energy Technology Network program under the International Energy Agency. OES was founded in 2001 and Task 10 ...
Modeling PM10 in Ho Chi Minh City, Vietnam and evaluation of its impact on human health
Directory of Open Access Journals (Sweden)
Bang Quoc Ho
2017-03-01
Full Text Available According to World Health Organization (WHO and Global Burden of Disease, ambient air pollution is estimated to be responsible for 3.7 million premature deaths in 2012 [1]. Therefore, it is urgent to estimate the impact of air pollution on public health and economic damage. The objectives of this research are: study the distribution of PM10 concentration over Ho Chi Minh city (HCMC and relationship to public health and for proposing solutions of diseases prevention in HCM, Vietnam. EMIssion SENSitivity model was applied to conduct air emission inventory for transportation sector. Then, Finite Volume Model and Transport and Photochemistry Mesoscale Model were used to simulate the meteorology and the spatial distribution of PM10 in HCMC. Together with disease data obtained, the US Environmental Benefits Mapping and Analysis Model was applied for calculating the number of deaths and estimating economic losses due to PM10 pollution. Finally, solutions to reduce PM10 pollution and protect public health are proposed. The results showed that the highest 1-h average concentration of PM10 is 240 μg m−3 in North Eastern of HCMC. The concentration of PM10 for annual average in District 5 ranged from 17 to 49 μg m−3. There are 12 wards of District 5 with PM10 concentration exceeding the WHO guidelines (20 μg m−3 for annual average of PM10 and 50 μg m−3 for 24-h average. The high concentration of PM10 causes 5 deaths yr−1 in District 5 and 204 deaths yr−1 in HCMC, and it causes economic losses of 1.84 billion of USD.
Evaluation of SAR in a human body model due to wireless power transmission in the 10 MHz band.
Laakso, Ilkka; Tsuchida, Shogo; Hirata, Akimasa; Kamimura, Yoshitsugu
2012-08-07
This study discusses a computational method for calculating the specific absorption rate (SAR) due to a wireless power transmission system in the 10 MHz frequency band. A two-step quasi-static method comprised of the method of moments and the scalar potential finite-difference method are proposed. The applicability of the quasi-static approximation for localized exposure in this frequency band is discussed by comparing the SAR in a lossy dielectric cylinder computed with a full-wave electromagnetic analysis and the quasi-static approximation. From the computational results, the input impedance of the resonant coils was affected by the existence of the cylinder. On the other hand, the magnetic field distribution in free space and considering the cylinder and an impedance matching circuit were in good agreement; the maximum difference in the amplitude of the magnetic field was 4.8%. For a cylinder-coil distance of 10 mm, the difference between the peak 10 g averaged SAR in the cylinder computed with the full-wave electromagnetic method and our quasi-static method was 7.8%. These results suggest that the quasi-static approach is applicable for conducting the dosimetry of wireless power transmission in the 10 MHz band. With our two-step quasi-static method, the SAR in the anatomically based model was computed for different exposure scenarios. From those computations, the allowable input power satisfying the limit of a peak 10 g averaged SAR of 2.0 W kg(-1) was 830 W in the worst case exposure scenario with a coil positioned at a distance of 30 mm from the chest.
Modelling of PM10 concentration for industrialized area in Malaysia: A case study in Shah Alam
N, Norazian Mohamed; Abdullah, M. M. A.; Tan, Cheng-yau; Ramli, N. A.; Yahaya, A. S.; Fitri, N. F. M. Y.
In Malaysia, the predominant air pollutants are suspended particulate matter (SPM) and nitrogen dioxide (NO2). This research is on PM10 as they may trigger harm to human health as well as environment. Six distributions, namely Weibull, log-normal, gamma, Rayleigh, Gumbel and Frechet were chosen to model the PM10 observations at the chosen industrial area i.e. Shah Alam. One-year period hourly average data for 2006 and 2007 were used for this research. For parameters estimation, method of maximum likelihood estimation (MLE) was selected. Four performance indicators that are mean absolute error (MAE), root mean squared error (RMSE), coefficient of determination (R2) and prediction accuracy (PA), were applied to determine the goodness-of-fit criteria of the distributions. The best distribution that fits with the PM10 observations in Shah Alamwas found to be log-normal distribution. The probabilities of the exceedences concentration were calculated and the return period for the coming year was predicted from the cumulative density function (cdf) obtained from the best-fit distributions. For the 2006 data, Shah Alam was predicted to exceed 150 μg/m3 for 5.9 days in 2007 with a return period of one occurrence per 62 days. For 2007, the studied area does not exceed the MAAQG of 150 μg/m3
Receptor modeling studies for the characterization of PM10 pollution sources in Belgrade
Directory of Open Access Journals (Sweden)
Mijić Zoran
2012-01-01
Full Text Available The objective of this study is to determine the major sources and potential source regions of PM10 over Belgrade, Serbia. The PM10 samples were collected from July 2003 to December 2006 in very urban area of Belgrade and concentrations of Al, V, Cr, Mn, Fe, Ni, Cu, Zn, Cd and Pb were analyzed by atomic absorption spectrometry. The analysis of seasonal variations of PM10 mass and some element concentrations reported relatively higher concentrations in winter, what underlined the importance of local emission sources. The Unmix model was used for source apportionment purpose and the four main source profiles (fossil fuel combustion; traffic exhaust/regional transport from industrial centers; traffic related particles/site specific sources and mineral/crustal matter were identified. Among the resolved factors the fossil fuel combustion was the highest contributor (34% followed by traffic/regional industry (26%. Conditional probability function (CPF results identified possible directions of local sources. The potential source contribution function (PSCF and concentration weighted trajectory (CWT receptor models were used to identify spatial source distribution and contribution of regional-scale transported aerosols. [Projekat Ministarstva nauke Republike Srbije, br. III43007 i br. III41011
International Nuclear Information System (INIS)
Lucas, V.; Raby, S.
1996-01-01
We show that one-loop GUT scale threshold corrections to gauge couplings are a significant constraint on the GUT symmetry-breaking sector of the theory. The one-loop threshold corrections relate the prediction for α s (M Z ) to the proton lifetime. We have calculated these corrections in a new complete SO(10) SUSY GUT. The results are consistent with the low-energy measurement of α s (M Z ). We have also calculated the proton lifetime and branching ratios in this model. We show that proton decay rates provide a powerful test for theories of fermion masses. copyright 1996 The American Physical Society
Design, Manufacture and Test of a 1.3 T / 10 Hz dipole model for Rapid Cycling Synchrotrons
Newborough, A
2013-01-01
The construction of a compact rapid cycling synchrotron has recently been studied at CERN to replace the first stage of its accelerator complex, the proton synchrotron booster. Although currently there are no plans to build this machine, fast cycled accelerator magnets are of general interest for numerous reasons. This has led to the design, manufacture and testing of a scaled model dipole as detailed in this paper to show the capability of producing and characterising a magnet design based on high-silicon content grain-oriented steel able to operate up to 1.3 T at 10 Hz.
Heileman, K L; Tabrizian, M
2017-05-02
3-Dimensional cell cultures are more representative of the native environment than traditional cell cultures on flat substrates. As a result, 3-dimensional cell cultures have emerged as a very valuable model environment to study tumorigenesis, organogenesis and tissue regeneration. Many of these models encompass the formation of cell aggregates, which mimic the architecture of tumor and organ tissue. Dielectric impedance spectroscopy is a non-invasive, label free and real time technique, overcoming the drawbacks of established techniques to monitor cell aggregates. Here we introduce a platform to monitor cell aggregation in a 3-dimensional extracellular matrix using dielectric spectroscopy. The MCF10A breast epithelial cell line serves as a model for cell aggregation. The platform maintains sterile conditions during the multi-day assay while allowing continuous dielectric spectroscopy measurements. The platform geometry optimizes dielectric measurements by concentrating cells within the electrode sensing region. The cells show a characteristic dielectric response to aggregation which corroborates with finite element analysis computer simulations. By fitting the experimental dielectric spectra to the Cole-Cole equation, we demonstrated that the dispersion intensity Δε and the characteristic frequency f c are related to cell aggregate growth. In addition, microscopy can be performed directly on the platform providing information about cell position, density and morphology. This platform could yield many applications for studying the electrophysiological activity of cell aggregates.
Directory of Open Access Journals (Sweden)
Christopher Naugler
2012-01-01
Full Text Available Background: The use of adjuvant tamoxifen therapy in the treatment of estrogen receptor (ER expressing breast carcinomas represents a major advance in personalized cancer treatment. Because there is no benefit (and indeed there is increased morbidity and mortality associated with the use of tamoxifen therapy in ER-negative breast cancer, its use is restricted to women with ER expressing cancers. However, correctly classifying cancers as ER positive or negative has been challenging given the high reported false negative test rates for ER expression in surgical specimens. In this paper I model practice recommendations using published information from clinical trials to address the question of whether there is a false negative test rate above which it is more efficacious to forgo ER testing and instead treat all patients with tamoxifen regardless of ER test results. Methods: I used data from randomized clinical trials to model two different hypothetical treatment strategies: (1 the current strategy of treating only ER positive women with tamoxifen and (2 an alternative strategy where all women are treated with tamoxifen regardless of ER test results. The variables used in the model are literature-derived survival rates of the different combinations of ER positivity and treatment with tamoxifen, varying true ER positivity rates and varying false negative ER testing rates. The outcome variable was hypothetical 10-year survival. Results: The model predicted that there will be a range of true ER rates and false negative test rates above which it would be more efficacious to treat all women with breast cancer with tamoxifen and forgo ER testing. This situation occurred with high true positive ER rates and false negative ER test rates in the range of 20-30%. Conclusions: It is hoped that this model will provide an example of the potential importance of diagnostic error on clinical outcomes and furthermore will give an example of how the effect of that
International Nuclear Information System (INIS)
Zhang, Fang; Zhang, Yan; Chen, Yun; Dai, Kun; Loosdrecht, Mark C.M. van; Zeng, Raymond J.
2015-01-01
Highlights: • Simultaneous production of acetate and methane from glycerol was investigated. • Acetate accounted for more than 90% of metabolites in liquid solutions. • The maximum concentration of acetate was above 13 g/L. • 93% of archaea were hydrogenotrophic methanogens. • Thermoanaerobacter was main bacterium and its percentage was 92%. - Abstract: The feasibility of simultaneous production of acetate and methane from glycerol was investigated by selective enrichment of hydrogenotrophic methanogens in an extreme-thermophilic (70 °C) fermentation. Fed-batch experiments showed acetate was produced at the concentration up to 13.0 g/L. A stable operation of the continuous stirred tank reactor (CSTR) was reached within 100 days. Acetate accounted for more than 90 w/w% of metabolites in the fermentation liquid. The yields of methane and acetate were close to the theoretical yields with 0.74–0.80 mol-methane/mol-glycerol and 0.63–0.70 mol-acetate/mol-glycerol. The obtained microbial community was characterized. Hydrogenotrophic methanogens, mainly Methanothermobacter thermautotrophicus formed 93% of the methanogenogenic community. This confirms that a high temperature (70 °C) could effectively select for hydrogenotrophic methanogenic archaea. Thermoanaerobacter spp. was the main bacterium forming 91.5% of the bacterial population. This work demonstrated the conversion of the byproduct of biodiesel production, glycerol, to acetate as a chemical and biogas for energy generation
Evaluation of SAR in a human body model due to wireless power transmission in the 10 MHz band
International Nuclear Information System (INIS)
Laakso, Ilkka; Tsuchida, Shogo; Hirata, Akimasa; Kamimura, Yoshitsugu
2012-01-01
This study discusses a computational method for calculating the specific absorption rate (SAR) due to a wireless power transmission system in the 10 MHz frequency band. A two-step quasi-static method comprised of the method of moments and the scalar potential finite-difference method are proposed. The applicability of the quasi-static approximation for localized exposure in this frequency band is discussed by comparing the SAR in a lossy dielectric cylinder computed with a full-wave electromagnetic analysis and the quasi-static approximation. From the computational results, the input impedance of the resonant coils was affected by the existence of the cylinder. On the other hand, the magnetic field distribution in free space and considering the cylinder and an impedance matching circuit were in good agreement; the maximum difference in the amplitude of the magnetic field was 4.8%. For a cylinder–coil distance of 10 mm, the difference between the peak 10 g averaged SAR in the cylinder computed with the full-wave electromagnetic method and our quasi-static method was 7.8%. These results suggest that the quasi-static approach is applicable for conducting the dosimetry of wireless power transmission in the 10 MHz band. With our two-step quasi-static method, the SAR in the anatomically based model was computed for different exposure scenarios. From those computations, the allowable input power satisfying the limit of a peak 10 g averaged SAR of 2.0 W kg −1 was 830 W in the worst case exposure scenario with a coil positioned at a distance of 30 mm from the chest. (paper)
SDG Fermion-Pair Algebraic SO(12) and Sp(10) Models and Their Boson Realizations
Navratil, P.; Geyer, H. B.; Dobes, J.; Dobaczewski, J.
1995-11-01
It is shown how the boson mapping formalism may be applied as a useful many-body tool to solve a fermion problem. This is done in the context of generalized Ginocchio models for which we introduce S-, D-, and G-pairs of fermions and subsequently construct the sdg-boson realizations of the generalized Dyson type. The constructed SO(12) and Sp(10) fermion models are solved beyond the explicit symmetry limits. Phase transitions to rotational structures are obtained also in situations where there is no underlying SU(3) symmetry.
Energy Technology Data Exchange (ETDEWEB)
Boergesson, Lennart (Clay Technology AB, Lund (Sweden)); Hernelind, Jan (5T Engineering AB, Vaesteraas (Sweden))
2010-11-15
Three model shear tests of very high quality simulating a horizontal rock shear through a deposition hole in the centre of a canister were performed 1986. The tests and the results are described by /Boergesson 1986/. The tests simulated a deposition hole in the scale 1:10 with reference density of the buffer, very stiff confinement simulating the rock, and a solid bar of copper simulating the canister. The three tests were almost identical with exception of the rate of shear, which was varied between 0.031 and 160 mm/s, i.e. with a factor of more than 5,000 and the density of the bentonite, which differed slightly. The tests were very well documented. Shear force, shear rate, total stress in the bentonite, strain in the copper and the movement of the top of the simulated canister were measured continuously during the shear. After finished shear the equipment was dismantled and careful sampling of the bentonite with measurement of water ratio and density were made. The deformed copper 'canister' was also carefully measured after the test. The tests have been modelled with the finite element code Abaqus with the same models and techniques that were used for the full scale scenarios in SR-Site. The results have been compared with the measured results, which has yielded very valuable information about the relevancy of the material models and the modelling technique. An elastic-plastic material model was used for the bentonite where the stress-strain relations have been derived from laboratory tests. The material model is made a function of both the density and the strain rate at shear. Since the shear is fast and takes place under undrained conditions, the density is not changed during the tests. However, strain rate varies largely with both the location of the elements and time. This can be taken into account in Abaqus by making the material model a function of the strain rate for each element. A similar model, based on tensile tests on the copper used in
International Nuclear Information System (INIS)
Brocheton, F.; Poulet, D.; Mesbah, B.; Hourdin, G.
2010-01-01
AIRFOBEP is the association in charge of the air quality monitoring in the Etang de Berre area. AIRFOBEP is managing a network of ten sensors to monitor the PMI (particulate matter index) particulate pollution. This network is updated once a year according to the Air Quality Monitoring Plan (PSQA). Optimizing this network needs to know how the particulate pollution is distributed in the area. In other words, to determine the limits of homogeneous zones of PM 10 pollution. The aim of the project presented in this article is to produce a map of homogeneous zones of PM 10 pollution in the Etang de Berre area. The project was carried out in two steps: - PM 10 atmospheric dispersion modeling, using a ADMS-URBAN software, - Statistic classification, based on the well known Hierarchical Ascending Classification (HAC) technique. Results of the atmospheric dispersion modeling was namely adjusted using an original technique for the 'background PM 10 pollution' computation. Good performances have been obtained when comparing modeling and measurements data. Finally, a set of five homogeneous zones was found to well describe the PM 10 pollution level distribution in the Etang de Berre area. (author)
Random cyclic constitutive models of 0Cr18Ni10Ti pipe steel
International Nuclear Information System (INIS)
Zhao Yongxiang; Yang Bing
2004-01-01
Experimental study is performed on the random cyclic constitutive relations of a new pipe stainless steel, 0Cr18Ni10Ti, by an incremental strain-controlled fatigue test. In the test, it is verified that the random cyclic constitutive relations, like the wide recognized random cyclic strain-life relations, is an intrinsic fatigue phenomenon of engineering materials. Extrapolating the previous work by Zhao et al, probability-based constitutive models are constructed, respectively, on the bases of Ramberg-Osgood equation and its modified form. Scattering regularity and amount of the test data are taken into account. The models consist of the survival probability-strain-life curves, the confidence strain-life curves, and the survival probability-confidence-strain-life curves. Availability and feasibility of the models have been indicated by analysis of the present test data
Tier I Rice Model - Version 1.0 - Guidance for Estimating Pesticide Concentrations in Rice Paddies
Describes a Tier I Rice Model (Version 1.0) for estimating surface water exposure from the use of pesticides in rice paddies. The concentration calculated can be used for aquatic ecological risk and drinking water exposure assessments.
Wang, Yang; Zhou, Ying; Zuo, Jian
2018-01-01
Particle emissions derived from construction activities have a significant impact on the local air quality, while the canyon effect with reduced natural ventilation contributes to the highest particulate pollution in urban environments. This study attempted to examine the effect of PM10 emissions derived from the construction of a rail transit system in an urban street canyon. Using a 3D computational fluid dynamic (CFD) model based on a real street canyon with different height ratios, this study formulates the impact of height ratio and wind directions on the dispersion and concentration of PM10. The results indicate that parallel flow would cause the concentration of PM10 at the end of the street canyons in all height ratios, and the trends in horizontal, vertical and lateral planes in all street canyons are similar. While in the condition of perpendicular flow, double-eddy circulations occur and lead to the concentration of PM10 in the middle part of the street canyon and leeward of backwind buildings in all height ratios. Furthermore, perpendicular flow will cause the concentration of PM10 to increase if the upwind buildings are higher than the backwind ones. This study also shows that the dispersion of PM10 is strongly associated with wind direction in and the height ratios of the street canyons. Certain measures could, therefore, be taken to prevent the impact on people in terms of the PM10 concentration and the heights of street canyons identified in this research. Potential mitigation strategies are suggested, include measurements below 4 m according to governmental regulations, dust shields, and atomized water. PMID:29522495
Wang, Yang; Zhou, Ying; Zuo, Jian; Rameezdeen, Raufdeen
2018-03-09
Particle emissions derived from construction activities have a significant impact on the local air quality, while the canyon effect with reduced natural ventilation contributes to the highest particulate pollution in urban environments. This study attempted to examine the effect of PM 10 emissions derived from the construction of a rail transit system in an urban street canyon. Using a 3D computational fluid dynamic (CFD) model based on a real street canyon with different height ratios, this study formulates the impact of height ratio and wind directions on the dispersion and concentration of PM 10 . The results indicate that parallel flow would cause the concentration of PM 10 at the end of the street canyons in all height ratios, and the trends in horizontal, vertical and lateral planes in all street canyons are similar. While in the condition of perpendicular flow, double-eddy circulations occur and lead to the concentration of PM 10 in the middle part of the street canyon and leeward of backwind buildings in all height ratios. Furthermore, perpendicular flow will cause the concentration of PM 10 to increase if the upwind buildings are higher than the backwind ones. This study also shows that the dispersion of PM 10 is strongly associated with wind direction in and the height ratios of the street canyons. Certain measures could, therefore, be taken to prevent the impact on people in terms of the PM 10 concentration and the heights of street canyons identified in this research. Potential mitigation strategies are suggested, include measurements below 4 m according to governmental regulations, dust shields, and atomized water.
Directory of Open Access Journals (Sweden)
Yang Wang
2018-03-01
Full Text Available Particle emissions derived from construction activities have a significant impact on the local air quality, while the canyon effect with reduced natural ventilation contributes to the highest particulate pollution in urban environments. This study attempted to examine the effect of PM10 emissions derived from the construction of a rail transit system in an urban street canyon. Using a 3D computational fluid dynamic (CFD model based on a real street canyon with different height ratios, this study formulates the impact of height ratio and wind directions on the dispersion and concentration of PM10. The results indicate that parallel flow would cause the concentration of PM10 at the end of the street canyons in all height ratios, and the trends in horizontal, vertical and lateral planes in all street canyons are similar. While in the condition of perpendicular flow, double-eddy circulations occur and lead to the concentration of PM10 in the middle part of the street canyon and leeward of backwind buildings in all height ratios. Furthermore, perpendicular flow will cause the concentration of PM10 to increase if the upwind buildings are higher than the backwind ones. This study also shows that the dispersion of PM10 is strongly associated with wind direction in and the height ratios of the street canyons. Certain measures could, therefore, be taken to prevent the impact on people in terms of the PM10 concentration and the heights of street canyons identified in this research. Potential mitigation strategies are suggested, include measurements below 4 m according to governmental regulations, dust shields, and atomized water.
Theory and modeling in nanoscience: Report of the May 10-11, 2002Workshop
Energy Technology Data Exchange (ETDEWEB)
McCurdy, C. William; Stechel, Ellen; Cummings, Peter; Hendrickson, Bruce; Keyes, David
2002-06-28
On May 10 and 11, 2002, a workshop entitled ''Theory and Modeling in Nanoscience'' was held in San Francisco, California, sponsored by the offices of Basic Energy Science and Advanced Scientific Computing Research of the Department of Energy. The Basic Energy Sciences Advisory Committee and the Advanced Scientific Computing Advisory Committee convened the workshop to identify challenges and opportunities for theory, modeling, and simulation in nanoscience and nanotechnology, and additionally to investigate the growing and promising role of applied mathematics and computer science in meeting those challenges. This report is the result of those contributions and the discussions at the workshop.
International Nuclear Information System (INIS)
Sundberg, Jan
2003-04-01
Site investigations are in progress for the siting of a deep repository for spent nuclear fuel. As part of the planning work, strategies are developed for site descriptive modelling regarding different disciplines, amongst them the thermal conditions. The objective of the strategy for a thermal site descriptive model is to guide the practical implementation of evaluating site specific data during the site investigations. It is understood that further development may be needed. The model describes the thermal properties and other thermal parameters of intact rock, fractures and fracture zones, and of the rock mass. The methodology is based on estimation of thermal properties of intact rock and discontinuities, using both empirical and theoretical/numerical approaches, and estimation of thermal processes using mathematical modelling. The methodology will be used and evaluated for the thermal site descriptive modelling at the Aespoe Hard Rock Laboratory
International Nuclear Information System (INIS)
Kleinschmidt, Axel; Nicolai, Hermann
2006-01-01
We construct simple exact solutions to the E 10 /K(E 10 ) coset model by exploiting its integrability. Using the known correspondences with the bosonic sectors of maximal supergravity theories, these exact solutions translate into exact cosmological solutions. In this way, we are able to recover some recently discovered solutions of M-theory exhibiting phases of accelerated expansion, or, equivalently, S-brane solutions, and thereby accommodate such solutions within the E 10 /K(E 10 ) model. We also discuss the situation regarding solutions with non-vanishing (constant) curvature of the internal manifold
Dynamic Simulation of a Periodic 10 K Sorption Cryocooler
Bhandari, P.; Rodriguez, J.; Bard, S.; Wade, L.
1994-01-01
A transient thermal simulation model has been developed to simulate the dynamic performance of a multiple-stage 10 K sorption cryocooler for spacecraft sensor cooling applications that require periodic quick-cooldown (under 2 minutes) , negligible vibration, low power consumption, and long life (5 to 10 years). The model was specifically designed to represent the Brilliant Eyes Ten-Kelvin Sorption Cryocooler Experiment (BETSCE), but it can be adapted to represent other sorption cryocooler systems as well. The model simulates the heat transfer, mass transfer, and thermodynamic processes in the cryostat and the sorbent beds for the entire refrigeration cycle, and includes the transient effects of variable hydrogen supply pressures due to expansion and overflow of hydrogen during the cooldown operation. The paper describes model limitations and simplifying assumptions, with estimates of errors induced by them, and presents comparisons of performance predictions with ground experiments. An important benefit of the model is its ability to predict performance sensitivities to variations of key design and operational parameters. The insights thus obtained are expected to lead to higher efficiencies and lower weights for future designs.
2010-07-01
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 9-10 Series Airplanes, DC-9-30 Series... previously to all known U.S. owners and operators of the McDonnell Douglas Corporation airplanes identified... INFORMATION: On July 15, 2009, we issued AD 2009-15-16, which applies to all McDonnell Douglas Model DC-9-10...
Mixing of ν/sub e/ and ν/sub μ/ in SO(10) models
International Nuclear Information System (INIS)
Milton, K.; Nandi, S.; Tanaka, K.
1982-01-01
We found previously in SO(10) grand unified theories that if the neutrinos have a Dirac mass and a right-handed Majorana mass (approx.10 15 GeV) but no left-handed Majorana mass, there is small ν/sub e/ mixing but ν/sub μ/-ν/sub tau/ mixing can be substantial. We reexamine this problem on the basis of a formalism that assumes that the up, down, lepton, and neutrino mass matrices arise from a single complex 10 and a single 126 Higgs boson. This formalism determines the Majorana mass matrix in terms of quark mass matrices. Adopting three different sets of quark mass matrices that produce acceptable fermion mass ratios and Cabbibo mixing, we obtain results consistent with the above; however, in the optimum case, ν/sub e/-ν/sub μ/ mixing can be of the order of the Cabbibo angle. In an extension of this model wherein the Witten mechanism generates the Majorana mass, we illustrate quantitatively how the parameter characterizing the Majorana sector must be tuned in order to achieve large ν/sub e/-ν/sub μ/ mixing
Adalbjörnsson, Björn V; Toogood, Helen S; Fryszkowska, Anna; Pudney, Christopher R; Jowitt, Thomas A; Leys, David; Scrutton, Nigel S
2010-01-25
We report the crystal structure of a thermophilic "ene" reductase (TOYE) isolated from Thermoanaerobacter pseudethanolicus E39. The crystal structure reveals a tetrameric enzyme and an active site that is relatively large compared to most other structurally determined and related Old Yellow Enzymes. The enzyme adopts higher order oligomeric states (octamers and dodecamers) in solution, as revealed by sedimentation velocity and multiangle laser light scattering. Bead modelling indicates that the solution structure is consistent with the basic tetrameric structure observed in crystallographic studies and electron microscopy. TOYE is stable at high temperatures (T(m)>70 degrees C) and shows increased resistance to denaturation in water-miscible organic solvents compared to the mesophilic Old Yellow Enzyme family member, pentaerythritol tetranitrate reductase. TOYE has typical ene-reductase properties of the Old Yellow Enzyme family. There is currently major interest in using Old Yellow Enzyme family members in the preparative biocatalysis of a number of activated alkenes. The increased stability of TOYE in organic solvents is advantageous for biotransformations in which water-miscible organic solvents and biphasic reaction conditions are required to both deliver novel substrates and minimize product racemisation.
Kumar, Raj; Son, Minky; Bavi, Rohit; Lee, Yuno; Park, Chanin; Arulalapperumal, Venkatesh; Cao, Guang Ping; Kim, Hyong-ha; Suh, Jung-keun; Kim, Yong-seong; Kwon, Yong Jung; Lee, Keun Woo
2015-08-01
Recent evidence suggests that aldo-keto reductase family 1 B10 (AKR1B10) may be a potential diagnostic or prognostic marker of human tumors, and that AKR1B10 inhibitors offer a promising choice for treatment of many types of human cancers. The aim of this study was to identify novel chemical scaffolds of AKR1B10 inhibitors using in silico approaches. The 3D QSAR pharmacophore models were generated using HypoGen. A validated pharmacophore model was selected for virtual screening of 4 chemical databases. The best mapped compounds were assessed for their drug-like properties. The binding orientations of the resulting compounds were predicted by molecular docking. Density functional theory calculations were carried out using B3LYP. The stability of the protein-ligand complexes and the final binding modes of the hit compounds were analyzed using 10 ns molecular dynamics (MD) simulations. The best pharmacophore model (Hypo 1) showed the highest correlation coefficient (0.979), lowest total cost (102.89) and least RMSD value (0.59). Hypo 1 consisted of one hydrogen-bond acceptor, one hydrogen-bond donor, one ring aromatic and one hydrophobic feature. This model was validated by Fischer's randomization and 40 test set compounds. Virtual screening of chemical databases and the docking studies resulted in 30 representative compounds. Frontier orbital analysis confirmed that only 3 compounds had sufficiently low energy band gaps. MD simulations revealed the binding modes of the 3 hit compounds: all of them showed a large number of hydrogen bonds and hydrophobic interactions with the active site and specificity pocket residues of AKR1B10. Three compounds with new structural scaffolds have been identified, which have stronger binding affinities for AKR1B10 than known inhibitors.
SDG fermion-pair algebraic SO(12) and Sp(10) models and their boson realizations
International Nuclear Information System (INIS)
Navatil, P.; Geyer, H.B.; Dobes, J.
1995-01-01
It is shown how the boson mapping formalism may be applied as a useful many-body tool to solve a fermion problem. This is done in the context of generalized Ginocchio models for which the authors introduce S-, D-, and G-pairs of fermions and subsequently construct the sdg-boson realizations of the generalized Dyson type. The constructed SO(12) and Sp(10) fermion models are solved beyond the explicit symmetry limits. Phase transitions to rotational structures are obtained also in situations where there is no underlying SU(3) symmetry. 34 refs., 5 figs., 2 tabs
LANL* V1.0: a radiation belt drift shell model suitable for real-time and reanalysis applications
Directory of Open Access Journals (Sweden)
J. Koller
2009-07-01
Full Text Available We describe here a new method for calculating the magnetic drift invariant, L*, that is used for modeling radiation belt dynamics and for other space weather applications. L* (pronounced L-star is directly proportional to the integral of the magnetic flux contained within the surface defined by a charged particle moving in the Earth's geomagnetic field. Under adiabatic changes to the geomagnetic field L* is a conserved quantity, while under quasi-adiabatic fluctuations diffusion (with respect to a particle's L* is the primary term in equations of particle dynamics. In particular the equations of motion for the very energetic particles that populate the Earth's radiation belts are most commonly expressed by diffusion in three dimensions: L*, energy (or momentum, and pitch angle (the dot product of velocity and the magnetic field vector. Expressing dynamics in these coordinates reduces the dimensionality of the problem by referencing the particle distribution functions to values at the magnetic equatorial point of a magnetic "drift shell" (or L-shell irrespective of local time (or longitude. While the use of L* aids in simplifying the equations of motion, practical applications such as space weather forecasting using realistic geomagnetic fields require sophisticated magnetic field models that, in turn, require computationally intensive numerical integration. Typically a single L* calculation can require on the order of 105 calls to a magnetic field model and each point in the simulation domain and each calculated pitch angle has a different value of L*. We describe here the development and validation of a neural network surrogate model for calculating L* in sophisticated geomagnetic field models with a high degree of fidelity at computational speeds that are millions of times faster than direct numerical field line mapping and integration. This new surrogate model has
DEFF Research Database (Denmark)
Gallice, Aurélie; Birkved, Morten; Kech, Sébastien
obtained applying SewageLCI 1.0 model reveal that it’s possible to account for many of the variations in emission quantities of chemicals, caused by variations in the chemical fate properties and in the composition of national waste water treatment grids. The results indicate that the total emission...... treatment is emission to surface water recipients, other environmental compartments such as agricultural soil may receive considerable loads of chemicals emitted by the national specific waste water grids. The SewageLCI 1.0 presentation and case study reveal how broad inclusion of chemicals emitted......Lack of inventory data on chemical emissions often forces life cycle assessors to rely on crude emissions estimates (e.g. 100 % of the applied chemical mass is assumed emitted) or in the worst case to omit chemical emissions due to lack of emission data. The inventory model SewageLCI 1.0, provides...
OpenDrift v1.0: a generic framework for trajectory modelling
Dagestad, Knut-Frode; Röhrs, Johannes; Breivik, Øyvind; Ådlandsvik, Bjørn
2018-04-01
OpenDrift is an open-source Python-based framework for Lagrangian particle modelling under development at the Norwegian Meteorological Institute with contributions from the wider scientific community. The framework is highly generic and modular, and is designed to be used for any type of drift calculations in the ocean or atmosphere. A specific module within the OpenDrift framework corresponds to a Lagrangian particle model in the traditional sense. A number of modules have already been developed, including an oil drift module, a stochastic search-and-rescue module, a pelagic egg module, and a basic module for atmospheric drift. The framework allows for the ingestion of an unspecified number of forcing fields (scalar and vectorial) from various sources, including Eulerian ocean, atmosphere and wave models, but also measurements or a priori values for the same variables. A basic backtracking mechanism is inherent, using sign reversal of the total displacement vector and negative time stepping. OpenDrift is fast and simple to set up and use on Linux, Mac and Windows environments, and can be used with minimal or no Python experience. It is designed for flexibility, and researchers may easily adapt or write modules for their specific purpose. OpenDrift is also designed for performance, and simulations with millions of particles may be performed on a laptop. Further, OpenDrift is designed for robustness and is in daily operational use for emergency preparedness modelling (oil drift, search and rescue, and drifting ships) at the Norwegian Meteorological Institute.
Cai, Jun; Lei, Ying; Wang, Kuaishe; Zhang, Xiaolu; Miao, Chengpeng; Li, Wenbing
2016-05-01
True stress and true strain data obtained from isothermal compression tests on a Gleeble-3800 thermo-mechanical simulator, in a wide range of temperatures (1073-1323 K) and strain rates (0.001-10 s-1), has been used to evaluate the material constants of two constitutive models: the modified Zerilli-Armstrong and the strain compensation Arrhenius-type models. Furthermore, a comparative study was conducted on the capabilities of the two models in order to represent the elevated temperature flow behavior of BFe10-1-2 cupronickel alloy. The suitability levels of these two models were evaluated by comparing the accuracy of their predictions of deformation behavior, correlation coefficient ( R), average absolute relative error ( AARE), relative errors of prediction, and the number of material constants. The results show that the predicted values of these two models agree well with the experimental values of BFe10-1-2 cupronickel alloy except at the temperature of 1123 K and the strain rate of 1 s-1. Meanwhile, the strain compensated Arrhenius-type model can track the deformation behavior of BFe10-1-2 cupronickel alloy more accurately throughout the entire temperature and strain rate range, while fewer material constants are involved in the modified Zerilli-Armstrong model.
Roy, Debananda; Singh, Gurdeep; Yadav, Pankaj
2016-10-01
Source apportionment study of PM 10 (Particulate Matter) in a critically polluted area of Jharia coalfield, India has been carried out using Dispersion model, Principle Component Analysis (PCA) and Chemical Mass Balance (CMB) techniques. Dispersion model Atmospheric Dispersion Model (AERMOD) was introduced to simplify the complexity of sources in Jharia coalfield. PCA and CMB analysis indicates that monitoring stations near the mining area were mainly affected by the emission from open coal mining and its associated activities such as coal transportation, loading and unloading of coal. Mine fire emission also contributed a considerable amount of particulate matters in monitoring stations. Locations in the city area were mostly affected by vehicular, Liquid Petroleum Gas (LPG) & Diesel Generator (DG) set emissions, residential, and commercial activities. The experimental data sampling and their analysis could aid understanding how dispersion based model technique along with receptor model based concept can be strategically used for quantitative analysis of Natural and Anthropogenic sources of PM 10 . Copyright © 2016. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
S. G. Tsyro
2005-01-01
Full Text Available Inter-comparisons of European air quality models show that regional transport models, including the EMEP (Co-operative Programme for monitoring and evaluation of the long-range transmission of air pollutants in Europe aerosol model, tend to underestimate the observed concentrations of PM10 and PM2.5. Obviously, an accurate representation of the individual aerosol constituents is a prerequisite for adequate calculation of PM concentrations. On the other hand, available measurements on the chemical characterization of ambient particles reveal that full chemical PM mass closure is rarely achieved. The fraction unaccounted for by chemical analysis can comprise as much as 30-40% of gravimetric PM10 or PM2.5 mass. The unaccounted PM mass can partly be due to non-C atoms in organic aerosols and/or due to sampling and measurement artefacts. Moreover, a part of the unaccounted PM mass is likely to consist of water associated with particles. Thus, the gravimetrically measured particle mass does not necessarily represent dry PM10 and PM2.5 mass. This is thought to be one of the reasons for models under-prediction of observed PM, if calculated dry PM10 and PM2.5 concentrations are compared with measurements. The EMEP aerosol model has been used to study to what extent particle-bound water can explain the chemically unidentified PM mass in filter-based particle samples. Water content of PM2.5 and PM10 has been estimated with the model for temperature 20°C and relative humidity 50%, which are conditions required for equilibration of dust-loaded filters according to the Reference method recommended by the European Committee for Standardization (CEN. Model calculations for Europe show that, depending on particle composition, particle-bound water constitutes 20-35% of the annual mean PM10 and PM2.5 concentrations, which is consistent with existing experimental estimates. At two Austrian sites, in Vienna and Streithofen, where daily measurements of PM2.5 mass
International Nuclear Information System (INIS)
Rouan, D.; Deeg, H. J.; Demangeon, O.; Samuel, B.; Cavarroc, C.; Léger, A.; Fegley, B.
2011-01-01
The Kepler mission has made an important observation: the first detection of photons from a terrestrial planet by observing its phase curve (Kepler-10b). This opens a new field in exoplanet science: the possibility of obtaining information about the atmosphere and surface of rocky planets, objects of prime interest. In this Letter, we apply the Lava-ocean model to interpret the observed phase curve. The model, a planet without atmosphere and a surface partially made of molten rocks, has been proposed for planets of the class of CoRoT-7b, i.e., rocky planets very close to their star (at a few stellar radii). Kepler-10b is a typical member of this family. It predicts that the light from the planet has an important emission component in addition to the reflected one, even in the Kepler spectral band. Assuming an isotropical reflection of light by the planetary surface (Lambertian-like approximation), we find that a Bond albedo of ∼50% can account for the observed amplitude of the phase curve, as opposed to a first attempt where an unusually high value was found. We propose a physical process to explain this still large value of the albedo. The overall interpretation can be tested in the future with instruments such as the James Webb Space Telescope or the Exoplanet Characterization Observatory. Our model predicts a spectral dependence that is clearly distinguishable from that of purely reflected light and from that of a planet at a uniform temperature.
Power deposition in a cylindrical geometry using B-10 coatings
International Nuclear Information System (INIS)
Chung, A.K.; Prelas, M.A.
1983-01-01
The transport of charged particles produced by 10 B (n, α) Li and 235 U (n, νn) ff nuclear reactions in a two region cylindrical geometry is predicted. We employed a mean-range straight-flight approximation to calculate the power deposition by the charged particles in a gaseous medium. Our model demonstrated some features in a cylindrical experiment which were suspected but not proven. In the common slab model used by Guyot et al 1 and Romero 2 , the spatial distribution of power deposition is much flatter than it would be in a cylindrical model. A steeper gradient in the power deposition is expected in a cylindrical geometry than in a slab geometry. We also found that for a standard thickness of Boron-10 coating (1.73 μm) used in NPLs, the expected efficiency of a cylindrical geometry (7.5%) is much lower than the 12% efficiency predicted by the slab model. Indeed the use of slab geometry in modeling current NPL experimental devices is not accurate
Subotin, Michael; Davis, Anthony R
2016-09-01
Natural language processing methods for medical auto-coding, or automatic generation of medical billing codes from electronic health records, generally assign each code independently of the others. They may thus assign codes for closely related procedures or diagnoses to the same document, even when they do not tend to occur together in practice, simply because the right choice can be difficult to infer from the clinical narrative. We propose a method that injects awareness of the propensities for code co-occurrence into this process. First, a model is trained to estimate the conditional probability that one code is assigned by a human coder, given than another code is known to have been assigned to the same document. Then, at runtime, an iterative algorithm is used to apply this model to the output of an existing statistical auto-coder to modify the confidence scores of the codes. We tested this method in combination with a primary auto-coder for International Statistical Classification of Diseases-10 procedure codes, achieving a 12% relative improvement in F-score over the primary auto-coder baseline. The proposed method can be used, with appropriate features, in combination with any auto-coder that generates codes with different levels of confidence. The promising results obtained for International Statistical Classification of Diseases-10 procedure codes suggest that the proposed method may have wider applications in auto-coding. © The Author 2016. Published by Oxford University Press on behalf of the American Medical Informatics Association. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Lulli, Matteo; Witort, Ewa; Papucci, Laura; Torre, Eugenio; Schipani, Christian; Bergamini, Christian; Dal Monte, Massimo; Capaccioli, Sergio
2012-12-17
To evaluate if coenzyme Q10 (CoQ10) can protect retinal ganglion cells (RGCs) from apoptosis and, when instilled as eye drops on the cornea, if it can reach the retina and exert its antiapoptotic activity in this area in a mouse model of kainate (KA)-induced retinal damage. Rat primary or cultured RGCs were subjected to glutamate (50 μM) or chemical hypoxia (Antimycin A, 200 μM) or serum withdrawal (FBS, 0.5%) in the presence or absence of CoQ10 (10 μM). Cell viability was evaluated by light microscopy and fluorescence-activated cell sorting analyses. Apoptosis was evaluated by caspase 3/7 activity and mitochondrion depolarization tetramethylrhodamine ethyl ester analysis. CoQ10 transfer to the retina following its instillation as eye drops on the cornea was quantified by HPLC. Retinal protection by CoQ10 (10 μM) eye drops instilled on the cornea was then evaluated in a mouse model of KA-induced excitotoxic retinal cell apoptosis by cleaved caspase 3 immunohistofluorescence, caspase 3/7 activity assays, and quantification of inhibition of RGC loss. CoQ10 significantly increased viable cells by preventing RGC apoptosis. Furthermore, when topically applied as eye drops to the cornea, it reached the retina, thus substantially increasing local CoQ10 concentration and protecting retinal layers from apoptosis. The ability of CoQ10 eye drops to protect retinal cells from apoptosis in the mouse model of KA-induced retinal damage suggests that topical CoQ10 may be evaluated in designing therapies for treating apoptosis-driven retinopathies.
OpenDrift v1.0: a generic framework for trajectory modelling
Directory of Open Access Journals (Sweden)
K.-F. Dagestad
2018-04-01
Full Text Available OpenDrift is an open-source Python-based framework for Lagrangian particle modelling under development at the Norwegian Meteorological Institute with contributions from the wider scientific community. The framework is highly generic and modular, and is designed to be used for any type of drift calculations in the ocean or atmosphere. A specific module within the OpenDrift framework corresponds to a Lagrangian particle model in the traditional sense. A number of modules have already been developed, including an oil drift module, a stochastic search-and-rescue module, a pelagic egg module, and a basic module for atmospheric drift. The framework allows for the ingestion of an unspecified number of forcing fields (scalar and vectorial from various sources, including Eulerian ocean, atmosphere and wave models, but also measurements or a priori values for the same variables. A basic backtracking mechanism is inherent, using sign reversal of the total displacement vector and negative time stepping. OpenDrift is fast and simple to set up and use on Linux, Mac and Windows environments, and can be used with minimal or no Python experience. It is designed for flexibility, and researchers may easily adapt or write modules for their specific purpose. OpenDrift is also designed for performance, and simulations with millions of particles may be performed on a laptop. Further, OpenDrift is designed for robustness and is in daily operational use for emergency preparedness modelling (oil drift, search and rescue, and drifting ships at the Norwegian Meteorological Institute.
International Nuclear Information System (INIS)
Bruhov, R.E.; Finkel, F.V.
2013-01-01
In 2006-2010 by the commission of the Radiation and Nuclear Safety Authority in Finland applied scientific research and development of a new model of an anthropomorphic radio dosimetric phantom of the human body (the Phantom) were performed, after the development of the production technology and initial testing in 2010-2012 the first serial copy of the Phantom under the name ARDF-10 ROMAN was produced. The main application of the new model of the Phantom ARDF-10 ROMAN: - increase of the precision of calibration and implementation of the periodic monitoring of Whole body counters (WBC) equipment, standardization of measurement procedure for inter-laboratory comparisons of the incorporated activity. - metrological support of the development and implementation of new methods for human radiation spectrometry: identification of radionuclide content of incorporated activity in the human body; measurements of the activity of incorporated technogenic and natural radionuclides in the whole body and in the lungs; measurements of 90 Sr content in the bone tissue. Study of the mechanisms of the intake, distribution, accumulation and excretion of the radionuclides in the human body, such as: daughter products of 222 Rn decay in the respiratory tract, 241 Am, other transuranic elements; isotopes of iodine in the thyroid gland; radiopharmaceuticals administered to patients for diagnostic and medicinal purposes. Obtaining estimates of spatial-temporal distribution of individual internal exposure dose of a human. The result of the work of recent years has been the creation of hygienic safe standard sample of an anthropomorphic radio dosimetric phantom of the human body ARDF-10 ROMAN, consisting of 4 anthropometric models of body parts, which are independent assembly units (head phantom, neck phantom, torso phantom, knee phantom). Phantom models are made from simulators of bone, soft (muscle) and lungs biological tissue. The Phantom contains 28 separate elements. To the first
Gravity model improvement using GEOS-3 (GEM 9 and 10)
Lerch, F. J.; Klosko, S. M.; Laubscher, R. E.; Wagner, C. A.
1977-01-01
The use of collocation permitted GEM 9 to be a larger field than previous derived satellite models, GEM 9 having harmonics complete to 20 x 20 with selected higher degree terms. The satellite data set has approximately 840,000 observations, of which 200,000 are laser ranges taken on 9 satellites equipped with retroreflectors. GEM 10 is complete to 22 x 22 with selected higher degree terms out to degree and order 30 amounting to a total of 592 coefficients. Comparisons with surface gravity and altimeter data indicate a substantial improvement in GEM 9 over previous satellite solutions; GEM 9 is in even closer agreement with surface data than the previously published GEM 6 solution which contained surface gravity. In particular the free air gravity anomalies calculated from GEM 9 and a surface gravity solution are in excellent agreement for the high degree terms.
Murguia-Flores, Fabiola; Arndt, Sandra; Ganesan, Anita L.; Murray-Tortarolo, Guillermo; Hornibrook, Edward R. C.
2018-06-01
Soil bacteria known as methanotrophs are the sole biological sink for atmospheric methane (CH4), a potent greenhouse gas that is responsible for ˜ 20 % of the human-driven increase in radiative forcing since pre-industrial times. Soil methanotrophy is controlled by a plethora of factors, including temperature, soil texture, moisture and nitrogen content, resulting in spatially and temporally heterogeneous rates of soil methanotrophy. As a consequence, the exact magnitude of the global soil sink, as well as its temporal and spatial variability, remains poorly constrained. We developed a process-based model (Methanotrophy Model; MeMo v1.0) to simulate and quantify the uptake of atmospheric CH4 by soils at the global scale. MeMo builds on previous models by Ridgwell et al. (1999) and Curry (2007) by introducing several advances, including (1) a general analytical solution of the one-dimensional diffusion-reaction equation in porous media, (2) a refined representation of nitrogen inhibition on soil methanotrophy, (3) updated factors governing the influence of soil moisture and temperature on CH4 oxidation rates and (4) the ability to evaluate the impact of autochthonous soil CH4 sources on uptake of atmospheric CH4. We show that the improved structural and parametric representation of key drivers of soil methanotrophy in MeMo results in a better fit to observational data. A global simulation of soil methanotrophy for the period 1990-2009 using MeMo yielded an average annual sink of 33.5 ± 0.6 Tg CH4 yr-1. Warm and semi-arid regions (tropical deciduous forest and open shrubland) had the highest CH4 uptake rates of 602 and 518 mg CH4 m-2 yr-1, respectively. In these regions, favourable annual soil moisture content ( ˜ 20 % saturation) and low seasonal temperature variations (variations < ˜ 6 °C) provided optimal conditions for soil methanotrophy and soil-atmosphere gas exchange. In contrast to previous model analyses, but in agreement with recent observational data
Energy Technology Data Exchange (ETDEWEB)
Park, Joo-Hyun; Park, Hyun Sun; Kim, Moo Hwan [POSTECH, Pohang (Korea, Republic of); Bae, Sung Won; Cha, Jae-Eun [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2016-10-15
In this study, recuperation cycle was chosen as a reference loop design and the MARS code was chosen as the transient cycle analysis code. Cycle design condition is focus on operation point of the light-water reactor. Development of a transient model was performed for 10MW-electron SCO{sub 2} coupled with light water reactors. In order to perform transient analysis, cycle transient model was developed and steady-state run was performed and presented in the paper. In this study, the transient model of SCO{sub 2} recuperation Brayton cycle was developed and implemented in MARS to study the steady-state simulation. We performed nodalization of the transient model using MARS code and obtained steady-state results. This study is shown that the supercritical CO{sub 2} Brayton cycle can be used as a power conversion system for light water reactors. Future work will include transient analysis such as partial road operation, power swing, start-up, and shutdown. Cycle control strategy will be considered for various control method.
Directory of Open Access Journals (Sweden)
J.-C. Raut
2011-10-01
Full Text Available An innovative approach using mobile lidar measurements was implemented to test the performances of chemistry-transport models in simulating mass concentrations (PM10 predicted by chemistry-transport models. A ground-based mobile lidar (GBML was deployed around Paris onboard a van during the MEGAPOLI (Megacities: Emissions, urban, regional and Global Atmospheric POLlution and climate effects, and Integrated tools for assessment and mitigation summer experiment in July 2009. The measurements performed with this Rayleigh-Mie lidar are converted into PM10 profiles using optical-to-mass relationships previously established from in situ measurements performed around Paris for urban and peri-urban aerosols. The method is described here and applied to the 10 measurements days (MD. MD of 1, 15, 16 and 26 July 2009, corresponding to different levels of pollution and atmospheric conditions, are analyzed here in more details. Lidar-derived PM10 are compared with results of simulations from POLYPHEMUS and CHIMERE chemistry-transport models (CTM and with ground-based observations from the AIRPARIF network. GBML-derived and AIRPARIF in situ measurements have been found to be in good agreement with a mean Root Mean Square Error RMSE (and a Mean Absolute Percentage Error MAPE of 7.2 μg m−3 (26.0% and 8.8 μg m−3 (25.2% with relationships assuming peri-urban and urban-type particles, respectively. The comparisons between CTMs and lidar at ~200 m height have shown that CTMs tend to underestimate wet PM10 concentrations as revealed by the mean wet PM10 observed during the 10 MD of 22.4, 20.0 and 17.5 μg m−3 for lidar with peri-urban relationship, and POLYPHEMUS and CHIMERE models, respectively. This leads to a RMSE (and a MAPE of 6.4 μg m−3 (29.6% and 6.4 μg m−3 (27.6% when considering POLYPHEMUS and CHIMERE CTMs, respectively. Wet integrated PM10 computed (between the ground and 1 km above the ground level from lidar, POLYPHEMUS and CHIMERE results
Location and activity of ubiquinone 10 and ubiquinone analogues in model and biological membranes
International Nuclear Information System (INIS)
Cornell, B.A.; Keniry, M.A.; Post, A.; Roberston, R.N.; Weir, L.E.; Westerman, P.W.
1987-01-01
Deuteriated analogues of ubiquinone 10 (Q 10 ) have been dispersed with plasma membranes of Escherichia coli and with the inner membranes of beetroot mitochondria. Orientational order at various deuteriated sites was measured by solid-state deuterium nuclear magnetic resonance ( 2 H NMR). Similar measurements were made, using the compounds dispersed in dimyristoylphosphatidylcholine (DMPC) and egg yolk lecithin and dispersions prepared from the lipid extracts of beetroot mitochondria. In all cases only a single unresolved 2 H NMR spectrum (typically 1000-Hz full width at half-height) was observed at concentrations down to 0.02 mol % Q 10 per membrane lipid. This result shows that most Q 10 is in a mobile environment which is physically separate from the orientational constraints of the bilayer lipid chains. In contrast, a short-chain analog of Q 10 , in which the 10 isoprene groups have been replaced by a perdeuteriated tridecyl chain, showed 2 H NMR spectra with quadrupolar splittings typical of an ordered lipid that is intercalated into the bilayer. The NADH oxidase activity and O 2 uptake in Escherichia coli and in mitochondria were independent of which analog was incorporated into the membrane. Thus, despite the major difference in their physical association with membranes, or their lipid extracts, the electron transport function of the long- and short-chain ubiquinones is similar, suggesting that the bulk of the long-chain ubiquinone does not have a direct function in electron transporting activity. The physiologically active Q 10 may only be a small fraction of the total ubiquinone, a fraction that is below the level of detection of the present NMR equipment. However, our results do not support any model of Q 10 electron transport action that includes intercalation of the long isoprenoid chain in lipid
Magnetic Modeling of Inflated Low-mass Stars Using Interior Fields No Larger than ˜10 kG
MacDonald, James; Mullan, D. J.
2017-11-01
We have previously reported on models of low-mass stars in which the presence of inflated radii is ascribed to magnetic fields that impede the onset of convection. Some of our magneto-convection models have been criticized because, when they were first reported by Mullan & MacDonald, the deep interior fields were found to be very large (50-100 MG). Such large fields are now known to be untenable. For example, Browning et al. used stability arguments to suggest that interior fields in low-mass stars cannot be larger than ˜1 MG. Moreover, 3D models of turbulent stellar dynamos suggest that fields generated in low-mass interiors may be not much stronger than 10-20 kG. In the present paper, we present magneto-convective models of inflated low-mass stars in which the interior fields are not permitted to be stronger than 10 kG. These models are used to fit empirical data for 15 low-mass stars for which precise masses and radii have been measured. We show that our 10 kG magneto-convective models can replicate the empirical radii and effective temperatures for 14 of the stars. In the case of the remaining star (in the Praesepe cluster), two different solutions have been reported in the literature. We find that one of these solutions can be fitted well with our model using the nominal age of Praesepe (800 Myr). However, the second solution cannot be fitted unless the star’s age is assumed to be much younger (˜150 Myr).
Energy Technology Data Exchange (ETDEWEB)
De Abrew, K. Nadira [Molecular and Environmental Toxicology Center, University of Wisconsin—Madison, Madison, WI 53706 (United States); Thomas-Virnig, Christina L.; Rasmussen, Cathy A. [Department of Pathology, University of Wisconsin—Madison, Madison, WI 53706 (United States); Bolterstein, Elyse A. [Molecular and Environmental Toxicology Center, University of Wisconsin—Madison, Madison, WI 53706 (United States); Schlosser, Sandy J. [Department of Pathology, University of Wisconsin—Madison, Madison, WI 53706 (United States); Allen-Hoffmann, B. Lynn, E-mail: blallenh@wisc.edu [Molecular and Environmental Toxicology Center, University of Wisconsin—Madison, Madison, WI 53706 (United States); Department of Pathology, University of Wisconsin—Madison, Madison, WI 53706 (United States)
2014-05-01
The epidermis of skin is the first line of defense against the environment. A three dimensional model of human skin was used to investigate tissue-specific phenotypes induced by the environmental contaminant, 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD). Continuous treatment of organotypic cultures of human keratinocytes with TCDD resulted in intracellular spaces between keratinocytes of the basal and immediately suprabasal layers as well as thinning of the basement membrane, in addition to the previously reported hyperkeratinization. These tissue remodeling events were preceded temporally by changes in expression of the extracellular matrix degrading enzyme, matrix metalloproteinase-10 (MMP-10). In organotypic cultures MMP-10 mRNA and protein were highly induced following TCDD treatment. Q-PCR and immunoblot results from TCDD-treated monolayer cultures, as well as indirect immunofluorescence and immunoblot analysis of TCDD-treated organotypic cultures, showed that MMP-10 was specifically contributed by the epidermal keratinocytes but not the dermal fibroblasts. Keratinocyte-derived MMP-10 protein accumulated over time in the dermal compartment of organotypic cultures. TCDD-induced epidermal phenotypes in organotypic cultures were attenuated by the keratinocyte-specific expression of tissue inhibitor of metalloproteinase-1, a known inhibitor of MMP-10. These studies suggest that MMP-10 and possibly other MMP-10-activated MMPs are responsible for the phenotypes exhibited in the basement membrane, the basal keratinocyte layer, and the cornified layer of TCDD-treated organotypic cultures. Our studies reveal a novel mechanism by which the epithelial–stromal microenvironment is altered in a tissue-specific manner thereby inducing structural and functional pathology in the interfollicular epidermis of human skin. - Highlights: • TCDD causes hyperkeratosis and basement membrane changes in a model of human skin. • TCDD induces MMP-10 expression in organotypic cultures
Orphan, V J; Taylor, L T; Hafenbradl, D; Delong, E F
2000-02-01
Recent investigations of oil reservoirs in a variety of locales have indicated that these habitats may harbor active thermophilic prokaryotic assemblages. In this study, we used both molecular and culture-based methods to characterize prokaryotic consortia associated with high-temperature, sulfur-rich oil reservoirs in California. Enrichment cultures designed for anaerobic thermophiles, both autotrophic and heterotrophic, were successful at temperatures ranging from 60 to 90 degrees C. Heterotrophic enrichments from all sites yielded sheathed rods (Thermotogales), pleomorphic rods resembling Thermoanaerobacter, and Thermococcus-like isolates. The predominant autotrophic microorganisms recovered from inorganic enrichments using H(2), acetate, and CO(2) as energy and carbon sources were methanogens, including isolates closely related to Methanobacterium, Methanococcus, and Methanoculleus species. Two 16S rRNA gene (rDNA) libraries were generated from total community DNA collected from production wellheads, using either archaeal or universal oligonucleotide primer sets. Sequence analysis of the universal library indicated that a large percentage of clones were highly similar to known bacterial and archaeal isolates recovered from similar habitats. Represented genera in rDNA clone libraries included Thermoanaerobacter, Thermococcus, Desulfothiovibrio, Aminobacterium, Acidaminococcus, Pseudomonas, Halomonas, Acinetobacter, Sphingomonas, Methylobacterium, and Desulfomicrobium. The archaeal library was dominated by methanogen-like rDNAs, with a lower percentage of clones belonging to the Thermococcales. Our results strongly support the hypothesis that sulfur-utilizing and methane-producing thermophilic microorganisms have a widespread distribution in oil reservoirs and the potential to actively participate in the biogeochemical transformation of carbon, hydrogen, and sulfur in situ.
Constructive characteristics and calculation test of the CTN-10-3/92 accelerator model
International Nuclear Information System (INIS)
Armas Cardona, R.; Garcia Rodriguez, R.; Calderon Pinar, F.
1996-01-01
In the present report is accomplished a short technical justification on the use of accelerometers in mechanical in mechanical vibration measurements and its theoretical basis. The principal objective is the presentation of the constructive solution of the CTN-10-3/92 accelerometer model, as well as the results of the calibration projects that permitted to determine the sensibility, the capacitance, the dielectric permissivity, the open circuit voltage, the piezoelectric constant and the frequency response. Finally, it is offered a technical valuation of obtained results
Cosmic rays: the spectrum and chemical composition from 10{sup 10} to 10{sup 20} eV
Energy Technology Data Exchange (ETDEWEB)
Peixoto, C.J. Todero; De Souza, Vitor [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-carlense 400, São Carlos (Brazil); Biermann, Peter L., E-mail: toderocj@usp.br, E-mail: vitor@ifsc.usp.br, E-mail: plbiermann@mpifr-bonn.mpg.de [Max-Planck-Institute for Radioastronomy, Auf dem Hügel 69, 53121 Bonn (Germany)
2015-07-01
The production of energetic particles in the universe remains one of the great mysteries of modern science. The mechanisms of acceleration in astrophysical sources and the details about the propagation through the galactic and extragalactic media are still to be defined. In recent years, the cosmic ray flux has been measured with high precision in the energy range from 10{sup 10} to 10{sup 20.5} eV by several experiments using different techniques. In some energy ranges, it has been possible to determine the flux of individual elements (hydrogen to iron nuclei). This paper explores an astrophysical scenario in which only our Galaxy and the radio galaxy Cen A produce all particles measured on Earth in the energy range from 10{sup 10} to 10{sup 20.5} eV . Data from AMS-02, CREAM, KASCADE, KASCADE-Grande and the Pierre Auger Observatories are considered. The model developed here is compared to the total and if available to the individual particle flux of the experiments considered.The flux of each element as determined by AMS-02, CREAM, KASCADE and KASCADE-Grande and the mass sensitivity parameter X{sub max} measured by the Pierre Auger Observatory above 10 eV are also explored within the framework of the model. The transition from 10{sup 16} to 10{sup 18} eV is carefully analyzed. It is shown that the flux measured in this energy range suggest the existence of an extra component of cosmic rays yet to be understood.
Directory of Open Access Journals (Sweden)
F. Murguia-Flores
2018-06-01
Full Text Available Soil bacteria known as methanotrophs are the sole biological sink for atmospheric methane (CH4, a potent greenhouse gas that is responsible for ∼ 20 % of the human-driven increase in radiative forcing since pre-industrial times. Soil methanotrophy is controlled by a plethora of factors, including temperature, soil texture, moisture and nitrogen content, resulting in spatially and temporally heterogeneous rates of soil methanotrophy. As a consequence, the exact magnitude of the global soil sink, as well as its temporal and spatial variability, remains poorly constrained. We developed a process-based model (Methanotrophy Model; MeMo v1.0 to simulate and quantify the uptake of atmospheric CH4 by soils at the global scale. MeMo builds on previous models by Ridgwell et al. (1999 and Curry (2007 by introducing several advances, including (1 a general analytical solution of the one-dimensional diffusion–reaction equation in porous media, (2 a refined representation of nitrogen inhibition on soil methanotrophy, (3 updated factors governing the influence of soil moisture and temperature on CH4 oxidation rates and (4 the ability to evaluate the impact of autochthonous soil CH4 sources on uptake of atmospheric CH4. We show that the improved structural and parametric representation of key drivers of soil methanotrophy in MeMo results in a better fit to observational data. A global simulation of soil methanotrophy for the period 1990–2009 using MeMo yielded an average annual sink of 33.5 ± 0.6 Tg CH4 yr−1. Warm and semi-arid regions (tropical deciduous forest and open shrubland had the highest CH4 uptake rates of 602 and 518 mg CH4 m−2 yr−1, respectively. In these regions, favourable annual soil moisture content ( ∼ 20 % saturation and low seasonal temperature variations (variations < ∼ 6 °C provided optimal conditions for soil methanotrophy and soil–atmosphere gas exchange
Bean model and ac losses in Bi2Ca2Cu3O10/Ag tapes
International Nuclear Information System (INIS)
Suenaga, M.; Chiba, T.; Wiesmann, H.J.; Haldar, P.
1997-01-01
The Bean model is almost solely used to interpret ac losses in the powder-in-tube processed composite conductor, Bi 2 Sr 2 Ca 2 Cu 3 O 10 /Ag. In order to examine the limits of the applicability of the model, a detailed comparison was made between the values of critical current density J c for Bi(2223)/Ag tapes which were determined by standard four-probe-dc measurement, and which were deduced from the field dependence of the ac losses utilizing the model. A significant inconsistency between these values of J c were found, particularly at high fields. Possible sources of the discrepancies are discussed
2010-07-01
... model year Otto-cycle heavy-duty engines and vehicles. 86.008-10 Section 86.008-10 Protection of... Otto-cycle HDE. (d) Every manufacturer of new motor vehicle engines subject to the standards prescribed... production of heavy-duty Otto-cycle motor vehicle engines for model year 2008, except as explicitly allowed...
Maximal supergravities and the E10 model
International Nuclear Information System (INIS)
Kleinschmidt, Axel; Nicolai, Hermann
2006-01-01
The maximal rank hyperbolic Kac-Moody algebra e 10 has been conjectured to play a prominent role in the unification of duality symmetries in string and M theory. We review some recent developments supporting this conjecture
Totz, Sonja; Eliseev, Alexey V.; Petri, Stefan; Flechsig, Michael; Caesar, Levke; Petoukhov, Vladimir; Coumou, Dim
2018-02-01
We present and validate a set of equations for representing the atmosphere's large-scale general circulation in an Earth system model of intermediate complexity (EMIC). These dynamical equations have been implemented in Aeolus 1.0, which is a statistical-dynamical atmosphere model (SDAM) and includes radiative transfer and cloud modules (Coumou et al., 2011; Eliseev et al., 2013). The statistical dynamical approach is computationally efficient and thus enables us to perform climate simulations at multimillennia timescales, which is a prime aim of our model development. Further, this computational efficiency enables us to scan large and high-dimensional parameter space to tune the model parameters, e.g., for sensitivity studies.Here, we present novel equations for the large-scale zonal-mean wind as well as those for planetary waves. Together with synoptic parameterization (as presented by Coumou et al., 2011), these form the mathematical description of the dynamical core of Aeolus 1.0.We optimize the dynamical core parameter values by tuning all relevant dynamical fields to ERA-Interim reanalysis data (1983-2009) forcing the dynamical core with prescribed surface temperature, surface humidity and cumulus cloud fraction. We test the model's performance in reproducing the seasonal cycle and the influence of the El Niño-Southern Oscillation (ENSO). We use a simulated annealing optimization algorithm, which approximates the global minimum of a high-dimensional function.With non-tuned parameter values, the model performs reasonably in terms of its representation of zonal-mean circulation, planetary waves and storm tracks. The simulated annealing optimization improves in particular the model's representation of the Northern Hemisphere jet stream and storm tracks as well as the Hadley circulation.The regions of high azonal wind velocities (planetary waves) are accurately captured for all validation experiments. The zonal-mean zonal wind and the integrated lower
CD44v10, osteopontin and lymphoma growth retardation by a CD44v10-specific antibody.
Megaptche, Amelie Pajip; Erb, Ulrike; Büchler, Markus Wolfgang; Zöller, Margot
2014-09-01
Blockade of CD44 is considered a therapeutic option for the elimination of leukemia-initiating cells. However, the application of anti-panCD44 can be burdened by severe side effects. We determined whether these side effects could be avoided by replacing anti-panCD44 with CD44 variant isoform (CD44v)-specific antibodies in CD44v-positive hematological malignancies using the EL4 thymoma and CD44v10-transfected EL4 (EL4-v10) as models. Subcutaneous growth of EL4 and EL4-v10 was equally well inhibited by the anti-panCD44 and anti-CD44v10 antibodies, respectively. Ex vivo analysis indicated that natural killer cytotoxicity and antibody-dependent cellular cytotoxicity were the main effector mechanisms. Under local inflammation, the efficacy of anti-CD44v10 prolonged the survival time twofold compared with untreated, EL4-v10 tumor-bearing mice, and this was due to inflammation-induced expression of osteopontin (OPN). A high level of OPN in EL4-v10 tumors supported leukocyte recruitment and tumor-infiltrating T-cell activation. Taken together, in hematological malignancies expressing CD44v, anti-panCD44 can be replaced by CD44v-specific antibodies without a loss in efficacy. Furthermore, CD44v10-specific antibodies appear particularly advantageous in cutaneous leukemia therapy, as CD44v10 binding of OPN drives leukocyte recruitment and activation.
Directory of Open Access Journals (Sweden)
P. Wintoft
2005-11-01
Full Text Available The 7-10 November 2004 period contains two events for which the local ground magnetic field was severely disturbed and simultaneously, the solar wind displayed several shocks and negative Bz periods. Using empirical models the 10-min RMS and at Brorfelde (BFE, 11.67° E, 55.63° N, Denmark, are predicted. The models are recurrent neural networks with 10-min solar wind plasma and magnetic field data as inputs. The predictions show a good agreement during 7 November, up until around noon on 8 November, after which the predictions become significantly poorer. The correlations between observed and predicted log RMS is 0.77 during 7-8 November but drops to 0.38 during 9-10 November. For RMS the correlations for the two periods are 0.71 and 0.41, respectively. Studying the solar wind data for other L1-spacecraft (WIND and SOHO it seems that the ACE data have a better agreement to the near-Earth solar wind during the first two days as compared to the last two days. Thus, the accuracy of the predictions depends on the location of the spacecraft and the solar wind flow direction. Another finding, for the events studied here, is that the and models showed a very different dependence on Bz. The model is almost independent of the solar wind magnetic field Bz, except at times when Bz is exceptionally large or when the overall activity is low. On the contrary, the model shows a strong dependence on Bz at all times.
2010-07-01
... model year Otto-cycle heavy-duty engines and vehicles. 86.098-10 Section 86.098-10 Protection of..., exhaust emissions from new 1998 and later model year Otto-cycle heavy-duty engines shall not exceed: (i) For Otto-cycle heavy-duty engines fueled with either gasoline or liquefied petroleum gas, and intended...
2010-07-01
... model year Otto-cycle heavy-duty engines and vehicles. 86.005-10 Section 86.005-10 Protection of... AND IN-USE HIGHWAY VEHICLES AND ENGINES General Provisions for Emission Regulations for 1977 and Later Model Year New Light-Duty Vehicles, Light-Duty Trucks and Heavy-Duty Engines, and for 1985 and Later...
Ditching Tests of a 1/10-Scale Model of the North American XFJ-1 Airplane Ted No. NACA 314
Fisher, Lloyd J.; McBride, Ellis E.
1948-01-01
Tests were made of a 1/10-scale dynamically similar model of the North American XFJ-1 airplane to study its behavior when ditched. The model was landed in calm water at the Langley tank no. 2 monorail. Various landing attitudes, speeds, and conditions of damage were simulated. The behavior of the model was determined from visual observations, by recording the accelerations, and by taking motion pictures of the ditchings. Data are presented in tabular form, sequence photographs, and time-history acceleration curves. From the results of the tests it was concluded that the airplane should be ditched at the near-stall, tail-down landing attitude of 12 deg. The flaps should be fully extended to obtain the lowest possible landing speed. The wing-tip tanks should be jettisoned if any appreciable load of fuel remains; if empty, they should be retained for additional buoyancy. In a calm-water ditching the airplane will probably run about 600 feet Maximum longitudinal decelerations of about 2.5g and maximum vertical acceleration of about 2g will be encountered. The nose-intake duct will be clear of the water until practically all forward motion has stopped.
Shobe, Charles M.; Tucker, Gregory E.; Barnhart, Katherine R.
2017-12-01
Models of landscape evolution by river erosion are often either transport-limited (sediment is always available but may or may not be transportable) or detachment-limited (sediment must be detached from the bed but is then always transportable). While several models incorporate elements of, or transition between, transport-limited and detachment-limited behavior, most require that either sediment or bedrock, but not both, are eroded at any given time. Modeling landscape evolution over large spatial and temporal scales requires a model that can (1) transition freely between transport-limited and detachment-limited behavior, (2) simultaneously treat sediment transport and bedrock erosion, and (3) run in 2-D over large grids and be coupled with other surface process models. We present SPACE (stream power with alluvium conservation and entrainment) 1.0, a new model for simultaneous evolution of an alluvium layer and a bedrock bed based on conservation of sediment mass both on the bed and in the water column. The model treats sediment transport and bedrock erosion simultaneously, embracing the reality that many rivers (even those commonly defined as bedrock rivers) flow over a partially alluviated bed. SPACE improves on previous models of bedrock-alluvial rivers by explicitly calculating sediment erosion and deposition rather than relying on a flux-divergence (Exner) approach. The SPACE model is a component of the Landlab modeling toolkit, a Python-language library used to create models of Earth surface processes. Landlab allows efficient coupling between the SPACE model and components simulating basin hydrology, hillslope evolution, weathering, lithospheric flexure, and other surface processes. Here, we first derive the governing equations of the SPACE model from existing sediment transport and bedrock erosion formulations and explore the behavior of local analytical solutions for sediment flux and alluvium thickness. We derive steady-state analytical solutions for
Chen, H. S.; Wang, Z. F.; Li, J.; Tang, X.; Ge, B. Z.; Wu, X. L.; Wild, O.; Carmichael, G. R.
2015-09-01
Atmospheric mercury (Hg) is a toxic pollutant and can be transported over the whole globe due to its long lifetime in the atmosphere. For the purpose of assessing Hg hemispheric transport and better characterizing regional Hg pollution, a global nested atmospheric Hg transport model (GNAQPMS-Hg - Global Nested Air Quality Prediction Modeling System for Hg) has been developed. In GNAQPMS-Hg, the gas- and aqueous-phase Hg chemistry representing the transformation among three forms of Hg: elemental mercury (Hg(0)), divalent mercury (Hg(II)), and primary particulate mercury (Hg(P)) are calculated. A detailed description of the model, including mercury emissions, gas- and aqueous-phase chemistry, and dry and wet deposition is given in this study. Worldwide observations including extensive data in China have been collected for model evaluation. Comparison results show that the model reasonably simulates the global mercury budget and the spatiotemporal variation of surface mercury concentrations and deposition. Overall, model predictions of annual total gaseous mercury (TGM) and wet deposition agree with observations within a factor of 2, and within a factor of 5 for oxidized mercury and dry deposition. The model performs significantly better in North America and Europe than in East Asia. This can probably be attributed to the large uncertainties in emission inventories, coarse model resolution and to the inconsistency between the simulation and observation periods in East Asia. Compared to the global simulation, the nested simulation shows improved skill at capturing the high spatial variability of surface Hg concentrations and deposition over East Asia. In particular, the root mean square error (RMSE) of simulated Hg wet deposition over East Asia is reduced by 24 % in the nested simulation. Model sensitivity studies indicate that Chinese primary anthropogenic emissions account for 30 and 62 % of surface mercury concentrations and deposition over China, respectively
Multi-level hydrodynamic modelling of a scaled 10MW TLP wind turbine
DEFF Research Database (Denmark)
Pegalajar Jurado, Antonio Manuel; Bredmose, Henrik; Borg, Michael
2016-01-01
and focused waves is run in the three models, where only wave loads are considered. The simulation results are compared against the test data, and the numerical models are assessed based on their ability to reproduce the test results. Finally, the possibility of enhancing the simple model by using...
A comparative study of inelastic scattering models at energy levels ranging from 0.5 keV to 10 keV
Energy Technology Data Exchange (ETDEWEB)
Hu, Chia-Yu [Department of Photonics, National Cheng Kung University, Tainan 701, Taiwan (China); Lin, Chun-Hung, E-mail: chlin@mail.ncku.edu.tw [Department of Photonics, National Cheng Kung University, Tainan 701, Taiwan (China); Advanced Optoelectronic Technology Center, National Cheng Kung University, Tainan 701, Taiwan (China)
2017-03-01
Six models, including a single-scattering model, four hybrid models, and one dielectric function model, were evaluated using Monte Carlo simulations for aluminum and copper at incident beam energies ranging from 0.5 keV to 10 keV. The inelastic mean free path, mean energy loss per unit path length, and backscattering coefficients obtained by these models are compared and discussed to understand the merits of the various models. ANOVA (analysis of variance) statistical models were used to quantify the effects of inelastic cross section and energy loss models on the basis of the simulated results deviation from the experimental data for the inelastic mean free path, the mean energy loss per unit path length, and the backscattering coefficient, as well as their correlations. This work in this study is believed to be the first application of ANOVA models towards evaluating inelastic electron beam scattering models. This approach is an improvement over the traditional approach which involves only visual estimation of the difference between the experimental data and simulated results. The data suggests that the optimization of the effective electron number per atom, binding energy, and cut-off energy of an inelastic model for different materials at different beam energies is more important than the selection of inelastic models for Monte Carlo electron scattering simulation. During the simulations, parameters in the equations should be tuned according to different materials for different beam energies rather than merely employing default parameters for an arbitrary material. Energy loss models and cross-section formulas are not the main factors influencing energy loss. Comparison of the deviation of the simulated results from the experimental data shows a significant correlation (p < 0.05) between the backscattering coefficient and energy loss per unit path length. The inclusion of backscattering electrons generated by both primary and secondary electrons for
Hyde, Peter; Mahalov, Alex; Li, Jialun
2018-03-01
Nine dust storms in south-central Arizona were simulated with the Weather Research and Forecasting with Chemistry model (WRF-Chem) at 2 km resolution. The windblown dust emission algorithm was the Air Force Weather Agency model. In comparison with ground-based PM 10 observations, the model unevenly reproduces the dust-storm events. The model adequately estimates the location and timing of the events, but it is unable to precisely replicate the magnitude and timing of the elevated hourly concentrations of particles 10 µm and smaller ([PM 10 ]).Furthermore, the model underestimated [PM 10 ] in highly agricultural Pinal County because it underestimated surface wind speeds and because the model's erodible fractions of the land surface data were too coarse to effectively resolve the active and abandoned agricultural lands. In contrast, the model overestimated [PM 10 ] in western Arizona along the Colorado River because it generated daytime sea breezes (from the nearby Gulf of California) for which the surface-layer speeds were too strong. In Phoenix, AZ, the model's performance depended on the event, with both under- and overestimations partly due to incorrect representation of urban features. Sensitivity tests indicate that [PM 10 ] highly relies on meteorological forcing. Increasing the fraction of erodible surfaces in the Pinal County agricultural areas improved the simulation of [PM 10 ] in that region. Both 24-hr and 1-hr measured [PM 10 ] were, for the most part, and especially in Pinal County, extremely elevated, with the former exceeding the health standard by as much as 10-fold and the latter exceeding health-based guidelines by as much as 70-fold. Monsoonal thunderstorms not only produce elevated [PM 10 ], but also cause urban flash floods and disrupt water resource deliveries. Given the severity and frequency of these dust storms, and conceding that the modeling system applied in this work did not produce the desired agreement between simulations and
Elangasinghe, M. A.; Singhal, N.; Dirks, K. N.; Salmond, J. A.; Samarasinghe, S.
2014-09-01
This paper uses artificial neural networks (ANN), combined with k-means clustering, to understand the complex time series of PM10 and PM2.5 concentrations at a coastal location of New Zealand based on data from a single site. Out of available meteorological parameters from the network (wind speed, wind direction, solar radiation, temperature, relative humidity), key factors governing the pattern of the time series concentrations were identified through input sensitivity analysis performed on the trained neural network model. The transport pathways of particulate matter under these key meteorological parameters were further analysed through bivariate concentration polar plots and k-means clustering techniques. The analysis shows that the external sources such as marine aerosols and local sources such as traffic and biomass burning contribute equally to the particulate matter concentrations at the study site. These results are in agreement with the results of receptor modelling by the Auckland Council based on Positive Matrix Factorization (PMF). Our findings also show that contrasting concentration-wind speed relationships exist between marine aerosols and local traffic sources resulting in very noisy and seemingly large random PM10 concentrations. The inclusion of cluster rankings as an input parameter to the ANN model showed a statistically significant (p advanced air dispersion models.
Instrumentation of the model in scaled 1:10 to prototype of the AquaBuOY wave energy converter
DEFF Research Database (Denmark)
Margheritini, Lucia; Frigaard, Peter
The objective of this report is to provide guidelines for the instrumentation of a model in scale 1:10 to prototype of the AquaBuOY wave energy converter. The model will be located in Nissum Bredning area: this is an important waterway already used by Aalborg University for real sea tests of wave...... energy converters....
EMERGE - an empirical model for the formation of galaxies since z ˜ 10
Moster, Benjamin P.; Naab, Thorsten; White, Simon D. M.
2018-06-01
We present EMERGE, an Empirical ModEl for the foRmation of GalaxiEs, describing the evolution of individual galaxies in large volumes from z ˜ 10 to the present day. We assign a star formation rate to each dark matter halo based on its growth rate, which specifies how much baryonic material becomes available, and the instantaneous baryon conversion efficiency, which determines how efficiently this material is converted to stars, thereby capturing the baryonic physics. Satellites are quenched following the delayed-then-rapid model, and they are tidally disrupted once their subhalo has lost a significant fraction of its mass. The model is constrained with observed data extending out to high redshift. The empirical relations are very flexible, and the model complexity is increased only if required by the data, assessed by several model selection statistics. We find that for the same final halo mass galaxies can have very different star formation histories. Galaxies that are quenched at z = 0 typically have a higher peak star formation rate compared to their star-forming counterparts. EMERGE predicts stellar-to-halo mass ratios for individual galaxies and introduces scatter self-consistently. We find that at fixed halo mass, passive galaxies have a higher stellar mass on average. The intracluster mass in massive haloes can be up to eight times larger than the mass of the central galaxy. Clustering for star-forming and quenched galaxies is in good agreement with observational constraints, indicating a realistic assignment of galaxies to haloes.
Study of carbon ion behavior by using collisional radiative model in the GAMMA 10 tandem mirror
International Nuclear Information System (INIS)
Kobayashi, Takayuki; Yoshikawa, Masayuki; Kubota, Yuusuke; Saito, Masashi; Matama, Ken; Itakura, Akiyoshi; Cho, Teruji; Kato, Takako
2006-01-01
In a plasma experiment, collisional radiative model (CRM) is very useful model to evaluate impurity behaviors and plasma parameters with line emission from a plasma. CRMs for carbon and oxygen have been developed. However verification and application of the model for analysis of experimental results are not enough. Then we applied CRM calculation results to observed impurity spectra in the GAMMA 10 tandem mirror to evaluate the impurity density profile and the particle balance of each charge state of carbon ion. We calculated the effective ionization rate for each charge state of carbon ion and obtained the density profile of each ion. Moreover, we calculated absolute emission intensities from all carbon ions. (author)
Finite-element model to predict roll-separation force and defects during rolling of U-10Mo alloys
Soulami, Ayoub; Burkes, Douglas E.; Joshi, Vineet V.; Lavender, Curt A.; Paxton, Dean
2017-10-01
A major goal of the Convert Program of the U.S. Department of Energy's National Nuclear Security Administration (DOE/NNSA) is to enable high-performance research reactors to operate with low-enriched uranium rather than the high-enriched uranium currently used. To this end, uranium alloyed with 10 wt% molybdenum (U-10Mo) represents an ideal candidate because of its stable gamma phase, low neutron caption cross section, acceptable swelling response, and predictable irradiation behavior. However, because of the complexities of the fuel design and the need for rolled monolithic U-10Mo foils, new developments in processing and fabrication are necessary. This study used a finite-element code, LS-DYNA, as a predictive tool to optimize the rolling process. Simulations of the hot rolling of U-10Mo coupons encapsulated in low-carbon steel were conducted following two different schedules. Model predictions of the roll-separation force and roll pack thicknesses at different stages of the rolling process were compared with experimental measurements. The study reported here discussed various attributes of the rolled coupons revealed by the model (e.g., waviness and thickness non-uniformity like dog-boning). To investigate the influence of the cladding material on these rolling defects, other cases were simulated: hot rolling with alternative can materials, namely, 304 stainless steel and Zircaloy-2, and bare-rolling. Simulation results demonstrated that reducing the mismatch in strength between the coupon and can material improves the quality of the rolled sheet. Bare-rolling simulation results showed a defect-free rolled coupon. The finite-element model developed and presented in this study can be used to conduct parametric studies of several process parameters (e.g., rolling speed, roll diameter, can material, and reduction).
Directory of Open Access Journals (Sweden)
Samsuri Abdullah
2016-07-01
Full Text Available Air pollution in Peninsular Malaysia is dominated by particulate matter which is demonstrated by having the highest Air Pollution Index (API value compared to the other pollutants at most part of the country. Particulate Matter (PM10 forecasting models development is crucial because it allows the authority and citizens of a community to take necessary actions to limit their exposure to harmful levels of particulates pollution and implement protection measures to significantly improve air quality on designated locations. This study aims in improving the ability of MLR using PCs inputs for PM10 concentrations forecasting. Daily observations for PM10 in Kuala Terengganu, Malaysia from January 2003 till December 2011 were utilized to forecast PM10 concentration levels. MLR and PCR (using PCs input models were developed and the performance was evaluated using RMSE, NAE and IA. Results revealed that PCR performed better than MLR due to the implementation of PCA which reduce intricacy and eliminate data multi-collinearity.
SiSeRHMap v1.0: a simulator for mapped seismic response using a hybrid model
Grelle, Gerardo; Bonito, Laura; Lampasi, Alessandro; Revellino, Paola; Guerriero, Luigi; Sappa, Giuseppe; Guadagno, Francesco Maria
2016-04-01
The SiSeRHMap (simulator for mapped seismic response using a hybrid model) is a computerized methodology capable of elaborating prediction maps of seismic response in terms of acceleration spectra. It was realized on the basis of a hybrid model which combines different approaches and models in a new and non-conventional way. These approaches and models are organized in a code architecture composed of five interdependent modules. A GIS (geographic information system) cubic model (GCM), which is a layered computational structure based on the concept of lithodynamic units and zones, aims at reproducing a parameterized layered subsoil model. A meta-modelling process confers a hybrid nature to the methodology. In this process, the one-dimensional (1-D) linear equivalent analysis produces acceleration response spectra for a specified number of site profiles using one or more input motions. The shear wave velocity-thickness profiles, defined as trainers, are randomly selected in each zone. Subsequently, a numerical adaptive simulation model (Emul-spectra) is optimized on the above trainer acceleration response spectra by means of a dedicated evolutionary algorithm (EA) and the Levenberg-Marquardt algorithm (LMA) as the final optimizer. In the final step, the GCM maps executor module produces a serial map set of a stratigraphic seismic response at different periods, grid solving the calibrated Emul-spectra model. In addition, the spectra topographic amplification is also computed by means of a 3-D validated numerical prediction model. This model is built to match the results of the numerical simulations related to isolate reliefs using GIS morphometric data. In this way, different sets of seismic response maps are developed on which maps of design acceleration response spectra are also defined by means of an enveloping technique.
Air Density Measurements in a Mach 10 Wake Using Iodine Cordes Bands
Balla, Robert J.; Everhart, Joel L.
2012-01-01
An exploratory study designed to examine the viability of making air density measurements in a Mach 10 flow using laser-induced fluorescence of the iodine Cordes bands is presented. Experiments are performed in the NASA Langley Research Center 31 in. Mach 10 air wind tunnel in the hypersonic near wake of a multipurpose crew vehicle model. To introduce iodine into the wake, a 0.5% iodine/nitrogen mixture is seeded using a pressure tap at the rear of the model. Air density was measured at 56 points along a 7 mm line and three stagnation pressures of 6.21, 8.62, and 10.0 MPa (900, 1250, and 1450 psi). Average results over time and space show rho(sub wake)/rho(sub freestream) of 0.145 plus or minus 0.010, independent of freestream air density. Average off-body results over time and space agree to better than 7.5% with computed densities from onbody pressure measurements. Densities measured during a single 60 s run at 10.0 MPa are time-dependent and steadily decrease by 15%. This decrease is attributed to model forebody heating by the flow.
Interleukin 10 is an essential modulator of mucoid metaplasia in a mouse otitis media model
Tsuchiya, Katsuyuki; Komori, Masahiro; Zheng, Qing Yin; Ferrieri, Patricia; Lin, Jizhen
2009-01-01
Inflammatory cytokines are involved in the development of mucus cell metaplasia/hyperplasia (MCM) in otitis media (OM). However, which cytokines play an essential role in MCM OM is not clear at the moment. In this study, we hypothesized that interleukin-10 (IL-10) played an indispensable role in MCM of bacterial OM and used IL-10 knockout mice to test this hypothesis. In wild-type mice, both S. pneumoniae and H. influenzae triggered the development of MCM in the middle ear mucosa. In IL-10 knockout mice, the number of goblet cells and mucin-producing cells in the middle ear was significantly reduced after bacterial middle ear infection compared with that in wild-type mice. We, therefore, concluded that IL-10 plays an essential role in MCM of bacterial OM. IL-10 is a potential target for the treatment of MCM in OM. PMID:18771082
Lewis, Jared; Bodeker, Greg E.; Kremser, Stefanie; Tait, Andrew
2017-12-01
A method, based on climate pattern scaling, has been developed to expand a small number of projections of fields of a selected climate variable (X) into an ensemble that encapsulates a wide range of indicative model structural uncertainties. The method described in this paper is referred to as the Ensemble Projections Incorporating Climate model uncertainty (EPIC) method. Each ensemble member is constructed by adding contributions from (1) a climatology derived from observations that represents the time-invariant part of the signal; (2) a contribution from forced changes in X, where those changes can be statistically related to changes in global mean surface temperature (Tglobal); and (3) a contribution from unforced variability that is generated by a stochastic weather generator. The patterns of unforced variability are also allowed to respond to changes in Tglobal. The statistical relationships between changes in X (and its patterns of variability) and Tglobal are obtained in a training phase. Then, in an implementation phase, 190 simulations of Tglobal are generated using a simple climate model tuned to emulate 19 different global climate models (GCMs) and 10 different carbon cycle models. Using the generated Tglobal time series and the correlation between the forced changes in X and Tglobal, obtained in the training phase, the forced change in the X field can be generated many times using Monte Carlo analysis. A stochastic weather generator is used to generate realistic representations of weather which include spatial coherence. Because GCMs and regional climate models (RCMs) are less likely to correctly represent unforced variability compared to observations, the stochastic weather generator takes as input measures of variability derived from observations, but also responds to forced changes in climate in a way that is consistent with the RCM projections. This approach to generating a large ensemble of projections is many orders of magnitude more
Performance Measurement Model A TarBase model with ...
Indian Academy of Sciences (India)
rohit
Model A 8.0 2.0 94.52% 88.46% 76 108 12 12 0.86 0.91 0.78 0.94. Model B 2.0 2.0 93.18% 89.33% 64 95 10 9 0.88 0.90 0.75 0.98. The above results for TEST – 1 show details for our two models (Model A and Model B).Performance of Model A after adding of 32 negative dataset of MiRTif on our testing set(MiRecords) ...
Aero-Elastic Optimization of a 10 MW Wind Turbine
DEFF Research Database (Denmark)
Zahle, Frederik; Tibaldi, Carlo; Verelst, David Robert
2015-01-01
This article describes a multi-disciplinary optimization and analysis tool for wind turbines that is based on the open-source framework OpenMDAO. Interfaces to several simulation codes have been implemented which allows for a wide variety of problem formulations and combinations of models....... In this article concurrent aeroelastic optimization of a 10 MW wind turbine rotor is carried out with respect to material distribution distribution and planform. The optimizations achieve up to 13% mass reduction while maintaining the same power production compared to the baseline DTU 10MW RWT....
Novel VCP modulators mitigate major pathologies of rd10, a mouse model of retinitis pigmentosa
Ikeda, Hanako Ohashi; Sasaoka, Norio; Koike, Masaaki; Nakano, Noriko; Muraoka, Yuki; Toda, Yoshinobu; Fuchigami, Tomohiro; Shudo, Toshiyuki; Iwata, Ayana; Hori, Seiji; Yoshimura, Nagahisa; Kakizuka, Akira
2014-01-01
Neuroprotection may prevent or forestall the progression of incurable eye diseases, such as retinitis pigmentosa, one of the major causes of adult blindness. Decreased cellular ATP levels may contribute to the pathology of this eye disease and other neurodegenerative diseases. Here we describe small compounds (Kyoto University Substances, KUSs) that were developed to inhibit the ATPase activity of VCP (valosin-containing protein), the most abundant soluble ATPase in the cell. Surprisingly, KUSs did not significantly impair reported cellular functions of VCP but nonetheless suppressed the VCP-dependent decrease of cellular ATP levels. Moreover, KUSs, as well as exogenous ATP or ATP-producing compounds, e.g. methylpyruvate, suppressed endoplasmic reticulum stress, and demonstrably protected various types of cultured cells from death, including several types of retinal neuronal cells. We then examined their in vivo efficacies in rd10, a mouse model of retinitis pigmentosa. KUSs prevented photoreceptor cell death and preserved visual function. These results reveal an unexpected, crucial role of ATP consumption by VCP in determining cell fate in this pathological context, and point to a promising new neuroprotective strategy for currently incurable retinitis pigmentosa. PMID:25096051
2013-01-01
Background Some governments have recently shown a willingness to introduce taxes on unhealthy foods and drinks. In 2011, the Irish Minister for Health proposed a 10% tax on sugar sweetened beverages (SSBs) as a measure to combat childhood obesity. Whilst this proposed tax received considerable support, the Irish Department of Finance requested a Health Impact Assessment of this measure. As part of this assessment we set out to model the impact on obesity. Methods We used price elasticity estimates to calculate the effect of a 10% SSB tax on SSB consumption. SSBs were assumed to have an own-price elasticity of −0.9 and we assumed a tax pass-on rate to consumers of 90%. Baseline SSB consumption and obesity prevalence, by age, sex and income-group, for Ireland were taken from the 2007 Survey on Lifestyle and Attitude to Nutrition. A comparative risk assessment model was used to estimate the effect on obesity arising from the predicted change in calorie consumption, both for the whole population and for sub-groups (age, sex, income). Sensitivity analyses were conducted on price-elasticity estimates and tax pass-on rates. Results We estimate that a 10% tax on SSBs will result in a mean reduction in energy intake of 2.1 kcal/person/day. After adjustment for self-reported data, the 10% tax is predicted to reduce the percentage of the obese adult population (body mass index [BMI] ≥30 kg/m2) by 1.3%, equating to 9,900 adults (95% credible intervals: 7,750 to 12,940), and the overweight or obese population (BMI ≥ 25 kg/m2) by 0.7%, or 14,380 adults (9,790 to 17,820). Reductions in obesity are similar for men (1.2%) and women (1.3%), and similar for each income group (between 1.1% and 1.4% across income groups). Reductions in obesity are greater in young adults than older adults (e.g. 2.9% in adults aged 18–24 years vs 0.6% in adults aged 65 years and over). Conclusions This study suggests that a tax on SSBs in Ireland would have a small but meaningful effect
Directory of Open Access Journals (Sweden)
Gustavo Bastos Lyra
2011-09-01
Full Text Available Regressão linear múltipla foi aplicada para ajustar dois modelos à concentração média de 24 h do material particulado com diâmetro inferior a 10 µm (PM10. As variáveis explanatórias no primeiro modelo (M1 foram os elementos meteorológicos (temperatura e umidade do ar, precipitação pluvial, velocidade do vento e pressão atmosférica e o índice de direção do vento (IDV. No segundo (M2, além dos elementos meteorológicos e do IDV, foi incluído como variável explanatória, a concentração de PM10 do dia anterior (PM10,i-1. Para a seleção das variáveis explanatórias a serem incluídas no modelo, utilizou-se a técnica stepwise. Medidas da concentração de PM10 e dos elementos meteorológicos foram realizadas entre 01/05/02 e 31/08/03 em São Cristóvão (22º 53´ S; 43º 13´ W e 24 m na cidade do Rio de Janeiro. O coeficiente de determinação (r² para o ajuste dos modelos foi razoável, sendo que o modelo M2 (r² = 0,557 mostrou ajuste superior ao modelo M1 (r² = 0,334. Os elementos meteorológicos tiveram correlação negativa com PM10, com exceção do índice de direção do vento, que da mesma forma de PM10,i-1, apresentou correlação positiva. A umidade relativa do ar e a precipitação pluvial mostraram-se os elementos meteorológicos mais significativos nos modelos. Contudo, quando PM10,i-1 é considerada, esta variável se mostrou a mais significativa no modelo. Independente do modelo, a inclusão da temperatura do ar não foi significativa (p > 0,05. O modelo M2 teve concordância entre os valores estimados e observados e precisão superior ao modelo M1. Em termos de previsão da qualidade do ar, os modelos mostraram resultados satisfatórios, sobressaindo-se o modelo M2.Multiple linear regression was used to fit two models to the daily average concentration of particulate matter with diameter lower than 10 µm (PM10. The explanatory variables in the first model (M1 were the weather variables (air temperature
Radiobiology of BNCT mediated by GB-10 and GB-10+BPA in experimental oral cancer
Energy Technology Data Exchange (ETDEWEB)
Trivillin, Veronica A.; Heber, Elisa M.; Itoiz, Maria E.; Nigg, David; Calzetta, Osvaldo; Blaumann, Herman; Longhino, Juan; Schwint, Amanda E. E-mail: schwint@cnea.gov.ar
2004-11-01
We previously reported biodistribution and pharmacokinetic data for GB-10 (Na{sub 2}{sup 10}B{sub 10}H{sub 10}) and the combined administration of GB-10 and boronophenylalanine (BPA) as boron delivery agents for boron neutron capture therapy (BNCT) in the hamster cheek pouch oral cancer model. The aim of the present study was to assess, for the first time, the response of hamster cheek pouch tumors, precancerous tissue and normal tissue to BNCT mediated by GB-10 and BNCT mediated by GB-10 and BPA administered jointly using the thermalized epithermal beam of the RA-6 Reactor at the Bariloche Atomic Center. GB-10 exerted 75.5% tumor control (partial+complete remission) with no damage to precancerous tissue around tumor or to normal tissue. Thus, GB-10 proved to be a therapeutically efficient boron agent in this model despite the fact that it is not taken up selectively by oral tumor tissue. GB-10 exerted a selective effect on tumor blood vessels leading to significant tumor control with a sparing effect on normal tissue. BNCT mediated by the combined administration of GB-10 and BPA resulted in a reduction in the dose to normal tissue and would thus allow for significant escalation of dose to tumor without exceeding normal tissue tolerance.
Radiobiology of BNCT mediated by GB-10 and GB-10+BPA in experimental oral cancer
International Nuclear Information System (INIS)
Trivillin, Veronica A.; Heber, Elisa M.; Itoiz, Maria E.; Nigg, David; Calzetta, Osvaldo; Blaumann, Herman; Longhino, Juan; Schwint, Amanda E.
2004-01-01
We previously reported biodistribution and pharmacokinetic data for GB-10 (Na 2 10 B 10 H 10 ) and the combined administration of GB-10 and boronophenylalanine (BPA) as boron delivery agents for boron neutron capture therapy (BNCT) in the hamster cheek pouch oral cancer model. The aim of the present study was to assess, for the first time, the response of hamster cheek pouch tumors, precancerous tissue and normal tissue to BNCT mediated by GB-10 and BNCT mediated by GB-10 and BPA administered jointly using the thermalized epithermal beam of the RA-6 Reactor at the Bariloche Atomic Center. GB-10 exerted 75.5% tumor control (partial+complete remission) with no damage to precancerous tissue around tumor or to normal tissue. Thus, GB-10 proved to be a therapeutically efficient boron agent in this model despite the fact that it is not taken up selectively by oral tumor tissue. GB-10 exerted a selective effect on tumor blood vessels leading to significant tumor control with a sparing effect on normal tissue. BNCT mediated by the combined administration of GB-10 and BPA resulted in a reduction in the dose to normal tissue and would thus allow for significant escalation of dose to tumor without exceeding normal tissue tolerance
Hoch, Jannis M.; Neal, Jeffrey C.; Baart, Fedor; van Beek, Rens; Winsemius, Hessel C.; Bates, Paul D.; Bierkens, Marc F. P.
2017-10-01
We here present GLOFRIM, a globally applicable computational framework for integrated hydrological-hydrodynamic modelling. GLOFRIM facilitates spatially explicit coupling of hydrodynamic and hydrologic models and caters for an ensemble of models to be coupled. It currently encompasses the global hydrological model PCR-GLOBWB as well as the hydrodynamic models Delft3D Flexible Mesh (DFM; solving the full shallow-water equations and allowing for spatially flexible meshing) and LISFLOOD-FP (LFP; solving the local inertia equations and running on regular grids). The main advantages of the framework are its open and free access, its global applicability, its versatility, and its extensibility with other hydrological or hydrodynamic models. Before applying GLOFRIM to an actual test case, we benchmarked both DFM and LFP for a synthetic test case. Results show that for sub-critical flow conditions, discharge response to the same input signal is near-identical for both models, which agrees with previous studies. We subsequently applied the framework to the Amazon River basin to not only test the framework thoroughly, but also to perform a first-ever benchmark of flexible and regular grids on a large-scale. Both DFM and LFP produce comparable results in terms of simulated discharge with LFP exhibiting slightly higher accuracy as expressed by a Kling-Gupta efficiency of 0.82 compared to 0.76 for DFM. However, benchmarking inundation extent between DFM and LFP over the entire study area, a critical success index of 0.46 was obtained, indicating that the models disagree as often as they agree. Differences between models in both simulated discharge and inundation extent are to a large extent attributable to the gridding techniques employed. In fact, the results show that both the numerical scheme of the inundation model and the gridding technique can contribute to deviations in simulated inundation extent as we control for model forcing and boundary conditions. This study shows
Measurement and modeling of room temperature co-deformation in WC-10 wt.%
Energy Technology Data Exchange (ETDEWEB)
Livescu, V. [MST-8/LANSCE, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)]. E-mail: vlivescu@lanl.gov; Clausen, B. [MST-8/LANSCE, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Paggett, J.W. [Department of Mechanical and Aerospace Engineering, University of Missouri, Columbia, MO 65211 (United States); Krawitz, A.D. [Department of Mechanical and Aerospace Engineering, University of Missouri, Columbia, MO 65211 (United States); Drake, E.F. [REEDHycalogTM/Grant Prideco, Houston, TX 77252 (United States); Bourke, M.A.M. [MST-8/LANSCE, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)
2005-06-15
In situ neutron diffraction measurements were performed on a tungsten carbide (WC)-10 wt.% cobalt (Co) cemented carbide composite subjected to compressive loading. The sample was subjected to consecutive load/unload cycles to -500, -1000, -2000 and -2100 MPa. Thermal residual stresses measured before loading reflected large hydrostatic tensile stresses in the binder phase and compressive stresses in the carbide phase. The carbide phase behaved elastically at all but the highest load levels, whereas plasticity was present in the binder phase from values of applied stress as low as -500 MPa. A finite element simulation utilizing an interpenetrating microstructure model showed remarkable agreement with the complex mean phase strain response during the loading cycles despite its under-prediction of thermal residual strains.
Towards a complete Δ(27) × SO(10) GUT of flavour
Björkeroth, Fredrik
2017-09-01
We propose a renormalisable model based on Δ(27) family symmetry with an SO(10) grand unified theory (GUT) leading to a novel form of spontaneous geometrical CP violation. The symmetries are broken close to the GUT breaking scale to yield the minimal supersymmetric standard model with standard R-parity. Low-scale Yukawa structure is dictated by the coupling of matter to Δ(27) antitriplets \\bar φ whose vacuum expectation values are aligned in the CSD3 directions by the superpotential. Light physical Majorana neutrinos masses emerge from the seesaw mechanism within SO(10). The model predicts a normal neutrino mass hierarchy with the best-fit lightest neutrino mass m 1 ∼ 0.3 meV, CP-violating oscillation phase δl ≈ 280° and the remaining neutrino parameters all within 1σ of their best-fit experimental values.
Energy Technology Data Exchange (ETDEWEB)
Findlay, R P; Dimbylow, P J [Health Protection Agency, Chilton, Didcot, Oxon OX11 0RQ (United Kingdom)
2006-05-07
Finite-difference time-domain (FDTD) calculations have been performed to investigate the frequency dependence of the specific energy absorption rate (SAR) in a seated voxel model of the human body. The seated model was derived from NORMAN (NORmalized MAN), an anatomically realistic voxel phantom in the standing posture with arms to the side. Exposure conditions included both vertically and horizontally polarized plane wave electric fields between 10 MHz and 3 GHz. The resolution of the voxel model was 4 mm for frequencies up to 360 MHz and 2 mm for calculations in the higher frequency range. The reduction in voxel size permitted the calculation of SAR at these higher frequencies using the FDTD method. SAR values have been calculated for the seated adult phantom and scaled versions representing 10-, 5- and 1-year-old children under isolated and grounded conditions. These scaled models do not exactly reproduce the dimensions and anatomy of children, but represent good geometric information for a seated child. Results show that, when the field is vertically polarized, the sitting position causes a second, smaller resonance condition not seen in resonance curves for the phantom in the standing posture. This occurs at {approx}130 MHz for the adult model when grounded. Partial-body SAR calculations indicate that the upper and lower regions of the body have their own resonant frequency at {approx}120 MHz and {approx}160 MHz, respectively, when the grounded adult model is orientated in the sitting position. These combine to produce this second resonance peak in the whole-body averaged SAR values calculated. Two resonance peaks also occur for the sitting posture when the incident electric field is horizontally polarized. For the adult model, the peaks in the whole-body averaged SAR occur at {approx}180 and {approx}600 MHz. These peaks are due to resonance in the arms and feet, respectively. Layer absorption plots and colour images of SAR in individual voxels show the
International Nuclear Information System (INIS)
Findlay, R P; Dimbylow, P J
2006-01-01
Finite-difference time-domain (FDTD) calculations have been performed to investigate the frequency dependence of the specific energy absorption rate (SAR) in a seated voxel model of the human body. The seated model was derived from NORMAN (NORmalized MAN), an anatomically realistic voxel phantom in the standing posture with arms to the side. Exposure conditions included both vertically and horizontally polarized plane wave electric fields between 10 MHz and 3 GHz. The resolution of the voxel model was 4 mm for frequencies up to 360 MHz and 2 mm for calculations in the higher frequency range. The reduction in voxel size permitted the calculation of SAR at these higher frequencies using the FDTD method. SAR values have been calculated for the seated adult phantom and scaled versions representing 10-, 5- and 1-year-old children under isolated and grounded conditions. These scaled models do not exactly reproduce the dimensions and anatomy of children, but represent good geometric information for a seated child. Results show that, when the field is vertically polarized, the sitting position causes a second, smaller resonance condition not seen in resonance curves for the phantom in the standing posture. This occurs at ∼130 MHz for the adult model when grounded. Partial-body SAR calculations indicate that the upper and lower regions of the body have their own resonant frequency at ∼120 MHz and ∼160 MHz, respectively, when the grounded adult model is orientated in the sitting position. These combine to produce this second resonance peak in the whole-body averaged SAR values calculated. Two resonance peaks also occur for the sitting posture when the incident electric field is horizontally polarized. For the adult model, the peaks in the whole-body averaged SAR occur at ∼180 and ∼600 MHz. These peaks are due to resonance in the arms and feet, respectively. Layer absorption plots and colour images of SAR in individual voxels show the specific regions in which the
Directory of Open Access Journals (Sweden)
P. Wintoft
2005-11-01
Full Text Available The 7-10 November 2004 period contains two events for which the local ground magnetic field was severely disturbed and simultaneously, the solar wind displayed several shocks and negative Bz periods. Using empirical models the 10-min RMS and at Brorfelde (BFE, 11.67° E, 55.63° N, Denmark, are predicted. The models are recurrent neural networks with 10-min solar wind plasma and magnetic field data as inputs. The predictions show a good agreement during 7 November, up until around noon on 8 November, after which the predictions become significantly poorer. The correlations between observed and predicted log RMS is 0.77 during 7-8 November but drops to 0.38 during 9-10 November. For RMS the correlations for the two periods are 0.71 and 0.41, respectively. Studying the solar wind data for other L1-spacecraft (WIND and SOHO it seems that the ACE data have a better agreement to the near-Earth solar wind during the first two days as compared to the last two days. Thus, the accuracy of the predictions depends on the location of the spacecraft and the solar wind flow direction. Another finding, for the events studied here, is that the and models showed a very different dependence on Bz. The model is almost independent of the solar wind magnetic field Bz, except at times when Bz is exceptionally large or when the overall activity is low. On the contrary, the model shows a strong dependence on Bz at all times.
Magombedze, Gesham; Eda, Shigetoshi; Stabel, Judy
2015-01-01
Mycobacterium avium subsp. paratuberculosis (MAP) is an intracellular bacterial pathogen that causes Johne’s disease (JD) in cattle and other animals. The hallmark of MAP infection in the early stages is a strong protective cell-mediated immune response (Th1-type), characterized by antigen-specific γ-interferon (IFN-γ). The Th1 response wanes with disease progression and is supplanted by a non-protective humoral immune response (Th2-type). Interleukin-10 (IL-10) is believed to play a critical role in the regulation of host immune responses to MAP infection and potentially orchestrate the reversal of Th1/Th2 immune dominance during disease progression. However, how its role correlates with MAP infection remains to be completely deciphered. We developed mathematical models to explain probable mechanisms for IL-10 involvement in MAP infection. We tested our models with IL-4, IL-10, IFN-γ, and MAP fecal shedding data collected from calves that were experimentally infected and followed over a period of 360 days in the study of Stabel and Robbe-Austerman (2011). Our models predicted that IL-10 can have different roles during MAP infection, (i) it can suppress the Th1 expression, (ii) can enhance Th2 (IL-4) expression, and (iii) can suppress the Th1 expression in synergy with IL-4. In these predicted roles, suppression of Th1 responses was correlated with increased number of MAP. We also predicted that Th1-mediated responses (IFN-γ) can lead to high expression of IL-10 and that infection burden regulates Th2 suppression by the Th1 response. Our models highlight areas where more experimental data is required to refine our model assumptions, and further test and investigate the role of IL-10 in MAP infection. PMID:26619346
Directory of Open Access Journals (Sweden)
Gesham Magombedze
Full Text Available Mycobacterium avium subsp. paratuberculosis (MAP is an intracellular bacterial pathogen that causes Johne's disease (JD in cattle and other animals. The hallmark of MAP infection in the early stages is a strong protective cell-mediated immune response (Th1-type, characterized by antigen-specific γ-interferon (IFN-γ. The Th1 response wanes with disease progression and is supplanted by a non-protective humoral immune response (Th2-type. Interleukin-10 (IL-10 is believed to play a critical role in the regulation of host immune responses to MAP infection and potentially orchestrate the reversal of Th1/Th2 immune dominance during disease progression. However, how its role correlates with MAP infection remains to be completely deciphered. We developed mathematical models to explain probable mechanisms for IL-10 involvement in MAP infection. We tested our models with IL-4, IL-10, IFN-γ, and MAP fecal shedding data collected from calves that were experimentally infected and followed over a period of 360 days in the study of Stabel and Robbe-Austerman (2011. Our models predicted that IL-10 can have different roles during MAP infection, (i it can suppress the Th1 expression, (ii can enhance Th2 (IL-4 expression, and (iii can suppress the Th1 expression in synergy with IL-4. In these predicted roles, suppression of Th1 responses was correlated with increased number of MAP. We also predicted that Th1-mediated responses (IFN-γ can lead to high expression of IL-10 and that infection burden regulates Th2 suppression by the Th1 response. Our models highlight areas where more experimental data is required to refine our model assumptions, and further test and investigate the role of IL-10 in MAP infection.
Villarrubia, J S; Vladár, A E; Ming, B; Kline, R J; Sunday, D F; Chawla, J S; List, S
2015-07-01
The width and shape of 10nm to 12 nm wide lithographically patterned SiO2 lines were measured in the scanning electron microscope by fitting the measured intensity vs. position to a physics-based model in which the lines' widths and shapes are parameters. The approximately 32 nm pitch sample was patterned at Intel using a state-of-the-art pitch quartering process. Their narrow widths and asymmetrical shapes are representative of near-future generation transistor gates. These pose a challenge: the narrowness because electrons landing near one edge may scatter out of the other, so that the intensity profile at each edge becomes width-dependent, and the asymmetry because the shape requires more parameters to describe and measure. Modeling was performed by JMONSEL (Java Monte Carlo Simulation of Secondary Electrons), which produces a predicted yield vs. position for a given sample shape and composition. The simulator produces a library of predicted profiles for varying sample geometry. Shape parameter values are adjusted until interpolation of the library with those values best matches the measured image. Profiles thereby determined agreed with those determined by transmission electron microscopy and critical dimension small-angle x-ray scattering to better than 1 nm. Published by Elsevier B.V.
Energy Technology Data Exchange (ETDEWEB)
Villarrubia, J.S., E-mail: john.villarrubia@nist.gov [Semiconductor and Dimensional Metrology Division, National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); Vladár, A.E.; Ming, B. [Semiconductor and Dimensional Metrology Division, National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); Kline, R.J.; Sunday, D.F. [Materials Science and Engineering Division, National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); Chawla, J.S.; List, S. [Intel Corporation, RA3-252, 5200 NE Elam Young Pkwy, Hillsboro, OR 97124 (United States)
2015-07-15
The width and shape of 10 nm to 12 nm wide lithographically patterned SiO{sub 2} lines were measured in the scanning electron microscope by fitting the measured intensity vs. position to a physics-based model in which the lines' widths and shapes are parameters. The approximately 32 nm pitch sample was patterned at Intel using a state-of-the-art pitch quartering process. Their narrow widths and asymmetrical shapes are representative of near-future generation transistor gates. These pose a challenge: the narrowness because electrons landing near one edge may scatter out of the other, so that the intensity profile at each edge becomes width-dependent, and the asymmetry because the shape requires more parameters to describe and measure. Modeling was performed by JMONSEL (Java Monte Carlo Simulation of Secondary Electrons), which produces a predicted yield vs. position for a given sample shape and composition. The simulator produces a library of predicted profiles for varying sample geometry. Shape parameter values are adjusted until interpolation of the library with those values best matches the measured image. Profiles thereby determined agreed with those determined by transmission electron microscopy and critical dimension small-angle x-ray scattering to better than 1 nm.
Atomistic modeling of L10 FePt: path to HAMR 5Tb/in2
Chen, Tianran; Benakli, Mourad; Rea, Chris
2015-03-01
Heat assisted magnetic recording (HAMR) is a promising approach for increasing the storage density of hard disk drives. To increase data density, information must be written in small grains, which requires materials with high anisotropy energy such as L10 FePt. On the other hand, high anisotropy implies high coercivity, making it difficult to write the data with existing recording heads. This issue can be overcome by the technique of HAMR, where a laser is used to heat the recording medium to reduce its coercivity while retaining good thermal stability at room temperature due to the large anisotropy energy. One of the keys to the success of HAMR is the precise control of writing process. In this talk, I will propose a Monte Carlo simulation, based on an atomistic model, that would allow us to study the magnetic properties of L10 FePt and dynamics of spin reversal for the writing process in HAMR.
International Nuclear Information System (INIS)
Ye Fei; Fang Wei; Wang Feng; Hua Zichun; Wang Zizheng; Yang Xiang
2011-01-01
Purpose: The goal of this study was to evaluate the feasibility of 99m Tc-His 10 -annexin V for the detection of acute myocardial cell death and to assess the effect of adenosine preconditioning in a porcine model of myocardium ischemia and reperfusion injury (RI). Materials and Methods: 99m Tc-His 10 -annexin V was prepared by one-step direct labeling, and RCP and radiostability were tested. The binding of 99m Tc-His 10 -annexin V to apoptosis was validated in vitro using camptothecin-induced Jurkat cells. In vivo biodistribution was determined in mice by the dissection method. Ischemia of 20-30 min was induced by balloon occlusion of the epicardial coronary artery of the porcine model (n=14). Adenosine was infused intravenously in six pigs before coronary occlusion. 99m Tc-His 10 -annexin V (n=12) was injected intravenously at 1 h after reperfusion. SPECT/CT was acquired at 3 h postinjection. Myocardial perfusion imaging (MPI) with 99m Tc-MIBI was also performed 1 day after His 10 -annexin V imaging. Cardiac tissues were analyzed postmortem using hematoxylin-and-eosin and TUNEL staining. Caspase-3 activity was measured to confirm the presence of apoptosis. Results: 99m Tc-His 10 -annexin V had a RCP >98% and high stability 2 h after radiolabeling; it could bind to apoptotic cells with high affinity. Biodistribution of 99m Tc-His 10 -annexin V showed a predominant uptake in the kidney and relatively low uptake in the myocardium, liver and gastrointestinal tract; rapid clearance from blood and kidney was observed. In the untreated group, intense uptake of His 10 -annexin V was visualized in the defect which was shown in MPI, whereas in the adenosine group a mild uptake of 99m Tc-His 10 -annexin was found in the risk area which showed no defects in the 99m Tc-MIBI image. TUNEL staining and activated caspase-3 confirmed the ongoing apoptosis in RI. Adenosine preconditioning significantly diminished the level of apoptosis. Uptake of His 10 -annexin V in RI correlated
Verhaart, Marcel R A; Bielen, Abraham A M; van der Oost, John; Stams, Alfons J M; Kengen, Servé W M
2010-01-01
Hydrogen produced from biomass by bacteria and archaea is an attractive renewable energy source. However, to make its application more feasible, microorganisms are needed with high hydrogen productivities. For several reasons, hyperthermophilic and extremely thermophilic bacteria and archaea are promising is this respect. In addition to the high polysaccharide-hydrolysing capacities of many of these organisms, an important advantage is their ability to use most of the reducing equivalents (e.g. NADH, reduced ferredoxin) formed during glycolysis for the production of hydrogen, enabling H2/hexose ratios of between 3.0 and 4.0. So, despite the fact that the hydrogen-yielding reactions, especially the one from NADH, are thermodynamically unfavourable, high hydrogen yields are obtained. In this review we focus on three different mechanisms that are employed by a few model organisms, viz. Caldicellulosiruptor saccharolyticus and Thermoanaerobacter tengcongensis, Thermotoga maritima, and Pyrococcus furiosus, to efficiently produce hydrogen. In addition, recent developments to improve hydrogen production by hyperthermophilic and extremely thermophilic bacteria and archaea are discussed.
Performance of a 10-kJ SMES model cooled by liquid hydrogen thermo-siphon flow for ASPCS study
International Nuclear Information System (INIS)
Makida, Y; Shintomi, T; Hamajima, T; Tsuda, M; Miyagi, D; Ota, N; Katsura, M; Ando, K; Takao, T; Tsujigami, H; Fujikawa, S; Hirose, J; Iwaki, K; Komagome, T
2015-01-01
We propose a new electrical power storage and stabilization system, called an Advanced Superconducting Power Conditioning System (ASPCS), which consists of superconducting magnetic energy storage (SMES) and hydrogen energy storage, converged on a liquid hydrogen station for fuel cell vehicles. A small 10- kJ SMES system, in which a BSCCO coil cooled by liquid hydrogen was installed, was developed to create an experimental model of an ASPCS. The SMES coil is conductively cooled by liquid hydrogen flow through a thermo-siphon line under a liquid hydrogen buffer tank. After fabrication of the system, cooldown tests were carried out using liquid hydrogen. The SMES coil was successfully charged up to a nominal current of 200 A. An eddy current loss, which was mainly induced in pure aluminum plates pasted onto each pancake coils for conduction cooling, was also measured. (paper)
Zykov, V. M.; Neiman, D. A.
2018-04-01
A physico-mathematical model of the processes of radiation-induced charging of dielectric materials with open surfaces, irradiated with monoenergetic electrons in the energy range 10-30 keV, is described. The model takes into account the relationship between the processes of surface and bulk charging for the given conditions of the experimental design, which accounts for the effect of anomalously long charging of dielectrics after the incident energy of primary electrons during charging is reduced to below the second critical energy for the secondary electronic emission coefficient. The initial fast phase of charging a high-resistivity dielectric material (Al2O3) is investigated. It is shown that as the incident electron energy is approaching the second critical energy during charging, the secondary electronic emission is partially suppressed due to negative charging of the open surface of the dielectric and formation of a near-surface inversion electrical field retarding the electronic emission yield.
HAM Construction modeling using COMSOL with MatLab Modeling Guide version 1.0.
Schijndel, van A.W.M.
2006-01-01
This paper presents a first modeling guide for the modeling and simulation of up to full 3D dynamic Heat, Air & Moisture (HAM) transport of building constructions using COMSOL with Matlab. The modeling scripts are provided at the appendix. Furthermore, all modeling files and results are published at
HAM Construction modeling using COMSOL with MatLab Modeling Guide, version 1.0
Schijndel, van A.W.M.
2006-01-01
This paper presents a first modeling guide for the modeling and simulation of up to full 3D dynamic Heat, Air & Moisture (HAM) transport of building constructions using COMSOL with Matlab. The modeling scripts are provided at the appendix. Furthermore, all modeling files and results are published at
Constructive Epistemic Modeling: A Hierarchical Bayesian Model Averaging Method
Tsai, F. T. C.; Elshall, A. S.
2014-12-01
Constructive epistemic modeling is the idea that our understanding of a natural system through a scientific model is a mental construct that continually develops through learning about and from the model. Using the hierarchical Bayesian model averaging (HBMA) method [1], this study shows that segregating different uncertain model components through a BMA tree of posterior model probabilities, model prediction, within-model variance, between-model variance and total model variance serves as a learning tool [2]. First, the BMA tree of posterior model probabilities permits the comparative evaluation of the candidate propositions of each uncertain model component. Second, systemic model dissection is imperative for understanding the individual contribution of each uncertain model component to the model prediction and variance. Third, the hierarchical representation of the between-model variance facilitates the prioritization of the contribution of each uncertain model component to the overall model uncertainty. We illustrate these concepts using the groundwater modeling of a siliciclastic aquifer-fault system. The sources of uncertainty considered are from geological architecture, formation dip, boundary conditions and model parameters. The study shows that the HBMA analysis helps in advancing knowledge about the model rather than forcing the model to fit a particularly understanding or merely averaging several candidate models. [1] Tsai, F. T.-C., and A. S. Elshall (2013), Hierarchical Bayesian model averaging for hydrostratigraphic modeling: Uncertainty segregation and comparative evaluation. Water Resources Research, 49, 5520-5536, doi:10.1002/wrcr.20428. [2] Elshall, A.S., and F. T.-C. Tsai (2014). Constructive epistemic modeling of groundwater flow with geological architecture and boundary condition uncertainty under Bayesian paradigm, Journal of Hydrology, 517, 105-119, doi: 10.1016/j.jhydrol.2014.05.027.
Hoch, Jannis M.; Neal, Jeffrey C.; Baart, Fedor; Van Beek, Rens; Winsemius, Hessel C.; Bates, Paul D.; Bierkens, Marc F.P.
2017-01-01
We here present GLOFRIM, a globally applicable computational framework for integrated hydrological-hydrodynamic modelling. GLOFRIM facilitates spatially explicit coupling of hydrodynamic and hydrologic models and caters for an ensemble of models to be coupled. It currently encompasses the global
Directory of Open Access Journals (Sweden)
A. Cauquoin
2015-03-01
Full Text Available Ice cores are exceptional archives which allow us to reconstruct a wealth of climatic parameters as well as past atmospheric composition over the last 800 kyr in Antarctica. Inferring the variations in past accumulation rate in polar regions is essential both for documenting past climate and for ice core chronology. On the East Antarctic Plateau, the accumulation rate is so small that annual layers cannot be identified and accumulation rate is mainly deduced from the water isotopic composition assuming constant temporal relationships between temperature, water isotopic composition and accumulation rate. Such an assumption leads to large uncertainties on the reconstructed past accumulation rate. Here, we use high-resolution beryllium-10 (10Be as an alternative tool for inferring past accumulation rate for the EPICA Dome C ice core, in East Antarctica. We present a high-resolution 10Be record covering a full climatic cycle over the period 269 to 355 ka from Marine Isotope Stage (MIS 9 to 10, including a period warmer than pre-industrial (MIS 9.3 optimum. After correcting 10Be for the estimated effect of the palaeomagnetic field, we deduce that the 10Be reconstruction is in reasonably good agreement with EDC3 values for the full cycle except for the period warmer than present. For the latter, the accumulation is up to 13% larger (4.46 cm ie yr−1 instead of 3.95. This result is in agreement with the studies suggesting an underestimation of the deuterium-based accumulation for the optimum of the Holocene (Parrenin et al. 2007a. Using the relationship between accumulation rate and surface temperature from the saturation vapour relationship, the 10Be-based accumulation rate reconstruction suggests that the temperature increase between the MIS 9.3 optimum and present day may be 2.4 K warmer than estimated by the water isotopes reconstruction. We compare these reconstructions to the available model results from CMIP5-PMIP3 for a glacial and an
de Bruijn, Carla; van den Brink, Wim; de Graaf, Ron; Vollebergh, Wilma A. M.
2006-01-01
AIMS: To determine the course of alcohol use disorders (AUD) in a prospective general population study using three different classification systems: Diagnostic and Statistical Manual version IV (DSM-IV), International Classification of Diseases version 10 (ICD-10) and the craving withdrawal model
Directory of Open Access Journals (Sweden)
Nicola Gagliani
Full Text Available BACKGROUND: A large pool of preexisting alloreactive effector T cells can cause allogeneic graft rejection following transplantation. However, it is possible to induce transplant tolerance by altering the balance between effector and regulatory T (Treg cells. Among the various Treg-cell types, Foxp3(+Treg and IL-10-producing T regulatory type 1 (Tr1 cells have frequently been associated with tolerance following transplantation in both mice and humans. Previously, we demonstrated that rapamycin+IL-10 promotes Tr1-cell-associated tolerance in Balb/c mice transplanted with C57BL/6 pancreatic islets. However, this same treatment was unsuccessful in C57BL/6 mice transplanted with Balb/c islets (classified as a stringent transplant model. We accordingly designed a protocol that would be effective in the latter transplant model by simultaneously depleting effector T cells and fostering production of Treg cells. We additionally developed and tested a clinically translatable protocol that used no depleting agent. METHODOLOGY/PRINCIPAL FINDINGS: Diabetic C57BL/6 mice were transplanted with Balb/c pancreatic islets. Recipient mice transiently treated with anti-CD45RB mAb+rapamycin+IL-10 developed antigen-specific tolerance. During treatment, Foxp3(+Treg cells were momentarily enriched in the blood, followed by accumulation in the graft and draining lymph node, whereas CD4(+IL-10(+IL-4(- T (i.e., Tr1 cells localized in the spleen. In long-term tolerant mice, only CD4(+IL-10(+IL-4(- T cells remained enriched in the spleen and IL-10 was key in the maintenance of tolerance. Alternatively, recipient mice were treated with two compounds routinely used in the clinic (namely, rapamycin and G-CSF; this drug combination promoted tolerance associated with CD4(+IL-10(+IL-4(- T cells. CONCLUSIONS/SIGNIFICANCE: The anti-CD45RB mAb+rapamycin+IL-10 combined protocol promotes a state of tolerance that is IL-10 dependent. Moreover, the combination of rapamycin+G-CSF induces
Heat-stable, FE-dependent alcohol dehydrogenase for aldehyde detoxification
Elkins, James G.; Clarkson, Sonya
2018-04-24
The present invention relates to microorganisms and polypeptides for detoxifying aldehydes associated with industrial fermentations. In particular, a heat-stable, NADPH- and iron-dependent alcohol dehydrogenase was cloned from Thermoanaerobacter pseudethanolicus 39E and displayed activity against a number of aldehydes including inhibitory compounds that are produced during the dilute-acid pretreatment process of lignocellulosic biomass before fermentation to biofuels. Methods to use the microorganisms and polypeptides of the invention for improved conversion of bio mass to biofuel are provided as well as use of the enzyme in metabolic engineering strategies for producing longer-chain alcohols from sugars using thermophilic, fermentative microorganisms.
TIA model is attainable in Wistar rats by intraluminal occlusion of the MCA for 10min or shorter.
Durukan Tolvanen, A; Tatlisumak, E; Pedrono, E; Abo-Ramadan, U; Tatlisumak, T
2017-05-15
Transient ischemic attack (TIA) has received only little attention in the experimental research field. Recently, we introduced a TIA model for mice, and here we set similar principles for simulating this human condition in Wistar rats. In the model: 1) transient nature of the event is ensured, and 2) 24h after the event animals are free from any sensorimotor deficit and from any detectable lesion by magnetic resonance imaging (MRI). Animals experienced varying durations of ischemia (5, 10, 12.5, 15, 25, and 30min, n=6-8pergroup) by intraluminal middle cerebral artery occlusion (MCAO). Ischemia severity and reperfusion rates were controlled by cerebral blood flow measurements. Sensorimotor neurological evaluations and MRI at 24h differentiated between TIA and ischemic stroke. Hematoxylin and eosin staining and apoptotic cell counts revealed pathological correlates of the event. We found that already 12.5min of ischemia was long enough to induce ischemic stroke in Wistar rats. Ten min or shorter durations induced neither gross neurological deficits nor infarcts visible on MRI, but histologically caused selective neuronal necrosis. A separate group of animals with 10min of ischemia followed up to 1week after reperfusion remained free of infarction and any MRI signal change. Thus, 10min or shorter focal cerebral ischemia induced by intraluminal MCAO in Wistar rats provides a clinically relevant TIA the rat. This model is useful for studying molecular correlates of TIA. Copyright © 2017 Elsevier B.V. All rights reserved.
PALM-USM v1.0: A new urban surface model integrated into the PALM large-eddy simulation model
Directory of Open Access Journals (Sweden)
J. Resler
2017-10-01
Full Text Available Urban areas are an important part of the climate system and many aspects of urban climate have direct effects on human health and living conditions. This implies that reliable tools for local urban climate studies supporting sustainable urban planning are needed. However, a realistic implementation of urban canopy processes still poses a serious challenge for weather and climate modelling for the current generation of numerical models. To address this demand, a new urban surface model (USM, describing the surface energy processes for urban environments, was developed and integrated as a module into the PALM large-eddy simulation model. The development of the presented first version of the USM originated from modelling the urban heat island during summer heat wave episodes and thus implements primarily processes important in such conditions. The USM contains a multi-reflection radiation model for shortwave and longwave radiation with an integrated model of absorption of radiation by resolved plant canopy (i.e. trees, shrubs. Furthermore, it consists of an energy balance solver for horizontal and vertical impervious surfaces, and thermal diffusion in ground, wall, and roof materials, and it includes a simple model for the consideration of anthropogenic heat sources. The USM was parallelized using the standard Message Passing Interface and performance testing demonstrates that the computational costs of the USM are reasonable on typical clusters for the tested configurations. The module was fully integrated into PALM and is available via its online repository under the GNU General Public License (GPL. The USM was tested on a summer heat-wave episode for a selected Prague crossroads. The general representation of the urban boundary layer and patterns of surface temperatures of various surface types (walls, pavement are in good agreement with in situ observations made in Prague. Additional simulations were performed in order to assess the
Massive type IIA supergravity and E10
International Nuclear Information System (INIS)
Henneaux, M.; Kleinschmidt, A.; Persson, D.; Jamsin, E.
2009-01-01
In this talk we investigate the symmetry under E 10 of Romans' massive type IIA supergravity. We show that the dynamics of a spinning particle in a non-linear sigma model on the coset space E 10 /K(E 10 ) reproduces the bosonic and fermionic dynamics of massive IIA supergravity, in the standard truncation. In particular, we identify Romans' mass with a generator of E 10 that is beyond the realm of the generators of E 10 considered in the eleven-dimensional analysis, but using the same, underformed sigma model. As a consequence, this work provides a dynamical unification of the massless and massive versions of type IIA supergravity inside E 10 . (Abstract Copyright [2009], Wiley Periodicals, Inc.)
Couvidat, F.; Sartelet, K.
2015-04-01
In this paper the Secondary Organic Aerosol Processor (SOAP v1.0) model is presented. This model determines the partitioning of organic compounds between the gas and particle phases. It is designed to be modular with different user options depending on the computation time and the complexity required by the user. This model is based on the molecular surrogate approach, in which each surrogate compound is associated with a molecular structure to estimate some properties and parameters (hygroscopicity, absorption into the aqueous phase of particles, activity coefficients and phase separation). Each surrogate can be hydrophilic (condenses only into the aqueous phase of particles), hydrophobic (condenses only into the organic phases of particles) or both (condenses into both the aqueous and the organic phases of particles). Activity coefficients are computed with the UNIFAC (UNIversal Functional group Activity Coefficient; Fredenslund et al., 1975) thermodynamic model for short-range interactions and with the Aerosol Inorganic-Organic Mixtures Functional groups Activity Coefficients (AIOMFAC) parameterization for medium- and long-range interactions between electrolytes and organic compounds. Phase separation is determined by Gibbs energy minimization. The user can choose between an equilibrium representation and a dynamic representation of organic aerosols (OAs). In the equilibrium representation, compounds in the particle phase are assumed to be at equilibrium with the gas phase. However, recent studies show that the organic aerosol is not at equilibrium with the gas phase because the organic phases could be semi-solid (very viscous liquid phase). The condensation-evaporation of organic compounds could then be limited by the diffusion in the organic phases due to the high viscosity. An implicit dynamic representation of secondary organic aerosols (SOAs) is available in SOAP with OAs divided into layers, the first layer being at the center of the particle (slowly
DEFF Research Database (Denmark)
Bredmose, Henrik; Lemmer, F.; Borg, Michael Borg
2017-01-01
Results of a test campaign for a floating wind turbine in simultaneous wind and wave forcing at scale 1:60 are presented. The floater is the Triple Spar floater, a hybrid between a spar buoy and a semi submersible tri-floater, tested here for the first time. The turbine is a model scale version...... of the DTU 10 MW reference wind turbine, which, also for the first time, is tested with active blade pitch control. The tests focus on the effects of aerodynamic damping and interaction effects between the wind forcing, wave forcing and the blade pitch control algorithm. Special focus is devoted...... to the instability of the platform pitch natural mode, that can occur if a standard land-based controller is applied....
Determining the nuclear data uncertainty on MONK10 and WIMS10 criticality calculations
Ware, Tim; Dobson, Geoff; Hanlon, David; Hiles, Richard; Mason, Robert; Perry, Ray
2017-09-01
The ANSWERS Software Service is developing a number of techniques to better understand and quantify uncertainty on calculations of the neutron multiplication factor, k-effective, in nuclear fuel and other systems containing fissile material. The uncertainty on the calculated k-effective arises from a number of sources, including nuclear data uncertainties, manufacturing tolerances, modelling approximations and, for Monte Carlo simulation, stochastic uncertainty. For determining the uncertainties due to nuclear data, a set of application libraries have been generated for use with the MONK10 Monte Carlo and the WIMS10 deterministic criticality and reactor physics codes. This paper overviews the generation of these nuclear data libraries by Latin hypercube sampling of JEFF-3.1.2 evaluated data based upon a library of covariance data taken from JEFF, ENDF/B, JENDL and TENDL evaluations. Criticality calculations have been performed with MONK10 and WIMS10 using these sampled libraries for a number of benchmark models of fissile systems. Results are presented which show the uncertainty on k-effective for these systems arising from the uncertainty on the input nuclear data.
A refined index of model performance: a rejoinder
Legates, David R.; McCabe, Gregory J.
2013-01-01
Willmott et al. [Willmott CJ, Robeson SM, Matsuura K. 2012. A refined index of model performance. International Journal of Climatology, forthcoming. DOI:10.1002/joc.2419.] recently suggest a refined index of model performance (dr) that they purport to be superior to other methods. Their refined index ranges from − 1.0 to 1.0 to resemble a correlation coefficient, but it is merely a linear rescaling of our modified coefficient of efficiency (E1) over the positive portion of the domain of dr. We disagree with Willmott et al. (2012) that dr provides a better interpretation; rather, E1 is more easily interpreted such that a value of E1 = 1.0 indicates a perfect model (no errors) while E1 = 0.0 indicates a model that is no better than the baseline comparison (usually the observed mean). Negative values of E1 (and, for that matter, dr McCabe [Legates DR, McCabe GJ. 1999. Evaluating the use of “goodness-of-fit” measures in hydrologic and hydroclimatic model validation. Water Resources Research 35(1): 233-241.] and Schaefli and Gupta [Schaefli B, Gupta HV. 2007. Do Nash values have value? Hydrological Processes 21: 2075-2080. DOI: 10.1002/hyp.6825.]. This important discussion focuses on the appropriate baseline comparison to use, and why the observed mean often may be an inadequate choice for model evaluation and development.
Ferguson, Stephen A.; Wang, Xuewei; Meyerhoff, Mark E.
2016-01-01
Polymeric quaternary ammonium salts (polyquaterniums) have found increasing use in industrial and cosmetic applications in recent years. More specifically, polyquaternium-10 (PQ-10) is routinely used in cosmetic applications as a conditioner in personal care product formulations. Herein, we demonstrate the use of potentiometric polyion-sensitive polymeric membrane-based electrodes to quantify PQ-10 levels. Mixtures containing both PQ-10 and sodium lauryl sulfate (SLS) are used as model sample...
Beck, Goichi; Maehara, Shunsuke; Chang, Phat Ly; Papa, Stella M
2018-03-06
Phosphodiesterase 10A is a member of the phosphodiesterase family whose brain expression is restricted to the striatum. Phosphodiesterase 10A regulates cyclic adenosine monophosphate and cyclic guanosine monophosphate, which mediate responses to dopamine receptor activation, and the levels of these cyclic nucleotides are decreased in experimental models of l-dopa-induced dyskinesia. The elevation of cyclic adenosine monophosphate/cyclic guanosine monophosphate levels by phosphodiesterase 10A inhibition may thus be targeted to reduce l-dopa-induced dyskinesia. The present study was aimed at determining the potential antidyskinetic effects of phosphodiesterase 10A inhibitors in a primate model of Parkinson's disease (PD). The experiments performed in this model were also intended to provide translational data for the design of future clinical trials. Five MPTP-treated macaques with advanced parkinsonism and reproducible l-dopa-induced dyskinesia were used. MR1916, a selective phosphodiesterase 10A inhibitor, at doses 0.0015 to 0.05 mg/kg, subcutaneously, or its vehicle (control test) was coadministered with l-dopa methyl ester acutely (predetermined optimal and suboptimal subcutaneous doses) and oral l-dopa chronically as daily treatment for 5 weeks. Standardized scales were used to assess motor disability and l-dopa-induced dyskinesia by blinded examiners. Pharmacokinetics was also examined. MR1916 consistently reduced l-dopa-induced dyskinesia in acute tests of l-dopa optimal and suboptimal doses. Significant effects were present with every MR1916 dose tested, but the most effective was 0.015 mg/kg. None of the MR1916 doses tested affected the antiparkinsonian action of l-dopa at the optimal dose. The anti-l-dopa-induced dyskinesia effect of MR1916 (0.015 mg/kg, subcutaneously) was sustained with chronic administration, indicating that tolerance did not develop over the 5-week treatment. No adverse effects were observed after MR1916 administration acutely or
Orru, Kati; Nordin, Steven; Harzia, Hedi; Orru, Hans
2018-03-31
Adverse health impact of air pollution on health may not only be associated with the level of exposure, but rather mediated by perception of the pollution and by top-down processing (e.g. beliefs of the exposure being hazardous), especially in areas with relatively low levels of pollutants. The aim of this study was to test a model that describes interrelations between air pollution (particles pollution, health risk perception, health symptoms and diseases. A population-based questionnaire study was conducted among 1000 Estonian residents (sample was stratified by age, sex, and geographical location) about health risk perception and coping. The PM 10 levels were modelled in 1 × 1 km grids using a Eulerian air quality dispersion model. Respondents were ascribed their annual mean PM 10 exposure according to their home address. Path analysis was performed to test the validity of the model. The data refute the model proposing that exposure level significantly influences symptoms and disease. Instead, the perceived exposure influences symptoms and the effect of perceived exposure on disease is mediated by health risk perception. This relationship is more pronounced in large cities compared to smaller towns or rural areas. Perceived pollution and health risk perception, in particular in large cities, play important roles in understanding and predicting environmentally induced symptoms and diseases at relatively low levels of air pollution.
Experiment Analysis and Modelling of Compaction Behaviour of Ag60Cu30Sn10 Mixed Metal Powders
Zhou, Mengcheng; Huang, Shangyu; Liu, Wei; Lei, Yu; Yan, Shiwei
2018-03-01
A novel process method combines powder compaction and sintering was employed to fabricate thin sheets of cadmium-free silver based filler metals, the compaction densification behaviour of Ag60Cu30Sn10 mixed metal powders was investigated experimentally. Based on the equivalent density method, the density-dependent Drucker-Prager Cap (DPC) model was introduced to model the powder compaction behaviour. Various experiment procedures were completed to determine the model parameters. The friction coefficients in lubricated and unlubricated die were experimentally determined. The determined material parameters were validated by experiments and numerical simulation of powder compaction process using a user subroutine (USDFLD) in ABAQUS/Standard. The good agreement between the simulated and experimental results indicates that the determined model parameters are able to describe the compaction behaviour of the multicomponent mixed metal powders, which can be further used for process optimization simulations.
Loposer, J. Dan; Rumsey, Charles B.
1954-01-01
Measurement of average skin-friction coefficients have been made on six rocket-powered free-flight models by using the boundary-layer rake technique. The model configuration was the NACA RM-10, a 12.2-fineness-ratio parabolic body of revolution with a flat base. Measurements were made over a Mach number range from 1 to 3.7, a Reynolds number range 40 x 10(exp 6) to 170 x 10(exp 6) based on length to the measurement station, and with aerodynamic heating conditions varying from strong skin heating to strong skin cooling. The measurements show the same trends over the test ranges as Van Driest's theory for turbulent boundary layer on a flat plate. The measured values are approximately 7 percent higher than the values of the flat-plate theory. A comparison which takes into account the differences in Reynolds number is made between the present results and skin-friction measurements obtained on NACA RM-10 scale models in the Langley 4- by 4-foot supersonic pressure tunnel, the Lewis 8- by 6-foot supersonic tunnel, and the Langley 9-inch supersonic tunnel. Good agreement is shown at all but the lowest tunnel Reynolds number conditions. A simple empirical equation is developed which represents the measurements over the range of the tests.
The operational eEMEP model version 10.4 for volcanic SO2 and ash forecasting
Steensen, Birthe M.; Schulz, Michael; Wind, Peter; Valdebenito, Álvaro M.; Fagerli, Hilde
2017-05-01
This paper presents a new version of the EMEP MSC-W model called eEMEP developed for transportation and dispersion of volcanic emissions, both gases and ash. EMEP MSC-W is usually applied to study problems with air pollution and aerosol transport and requires some adaptation to treat volcanic eruption sources and effluent dispersion. The operational set-up of model simulations in case of a volcanic eruption is described. Important choices have to be made to achieve CPU efficiency so that emergency situations can be tackled in time, answering relevant questions of ash advisory authorities. An efficient model needs to balance the complexity of the model and resolution. We have investigated here a meteorological uncertainty component of the volcanic cloud forecast by using a consistent ensemble meteorological dataset (GLAMEPS forecast) at three resolutions for the case of SO2 emissions from the 2014 Barðarbunga eruption. The low resolution (40 × 40 km) ensemble members show larger agreement in plume position and intensity, suggesting that the ensemble here does not give much added value. To compare the dispersion at different resolutions, we compute the area where the column load of the volcanic tracer, here SO2, is above a certain threshold, varied for testing purposes between 0.25 and 50 Dobson units. The increased numerical diffusion causes a larger area (+34 %) to be covered by the volcanic tracer in the low resolution simulations than in the high resolution ones. The higher resolution (10 × 10 km) ensemble members show higher column loads farther away from the volcanic eruption site in narrower clouds. Cloud positions are more varied between the high resolution members, and the cloud forms resemble the observed clouds more than the low resolution ones. For a volcanic emergency case this means that to obtain quickly results of the transport of volcanic emissions, an individual simulation with our low resolution is sufficient; however, to forecast peak
Neutrino masses in an SO(10) model with an intermediate stage of symmetry breaking
International Nuclear Information System (INIS)
Svetovoi, V.B.
1982-01-01
The effect on neutrino masses of an intermediate stage in symmetry breaking different from SU(5) is investigated in detail for the SO(10) model. There are two possibilities depending on the contents of the Higgs sector: i) m/sub ν/approx.m/sub f/(M/sub W//M 1 ); ii) m/sub ν/approx.m/sub f/(M/sub W//M 1 )(M/M 1 ), where M, M 1 and M/sub W/ are the scales of the breaking of the original SO(10) symmetry, the intermediate symmetry, and the standard SU/sub c/(3) x SU/sub L/(2) x U(1) symmetry, respectively, and m/sub f/ is a typical fermion mass. It is shown that a Majorana mass of the right-handed-neutrino (ν/sub R/) of a purely loop origin would result in too large a mass of the usual neutrinos, so a tree-graph contribution to the mass of ν/sub R/ is necessary. Numerical estimates for the neutrino masses are discussed
BADGER v1.0: A Fortran equation of state library
Heltemes, T. A.; Moses, G. A.
2012-12-01
The BADGER equation of state library was developed to enable inertial confinement fusion plasma codes to more accurately model plasmas in the high-density, low-temperature regime. The code had the capability to calculate 1- and 2-T plasmas using the Thomas-Fermi model and an individual electron accounting model. Ion equation of state data can be calculated using an ideal gas model or via a quotidian equation of state with scaled binding energies. Electron equation of state data can be calculated via the ideal gas model or with an adaptation of the screened hydrogenic model with ℓ-splitting. The ionization and equation of state calculations can be done in local thermodynamic equilibrium or in a non-LTE mode using a variant of the Busquet equivalent temperature method. The code was written as a stand-alone Fortran library for ease of implementation by external codes. EOS results for aluminum are presented that show good agreement with the SESAME library and ionization calculations show good agreement with the FLYCHK code. Program summaryProgram title: BADGERLIB v1.0 Catalogue identifier: AEND_v1_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/AEND_v1_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.: 41 480 No. of bytes in distributed program, including test data, etc.: 2 904 451 Distribution format: tar.gz Programming language: Fortran 90. Computer: 32- or 64-bit PC, or Mac. Operating system: Windows, Linux, MacOS X. RAM: 249.496 kB plus 195.630 kB per isotope record in memory Classification: 19.1, 19.7. Nature of problem: Equation of State (EOS) calculations are necessary for the accurate simulation of high energy density plasmas. Historically, most EOS codes used in these simulations have relied on an ideal gas model. This model is inadequate for low
A Comprehensive Curation Shows the Dynamic Evolutionary Patterns of Prokaryotic CRISPRs
Directory of Open Access Journals (Sweden)
Guoqin Mai
2016-01-01
Full Text Available Motivation. Clustered regularly interspaced short palindromic repeat (CRISPR is a genetic element with active regulation roles for foreign invasive genes in the prokaryotic genomes and has been engineered to work with the CRISPR-associated sequence (Cas gene Cas9 as one of the modern genome editing technologies. Due to inconsistent definitions, the existing CRISPR detection programs seem to have missed some weak CRISPR signals. Results. This study manually curates all the currently annotated CRISPR elements in the prokaryotic genomes and proposes 95 updates to the annotations. A new definition is proposed to cover all the CRISPRs. The comprehensive comparison of CRISPR numbers on the taxonomic levels of both domains and genus shows high variations for closely related species even in the same genus. The detailed investigation of how CRISPRs are evolutionarily manipulated in the 8 completely sequenced species in the genus Thermoanaerobacter demonstrates that transposons act as a frequent tool for splitting long CRISPRs into shorter ones along a long evolutionary history.
A LEI 10.639/2003 – UMA ABORDAGEM CONCEITUAL
Directory of Open Access Journals (Sweden)
Fabiana Haro dos Santos,
2015-09-01
Full Text Available This article refers to a literature entitled "The Law 10.639/2003 - AN APPROACH CONCEPT" and aims to present the definition of concepts that permeate the Law 10.639/2003, which deals with the mandatory teaching of African History and Culture -Brasileira in schools. This concept is essential to the reader, can teacher, clarifying as their ways of working this subject in the classroom. It aims to guide the practice of vocational education, which through their studies, may contribute to the promotion of equality between people, excluding its pedagogical action thoughts and reflections laden with stereotypes, ideologies, labels and models in order to, establish a multicultural society
MLP based models to predict PM10, O3 concentrations, in Sines industrial area
Durao, R.; Pereira, M. J.
2012-04-01
Sines is an important Portuguese industrial area located southwest cost of Portugal with important nearby protected natural areas. The main economical activities are related with this industrial area, the deep-water port, petrochemical and thermo-electric industry. Nevertheless, tourism is also an important economic activity especially in summer time with potential to grow. The aim of this study is to develop prediction models of pollutant concentration categories (e.g. low concentration and high concentration) in order to provide early warnings to the competent authorities who are responsible for the air quality management. The knowledge in advanced of pollutant high concentrations occurrence will allow the implementation of mitigation actions and the release of precautionary alerts to population. The regional air quality monitoring network consists in three monitoring stations where a set of pollutants' concentrations are registered on a continuous basis. From this set stands out the tropospheric ozone (O3) and particulate matter (PM10) due to the high concentrations occurring in the region and their adverse effects on human health. Moreover, the major industrial plants of the region monitor SO2, NO2 and particles emitted flows at the principal chimneys (point sources), also on a continuous basis,. Therefore Artificial neuronal networks (ANN) were the applied methodology to predict next day pollutant concentrations; due to the ANNs structure they have the ability to capture the non-linear relationships between predictor variables. Hence the first step of this study was to apply multivariate exploratory techniques to select the best predictor variables. The classification trees methodology (CART) was revealed to be the most appropriate in this case.. Results shown that pollutants atmospheric concentrations are mainly dependent on industrial emissions and a complex combination of meteorological factors and the time of the year. In the second step, the Multi
Shane, D D; Larson, R L; Sanderson, M W; Miesner, M; White, B J
2017-10-01
Some cattle production experts believe that cow-calf producers should breed replacement heifers (nulliparous cows) before cows (primiparous and multiparous cows), sometimes referred to as providing a heifer lead time (tHL). Our objective was to model the effects different durations of tHL may have on measures of herd productivity, including the percent of the herd cycling before the end of the first 21 d of the breeding season (%C21), the percent of the herd pregnant at pregnancy diagnosis (%PPD), the distribution of pregnancy by 21-d breeding intervals, the kilograms of calf weaned per cow exposed (KPC), and the replacement percentage (%RH), using a deterministic, dynamic systems model of cow-calf production over a 10-yr horizon. We also wished to examine differences in the effect of tHL related to the primiparous duration of postpartum anestrus (dPPA). The study model examined 6 different dPPA for primiparous cows (60, 70, 80, 90, 100, or 110 d). The multiparous cow duration of postpartum anestrus was set to 60 d. The breeding season length for nulliparous cows was 63 d, as was the breeding season length for primiparous and multiparous cows. Nulliparous cows were modeled with a tHL of 0, 7, 14, 21, 28, 35, or 42 d. Results are reported for the final breeding season of the 10-yr horizon. Increasing tHL resulted in a greater %C21 for the herd and for primiparous cows. Length of tHL had minimal impact on the %PPD unless the dPPA was 80 d or greater. For a dPPA of 110 d, a 0 d tHL resulted in the herd having 88.1 %PPD. When tHL was 21 d, the %PPD increased to 93.0%. The KPC was 161.2 kg when the dPPA was 110 d and tHL was 0 d and improved to 183.2 kg when tHL was increased to 42 d. The %RH did not vary much unless the dPPA was 90 d or greater, but increasing tHL resulted in decreased %RH. Based on the model results, increasing tHL improves the production outcomes included in the analysis, but herds with dPPA of 90 d or greater had the greatest degree of improvement
Directory of Open Access Journals (Sweden)
Stefania Correale
Full Text Available UbcH10 is a component of the Ubiquitin Conjugation Enzymes (Ubc; E2 involved in the ubiquitination cascade controlling the cell cycle progression, whereby ubiquitin, activated by E1, is transferred through E2 to the target protein with the involvement of E3 enzymes. In this work we propose the first three dimensional model of the tetrameric complex formed by the human UbA1 (E1, two ubiquitin molecules and UbcH10 (E2, leading to the transthiolation reaction. The 3D model was built up by using an experimentally guided incremental docking strategy that combined homology modeling, protein-protein docking and refinement by means of molecular dynamics simulations. The structural features of the in silico model allowed us to identify the regions that mediate the recognition between the interacting proteins, revealing the active role of the ubiquitin crosslinked to E1 in the complex formation. Finally, the role of these regions involved in the E1-E2 binding was validated by designing short peptides that specifically interfere with the binding of UbcH10, thus supporting the reliability of the proposed model and representing valuable scaffolds for the design of peptidomimetic compounds that can bind selectively to Ubcs and inhibit the ubiquitylation process in pathological disorders.
Czech Academy of Sciences Publication Activity Database
Kovářová, Hana; Valeková, Ivona; Jarkovská, Karla; Kotrčová, Eva; Motlík, Jan; Gadher, S. J.
2015-01-01
Roč. 78, Suppl 2 (2015), s. 10-11 ISSN 1210-7859. [Conference on Animal Models for neurodegenerative Diseases /3./. 08.11.2015-10.11.2015, Liblice] R&D Projects: GA MŠk ED2.1.00/03.0124 Institutional support: RVO:67985904 Keywords : porcine Huntington ´s disease model * IFNα * IL-10 Subject RIV: EB - Genetics ; Molecular Biology
Grids of rotating stellar models with masses between 1.0 and 3.0 M⊙
International Nuclear Information System (INIS)
Yang Wu-Ming; Bi Shao-Lan; Meng Xiang-Cun
2013-01-01
We calculated a grid of evolutionary tracks of rotating models with masses between 1.0 and 3.0 M ⊙ and resolution δM ≤ 0.02 M ⊙ , which can be used to study the effects of rotation on stellar evolution and on the characteristics of star clusters. The value of ∼ 2.05 M ⊙ is a critical mass for the effects of rotation on stellar structure and evolution. For stars with M > 2.05 M ⊙ , rotation leads to an increase in the convective core and prolongs their lifetime on the main sequence (MS); rotating models evolve more slowly than non-rotating ones; the effects of rotation on the evolution of these stars are similar to those of convective core overshooting. However for stars with 1.1 < M/M ⊙ < 2.05, rotation results in a decrease in the convective core and shortens the duration of the MS stage; rotating models evolve faster than non-rotating ones. When the mass has values in the range ∼ 1.7–2.0 M ⊙ , the mixing caused by rotationally induced instabilities is not efficient; the hydrostatic effects dominate processes associated with the evolution of these stars. For models with masses between about 1.6 and 2.0 M ⊙ , rotating models always exhibit lower effective temperatures than non-rotating ones at the same age during the MS stage. For a given age, the lower the mass, the smaller the change in the effective temperature. Thus rotations could lead to a color spread near the MS turnoff in the color-magnitude diagram for intermediate-age star clusters
Directory of Open Access Journals (Sweden)
Mirco Martens
2017-11-01
Full Text Available In this paper, a new approach for modeling the static force characteristic of Festo pneumatic muscle actuators (PMAs will be presented. The model is physically motivated and therefore gives a deeper understanding of the Festo PMA. After introducing the new model, it will be validated through a comparison to a measured force map of a Festo DMSP-10-250 and a DMSP-20-300, respectively. It will be shown that the error between the new model and the measured data is below 4.4% for the DMSP-10-250 and below 2.35% for the DMSP-20-300. In addition, the quality of the presented model will be compared to the quality of existing models by comparing the maximum error. It can be seen that the newly introduced model is closer to the measured force characteristic of a Festo PMA than any existing model.
Determining the nuclear data uncertainty on MONK10 and WIMS10 criticality calculations
Directory of Open Access Journals (Sweden)
Ware Tim
2017-01-01
Full Text Available The ANSWERS Software Service is developing a number of techniques to better understand and quantify uncertainty on calculations of the neutron multiplication factor, k-effective, in nuclear fuel and other systems containing fissile material. The uncertainty on the calculated k-effective arises from a number of sources, including nuclear data uncertainties, manufacturing tolerances, modelling approximations and, for Monte Carlo simulation, stochastic uncertainty. For determining the uncertainties due to nuclear data, a set of application libraries have been generated for use with the MONK10 Monte Carlo and the WIMS10 deterministic criticality and reactor physics codes. This paper overviews the generation of these nuclear data libraries by Latin hypercube sampling of JEFF-3.1.2 evaluated data based upon a library of covariance data taken from JEFF, ENDF/B, JENDL and TENDL evaluations. Criticality calculations have been performed with MONK10 and WIMS10 using these sampled libraries for a number of benchmark models of fissile systems. Results are presented which show the uncertainty on k-effective for these systems arising from the uncertainty on the input nuclear data.
Susiana, Elis
2017-01-01
The purpose of this study is to determine the effectiveness of the implementation of Active Learning model with Crossword Puzzle method in the learning of class X economics at SMAN 10 Pontianak. The method used in this research is the experimental method with the experimental quasi-experimental design with the design of time series research design. The subjects in this study are students of class XE SMAN 10 Pontianak with 39 students. Data collection techniques used are direct observation tec...
Fetoni, Anna Rita; Piacentini, Roberto; Fiorita, Antonella; Paludetti, Gaetano; Troiani, Diana
2009-02-27
The mitochondrial respiratory chain is a powerful source of reactive oxygen species (ROS) also in noise induced hearing loss (NIHL) and anti-oxidants and free-radicals scavengers have been shown to attenuate the damage. Coenzyme Q(10) (CoQ(10)) or ubiquinone has a bioenergetic role as a component of the mithocondrial respiratory chain, it inhibits mitochondrial lipid peroxidation, inducing ATP production and it is involved in ROS removal and prevention of oxidative stress-induced apoptosis. However the therapeutic application of CoQ(10) is limited by the lack of solubility and poor bio- availability, therefore it is a challenge to improve its water solubility in order to ameliorate the efficacy in tissues and fluids. This study was conducted in a model of acoustic trauma in the guinea pig where the effectiveness of CoQ(10) was compared with a soluble formulation of CoQ(10) (multicomposite CoQ(10) Terclatrate, Q-ter) given intraperitoneally 1 h before and once daily for 3 days after pure tone noise exposure (6 kHz for 1 h at 120 dB SPL). Functional and morphological studies were carried out by measuring auditory brainstem responses, scanning electron microscopy for hair cell loss count, active caspase 3 staining and terminal deoxynucleotidyl transferase-mediated dUTP labelling assay in order to identify initial signs of apoptosis. Treatments decreased active caspase 3 expression and the number of apoptotic cells, but animals injected with Q-ter showed a greater degree of activity in preventing apoptosis and thus in improving hearing. These data confirm that solubility of Coenzyme Q(10) improves the ability of CoQ(10) in preventing oxidative injuries that result from mitochondrial dysfunction.
Analysis of Seismic Soil-Structure Interaction for a Nuclear Power Plant (HTR-10
Directory of Open Access Journals (Sweden)
Xiaoxin Wang
2017-01-01
Full Text Available The response of nuclear power plants (NPPs to seismic events is affected by soil-structure interactions (SSI. In the present paper, a finite element (FE model with transmitting boundaries is used to analyse the SSI effect on the response of NPP buildings subjected to vertically incident seismic excitation. Analysis parameters that affect the accuracy of the calculations, including the dimension of the domain and artificial boundary types, are investigated through a set of models. A numerical SSI analysis for the 10 MW High Temperature Gas Cooled Test Reactor (HTR-10 under seismic excitation was carried out using the developed model. The floor response spectra (FRS produced by the SSI analysis are compared with a fixed-base model to investigate the SSI effect on the dynamic response of the reactor building. The results show that the FRS at foundation level are reduced and those at higher floor levels are altered significantly when taking SSI into account. The peak frequencies of the FRS are reduced due to the SSI, whereas the acceleration at high floor levels is increased at a certain frequency range. The seismic response of the primary system components, however, is reduced by the analysed SSI for the HTR-10 on the current soil site.
Futility of high-precision SO(10) calculations
International Nuclear Information System (INIS)
Dixit, V.V.; Sher, M.
1989-01-01
In grand unified models, there are a large number of scalar bosons with masses of the order of the unification scale. Since the masses could be an order of magnitude or so above or below the vector-boson masses, they will affect the beta functions and thus low-energy predictions; the lack of knowledge of the masses translates into an uncertainty in these predictions. Although the effect is very small for a single scalar field, SO(10) models have hundreds of such fields, leading to very large uncertainties. We analyze this effect in SO(10) models with intermediate scales, and show that all such models have an additional uncertainty which can be as large as 4 orders of magnitude in the proton lifetime and as large as a factor of 0.02 in sin 2 θ w . In models with 210-dimensional representations, the weak mixing angle is uncertain by as much as 0.06. As a result, we argue that precise calculations in SO(10) models with intermediate scales may not be possible
Mikolka, P; Mokra, D; Drgova, A; Petras, M; Mokry, J
2012-04-01
In allergic asthma, activated cells produce various substances including reactive oxygen species (ROS). As heterogenic pathophysiology of asthma results to different response to the therapy, testing novel interventions continues. Because of water-insolubility of some potentially beneficial drugs, dimethyl sulfoxide (DMSO) is often used as a solvent. Based on its antioxidant properties, this study evaluated effects of DMSO on mobilization of leukocytes into the lungs, and oxidation processes induced by ovalbumin (OVA)-sensitization in a guinea-pig model of allergic asthma. Guinea-pigs were divided into OVA-sensitized and naive animals. One group of OVA-sensitized animals and one group of naive animals were pretreated with 10% DMSO, the other two groups were given saline. After sacrificing animals, blood samples were taken and total antioxidant status (TAS) in the plasma was determined. Left lungs were saline-lavaged and differential leukocyte count in bronchoalveolar lavage fluid (BAL) was made. Right lung tissue was homogenized, TAS and products of lipid and protein oxidation were determined in the lung homogenate and in isolated mitochondria. OVA-sensitization increased total number of cells and percentages of eosinophils and neutrophils in BAL fluid; increased lipid and protein oxidation in the lung homogenate and mitochondria, and decreased TAS in the lungs and plasma compared with naive animals. However, no differences were observed in DMSO-instilled animals compared to controls. In conclusion, OVA-sensitization increased mobilization of leukocytes into the lungs and elevated production of ROS, accompanied by decrease in TAS. 10% DMSO had no effect on lipid and protein oxidation in a guinea-pig model of allergic asthma.
Directory of Open Access Journals (Sweden)
Rockwood Kenneth
2008-02-01
Full Text Available Abstract Background On average, health worsens with age, but many people have periods of improvement. A stochastic model provides an excellent description of how such changes occur. Given that cognition also changes with age, we wondered whether the same model might also describe the accumulation of errors in cognitive test scores in community-dwelling older adults. Methods In this prospective cohort study, 8954 older people (aged 65+ at baseline from the Canadian Study of Health and Aging were followed for 10 years. Cognitive status was defined by the number of errors on the 100-point Modified Min-Mental State Examination. The error count was chosen to parallel the deficit count in the general model of aging, which is based on deficit accumulation. As with the deficit count, a Markov chain transition model was employed, with 4 parameters. Results On average, the chance of making errors increased linearly with the number of errors present at each time interval. Changes in cognitive states were described with high accuracy (R2 = 0.96 by a modified Poisson distribution, using four parameters: the background chance of accumulating additional errors, the chance of incurring more or fewer errors, given the existing number, and the corresponding background and incremental chances of dying. Conclusion The change in the number of errors in a cognitive test corresponded to a general model that also summarizes age-related changes in deficits. The model accounts for both improvement and deterioration and appears to represent a clinically relevant means of quantifying how various aspects of health status change with age.
Due Regard Encounter Model Version 1.0
2013-08-19
Note that no existing model covers encoun- ters between two IFR aircraft in oceanic airspace. The reason for this is that one cannot observe encounters...encounters between instrument flight rules ( IFR ) and non- IFR traffic beyond 12NM. 2 TABLE 1 Encounter model categories. Aircraft of Interest Intruder...Aircraft Location Flight Rule IFR VFR Noncooperative Noncooperative Conventional Unconventional CONUS IFR C C U X VFR C U U X Offshore IFR C C U X VFR C U
Directory of Open Access Journals (Sweden)
J. M. Hoch
2017-10-01
Full Text Available We here present GLOFRIM, a globally applicable computational framework for integrated hydrological–hydrodynamic modelling. GLOFRIM facilitates spatially explicit coupling of hydrodynamic and hydrologic models and caters for an ensemble of models to be coupled. It currently encompasses the global hydrological model PCR-GLOBWB as well as the hydrodynamic models Delft3D Flexible Mesh (DFM; solving the full shallow-water equations and allowing for spatially flexible meshing and LISFLOOD-FP (LFP; solving the local inertia equations and running on regular grids. The main advantages of the framework are its open and free access, its global applicability, its versatility, and its extensibility with other hydrological or hydrodynamic models. Before applying GLOFRIM to an actual test case, we benchmarked both DFM and LFP for a synthetic test case. Results show that for sub-critical flow conditions, discharge response to the same input signal is near-identical for both models, which agrees with previous studies. We subsequently applied the framework to the Amazon River basin to not only test the framework thoroughly, but also to perform a first-ever benchmark of flexible and regular grids on a large-scale. Both DFM and LFP produce comparable results in terms of simulated discharge with LFP exhibiting slightly higher accuracy as expressed by a Kling–Gupta efficiency of 0.82 compared to 0.76 for DFM. However, benchmarking inundation extent between DFM and LFP over the entire study area, a critical success index of 0.46 was obtained, indicating that the models disagree as often as they agree. Differences between models in both simulated discharge and inundation extent are to a large extent attributable to the gridding techniques employed. In fact, the results show that both the numerical scheme of the inundation model and the gridding technique can contribute to deviations in simulated inundation extent as we control for model forcing and boundary
Denollet, Johan; Smolderen, Kim G E; van den Broek, Krista C; Pedersen, Susanne S
2007-06-01
Dysfunctional parenting styles are associated with poor mental and physical health. The 10-item Remembered Relationship with Parents (RRP(10)) scale retrospectively assesses Alienation (dysfunctional communication and intimacy) and Control (overprotection by parents), with an emphasis on deficiencies in empathic parenting. We examined the 2-factor structure of the RRP(10) and its relationship with adult depression. 664 respondents from the general population (48% men, mean age 54.6+/-14.2 years) completed the RRP(10), Parental Bonding Instrument (PBI), and Beck Depression Inventory. The Alienation and Control dimensions of the RRP(10) displayed a sound factor structure, good internal consistency (Cronbach's alpha=0.83-0.86), and convergent validity against the PBI scales. No significant gender differences were found on the RRP(10) scales. Stratifying by RRP(10) dimensions showed that respondents high in Alienation and Control, for both father (33.3% vs. 14.5%, pparental Alienation and Control. High Alienation and Control were independently related to increased risk of depressive symptoms. Given the brevity of the RRP(10), it can easily be used in epidemiological/clinical research on the link between the remembered relationship with parents and mental/physical health.
International Nuclear Information System (INIS)
Lito, P. F.; Aniceto, J. P. S.; Silva, C. M.
2015-01-01
Cadmium(II) is a toxic hazardous cation, whose presence in the environment causes great concern because of its bioaccumulation in organisms and bio amplification along food chain. Hence, the removal of cadmium compounds from industrial waters and wastewaters is particularly essential, which requires intensive experimental and modelling studies to deal with the problem. In this work, the ion exchange of Cd"2"+ ions from aqueous solution using microporous titanosilicates (ETS-4 and ETS-10) has been modelled using adapted Maxwell-Stefan equations for the ions transport inside the sorbent particles. The fundamentals of the Maxwell-Stefan equations along with correlations for the convective mass transfer coefficients have been used with advantage to reduce the number of model parameters. In the whole, the model was able to represent successfully the kinetic behaviour of 11 independent and very distinct curves of both studied systems (Cd2"+"/Na"+/ETS-4 and Cd"2"+/Na"+/ ETS-10). The predictive capability of the model has been also shown, since several uptake curves were accurately predicted with parameters fitted previously to different sets of experimental data.
Directory of Open Access Journals (Sweden)
Carmela Giampà
2010-10-01
Full Text Available Huntington's disease is a devastating neurodegenerative condition for which there is no therapy to slow disease progression. The particular vulnerability of striatal medium spiny neurons to Huntington's pathology is hypothesized to result from transcriptional dysregulation within the cAMP and CREB signaling cascades in these neurons. To test this hypothesis, and a potential therapeutic approach, we investigated whether inhibition of the striatal-specific cyclic nucleotide phosphodiesterase PDE10A would alleviate neurological deficits and brain pathology in a highly utilized model system, the R6/2 mouse.R6/2 mice were treated with the highly selective PDE10A inhibitor TP-10 from 4 weeks of age until euthanasia. TP-10 treatment significantly reduced and delayed the development of the hind paw clasping response during tail suspension, deficits in rotarod performance, and decrease in locomotor activity in an open field. Treatment prolonged time to loss of righting reflex. These effects of PDE10A inhibition on neurological function were reflected in a significant amelioration in brain pathology, including reduction in striatal and cortical cell loss, the formation of striatal neuronal intranuclear inclusions, and the degree of microglial activation that occurs in response to the mutant huntingtin-induced brain damage. Striatal and cortical levels of phosphorylated CREB and BDNF were significantly elevated.Our findings provide experimental support for targeting the cAMP and CREB signaling pathways and more broadly transcriptional dysregulation as a therapeutic approach to Huntington's disease. It is noteworthy that PDE10A inhibition in the R6/2 mice reduces striatal pathology, consistent with the localization of the enzyme in medium spiny neurons, and also cortical pathology and the formation of neuronal nuclear inclusions. These latter findings suggest that striatal pathology may be a primary driver of these secondary pathological events. More
Directory of Open Access Journals (Sweden)
Soraya Meghari
2008-02-01
Full Text Available Interleukin (IL-10 increases host susceptibility to microorganisms and is involved in intracellular persistence of bacterial pathogens. IL-10 is associated with chronic Q fever, an infectious disease due to the intracellular bacterium Coxiella burnetii. Nevertheless, accurate animal models of chronic C. burnetii infection are lacking. Transgenic mice constitutively expressing IL-10 in macrophages were infected with C. burnetti by intraperitoneal and intratracheal routes and infection was analyzed through real-time PCR and antibody production. Transgenic mice exhibited sustained tissue infection and strong antibody response in contrast to wild-type mice; thus, bacterial persistence was IL-10-dependent as in chronic Q fever. The number of granulomas was low in spleen and liver of transgenic mice infected through the intraperitoneal route, as in patients with chronic Q fever. Macrophages from transgenic mice were unable to kill C. burnetii. C. burnetii-stimulated macrophages were characterized by non-microbicidal transcriptional program consisting of increased expression of arginase-1, mannose receptor, and Ym1/2, in contrast to wild-type macrophages in which expression of inducible NO synthase and inflammatory cytokines was increased. In vivo results emphasized macrophage data. In spleen and liver of transgenic mice infected with C. burnetii by the intraperitoneal route, the expression of arginase-1 was increased while microbicidal pathway consisting of IL-12p40, IL-23p19, and inducible NO synthase was depressed. The overexpression of IL-10 in macrophages prevents anti-infectious competence of host, including the ability to mount granulomatous response and microbicidal pathway in tissues. To our knowledge, this is the first efficient model for chronic Q fever pathogenesis.
Turbulence modeling of natural convection in enclosures: A review
International Nuclear Information System (INIS)
Choi, Seok Ki; Kim, Seong O
2012-01-01
In this paper a review of recent developments of turbulence models for natural convection in enclosures is presented. The emphasis is placed on the effect of the treatments of Reynolds stress and turbulent heat flux on the stability and accuracy of the solution for natural convection in enclosures. The turbulence models considered in the preset study are the two-layer k -ε model, the shear stress transport (SST) model, the elliptic-relaxation (V2-f) model and the elliptic-blending second-moment closure (EBM). Three different treatments of the turbulent heat flux are the generalized gradient diffusion hypothesis (GGDH), the algebraic flux model (AFM) and the differential flux model (DFM). The mathematical formulation of the above turbulence models and their solution method are presented. Evaluation of turbulence models are performed for turbulent natural convection in a 1:5 rectangular cavity ( Ra = 4.3x10 10 ) and in a square cavity with conducting top and bottom walls ( Ra =1.58x10 9 ) and the Rayleigh-Benard convection ( Ra = 2x10 6 ∼ Ra =10 9 ). The relative performances of turbulence models are examined and their successes and shortcomings are addressed
Experiments to populate and validate a processing model for polyurethane foam. BKC 44306 PMDI-10
Energy Technology Data Exchange (ETDEWEB)
Mondy, Lisa Ann [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Rao, Rekha Ranjana [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Shelden, Bion [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Soehnel, Melissa Marie [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); O' Hern, Timothy J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Grillet, Anne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Celina, Mathias C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Wyatt, Nicholas B. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Russick, Edward Mark [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Bauer, Stephen J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hileman, Michael Bryan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Urquhart, Alexander [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Thompson, Kyle Richard [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Smith, David Michael [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2014-03-01
We are developing computational models to elucidate the expansion and dynamic filling process of a polyurethane foam, PMDI. The polyurethane of interest is chemically blown, where carbon dioxide is produced via the reaction of water, the blowing agent, and isocyanate. The isocyanate also reacts with polyol in a competing reaction, which produces the polymer. Here we detail the experiments needed to populate a processing model and provide parameters for the model based on these experiments. The model entails solving the conservation equations, including the equations of motion, an energy balance, and two rate equations for the polymerization and foaming reactions, following a simplified mathematical formalism that decouples these two reactions. Parameters for the polymerization kinetics model are reported based on infrared spectrophotometry. Parameters describing the gas generating reaction are reported based on measurements of volume, temperature and pressure evolution with time. A foam rheology model is proposed and parameters determined through steady-shear and oscillatory tests. Heat of reaction and heat capacity are determined through differential scanning calorimetry. Thermal conductivity of the foam as a function of density is measured using a transient method based on the theory of the transient plane source technique. Finally, density variations of the resulting solid foam in several simple geometries are directly measured by sectioning and sampling mass, as well as through x-ray computed tomography. These density measurements will be useful for model validation once the complete model is implemented in an engineering code.
Energy Technology Data Exchange (ETDEWEB)
Klingeberg, M [Goettingen Univ. (Germany, F.R.). Inst. fuer Mikrobiologie; Vorlop, K D [Technische Univ. Braunschweig (Germany, F.R.). Inst. fuer Technische Chemie; Antranikian, G [Technische Univ. Hamburg-Harburg, Hamburg (Germany, F. R.). Arbeitsbereich Biotechnologie 1
1990-08-01
For the production of cell-free thermostable {alpha}-amylases and pullulanases various anaerobic thermophilic bacteria that belong to the genera Clostridium and Thermoanaerobacter were immobilized in calcium alginate gel beads. The entrapment of bacteria was performed in full was well as in hollow spheres. An optimal limited medium, which avoided bacterial outgrowth, was developed for the cultivation of immobilized organisms at 60deg C using 0.4% starch as substrate. Compared to non-immobilized cells these techniques allowed a significant increase (up to 5.6-fold) in the specific activities of the extracellular enzymes formed. An increase in the productivity of extracellular enzymes was observed after immobilization of bacteria in full spheres. In the case of C. thermosaccharolyticum, for instance, the productivity was raised from 90 units (U)/10{sup 12} cells up to 700 U/10{sup 12} cells. Electrophoretic analysis of the secreted proteins showed that in all cases most of the amylolytic enzymes formed were released into the culture medium. Proteins that had a molecular mass of less than 450 000 daltons could easily diffuse through the gel matrix. Cultivation of immobilized bacteria in semi-continuous and fed-batch cultures was also accompanied by an elevation in the concentration of cell-free enzymes. (orig.).
International Nuclear Information System (INIS)
Rosales, J.; Perez, J.; Garcia, C.; Munnoz, A.; Lira, C. A. B. O.
2015-01-01
TRISO particles are the specific features of HTR-10 and generally HTGR reactors. Their heterogeneity and random arrangement in graphite matrix of these reactors create a significant modeling challenge. In the simulation of spherical fuel elements using MCNPX are usually created repetitive structures using uniform distribution models. The use of these repetitive structures introduces two major approaches: the non-randomness of the TRISO particles inside the pebbles and the intersection of the pebble surface with the TRISO particles. These approaches could affect significantly the multiplicative properties of the core. In order to study the influence of these approaches in the multiplicative properties was estimated the K inf value in one pebble with white boundary conditions using 4 different configurations regarding the distribution of the TRISO particles inside the pebble: uniform hexagonal model, cubic uniform model, cubic uniform without the effect of cutting and a random distribution model. It was studied the impact these models on core scale solving the problem B1, from the Benchmark Problems presented in a Coordinated Research Program of the IAEA. (Author)
Matthaios, Vasileios N; Triantafyllou, Athanasios G; Koutrakis, Petros
2017-01-01
Periods of abnormally high concentrations of atmospheric pollutants, defined as air pollution episodes, can cause adverse health effects. Southern European countries experience high particulate matter (PM) levels originating from local and distant sources. In this study, we investigated the occurrence and nature of extreme PM 10 (PM with an aerodynamic diameter ≤10 μm) pollution episodes in Greece. We examined PM 10 concentration data from 18 monitoring stations located at five sites across the country: (1) an industrial area in northwestern Greece (Western Macedonia Lignite Area, WMLA), which includes sources such as lignite mining operations and lignite power plants that generate a high percentage of the energy in Greece; (2) the greater Athens area, the most populated area of the country; and (3) Thessaloniki, (4) Patra, and (5) Volos, three large cities in Greece. We defined extreme PM 10 pollution episodes (EEs) as days during which PM 10 concentrations at all five sites exceeded the European Union (EU) 24-hr PM 10 standards. For each EE, we identified the corresponding prevailing synoptic and local meteorological conditions, including wind surface data, for the period from January 2009 through December 2011. We also analyzed data from remote sensing and model simulations. We recorded 14 EEs that occurred over 49 days and could be grouped into two categories: (1) Local Source Impact (LSI; 26 days, 53%) and (2) African Dust Impact (ADI; 23 days, 47%). Our analysis suggested that the contribution of local sources to ADI EEs was relatively small. LSI EEs were observed only in the cold season, whereas ADI EEs occurred throughout the year, with a higher frequency during the cold season. The EEs with the highest intensity were recorded during African dust intrusions. ADI episodes were found to contribute more than local sources in Greece, with ADI and LSI fraction contribution ranging from 1.1 to 3.10. The EE contribution during ADI fluctuated from 41 to 83
Hoch, J.M.; Neal, Jeffrey; Baart, Fedor; van Beek, L.P.H.; Winsemius, Hessel; Bates, Paul; Bierkens, M.F.P.
2017-01-01
We here present GLOFRIM, a globally applicable computational framework for integrated hydrological–hydrodynamic modelling. GLOFRIM facilitates spatially explicit coupling of hydrodynamic and hydrologic models and caters for an ensemble of models to be coupled. It currently encompasses the global
Ishiuchi, Yuri; Sato, Hitoshi; Tsujimura, Kazuki; Kawaguchi, Hideo; Matsuwaki, Takashi; Yamanouchi, Keitaro; Nishihara, Masugi; Nedachi, Taku
2018-01-01
Accumulating evidence indicates that skeletal muscle secrets proteins referred to as myokines and that exercise contributes to their regulation. In this study, we propose that chemokine (C-X-C motif) ligand 10 (CXCL10) functions as a novel myokine. Initially, we stimulated differentiated C2C12 myotubes with or without electrical pulse stimulation (EPS) to identify novel myokines. Cytokine array analysis revealed that CXCL10 secretion was significantly reduced by EPS, which was further confirmed by enzyme-linked immunosorbent assay and quantitative polymerase chain reaction analysis. Treadmill experiments in mice identified significant reduction of Cxcl10 gene expression in the soleus muscle. Additionally, contraction-dependent p38 MAPK activation appeared to be involved in this reduction. Furthermore, C2C12 conditioned medium obtained after applying EPS could induce survival of MSS31, a vascular endothelial cell model, which was partially attenuated by the addition of recombinant CXCL10. Overall, our findings suggest CXCL10 as a novel exercise-reducible myokine, to control endothelial cell viability.
HAT-P-10b: A LIGHT AND MODERATELY HOT JUPITER TRANSITING A K DWARF
International Nuclear Information System (INIS)
Bakos, G. A.; Pal, A.; Torres, G.; Sipocz, B.; Latham, D. W.; Noyes, R. W.; Hartman, J.; Esquerdo, G. A.; Sasselov, D. D.; Kovacs, Gabor; Stefanik, R. P.; Kovacs, Geza; Fischer, D. A.; Johnson, J. A.; Marcy, G. W.; Howard, A. W.; Butler, R. P.; Lazar, J.; Papp, I.; Sari, P.
2009-01-01
We report on the discovery of HAT-P-10b, one of the lowest mass (0.487 ± 0.018 M J ) transiting extrasolar planets (TEPs) discovered to date by transit searches. HAT-P-10b orbits the moderately bright V = 11.89 K dwarf GSC 02340-01714, with a period P = 3.7224747 ± 0.0000065 days, transit epoch T c = 2454759.68683 ± 0.00016 (BJD), and duration 0.1090 ± 0.0008 days. HAT-P-10b has a radius of 1.005 +0.032 -0.027 R J yielding a mean density of 0.594 ± 0.052 g cm -3 . Comparing these observations with recent theoretical models we find that HAT-P-10b is consistent with a ∼4.5 Gyr, almost pure hydrogen and helium gas giant planet with a 10 M + core. With an equilibrium temperature of T eq = 1020 ± 17 K, HAT-P-10b is one of the coldest TEPs. Curiously, its Safronov number θ = 0.053 ± 0.002 falls close to the dividing line between the two suggested TEP populations.
International Nuclear Information System (INIS)
Gulam, M; Gardner, S; Zhao, B; Snyder, K; Song, K; Li, H; Gordon, J; Wen, N; Chetty, I; Kearns, W
2014-01-01
Purpose: To measure attenuation for modelling of the KVue Couchtop for 6X and 10X FFF SRS/SBRT treatment Methods: Treatment planning simulation studies were done using 6X FFF beams to estimate the dosimetric impact of KVue couchtops (including the Q-Fix IGRT [carbon fiber] and Calypso [nonconductive Kevlar material]) with a structure model obtained from a research workstation (Eclipse, advanced planning interface (API) v13). Prior to installation on the Varian Edge linac, the couchtop along with (Kevlar) rails were CT scanned with the rails at various positions. An additional scan with the couchtop 15cm above the CT table top was obtained with 20cm solid water to facilitate precised/indexed data acquisition. Measurements for attenuation were obtained for field sizes of 2, 4 and 10 cm 2 at 42 gantry angles including 6 pairs of opposing fields and other angles for oblique delivery where the beams traversed the couchtop and or rails. The delivery was fully automated with xml scripts running in developer mode. The results were then used to determine an accurate structure model for AAA (Eclipse v11) planning of IMRT and RapidArc delivery. Results: The planning simulation relative dose attenuation for oblique entry was not significantly different than the Exact IGRT or BrainLab iBeam couch except that the rails added 6% additional attenuation. The relative attenuation measurements for PA, PA (rails: inner position), oblique, oblique (rails: outer position), oblique (rails: inner position) were: −2.0%, −2.5%, −15.6%, −2.5%, −5.0% for 6X FFF and −1.4%, −1.5%, −12.2%, − 2.5%, −5.0% for 10X FFF with slight decrease in attenuation versus field size. A Couch structure model (with HU values) was developed. Calculation compared to measurement showed good agreement except for oblique (rails: outer position) where differences approached a magnitude of 6%. Conclusion: A model of the couch structures has been developed accounting for attenuation for FFF beams
Meteoric 10Be in soil profiles - A global meta-analysis
Graly, Joseph A.; Bierman, Paul R.; Reusser, Lucas J.; Pavich, Milan J.
2010-01-01
In order to assess current understanding of meteoric 10Be dynamics and distribution in terrestrial soils, we assembled a database of all published meteoric 10Be soil depth profiles, including 104 profiles from 27 studies in globally diverse locations, collectively containing 679 individual measurements. This allows for the systematic comparison of meteoric 10Be concentration to other soil characteristics and the comparison of profile depth distributions between geologic settings. Percent clay, 9Be, and dithionite-citrate extracted Al positively correlate to meteoric 10Be in more than half of the soils where they were measured, but the lack of significant correlation in other soils suggests that no one soil factor controls meteoric 10Be distribution with depth. Dithionite-citrate extracted Fe and cation exchange capacity are only weakly correlated to meteoric 10Be. Percent organic carbon and pH are not significantly related to meteoric 10Be concentration when all data are complied.The compilation shows that meteoric 10Be concentration is seldom uniform with depth in a soil profile. In young or rapidly eroding soils, maximum meteoric 10Be concentrations are typically found in the uppermost 20 cm. In older, more slowly eroding soils, the highest meteoric 10Be concentrations are found at depth, usually between 50 and 200 cm. We find that the highest measured meteoric 10Be concentration in a soil profile is an important metric, as both the value and the depth of the maximum meteoric 10Be concentration correlate with the total measured meteoric 10Be inventory of the soil profile.In order to refine the use of meteoric 10Be as an estimator of soil erosion rate, we compare near-surface meteoric 10Be concentrations to total meteoric 10Be soil inventories. These trends are used to calibrate models of meteoric 10Be loss by soil erosion. Erosion rates calculated using this method vary based on the assumed depth and timing of erosional events and on the reference data selected.
Energy Technology Data Exchange (ETDEWEB)
Ye Fei [Department of Cardiology, Nanjing First Hospital Affiliated to Nanjing Medical University, 68 Changle Road, Nanjing 210006 (China); Fang Wei [Cardiovascular Institute and Fuwai Hospital, No. 167 Bei-Li-Shi-Lu, Beijing 100037 (China); Wang Feng, E-mail: fengwang1972cn@gmail.co [Department of Nuclear Medicine, Nanjing First Hospital Affiliated to Nanjing Medical University, 68 Changle Road, Nanjing 210006 (China); State Key Laboratory of Pharmaceutical Biotechnology, Department of Biochemistry, College of Life Sciences, Nanjing University, 22 Hankou Road, Nanjing 210093 (China); Hua Zichun [State Key Laboratory of Pharmaceutical Biotechnology, Department of Biochemistry, College of Life Sciences, Nanjing University, 22 Hankou Road, Nanjing 210093 (China); Wang Zizheng [Department of Nuclear Medicine, Nanjing First Hospital Affiliated to Nanjing Medical University, 68 Changle Road, Nanjing 210006 (China); Yang Xiang [State Key Laboratory of Pharmaceutical Biotechnology, Department of Biochemistry, College of Life Sciences, Nanjing University, 22 Hankou Road, Nanjing 210093 (China)
2011-05-15
Purpose: The goal of this study was to evaluate the feasibility of {sup 99m}Tc-His{sub 10}-annexin V for the detection of acute myocardial cell death and to assess the effect of adenosine preconditioning in a porcine model of myocardium ischemia and reperfusion injury (RI). Materials and Methods: {sup 99m}Tc-His{sub 10}-annexin V was prepared by one-step direct labeling, and RCP and radiostability were tested. The binding of {sup 99m}Tc-His{sub 10}-annexin V to apoptosis was validated in vitro using camptothecin-induced Jurkat cells. In vivo biodistribution was determined in mice by the dissection method. Ischemia of 20-30 min was induced by balloon occlusion of the epicardial coronary artery of the porcine model (n=14). Adenosine was infused intravenously in six pigs before coronary occlusion. {sup 99m}Tc-His{sub 10}-annexin V (n=12) was injected intravenously at 1 h after reperfusion. SPECT/CT was acquired at 3 h postinjection. Myocardial perfusion imaging (MPI) with {sup 99m}Tc-MIBI was also performed 1 day after His{sub 10}-annexin V imaging. Cardiac tissues were analyzed postmortem using hematoxylin-and-eosin and TUNEL staining. Caspase-3 activity was measured to confirm the presence of apoptosis. Results: {sup 99m}Tc-His{sub 10}-annexin V had a RCP >98% and high stability 2 h after radiolabeling; it could bind to apoptotic cells with high affinity. Biodistribution of {sup 99m}Tc-His{sub 10}-annexin V showed a predominant uptake in the kidney and relatively low uptake in the myocardium, liver and gastrointestinal tract; rapid clearance from blood and kidney was observed. In the untreated group, intense uptake of His{sub 10}-annexin V was visualized in the defect which was shown in MPI, whereas in the adenosine group a mild uptake of {sup 99m}Tc-His{sub 10}-annexin was found in the risk area which showed no defects in the {sup 99m}Tc-MIBI image. TUNEL staining and activated caspase-3 confirmed the ongoing apoptosis in RI. Adenosine preconditioning significantly
Kerkweg, Astrid; Hofmann, Christiane; Jöckel, Patrick; Mertens, Mariano; Pante, Gregor
2018-03-01
As part of the Modular Earth Submodel System (MESSy), the Multi-Model-Driver (MMD v1.0) was developed to couple online the regional Consortium for Small-scale Modeling (COSMO) model into a driving model, which can be either the regional COSMO model or the global European Centre Hamburg general circulation model (ECHAM) (see Part 2 of the model documentation). The coupled system is called MECO(n), i.e., MESSy-fied ECHAM and COSMO models nested n times. In this article, which is part of the model documentation of the MECO(n) system, the second generation of MMD is introduced. MMD comprises the message-passing infrastructure required for the parallel execution (multiple programme multiple data, MPMD) of different models and the communication of the individual model instances, i.e. between the driving and the driven models. Initially, the MMD library was developed for a one-way coupling between the global chemistry-climate ECHAM/MESSy atmospheric chemistry (EMAC) model and an arbitrary number of (optionally cascaded) instances of the regional chemistry-climate model COSMO/MESSy. Thus, MMD (v1.0) provided only functions for unidirectional data transfer, i.e. from the larger-scale to the smaller-scale models.Soon, extended applications requiring data transfer from the small-scale model back to the larger-scale model became of interest. For instance, the original fields of the larger-scale model can directly be compared to the upscaled small-scale fields to analyse the improvements gained through the small-scale calculations, after the results are upscaled. Moreover, the fields originating from the two different models might be fed into the same diagnostic tool, e.g. the online calculation of the radiative forcing calculated consistently with the same radiation scheme. Last but not least, enabling the two-way data transfer between two models is the first important step on the way to a fully dynamical and chemical two-way coupling of the various model instances.In MMD (v1.0
2010-07-01
... model year Otto-cycle heavy-duty engines and vehicles. 86.099-10 Section 86.099-10 Protection of... to Otto-cycle engines used in such MDPVs, except as specified in subpart S of this part. The term... AND IN-USE HIGHWAY VEHICLES AND ENGINES General Provisions for Emission Regulations for 1977 and Later...
Directory of Open Access Journals (Sweden)
Luis Camilo Blanco-Becerra
2014-07-01
Full Text Available Objective. To analyze the association between daily mortality from different causes and acute exposure to particulate matter less than 10 microns in aerodynamic diameter (PM10, in Bogota, Colombia. Materials and methods. A time-series ecological study was conducted from 1998 to 2006. The association between mortality (due to different causes and exposure was analyzed using single and distributed lag models and adjusting for potential confounders. Results. For all ages, the cumulative effect of acute mortality from all causes and respiratory causes increased 0.71% (95%CI 0.46-0.96 and 1.43% (95%CI 0.85-2.00, respectively, per 10μg/m3 increment in daily average PM10 with a lag of three days before death. Cumulative effect of mortality from cardiovascular causes was -0.03% (95%CI -0.49-0.44% with the same lag. Conclusions. The results suggest an association between an increase in PM10 concentrations and acute mortality from all causes and respiratory causes.
Y. Kim; Y. Wu; C. Seigneur; Y. Roustan
2018-01-01
A new multi-scale model of urban air pollution is presented. This model combines a chemistry–transport model (CTM) that includes a comprehensive treatment of atmospheric chemistry and transport on spatial scales down to 1 km and a street-network model that describes the atmospheric concentrations of pollutants in an urban street network. The street-network model is the Model of Urban Network of Intersecting Canyons and Highways (MUNICH), which consists of two main components...
Boots, C.E.; Boudoures, A.; Zhang, W.; Drury, A.; Moley, K.H.
2016-01-01
STUDY QUESTION Does supplementation with co-enzyme Q10 (CoQ10) improve the oocyte mitochondrial abnormalities associated with obesity in mice? SUMMARY ANSWER In an obese mouse model, CoQ10 improves the mitochondrial function of oocytes. WHAT IS KNOWN ALREADY Obesity impairs oocyte quality. Oocytes from mice fed a high-fat/high-sugar (HF/HS) diet have abnormalities in mitochondrial distribution and function and in meiotic progression. STUDY DESIGN, SIZE, DURATION Mice were randomly assigned to a normal, chow diet or an isocaloric HF/HS diet for 12 weeks. After 6 weeks on the diet, half of the mice receiving a normal diet and half of the mice receiving a HF/HS diet were randomly assigned to receive CoQ10 supplementation injections for the remaining 6 weeks. PARTICIPANTS/MATERIALS, SETTING, METHODS Dietary intervention was initiated on C57Bl6 female mice at 4 weeks of age, CoQ10 versus vehicle injections were assigned at 10 weeks, and assays were conducted at 16 weeks of age. Mice were super-ovulated, and oocytes were collected and stained to assess mitochondrial distribution, quantify reactive oxygen species (ROS), assess meiotic spindle formation, and measure metabolites. In vitro fertilization was performed, and blastocyst embryos were transferred into control mice. Oocyte number, fertilization rate, blastulation rate and implantation rate were compared between the four cohorts. Bivariate statistics were performed appropriately. MAIN RESULTS AND THE ROLE OF CHANCE HF/HS mice weighed significantly more than normal diet mice (29 versus 22 g, P< 0.001). CoQ10 supplementation did not influence weight. Levels of ATP, citrate, and phosphocreatine were lower and ROS levels were higher in HF/HS mice than in controls (P< 0.001). CoQ10 supplementation significantly increased the levels of metabolites and decreased ROS levels in oocytes from normal diet mice but not in oocytes from HF/HS mice. However, CoQ10 completely prevented the mitochondrial distribution abnormalities
Chirico, Peter G.; Tanner, Seth D.
2004-01-01
Explanation The purpose of developing a new 10m resolution DEM of the Shenandoah National Park Region was to more accurately depict geologic structure, surfical geology, and landforms of the Shenandoah National Park Region in preparation for automated landform classification. Previously, only a 30m resolution DEM was available through the National Elevation Dataset (NED). During production of the Shenandoah10m DEM of the Park the Geography Discipline of the USGS completed a revised 10m DEM to be included into the NED. However, different methodologies were used to produce the two similar DEMs. The ANUDEM algorithm was used to develop the Shenadoah DEM data. This algorithm allows for the inclusion of contours, streams, rivers, lake and water body polygons as well as spot height data to control the elevation model. A statistical analysis using over 800 National Geodetic Survey (NGS) first and second order vertical control points reveals that the Shenandoah10m DEM, produced as a part of the Appalachian Blue Ridge Landscape project, has a vertical accuracy of ?4.87 meters. The metadata for the 10m NED data reports a vertical accuracy of ?7m. A table listing the NGS control points, the elevation comparison, and the RMSE for the Shenandoah10m DEM is provided. The process of automated terrain classification involves developing statistical signatures from the DEM for each type of surficial deposit and landform type. The signature will be a measure of several characteristics derived from the elevation data including slope, aspect, planform curvature, and profile curvature. The quality of the DEM is of critical importance when extracting terrain signatures. The highest possible horizontal and vertical accuracy is required. The more accurate Shenandoah 10m DEM can now be analyzed and integrated with the geologic observations to yield statistical correlations between the two in the development of landform and surface geology mapping projects.
Souty, F.; Brunelle, T.; Dumas, P.; Dorin, B.; Ciais, P.; Crassous, R.; Müller, C.; Bondeau, A.
2012-10-01
Interactions between food demand, biomass energy and forest preservation are driving both food prices and land-use changes, regionally and globally. This study presents a new model called Nexus Land-Use version 1.0 which describes these interactions through a generic representation of agricultural intensification mechanisms within agricultural lands. The Nexus Land-Use model equations combine biophysics and economics into a single coherent framework to calculate crop yields, food prices, and resulting pasture and cropland areas within 12 regions inter-connected with each other by international trade. The representation of cropland and livestock production systems in each region relies on three components: (i) a biomass production function derived from the crop yield response function to inputs such as industrial fertilisers; (ii) a detailed representation of the livestock production system subdivided into an intensive and an extensive component, and (iii) a spatially explicit distribution of potential (maximal) crop yields prescribed from the Lund-Postdam-Jena global vegetation model for managed Land (LPJmL). The economic principles governing decisions about land-use and intensification are adapted from the Ricardian rent theory, assuming cost minimisation for farmers. In contrast to the other land-use models linking economy and biophysics, crops are aggregated as a representative product in calories and intensification for the representative crop is a non-linear function of chemical inputs. The model equations and parameter values are first described in details. Then, idealised scenarios exploring the impact of forest preservation policies or rising energy price on agricultural intensification are described, and their impacts on pasture and cropland areas are investigated.
Directory of Open Access Journals (Sweden)
F. Souty
2012-10-01
Full Text Available Interactions between food demand, biomass energy and forest preservation are driving both food prices and land-use changes, regionally and globally. This study presents a new model called Nexus Land-Use version 1.0 which describes these interactions through a generic representation of agricultural intensification mechanisms within agricultural lands. The Nexus Land-Use model equations combine biophysics and economics into a single coherent framework to calculate crop yields, food prices, and resulting pasture and cropland areas within 12 regions inter-connected with each other by international trade. The representation of cropland and livestock production systems in each region relies on three components: (i a biomass production function derived from the crop yield response function to inputs such as industrial fertilisers; (ii a detailed representation of the livestock production system subdivided into an intensive and an extensive component, and (iii a spatially explicit distribution of potential (maximal crop yields prescribed from the Lund-Postdam-Jena global vegetation model for managed Land (LPJmL. The economic principles governing decisions about land-use and intensification are adapted from the Ricardian rent theory, assuming cost minimisation for farmers. In contrast to the other land-use models linking economy and biophysics, crops are aggregated as a representative product in calories and intensification for the representative crop is a non-linear function of chemical inputs. The model equations and parameter values are first described in details. Then, idealised scenarios exploring the impact of forest preservation policies or rising energy price on agricultural intensification are described, and their impacts on pasture and cropland areas are investigated.
International Nuclear Information System (INIS)
Nakayama, Yu
2008-01-01
We show a calculable example of stable supersymmetry (SUSY) breaking models with O(10) eV gravitino mass based on the combination of D-term gauge mediation and U(1)' mediation. A potential problem of the negative mass squared for the SUSY standard model (SSM) sfermions in the D-term gauge mediation is solved by the contribution from the U(1)' mediation. On the other hand, the splitting between the SSM gauginos and sfermions in the U(1)' mediation is circumvented by the contributions from the D-term gauge mediation. Since the U(1)' mediation does not introduce any new SUSY vacua, we achieve a completely stable model under thermal effects. Our model, therefore, has no cosmological difficulty
Craig, Benjamin M; Brisson, Marc; Chesson, Harrell; Giuliano, Anna R; Jit, Mark
2010-08-01
Prominent published and active human papillomavirus (HPV) modelers from around the world were invited to participate in the inaugural Modeling Evidence in HPV (MEHPV) Pre-Conference Workshop on May 9-10, 2009, in Malmö, Sweden. The workshop took place directly before the 25th International Papillomavirus Conference. The aim of the workshop was to develop an international network of investigators engaged in HPV modeling and to facilitate open discussion about the structure and parameterization of models, as well as other methodologic concerns. Thirty-four participants from more than a dozen countries and a variety of settings, representing the authors or coauthors of 82% of the HPV modeling literature, exchanged ideas on fundamental questions in the field. These proceedings, based on the 217-page transcript, were assembled by the Scientific Committee to summarize the ideas of workshop participants in a deidentified, readable fashion. They represent the work and recorded opinions of session participants and do not constitute the official positions of participants as a whole or individually, the Scientific Committee, or any sponsoring organization or entity. In charting a path forward, 3 topics emerged as most pressing: best practices for HPV modeling, comparative modeling, and modeling in developing countries. This summary of the proceedings of the preconference workshop on HPV modeling characterizes many of the prominent contemporary issues in the field. 2010 Excerpta Medica Inc. All rights reserved.
DEFF Research Database (Denmark)
Collalti, A.; Marconi, S.; Ibrom, Andreas
2016-01-01
This study evaluates the performances of the new version (v.5.1) of 3D-CMCC Forest Ecosystem Model (FEM) in simulating gross primary productivity (GPP), against eddy covariance GPP data for 10 FLUXNET forest sites across Europe. A new carbon allocation module, coupled with new both phenological...... over Europe without a site-related calibration, the model has been deliberately parametrized with a single set of species-specific parametrizations for each forest ecosystem. The model consistently reproduces both in timing and in magnitude daily and monthly GPP variability across all sites...... sites we evaluate whether a more accurate representation of forest structural characteristics (i.e. cohorts, forest layers) and species composition can improve model results. In two of the three sites results reveal that model slightly increases its performances although, statistically speaking...
Luo, Hongyuan; Wang, Deyun; Yue, Chenqiang; Liu, Yanling; Guo, Haixiang
2018-03-01
In this paper, a hybrid decomposition-ensemble learning paradigm combining error correction is proposed for improving the forecast accuracy of daily PM10 concentration. The proposed learning paradigm is consisted of the following two sub-models: (1) PM10 concentration forecasting model; (2) error correction model. In the proposed model, fast ensemble empirical mode decomposition (FEEMD) and variational mode decomposition (VMD) are applied to disassemble original PM10 concentration series and error sequence, respectively. The extreme learning machine (ELM) model optimized by cuckoo search (CS) algorithm is utilized to forecast the components generated by FEEMD and VMD. In order to prove the effectiveness and accuracy of the proposed model, two real-world PM10 concentration series respectively collected from Beijing and Harbin located in China are adopted to conduct the empirical study. The results show that the proposed model performs remarkably better than all other considered models without error correction, which indicates the superior performance of the proposed model.
Two-loop renormalization group analysis of supersymmetric SO(10) models with an intermediate scale
International Nuclear Information System (INIS)
Bastero-Gil, M.; Brahmachari, B.
1996-03-01
Two-loop evolutions of the gauge couplings in a class of intermediate scale supersymmetric SO(10) models including the effect of third generation Yukawa couplings are studied. The unification scale, the intermediate scale and the value of the unification gauge coupling in these models are calculated and the gauge boson mediated proton decay rates are estimated. In some cases the predicted proton lifetime turns out to be in the border-line of experimental limit. The predictions of the top quark mass, the mass ratio m b (m b )/m τ (m τ ) from the two-loop evolution of Yukawa couplings and the mass of the left handed neutrino via see-saw mechanism are summarized. The lower bounds on the ratio of the VEVs of the two low energy doublets (tan β) from the requirement of the perturbative unitarity of the top quark Yukawa coupling up to the grand unification scale are also presented. All the predictions have been compared with those of the one-step unified theory. (author). 33 refs, 5 figs, 1 tab
DEFF Research Database (Denmark)
Nakai, Hiroyuki; Petersen, B.O.; Westphal, Y.
2010-01-01
. LaMP has about 35 and 26% amino acid sequence identity with GH65 trehalose phosphorylase (TP) and kojibiose phosphorylase (KP) from Thermoanaerobacter brockii ATCC35047. The structure of L. brevis MP and multiple sequence alignment identified (alpha/alpha)(6)-barrel loop 3 that forms the rim...... group of the glucose moiety at subsite +1, by corresponding segments from Ser426-Ala431 in TP and Thr419-Phe427 in KP, thus conferred LaMP with phosphorolytic activity towards trehalose and kojibiose, respectively. Two different loop 3 LaMP variants catalysed the formation of trehalose and kojibiose...
DEFF Research Database (Denmark)
Kongjan, Prawit; O-Thong, Sompong; Angelidaki, Irini
2011-01-01
The two-stage process for extreme thermophilic hydrogen and thermophilic methane production from wheat straw hydrolysate was investigated in up-flow anaerobic sludge bed (UASB) reactors. Specific hydrogen and methane yields of 89ml-H2/g-VS (190ml-H2/g-sugars) and 307ml-CH4/g-VS, respectively were...... energy of 13.4kJ/g-VS. Dominant hydrogen-producing bacteria in the H2-UASB reactor were Thermoanaerobacter wiegelii, Caldanaerobacter subteraneus, and Caloramator fervidus. Meanwhile, the CH4-UASB reactor was dominated with methanogens of Methanosarcina mazei and Methanothermobacter defluvii. The results...
LHC constraints on Yukawa unification in SO(10)
Energy Technology Data Exchange (ETDEWEB)
Badziak, Marcin [Cambridge Univ. (United Kingdom). Centre for Mathematical Sciences; Cambridge Univ. (United Kingdom). Cavendish Lab.; Sakurai, Kazuki [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2011-12-15
LHC constraints on the recently proposed SUSY SO(10) GUT model with top-bottom-tau Yukawa uni cation are investigated. In this model, various phenomenological constraints are in concord with Yukawa uni cation thanks to the negative sign of {mu}, D-term splitting in the soft scalar masses and non-universal gaugino masses generated by non-zero F-term in a 24-dimensional representation of SU(5) is contained in SO(10). After discussing the impact of the CP-odd Higgs boson mass bound on this model, we provide a detailed analysis of the recent direct SUSY searches performed by ATLAS and investigate the constraints on this SO(10) model. At 95% confidence level, the lower limit on the gluino mass is found at 675 GeV. Assuming an integrated luminosity of 10 fb{sup -1}, this bound may be extended to 1.1 TeV if the right-handed down squark is lighter than about 1 TeV. (orig.)
Directory of Open Access Journals (Sweden)
Gokce Mertol
2012-09-01
Full Text Available Abstract Background The goal of our study is to evaluate the effects of antioxidant vitamins (vitamin C and E, Coenzyme Q10 (CoQ10 and dexamethasone (Dxm in experimental rat models with pulmonary contusion (PC. Methods Rats were randomly divided into six groups. Except for the control, all subgroups had a moderate pulmonary contusion. Animals in the group I and group II received intraperitoneal saline, group III received 10mg.kg-1 CoQ10 group IV received 100mg.kg-1 vitamin C, group V received 150mg.kg-1 vitamin E, and group VI received 10mg.kg-1 Dxm. Blood gas analysis, serum nitric oxide (NO and malondialdehyde (MDA levels as well as superoxide dismutase (SOD activity assays, bronchoalveolar lavage (BAL fluid and histopathological examination were performed. Results Administration of CoQ10 resulted in a significant increase in PaO2 values compared with the group I (p = 0.004. Levels of plasma MDA in group II were significantly higher than those in the group I (p = 0.01. Early administration of vitamin C, CoQ10, and Dxm significantly decreased the levels of MDA (p = 0.01. Lung contusion due to blunt trauma significantly decreased SOD activities in rat lung tissue compared with group I (p = 0.01. SOD levels were significantly elevated in animals treated with CoQ10, Vitamin E, or Dxm compared with group II (p = 0.01. Conclusions In our study, CoQ10, vitamin C, vitamin E and Dxm had a protective effect on the biochemical and histopathological outcome of PC after experimental blunt thorax trauma.
The BRIDGE HadCM3 family of climate models: HadCM3@Bristol v1.0
Valdes, Paul J.; Armstrong, Edward; Badger, Marcus P. S.; Bradshaw, Catherine D.; Bragg, Fran; Crucifix, Michel; Davies-Barnard, Taraka; Day, Jonathan J.; Farnsworth, Alex; Gordon, Chris; Hopcroft, Peter O.; Kennedy, Alan T.; Lord, Natalie S.; Lunt, Dan J.; Marzocchi, Alice; Parry, Louise M.; Pope, Vicky; Roberts, William H. G.; Stone, Emma J.; Tourte, Gregory J. L.; Williams, Jonny H. T.
2017-10-01
Understanding natural and anthropogenic climate change processes involves using computational models that represent the main components of the Earth system: the atmosphere, ocean, sea ice, and land surface. These models have become increasingly computationally expensive as resolution is increased and more complex process representations are included. However, to gain robust insight into how climate may respond to a given forcing, and to meaningfully quantify the associated uncertainty, it is often required to use either or both ensemble approaches and very long integrations. For this reason, more computationally efficient models can be very valuable tools. Here we provide a comprehensive overview of the suite of climate models based around the HadCM3 coupled general circulation model. This model was developed at the UK Met Office and has been heavily used during the last 15 years for a range of future (and past) climate change studies, but has now been largely superseded for many scientific studies by more recently developed models. However, it continues to be extensively used by various institutions, including the BRIDGE (Bristol Research Initiative for the Dynamic Global Environment) research group at the University of Bristol, who have made modest adaptations to the base HadCM3 model over time. These adaptations mean that the original documentation is not entirely representative, and several other relatively undocumented configurations are in use. We therefore describe the key features of a number of configurations of the HadCM3 climate model family, which together make up HadCM3@Bristol version 1.0. In order to differentiate variants that have undergone development at BRIDGE, we have introduced the letter B into the model nomenclature. We include descriptions of the atmosphere-only model (HadAM3B), the coupled model with a low-resolution ocean (HadCM3BL), the high-resolution atmosphere-only model (HadAM3BH), and the regional model (HadRM3B). These also include
Latitude SSTmax = 0 SSTmax = 10 SSTmax = 20
Indian Academy of Sciences (India)
. −10. −5. 0. 5. 10. V (m/s). −30. −20. −10. 0. 10. 20. 30. −10. −5. 0. 5. 10. Latitude. V (m/s). V Non−linear model. Non−linear advection term. Pressure gradient term. SSTmax = 0. SSTmax = 10. SSTmax = 20.
de Gennaro, Gianluigi; Trizio, Livia; Di Gilio, Alessia; Pey, Jorge; Pérez, Noemi; Cusack, Michael; Alastuey, Andrés; Querol, Xavier
2013-10-01
An artificial neural network (ANN) was developed and tested to forecast PM10 daily concentration in two contrasted environments in NE Spain, a regional background site (Montseny), and an urban background site (Barcelona-CSIC), which was highly influenced by vehicular emissions. In order to predict 24-h average PM10 concentrations, the artificial neural network previously developed by Caselli et al. (2009) was improved by using hourly PM concentrations and deterministic factors such as a Saharan dust alert. In particular, the model input data for prediction were the hourly PM10 concentrations 1-day in advance, local meteorological data and information about air masses origin. The forecasted performance indexes for both sites were calculated and they showed better results for the regional background site in Montseny (R(2)=0.86, SI=0.75) than for urban site in Barcelona (R(2)=0.73, SI=0.58), influenced by local and sometimes unexpected sources. Moreover, a sensitivity analysis conducted to understand the importance of the different variables included among the input data, showed that local meteorology and air masses origin are key factors in the model forecasts. This result explains the reason for the improvement of ANN's forecasting performance at the Montseny site with respect to the Barcelona site. Moreover, the artificial neural network developed in this work could prove useful to predict PM10 concentrations, especially, at regional background sites such as those on the Mediterranean Basin which are primarily affected by long-range transports. Hence, the artificial neural network presented here could be a powerful tool for obtaining real time information on air quality status and could aid stakeholders in their development of cost-effective control strategies. © 2013 Elsevier B.V. All rights reserved.
Goodarzi, Mohammad; Saeys, Wouter; Deeb, Omar; Pieters, Sigrid; Vander Heyden, Yvan
2013-12-01
Quantitative structure-activity relationship (QSAR) modeling was performed for imidazo[1,5-a]pyrido[3,2-e]pyrazines, which constitute a class of phosphodiesterase 10A inhibitors. Particle swarm optimization (PSO) and genetic algorithm (GA) were used as feature selection techniques to find the most reliable molecular descriptors from a large pool. Modeling of the relationship between the selected descriptors and the pIC50 activity data was achieved by linear [multiple linear regression (MLR)] and non-linear [locally weighted regression (LWR) based on both Euclidean (E) and Mahalanobis (M) distances] methods. In addition, a stepwise MLR model was built using only a limited number of quantum chemical descriptors, selected because of their correlation with the pIC50 . The model was not found interesting. It was concluded that the LWR model, based on the Euclidean distance, applied on the descriptors selected by PSO has the best prediction ability. However, some other models behaved similarly. The root-mean-squared errors of prediction (RMSEP) for the test sets obtained by PSO/MLR, GA/MLR, PSO/LWRE, PSO/LWRM, GA/LWRE, and GA/LWRM models were 0.333, 0.394, 0.313, 0.333, 0.421, and 0.424, respectively. The PSO-selected descriptors resulted in the best prediction models, both linear and non-linear. © 2013 John Wiley & Sons A/S.
Coenzyme Q10 effects in neurodegenerative disease
Directory of Open Access Journals (Sweden)
Meredith Spindler
2009-11-01
Full Text Available Meredith Spindler1, M Flint Beal1,2, Claire Henchcliffe1,21Department of Neurology, 2Department of Neuroscience, Weill Medical College of Cornell University, New York, NY, USAAbstract: Coenzyme Q10 (CoQ10 is an essential cofactor in the mitochondrial respiratory chain, and as a dietary supplement it has recently gained attention for its potential role in the treatment of neurodegenerative disease. Evidence for mitochondrial dysfunction in neurodegenerative disorders derives from animal models, studies of mitochondria from patients, identification of genetic defects in patients with neurodegenerative disease, and measurements of markers of oxidative stress. Studies of in vitro models of neuronal toxicity and animal models of neurodegenerative disorders have demonstrated potential neuroprotective effects of CoQ10. With this data in mind, several clinical trials of CoQ10 have been performed in Parkinson’s disease and atypical Parkinson’s syndromes, Huntington’s disease, Alzheimer disease, Friedreich’s ataxia, and amyotrophic lateral sclerosis, with equivocal findings. CoQ10 is widely available in multiple formulations and is very well tolerated with minimal adverse effects, making it an attractive potential therapy. Phase III trials of high-dose CoQ10 in large sample sizes are needed to further ascertain the effects of CoQ10 in neurodegenerative diseases.Keywords: coenzyme Q10, neurodegenerative disease, Parkinson’s disease, Huntington’s disease, mitochondrial dysfunction
Exploring 0.1–10 eV axions with a new helioscope concept
International Nuclear Information System (INIS)
Galán, J.; Dafni, T.; Iguaz, F.J.
2015-01-01
We explore the possibility to develop a new axion helioscope type, sensitive to the higher axion mass region favored by axion models. We propose to use a low background large volume TPC immersed in an intense magnetic field. Contrary to traditional tracking helioscopes, this detection technique takes advantage of the capability to directly detect the photons converted on the buffer gas which defines the axion mass sensitivity region, and does not require pointing the magnet to the Sun. The operation flexibility of a TPC to be used with different gas mixtures (He, Ne, Xe, etc.) and pressures (from 10 mbar to 10 bar) will allow to enhance sensitivity for axion masses from few meV to several eV. We present different helioscope data taking scenarios, considering detection efficiency and axion absorption probability, and show the sensitivities reachable with this technique to be few × 10 −11 GeV −1 for a 5 T, m 3 scale TPC. We show that a few years program taking data with such setup would allow to probe the KSVZ axion model for axion masses above 0∼> 10 meV
Directory of Open Access Journals (Sweden)
A. Kerkweg
2018-03-01
Full Text Available As part of the Modular Earth Submodel System (MESSy, the Multi-Model-Driver (MMD v1.0 was developed to couple online the regional Consortium for Small-scale Modeling (COSMO model into a driving model, which can be either the regional COSMO model or the global European Centre Hamburg general circulation model (ECHAM (see Part 2 of the model documentation. The coupled system is called MECO(n, i.e., MESSy-fied ECHAM and COSMO models nested n times. In this article, which is part of the model documentation of the MECO(n system, the second generation of MMD is introduced. MMD comprises the message-passing infrastructure required for the parallel execution (multiple programme multiple data, MPMD of different models and the communication of the individual model instances, i.e. between the driving and the driven models. Initially, the MMD library was developed for a one-way coupling between the global chemistry–climate ECHAM/MESSy atmospheric chemistry (EMAC model and an arbitrary number of (optionally cascaded instances of the regional chemistry–climate model COSMO/MESSy. Thus, MMD (v1.0 provided only functions for unidirectional data transfer, i.e. from the larger-scale to the smaller-scale models.Soon, extended applications requiring data transfer from the small-scale model back to the larger-scale model became of interest. For instance, the original fields of the larger-scale model can directly be compared to the upscaled small-scale fields to analyse the improvements gained through the small-scale calculations, after the results are upscaled. Moreover, the fields originating from the two different models might be fed into the same diagnostic tool, e.g. the online calculation of the radiative forcing calculated consistently with the same radiation scheme. Last but not least, enabling the two-way data transfer between two models is the first important step on the way to a fully dynamical and chemical two-way coupling of the various model
Energy Technology Data Exchange (ETDEWEB)
Wendt, Fabian F [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Yu, Yi-Hsiang [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Nielsen, Kim [Ramboll, Copenhagen (Denmark); Ruehl, Kelley [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Bunnik, Tim [MARIN (Netherlands); Touzon, Imanol [Tecnalia (Spain); Nam, Bo Woo [KRISO (Korea, Rep. of); Kim, Jeong Seok [KRISO (Korea, Rep. of); Janson, Carl Erik [Chalmers University (Sweden); Jakobsen, Ken-Robert [EDRMedeso (Norway); Crowley, Sarah [WavEC (Portugal); Vega, Luis [Hawaii Natural Energy Institute (United States); Rajagopalan, Krishnakimar [Hawaii Natural Energy Institute (United States); Mathai, Thomas [Glosten (United States); Greaves, Deborah [Plymouth University (United Kingdom); Ransley, Edward [Plymouth University (United Kingdom); Lamont-Kane, Paul [Queen' s University Belfast (United Kingdom); Sheng, Wanan [University College Cork (Ireland); Costello, Ronan [Wave Venture (United Kingdom); Kennedy, Ben [Wave Venture (United Kingdom); Thomas, Sarah [Floating Power Plant (Denmark); Heras, Pilar [Floating Power Plant (Denmark); Bingham, Harry [Technical University of Denmark (Denmark); Kurniawan, Adi [Aalborg University (Denmark); Kramer, Morten Mejlhede [Aalborg University (Denmark); Ogden, David [INNOSEA (France); Girardin, Samuel [INNOSEA (France); Babarit, Aurelien [EC Nantes (France); Wuillaume, Pierre-Yves [EC Nantes (France); Steinke, Dean [Dynamic Systems Analysis (Canada); Roy, Andre [Dynamic Systems Analysis (Canada); Beatty, Scott [Cascadia Coast Research (Canada); Schofield, Paul [ANSYS (United States); Kim, Kyong-Hwan [KRISO (Korea, Rep. of); Jansson, Johan [KTH Royal Inst. of Technology, Stockholm (Sweden); BCAM (Spain); Hoffman, Johan [KTH Royal Inst. of Technology, Stockholm (Sweden)
2017-10-16
This is the first joint reference paper for the Ocean Energy Systems (OES) Task 10 Wave Energy Converter modeling verification and validation group. The group is established under the OES Energy Technology Network program under the International Energy Agency. OES was founded in 2001 and Task 10 was proposed by Bob Thresher (National Renewable Energy Laboratory) in 2015 and approved by the OES Executive Committee EXCO in 2016. The kickoff workshop took place in September 2016, wherein the initial baseline task was defined. Experience from similar offshore wind validation/verification projects (OC3-OC5 conducted within the International Energy Agency Wind Task 30) [1], [2] showed that a simple test case would help the initial cooperation to present results in a comparable way. A heaving sphere was chosen as the first test case. The team of project participants simulated different numerical experiments, such as heave decay tests and regular and irregular wave cases. The simulation results are presented and discussed in this paper.
A model for global biomass burning in preindustrial time: LPJ-LMfire (v1.0
Directory of Open Access Journals (Sweden)
M. Pfeiffer
2013-05-01
Full Text Available Fire is the primary disturbance factor in many terrestrial ecosystems. Wildfire alters vegetation structure and composition, affects carbon storage and biogeochemical cycling, and results in the release of climatically relevant trace gases including CO2, CO, CH4, NOx, and aerosols. One way of assessing the impacts of global wildfire on centennial to multi-millennial timescales is to use process-based fire models linked to dynamic global vegetation models (DGVMs. Here we present an update to the LPJ-DGVM and a new fire module based on SPITFIRE that includes several improvements to the way in which fire occurrence, behaviour, and the effects of fire on vegetation are simulated. The new LPJ-LMfire model includes explicit calculation of natural ignitions, the representation of multi-day burning and coalescence of fires, and the calculation of rates of spread in different vegetation types. We describe a new representation of anthropogenic biomass burning under preindustrial conditions that distinguishes the different relationships between humans and fire among hunter-gatherers, pastoralists, and farmers. We evaluate our model simulations against remote-sensing-based estimates of burned area at regional and global scale. While wildfire in much of the modern world is largely influenced by anthropogenic suppression and ignitions, in those parts of the world where natural fire is still the dominant process (e.g. in remote areas of the boreal forest and subarctic, our results demonstrate a significant improvement in simulated burned area over the original SPITFIRE. The new fire model we present here is particularly suited for the investigation of climate–human–fire relationships on multi-millennial timescales prior to the Industrial Revolution.
Pembuatan Digital Elevation Model Resolusi 10m dari Peta RBI dan Survei GPS dengan Algoritma Anudem
Directory of Open Access Journals (Sweden)
Indarto
2014-04-01
Full Text Available This study proposes the generation of Digital Elevation Model (DEM with spatial resolution of 10m x 10m by re-interpolation of elevation data. Data input for this study includes: (1 digitized datum coordinate from RBI map, (2 sample points surveyed by GPS, (3 digitized contour data fromSRTM DEM and ASTER GDEM2, and (4 digitized stream-network layer from RBI. All collected data were converted to mass point coordinats. On the top of Topogrid-ArcGIS, all points data were interpolated to produce DEM. After that the produced DEM were compared and evaluated to the SRTM and ASTER DEMvisually. The result shows that produced DEM are more accurate to represent the detailed topography of the study areas.
Characterisation of 10 kV 10 A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Incau, Bogdan Ioan; Munk-Nielsen, Stig
2015-01-01
The objective of this paper is to characterize and evaluate the static and dynamic performances of 10 kV 10 A 4H-SIC MOSFETs at high temperatures. The results show good electrical performances of the SiC MOSFETs for high temperature operations. The double-pulse test results showed interesting...
SPRAYTRAN 1.0 User’s Guide: A GIS-Based Atmospheric Spray Droplet Dispersion Modeling System
Energy Technology Data Exchange (ETDEWEB)
Allwine, K Jerry; Rutz, Frederick C.; Droppo, James G.; Rishel, Jeremy P.; Chapman, Elaine G.; Bird, S. L.; Thistle, Harold W.
2006-09-20
SPRAY TRANsport (SPRAYTRAN) is a comprehensive dispersion modeling system that is used to simulate the offsite drift of pesticides from spray applications. SPRAYTRAN functions as a console application within Environmental System Research Institute’s ArcMap Geographic Information System (Version 9.x) and integrates the widely-used, U.S. Environmental Protection Agency (EPA)-approved CALifornia PUFF (CALPUFF) dispersion model and model components to simulate longer-range transport and diffusion in variable terrain and spatially/temporally varying meteorological (e.g., wind) fields. Area sources, which are used to define spray blocks in SPRAYTRAN, are initialized using output files generated from a separate aerial-spray-application model called AGDISP (AGricultural DISPersal). The AGDISP model is used for estimating the amount of pesticide deposited to the spray block based on spraying characteristics (e.g., pesticide type, spray nozzles, and aircraft type) and then simulating the near-field (less than 300-m) drift from a single pesticide application. The fraction of pesticide remaining airborne from the AGDISP near-field simulation is then used by SPRAYTRAN for simulating longer-range (greater than 300 m) drift and deposition of the pesticide.
Bye, Robin T; Neilson, Peter D
2010-10-01
Physiological tremor during movement is characterized by ∼10 Hz oscillation observed both in the electromyogram activity and in the velocity profile. We propose that this particular rhythm occurs as the direct consequence of a movement response planning system that acts as an intermittent predictive controller operating at discrete intervals of ∼100 ms. The BUMP model of response planning describes such a system. It forms the kernel of Adaptive Model Theory which defines, in computational terms, a basic unit of motor production or BUMP. Each BUMP consists of three processes: (1) analyzing sensory information, (2) planning a desired optimal response, and (3) execution of that response. These processes operate in parallel across successive sequential BUMPs. The response planning process requires a discrete-time interval in which to generate a minimum acceleration trajectory to connect the actual response with the predicted future state of the target and compensate for executional error. We have shown previously that a response planning time of 100 ms accounts for the intermittency observed experimentally in visual tracking studies and for the psychological refractory period observed in double stimulation reaction time studies. We have also shown that simulations of aimed movement, using this same planning interval, reproduce experimentally observed speed-accuracy tradeoffs and movement velocity profiles. Here we show, by means of a simulation study of constant velocity tracking movements, that employing a 100 ms planning interval closely reproduces the measurement discontinuities and power spectra of electromyograms, joint-angles, and angular velocities of physiological tremor reported experimentally. We conclude that intermittent predictive control through sequential operation of BUMPs is a fundamental mechanism of 10 Hz physiological tremor in movement. Copyright © 2010 Elsevier B.V. All rights reserved.
Analysis of the RPE sheet in the rd10 retinal degeneration model
Energy Technology Data Exchange (ETDEWEB)
Jiang, Yi [Los Alamos National Laboratory
2011-01-04
The normal RPE sheet in the C57Bl/6J mouse is subclassified into two major tiling patterns: A regular generally hexagonal array covering most of the surface and a 'soft network' near the ciliary body made of irregularly shaped cells. Physics models predict these two patterns based on contractility and elasticity of the RPE cell, and strength of cellular adhesion between cells. We hypothesized and identified major changes in RPE regular hexagonal tiling pattern in rdl0 compared to C57BL/6J mice. RPE sheet damage was extensive but occurred in rd10 later than expected, after most retinal degeneration. RPE sheet changes occur in zones with a bullseye pattern. In the posterior zone around the optic nerve RPE cells take on larger irregular and varied shapes to form an intact monolayer. In mid periphery, there is a higher than normal density of cells that progress into involuted layers of RPE under the retina. The periphery remains mostly normal until late stages of degeneration. The number of neighboring cells varies widely depending on zone and progression. RPE morphology continues to deteriorate long after the photoreceptors have degenerated. The RPE cells are bystanders to the rd10 degeneration within photo receptors, and the collateral damage to the RPE sheet resembles stimulation of migration or chemotaxis. Quantitative measures of the tiling patterns and histopathology detected here, scripted in a pipeline written in Perl and Cell Profiler (an open source Matlab plugin), are directly applicable to RPE sheet images from noninvasive fundus autofluorescence (FAF), adaptive optics confocal scanning laser ophthalmoscope (AO-cSLO), and spectral domain optical coherence tomography (SD-OCT) of patients with early stage AMD or RP.
Berry, R. L.; Tegart, J. R.; Demchak, L. J.
1979-01-01
Space shuttle propellant dynamics during ET/Orbiter separation in the RTLS (return to launch site) mission abort sequence were investigated in a test program conducted in the NASA KC-135 "Zero G" aircraft using a 1/10th-scale model of the ET LOX Tank. Low-g parabolas were flown from which thirty tests were selected for evaluation. Data on the nature of low-g propellant reorientation in the ET LOX tank, and measurements of the forces exerted on the tank by the moving propellent will provide a basis for correlation with an analytical model of the slosh phenomenon.
Kim, Youngseob; Wu, You; Seigneur, Christian; Roustan, Yelva
2018-02-01
A new multi-scale model of urban air pollution is presented. This model combines a chemistry-transport model (CTM) that includes a comprehensive treatment of atmospheric chemistry and transport on spatial scales down to 1 km and a street-network model that describes the atmospheric concentrations of pollutants in an urban street network. The street-network model is the Model of Urban Network of Intersecting Canyons and Highways (MUNICH), which consists of two main components: a street-canyon component and a street-intersection component. MUNICH is coupled to the Polair3D CTM of the Polyphemus air quality modeling platform to constitute the Street-in-Grid (SinG) model. MUNICH is used to simulate the concentrations of the chemical species in the urban canopy, which is located in the lowest layer of Polair3D, and the simulation of pollutant concentrations above rooftops is performed with Polair3D. Interactions between MUNICH and Polair3D occur at roof level and depend on a vertical mass transfer coefficient that is a function of atmospheric turbulence. SinG is used to simulate the concentrations of nitrogen oxides (NOx) and ozone (O3) in a Paris suburb. Simulated concentrations are compared to NOx concentrations measured at two monitoring stations within a street canyon. SinG shows better performance than MUNICH for nitrogen dioxide (NO2) concentrations. However, both SinG and MUNICH underestimate NOx. For the case study considered, the model performance for NOx concentrations is not sensitive to using a complex chemistry model in MUNICH and the Leighton NO-NO2-O3 set of reactions is sufficient.
Directory of Open Access Journals (Sweden)
Y. Kim
2018-02-01
Full Text Available A new multi-scale model of urban air pollution is presented. This model combines a chemistry–transport model (CTM that includes a comprehensive treatment of atmospheric chemistry and transport on spatial scales down to 1 km and a street-network model that describes the atmospheric concentrations of pollutants in an urban street network. The street-network model is the Model of Urban Network of Intersecting Canyons and Highways (MUNICH, which consists of two main components: a street-canyon component and a street-intersection component. MUNICH is coupled to the Polair3D CTM of the Polyphemus air quality modeling platform to constitute the Street-in-Grid (SinG model. MUNICH is used to simulate the concentrations of the chemical species in the urban canopy, which is located in the lowest layer of Polair3D, and the simulation of pollutant concentrations above rooftops is performed with Polair3D. Interactions between MUNICH and Polair3D occur at roof level and depend on a vertical mass transfer coefficient that is a function of atmospheric turbulence. SinG is used to simulate the concentrations of nitrogen oxides (NOx and ozone (O3 in a Paris suburb. Simulated concentrations are compared to NOx concentrations measured at two monitoring stations within a street canyon. SinG shows better performance than MUNICH for nitrogen dioxide (NO2 concentrations. However, both SinG and MUNICH underestimate NOx. For the case study considered, the model performance for NOx concentrations is not sensitive to using a complex chemistry model in MUNICH and the Leighton NO–NO2–O3 set of reactions is sufficient.
You, Heejo; Magnuson, James S
2018-04-30
This article describes a new Python distribution of TISK, the time-invariant string kernel model of spoken word recognition (Hannagan et al. in Frontiers in Psychology, 4, 563, 2013). TISK is an interactive-activation model similar to the TRACE model (McClelland & Elman in Cognitive Psychology, 18, 1-86, 1986), but TISK replaces most of TRACE's reduplicated, time-specific nodes with theoretically motivated time-invariant, open-diphone nodes. We discuss the utility of computational models as theory development tools, the relative merits of TISK as compared to other models, and the ways in which researchers might use this implementation to guide their own research and theory development. We describe a TISK model that includes features that facilitate in-line graphing of simulation results, integration with standard Python data formats, and graph and data export. The distribution can be downloaded from https://github.com/maglab-uconn/TISK1.0 .
International Nuclear Information System (INIS)
Engelbrecht, J.P.; Swanepoel, L.; Zunckel, M.; Chow, J.C.
1998-01-01
D-grade domestic coal is being widely used for household cooking and heating purposes by the poorer urban communities in South Africa. The smoke from the combustion of coal has had a severe impact on the health of communities living in the rural townships and cities. To alleviate this escalating problem, the Department of Minerals and Energy of South Africa evaluated low-smoke fuels as an alternative source of energy. The technical and social implications of such fuels were investigated in the course of the Qalabotjha Low-Smoke Fuels Macro-Scale Experiment. Three low-smoke fuels (Chartech, African Fine Carbon (AFC) and Flame Africa) were tested in Qalabotjha over a 10 to 20 day period. This paper presents results from a PM10 TEOM continuous monitor at the Clinic site in Qalabotjha over the mentioned monitoring period. Both the fuel-type and the wind were found to have an effect on the air particulate concentrations. An exponential model which incorporates both these variables is proposed. This model allows for all measured particulate concentrations to be re-calculated to zero wind values. From the analysis of variance (ANOVA) calculations on the zero wind concentrations, it is concluded that the combustion of low-smoke fuels did make a significant improvement to the air quality in Qalabotjha over the period when these were used
Leptogenesis in a Δ(27)×SO(10) SUSY GUT
Energy Technology Data Exchange (ETDEWEB)
Björkeroth, Fredrik [School of Physics and Astronomy, University of Southampton,SO17 1BJ Southampton (United Kingdom); Anda, Francisco J. de [Departamento de Física, CUCEI, Universidad de Guadalajara,Guadalajara (Mexico); Varzielas, Ivo de Medeiros; King, Stephen F. [School of Physics and Astronomy, University of Southampton,SO17 1BJ Southampton (United Kingdom)
2017-01-17
Although SO(10) Supersymmetric (SUSY) Grand Unification Theories (GUTs) are very attractive for neutrino mass and mixing, it is often quite difficult to achieve successful leptogenesis from the lightest right-handed neutrino N{sub 1} due to the strong relations between neutrino and up-type quark Yukawa couplings. We show that in a realistic model these constraints are relaxed, making N{sub 1} leptogenesis viable. To illustrate this, we calculate the baryon asymmetry of the Universe Y{sub B} from flavoured N{sub 1} leptogenesis in a recently proposed Δ(27)×SO(10) SUSY GUT. The flavoured Boltzmann equations are solved numerically, and comparison with the observed Y{sub B} places constraints on the allowed values of right-handed neutrino masses and neutrino Yukawa couplings. The flavoured SO(10) SUSY GUT is not only fairly complete and predictive in the lepton sector, but can also explain the BAU through leptogenesis with natural values in the lepton sector albeit with some tuning in the quark sector.
Ferguson, Stephen A; Wang, Xuewei; Meyerhoff, Mark E
2016-08-07
Polymeric quaternary ammonium salts (polyquaterniums) have found increasing use in industrial and cosmetic applications in recent years. More specifically, polyquaternium-10 (PQ-10) is routinely used in cosmetic applications as a conditioner in personal care product formulations. Herein, we demonstrate the use of potentiometric polyion-sensitive polymeric membrane-based electrodes to quantify PQ-10 levels. Mixtures containing both PQ-10 and sodium lauryl sulfate (SLS) are used as model samples to illustrate this new method. SLS is often present in cosmetic samples that contain PQ-10 (e.g., shampoos, etc.) and this surfactant species interferes with the polyion sensor detection chemistry. However, it is shown here that SLS can be readily separated from the PQ-10/SLS mixture by use of an anion-exchange resin and that the PQ-10 can then be titrated with dextran sulphate (DS). This titration is monitored by potentiometric polyanion sensors to provide equivalence points that are directly proportional to PQ-10 concentrations.
International Nuclear Information System (INIS)
Gao Wen; Liu Lu; Zhou Yun
2007-01-01
Objective: To study the influence of 131 I-17-allylamino-17-demethoxygeldanamycin( 131 I-17-AAG) therapy on immune function in VX2 rabbit models with transplanted liver cancer. Methods: Serum IL-2, IL-4, IL-10 and IFN-γ levels were measured with RIA in 8 VX2 rabbit models with transplanted liver cancer 1-2 weeks after 10mCi 131 I-17-AAG treatment as well as in 8 controls rabbits (models with tumor but without treatment). Results: 1 week after 10mCi 131 I treatment, the serum IL - 2 and IFN-γ levels were significantly lower in the treated rabbits than those in controls (P 0.05). Serum IL-4 and IL-10 levels in the treated rabbits (both at 1 and 2 week) were not significantly different from those in controls (P>0.05). Conclusion: 131 I-17-AAG treatment had transient effects on cellular immunity with no influence on humoral immunity. As a whole, it is a safe to treat VX2 rabbit models with this preparation. (authors)
International Nuclear Information System (INIS)
Pantin, Eric
1996-01-01
In 1984, the observations of the infrared satellite IRAS showed that numerous main-sequence stars are surrounded by a relatively tenuous dust disk. The most studied example is the disk of the star Beta Pictoris. The corono-graphic observations are limited to the most outer regions of the disk. In infrared, it is not the case. We have used an infrared camera to obtain 10 microns images of the central regions. In order to be able to deduce the dust density, one has to fulfil some requirements. First, we had to de-convolute these images degraded by a combination of diffraction and seeing. We initially used standard methods (Richardson-Lucy, Maximum Entropy etc..), then we have developed a new method of astronomical images deconvolution and filtering based on a regularization by Multi-Scales Maximum Entropy. Then we have built a model of thermal emission of the dust to calculate the temperature of the grains. The resulting density shows a region between the star and 50-60 Astronomical Units, depleted of dust. The density is compatible with models simulating the gravitational interactions between such a disk and a planet having a mass the half of Saturn's mass. We have refined the models of the particles' emission: mixture of several materials, porous particles or not, coated with ice or not, to build a global model of the disk taking into account all the observables: IRAS infrared fluxes, 10 and 20 microns fluxes, 10 microns spectrum, scattered fluxes in the visible. In our best model, the particles are porous silicate grains (mixture of olivine and pyroxene) coated with a refractory organics mantle, which becomes 'frozen' (coated with ice) beyond a distance of 90 Astronomical Units from the star. This model allows us to predict an infrared spectrum showing the characteristic emission of the ice around 45-50 microns, that will be compared to the observations of the infrared satellite ISO. (author) [fr
Bryanston-Cross, P.; Sale, R.
1992-06-01
A series of laser visualization measurements has been made to both visualize and map the velocity and direction of the transonic flow from a 1/10th scale model of a thrust reverser. The measurements which have been made by injecting micron sized water droplets into the flow, used two techniques to provide a quantitative measurement of the flow field. The first technique LLS (laser light sheet) provided a general view of the flow, whereas a second pulse laser technique PIV (particle image velocimetry) made a specific measurement in the vicinity of the thrust reverser's 'kicker' plate to map the velocity and direction of the exit flow. This successful study is, to the best of the author's knowledge, the first example of a whole field quantitative visualization being achieved in such a turbulent transonic flow.
MCF-10A-NeoST: A New Cell System for Studying Cell-ECM and Cell-Cell Interactions in Breast Cancer
Energy Technology Data Exchange (ETDEWEB)
Zantek, Nicole Dodge; Walker-Daniels, Jennifer; Stewart, Jane; Hansen, Rhonda K.; Robinson, Daniel; Miao, Hui; Wang, Bingcheng; Kung, Hsing-Jien; Bissell, Mina J.; Kinch, Michael S.
2001-08-22
There is a continuing need for genetically matched cell systems to model cellular behaviors that are frequently observed in aggressive breast cancers. We report here the isolation and initial characterization of a spontaneously arising variant of MCF-10A cells, NeoST, which provides a new model to study cell adhesion and signal transduction in breast cancer. NeoST cells recapitulate important biological and biochemical features of metastatic breast cancer, including anchorage-independent growth, invasiveness in threedimensional reconstituted membranes, loss of E-cadherin expression, and increased tyrosine kinase activity. A comprehensive analysis of tyrosine kinase expression revealed overexpression or functional activation of the Axl, FAK, and EphA2 tyrosine kinases in transformed MCF-10A cells. MCF-10A and these new derivatives provide a genetically matched model to study defects in cell adhesion and signaling that are relevant to cellular behaviors that often typify aggressive breast cancer cells.
Architectural Design Study for a 10Gb/s Ethernet Switch
Oltean, Alexandra Dana
2004-01-01
The demand for 10Gb/s switches at this early stage in the market is primarily for modular solutions that can grow as do the bandwidth requirements. This indicates a requirement for chassis based solutions where individual line cards can be added to a chassis infrastructure and have to communicate across a 10Gb/s switching backplane. The present study is provides an architectural design solution for a passive copper backplane used for moving data between the line cards of a 10Gb/s Ethernet switch system. The ability to pass multi-gigabit data rates through a backplane system requires great attention to details previously thought to be irrelevant at lower frequencies. The trace dimensions, the via holes diameters, the backplane materials and choice of connectors, all play a crucial role in determining the success of the system. At high-speed even a subtle change in any of these elements can drastically affect the end-to-end system performance. In this context, the study presents the modeling and simulation work...
TAF10 and TAF10b partially redundant roles during Drosophila melanogaster morphogenesis.
Pahi, Z; Borsos, B N; Vedelek, B; Shidlovskii, Y V; Georgieva, S G; Boros, I M; Pankotai, T
2017-01-01
Transcription of eukaryotic genes requires the cooperative action of the RNA polymerase complex, the general transcription factors (TFIIB, TFIID, TFIIE, TFIIF and TFIIH) and chromatin modifiers. The TFIID complex contributes to transcriptional activation by several mechanisms and has a subunit with associated histone acetyltransferase (HAT) activity. The histone modifier SAGA complex has both HAT and deubiquitylase (DUB) activities. TFIID and SAGA share several TBP-associated factors (TAFs), but not their HAT subunit. Recently, several duplicated TAF proteins have been identified in higher eukaryotes, but their functional diversity has been so far poorly characterized. Here, we report the functional similarities and differences of TAF10 and TAF10b, the two TAF10 orthologs of Drosophila melanogaster. Results from in silico modeling suggest that dTAF10 and dTAF10b have similar secondary structures characterized by the presence of a histone-fold domain. Additionally, dTAF10 and dTAF10b share interaction partners and show similar expression patterns in neuronal tissues. Nonetheless, dTAF10 and dTAF10b seem to have partly distinct functions. To investigate their roles, we generated dTaf10-dTaf10b double-mutants and rescued the mutant flies with transgenes, which allowed the translation of either dTAF10 or dTAF10b protein. We found that the loss of dTAF10b resulted in pupal lethality, while animals lacking dTAF10 were able to form puparium. dTaf10 mutant adults showed distorted eye morphology. During DNA repair, dTAF10 and dTAF10b act redundantly, suggesting that these proteins have distinct but partially overlapping functions.
Kong, Shaofei; Han, Bin; Bai, Zhipeng; Chen, Li; Shi, Jianwu; Xu, Zhun
2010-09-15
Atmospheric particulate matter (PM(2.5), PM(10) and TSP) were sampled synchronously during three monitoring campaigns from June 2007 to February 2008 at a coastal site in TEDA of Tianjin, China. Chemical compositions including 19 elements, 6 water-solubility ions, organic and elemental carbon were determined. principle components analysis (PCA) and chemical mass balance modeling (CMB) were applied to determine the PM sources and their contributions with the assistance of NSS SO(4)(2)(-), the mass ratios of NO(3)(-) to SO(4)(2)(-) and OC to EC. Air mass backward trajectory model was compared with source apportionment results to evaluate the origin of PM. Results showed that NSS SO(4)(2)(-) values for PM(2.5) were 2147.38, 1701.26 and 239.80 ng/m(3) in summer, autumn and winter, reflecting the influence of sources from local emissions. Most of it was below zero in summer for PM(10) indicating the influence of sea salt. The ratios of NO(3)(-) to SO(4)(2)(-) was 0.19 for PM(2.5), 0.18 for PM(10) and 0.19 for TSP in winter indicating high amounts of coal consumed for heating purpose. Higher OC/EC values (mostly larger than 2.5) demonstrated that secondary organic aerosol was abundant at this site. The major sources were construction activities, road dust, vehicle emissions, marine aerosol, metal manufacturing, secondary sulfate aerosols, soil dust, biomass burning, some pharmaceutics industries and fuel-oil combustion according to PCA. Coal combustion, marine aerosol, vehicular emission and soil dust explained 5-31%, 1-13%, 13-44% and 3-46% for PM(2.5), PM(10) and TSP, respectively. Backward trajectory analysis showed air parcels originating from sea accounted for 39% in summer, while in autumn and winter the air parcels were mainly related to continental origin. Copyright 2010 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Rodrigo Alves Silva
2017-09-01
Full Text Available This paper aims to show the importance of the use of financial metrics in decision-making of credit scoring models selection. In order to achieve such, we considered an automatic approval system approach and we carried out a performance analysis of the financial metrics on the theoretical portfolios generated by seven credit scoring models based on main statistical learning techniques. The models were estimated on German Credit dataset and the results were analyzed based on four metrics: total accuracy, error cost, risk adjusted return on capital and Sharpe index. The results show that total accuracy, widely used as a criterion for selecting credit scoring models, is unable to select the most profitable model for the company, indicating the need to incorporate financial metrics into the credit scoring model selection process. Keywords Credit risk; Model’s selection; Statistical learning.
A model for the determination of the nominal potential for a linear accelerator
International Nuclear Information System (INIS)
Gutt, F.; Silva, P.; Guerrero, R.; Diaz, J.; Colmenares, J.
1998-01-01
The objective of the present work is to find a physical mathematical model based on the reason of the dose percentages at 10 and 20 cm depth, at 100 cm DFS and a 10 x 10 cm 2 field. It was utilized literature data of new manufactured accelerators and those are in use in hospitals, which allow to prove the model under different conditions. Our objective consists only to obtain a model that verifies the nominal potential for a linear accelerator, but without pretending that such a model to be used to calculate any one factor to determination of absorbed dose. (Author)
Connected Equipment Maturity Model Version 1.0
Energy Technology Data Exchange (ETDEWEB)
Butzbaugh, Joshua B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Mayhorn, Ebony T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sullivan, Greg [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Whalen, Scott A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2017-05-01
The Connected Equipment Maturity Model (CEMM) evaluates the high-level functionality and characteristics that enable equipment to provide the four categories of energy-related services through communication with other entities (e.g., equipment, third parties, utilities, and users). The CEMM will help the U.S. Department of Energy, industry, energy efficiency organizations, and research institutions benchmark the current state of connected equipment and identify capabilities that may be attained to reach a more advanced, future state.
Directory of Open Access Journals (Sweden)
Sergio A. Alvarado
2010-12-01
Full Text Available Objetivo: Evaluar la eficiencia predictiva de modelos estadísticos paramétricos y no paramétricos para predecir episodios críticos de contaminación por material particulado PM10 del día siguiente, que superen en Santiago de Chile la norma de calidad diaria. Una predicción adecuada de tales episodios permite a la autoridad decretar medidas restrictivas que aminoren la gravedad del episodio, y consecuentemente proteger la salud de la comunidad. Método: Se trabajó con las concentraciones de material particulado PM10 registradas en una estación asociada a la red de monitorización de la calidad del aire MACAM-2, considerando 152 observaciones diarias de 14 variables, y con información meteorológica registrada durante los años 2001 a 2004. Se ajustaron modelos estadísticos paramétricos Gamma usando el paquete estadístico STATA v11, y no paramétricos usando una demo del software estadístico MARS v 2.0 distribuida por Salford-Systems. Resultados: Ambos métodos de modelación presentan una alta correlación entre los valores observados y los predichos. Los modelos Gamma presentan mejores aciertos que MARS para las concentraciones de PM10 con valores Objective: To evaluate the predictive efficiency of two statistical models (one parametric and the other non-parametric to predict critical episodes of air pollution exceeding daily air quality standards in Santiago, Chile by using the next day PM10 maximum 24h value. Accurate prediction of such episodes would allow restrictive measures to be applied by health authorities to reduce their seriousness and protect the community´s health. Methods: We used the PM10 concentrations registered by a station of the Air Quality Monitoring Network (152 daily observations of 14 variables and meteorological information gathered from 2001 to 2004. To construct predictive models, we fitted a parametric Gamma model using STATA v11 software and a non-parametric MARS model by using a demo version of Salford
Operational cooling tower model (CTTOOL V1.0)
Energy Technology Data Exchange (ETDEWEB)
Aleman, S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); LocalDomainServers, L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Garrett, A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2015-01-01
Mechanical draft cooling towers (MDCT’s) are widely used to remove waste heat from industrial processes, including suspected proliferators of weapons of mass destruction (WMD). The temperature of the air being exhausted from the MDCT is proportional to the amount of thermal energy being removed from the process cooling water, although ambient weather conditions and cooling water flow rate must be known or estimated to calculate the rate of thermal energy dissipation (Q). It is theoretically possible to derive MDCT air exhaust temperatures from thermal images taken from a remote sensor. A numerical model of a MDCT is required to translate the air exhaust temperature to a Q. This report describes the MDCT model developed by the Problem Centered Integrated Analysis (PCIA) program that was designed to perform those computational tasks. The PCIA program is a collaborative effort between the Savannah River National Laboratory (SRNL), the Northrop-Grumman Corporation (NG) and the Aerospace Corporation (AERO).
Samara, Constantini; Argyropoulos, George; Grigoratos, Theodoros; Kouras, Αthanasios; Manoli, Εvangelia; Andreadou, Symela; Pavloudakis, Fragkiskos; Sahanidis, Chariton
2018-05-01
The Western Macedonian Lignite Center (WMLC) in northwestern Greece is the major lignite center in the Balkans feeding four major power plants of total power exceeding 4 GW. Concentrations of PM 10 (i.e., particulate matters with diameters ≤10 μm) are the main concern in the region, and the high levels observed are often attributed to the activities related to power generation. In this study, the contribution of fugitive dust emissions from the opencast lignite mines to the ambient levels of PM 10 in the surroundings was estimated by performing chemical mass balance (CMB) receptor modeling. For this purpose, PM 10 samples were concurrently collected at four receptor sites located in the periphery of the mine area during the cold and the warm periods of the year (November-December 2011 and August-September 2012), and analyzed for a total of 26 macro- and trace elements and ionic species (sulfate, nitrate, chloride). The robotic chemical mass balance (RCMB) model was employed for source identification/apportionment of PM 10 at each receptor site using as inputs the ambient concentrations and the chemical profiles of various sources including the major mine operations, the fly ash escaping the electrostatic filters of the power plants, and other primary and secondary sources. Mean measured PM 10 concentrations at the different sites ranged from 38 to 72 μg m -3 . The estimated total contribution of mines ranged between 9 and 22% in the cold period increasing to 36-42% in the dry warm period. Other significant sources were vehicular traffic, biomass burning, and secondary sulfate and nitrate aerosol. These results imply that more efficient measures to prevent and suppress fugitive dust emissions from the mines are needed.
Directory of Open Access Journals (Sweden)
Liliana B Menalled
2010-03-01
Full Text Available Previous studies of the effects of coenzyme Q10 and minocycline on mouse models of Huntington's disease have produced conflicting results regarding their efficacy in behavioral tests. Using our recently published best practices for husbandry and testing for mouse models of Huntington's disease, we report that neither coenzyme Q10 nor minocycline had significant beneficial effects on measures of motor function, general health (open field, rotarod, grip strength, rearing-climbing, body weight and survival in the R6/2 mouse model. The higher doses of minocycline, on the contrary, reduced survival. We were thus unable to confirm the previously reported benefits for these two drugs, and we discuss potential reasons for these discrepancies, such as the effects of husbandry and nutrition.
Evaluation of the Westinghouse 10B depletion for BWR control rods
International Nuclear Information System (INIS)
Vallgren, Christina
2008-03-01
The aim of this work was to establish the 10 B depletion model for CR 99 control rods by using the latest version of POLCA7. In order to obtain an understanding of the differences between the currently used 10 B depletion models implemented in POLCA4 at O3 and in SIMULATE-3 at OL1, and the latest improved model implemented in the latest POLCA7, this work has been performed in three different parts. The first part of the work was to find out how large differences there exist in 10 B depletion between the calculated data by using the latest core monitoring system (POLCA7 version 4.10.0) and the measured data obtained in the hot-cell laboratory in Studsvik. It was found that the 10 B depletion computed by the latest POLCA7 version is in good agreement with the measured data from Studsvik. A poor agreement with a conservative overestimation in 10 B depletion was also found between the old model and the measured data. The aim of the second part of the work was to compare the calculated 10 B depletion values for two CR 99 rods from Olkiluoto 1 with the calculated 10 B depletion value for a CR 99 rod from Oskarshamn 3, by using the new 10 B depletion model implemented in the latest POLCA7 version. Swelling measurements of the boron carbide pins, used as absorber material, have indicated that the 10 B depletion should be of similar magnitude for the rods in Olkiluoto 1 and the rod in Oskarshamn 3, whereas the calculated values by using the earlier 10 B depletion models on the process computers showed a difference of about 20 %. By using the new 10 B depletion model m POLCA7, it was found that the 10 B depletion in the two studied cases was similar to each other and, thus, the hypothesis of a linear relationship between B 4 C swelling and thermal neutron fluence was supported. This third part of the work was carried out at KKL, Switzerland, and focused on comparing the B depletion models used in Westinghouse/POLCA7 and KKL/PRESTO-2. It was found that there is a slight
Evaluation of the Westinghouse 10B depletion for BWR control rods
Energy Technology Data Exchange (ETDEWEB)
Vallgren, Christina
2008-03-15
The aim of this work was to establish the 10B depletion model for CR 99 control rods by using the latest version of POLCA7. In order to obtain an understanding of the differences between the currently used 10B depletion models implemented in POLCA4 at O3 and in SIMULATE-3 at OL1, and the latest improved model implemented in the latest POLCA7, this work has been performed in three different parts. The first part of the work was to find out how large differences there exist in 10B depletion between the calculated data by using the latest core monitoring system (POLCA7 version 4.10.0) and the measured data obtained in the hot-cell laboratory in Studsvik. It was found that the 10B depletion computed by the latest POLCA7 version is in good agreement with the measured data from Studsvik. A poor agreement with a conservative overestimation in 10B depletion was also found between the old model and the measured data. The aim of the second part of the work was to compare the calculated 10B depletion values for two CR 99 rods from Olkiluoto 1 with the calculated 10B depletion value for a CR 99 rod from Oskarshamn 3, by using the new 10B depletion model implemented in the latest POLCA7 version. Swelling measurements of the boron carbide pins, used as absorber material, have indicated that the 10B depletion should be of similar magnitude for the rods in Olkiluoto 1 and the rod in Oskarshamn 3, whereas the calculated values by using the earlier 10B depletion models on the process computers showed a difference of about 20 %. By using the new 10B depletion model m POLCA7, it was found that the 10B depletion in the two studied cases was similar to each other and, thus, the hypothesis of a linear relationship between B{sub 4}C swelling and thermal neutron fluence was supported. This third part of the work was carried out at KKL, Switzerland, and focused on comparing the B depletion models used in Westinghouse/POLCA7 and KKL/PRESTO-2. It was found that there is a slight difference in
Lukyanov, V. K.; Kadrev, D. N.; Zemlyanaya, E. V.; Spasova, K.; Lukyanov, K. V.; Antonov, A. N.; Gaidarov, M. K.
2015-03-01
The density distributions of 10Be and 11Be nuclei obtained within the quantum Monte Carlo model and the generator coordinate method are used to calculate the microscopic optical potentials (OPs) and cross sections of elastic scattering of these nuclei on protons and 12C at energies E energy approximation. In this hybrid model of OP the free parameters are the depths of the real and imaginary parts obtained by fitting the experimental data. The well-known energy dependence of the volume integrals is used as a physical constraint to resolve the ambiguities of the parameter values. The role of the spin-orbit potential and the surface contribution to the OP is studied for an adequate description of available experimental elastic scattering cross-section data. Also, the cluster model, in which 11Be consists of a n -halo and the 10Be core, is adopted. Within the latter, the breakup cross sections of 11Be nucleus on 9Be,93Nb,181Ta , and 238U targets and momentum distributions of 10Be fragments are calculated and compared with the existing experimental data.
Differential gene expression in ADAM10 and mutant ADAM10 transgenic mice
Directory of Open Access Journals (Sweden)
Postina Rolf
2009-02-01
Full Text Available Abstract Background In a transgenic mouse model of Alzheimer disease (AD, cleavage of the amyloid precursor protein (APP by the α-secretase ADAM10 prevented amyloid plaque formation, and alleviated cognitive deficits. Furthermore, ADAM10 overexpression increased the cortical synaptogenesis. These results suggest that upregulation of ADAM10 in the brain has beneficial effects on AD pathology. Results To assess the influence of ADAM10 on the gene expression profile in the brain, we performed a microarray analysis using RNA isolated from brains of five months old mice overexpressing either the α-secretase ADAM10, or a dominant-negative mutant (dn of this enzyme. As compared to non-transgenic wild-type mice, in ADAM10 transgenic mice 355 genes, and in dnADAM10 mice 143 genes were found to be differentially expressed. A higher number of genes was differentially regulated in double-transgenic mouse strains additionally expressing the human APP[V717I] mutant. Overexpression of proteolytically active ADAM10 affected several physiological pathways, such as cell communication, nervous system development, neuron projection as well as synaptic transmission. Although ADAM10 has been implicated in Notch and β-catenin signaling, no significant changes in the respective target genes were observed in adult ADAM10 transgenic mice. Real-time RT-PCR confirmed a downregulation of genes coding for the inflammation-associated proteins S100a8 and S100a9 induced by moderate ADAM10 overexpression. Overexpression of the dominant-negative form dnADAM10 led to a significant increase in the expression of the fatty acid-binding protein Fabp7, which also has been found in higher amounts in brains of Down syndrome patients. Conclusion In general, there was only a moderate alteration of gene expression in ADAM10 overexpressing mice. Genes coding for pro-inflammatory or pro-apoptotic proteins were not over-represented among differentially regulated genes. Even a decrease of
South African Actuarial Journal - Vol 10 (2010)
African Journals Online (AJOL)
A multiple Markov switching model for actuarial use in South Africa · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AJ Maitland. http://dx.doi.org/10.4314/saaj.v10i1.61713 ...
A new family symmetry for SO(10) GUTs
International Nuclear Information System (INIS)
King, Stephen F.; Luhn, Christoph
2009-01-01
We argue that the projective special linear group PSL 2 (7), also known as Σ(168), has unique features which make it the most suitable discrete family symmetry for describing quark and lepton masses and mixing in the framework of SO(10) type unified models. In such models flavon fields in the sextet representation of PSL 2 (7) play a crucial role both in obtaining tri-bimaximal neutrino mixing as well as in generating the third family charged fermion Yukawa couplings. In preparation for physical applications, we derive the triplet representation of PSL 2 (7) in the basis S,T,U,V where S,T,U are the familiar triplet generators of S 4 in the diagonal charged lepton basis where T is diagonal. We also derive an analogous basis for the real sextet representation and identify the vacuum alignments which lead to tri-bimaximal neutrino mixing and large third family charged fermion Yukawa couplings.
International Nuclear Information System (INIS)
Yoon, Churl; Park, Joo Hwan
2007-01-01
When a PHT(Primary Heat Transfer) system fails to remove excess heat from fuel channels for some loss of coolant accidents(LOCA's) in CANDU NPP's, the fuel channel temperature could increase until the pressure tube strains (i.e., balloon or sag) to contact its surrounding Calandria tube.(PT/CT contact) Following a PT/CT contact, there is a spike in the heat flux to the moderator surrounding the Calandria tube, which may lead to a sustained CT dryout and also a failure of a fuel channel. The prevention of a CT dryout following a PT/CT contact depends on the local moderator subcooling. That is, fuel channel integrity depends on the capability of the moderator to act as the ultimate heat sink for some LOCA's in a CANDU reactor. In KAERI, Yoon et al. developed a CFD model for predicting a CANDU-6 moderator temperature on the basis of a commercial CFD code CFX-4(ANSYS Inc.). This analytic model has the strength of modelling the hydraulic resistances in the core region and accounting for a heat source term in the energy equations. But convergence difficulties and a slow computing speed are the limitations of this model, because the CFX-4 code adapts a segregated solver to resolve a moderator circulation including a strong coupled-effect. Compared to a segregated solver, a coupled-solver is highly efficient and robust especially for a flow with a strong interference between the variables such as combustion
Energy Technology Data Exchange (ETDEWEB)
Dias de Deus, J [Instituto de Fisica e Matematica, Lisboa (Portugal); Kroll, P [Wuppertal Univ. (Gesamthochschule) (Germany, F.R.)
1976-08-21
The inclusion of secondary contributions Reggeons and real parts by changing the radial scale but exactly preserving geometrical scaling (GS) alloys an exclusion of GS to lower energies. The crossover curves in proton proton, Kp, and *pp are in this way correctly described. A GS formula relating two measurable quantities, the depth of the dip in proton proton scattering and the ratio of the real to immaginary part of the amplitude at t=0, is shown to be valid in the 10-1000 GeV region.
Directory of Open Access Journals (Sweden)
Melissa A. Musser
2015-01-01
Full Text Available Background & Aims: In Hirschsprung disease (HSCR, neural crest-derived progenitors (NCPs fail to completely colonize the intestine so that the enteric nervous system is absent from distal bowel. Despite removal of the aganglionic region, many HSCR patients suffer from residual intestinal dysmotility. To test the hypothesis that inappropriate lineage segregation of NCPs in proximal ganglionated regions of the bowel could contribute to such postoperative disease, we investigated neural crest (NC-derived lineages and motility in ganglionated, postnatal intestine of the Sox10Dom/+ HSCR mouse model. Methods: Cre-mediated fate-mapping was applied to evaluate relative proportions of NC-derived cell types. Motility assays were performed to assess gastric emptying and small intestine motility while colonic inflammation was assessed by histopathology for Sox10Dom/+ mutants relative to wild-type controls. Results: Sox10Dom/+ mice showed regional alterations in neuron and glia proportions as well as calretinin+ and neuronal nitric oxide synthase (nNOS+ neuronal subtypes. In the colon, imbalance of enteric NC derivatives correlated with the extent of aganglionosis. All Sox10Dom/+ mice exhibited reduced small intestinal transit at 4 weeks of age; at 6 weeks of age, Sox10Dom/+ males had increased gastric emptying rates. Sox10Dom/+ mice surviving to 6 weeks of age had little or no colonic inflammation when compared with wild-type littermates, suggesting that these changes in gastrointestinal motility are neurally mediated. Conclusions: The Sox10Dom mutation disrupts the balance of NC-derived lineages and affects gastrointestinal motility in the proximal, ganglionated intestine of adult animals. This is the first report identifying alterations in enteric neuronal classes in Sox10Dom/+ mutants, which suggests a previously unrecognized role for Sox10 in neuronal subtype specification. Keywords: Aganglionosis, Enteric Nervous System, Neural Crest
Editorial: The publication of geoscientific model developments v1.0
Directory of Open Access Journals (Sweden)
GMD Executive Editors
2013-08-01
Full Text Available In 2008, the first volume of the European Geosciences Union (EGU journal Geoscientific Model Development (GMD was published. GMD was founded because we perceived there to be a need for a space to publish comprehensive descriptions of numerical models in the geosciences. The journal is now well established, with the submission rate increasing over time. However, there are several aspects of model publication that we believe could be further improved. In this editorial we assess the lessons learned over the first few years of the journal's life, and describe some changes to GMD's editorial policy, which will ensure that the models and model developments are published in such a way that they are of maximum value to the community. These changes to editorial policy mostly focus on improving the rigour of the review process through a stricter requirement for access to the materials necessary to test the behaviour of the models. Throughout this editorial, "must" means that the stated actions are required, and the paper cannot be published without them; "strongly encouraged" means that we encourage the action, but papers can still be published if the criteria are not met; "may" means that the action may be carried out by the authors or referees, if they so wish. We have reviewed and rationalised the manuscript types into five new categories. For all papers which are primarily based on a specific numerical model, the changes are as follows: – The paper must be accompanied by the code, or means of accessing the code, for the purpose of peer-review. If the code is normally distributed in a way which could compromise the anonymity of the referees, then the code must be made available to the editor. The referee/editor is not required to review the code in any way, but they may do so if they so wish. – All papers must include a section at the end of the paper entitled "Code availability". In this section, instructions for obtaining the code (e.g. from a
Directory of Open Access Journals (Sweden)
X. Huang
2016-11-01
Full Text Available In the Community Earth System Model (CESM, the ocean model is computationally expensive for high-resolution grids and is often the least scalable component for high-resolution production experiments. The major bottleneck is that the barotropic solver scales poorly at high core counts. We design a new barotropic solver to accelerate the high-resolution ocean simulation. The novel solver adopts a Chebyshev-type iterative method to reduce the global communication cost in conjunction with an effective block preconditioner to further reduce the iterations. The algorithm and its computational complexity are theoretically analyzed and compared with other existing methods. We confirm the significant reduction of the global communication time with a competitive convergence rate using a series of idealized tests. Numerical experiments using the CESM 0.1° global ocean model show that the proposed approach results in a factor of 1.7 speed-up over the original method with no loss of accuracy, achieving 10.5 simulated years per wall-clock day on 16 875 cores.
Ciuladaite, Zivile; Preiksaitiene, Egle; Utkus, Algirdas; Kučinskas, Vaidutis
2014-01-01
Large pericentric inversions in chromosome 10 are rare chromosomal aberrations with only few cases of familial inheritance. Such chromosomal rearrangements may lead to production of unbalanced gametes. As a result of a recombination event in the inversion loop, 2 recombinants with duplicated and deficient chromosome segments, including the regions distal to the inversion, may be produced. We report on 2 relatives in a family with opposite terminal chromosomal rearrangements of chromosome 10, i.e. rec(10)dup(10p)inv(10) and rec(10)dup(10q)inv(10), due to familial pericentric inversion inv(10)(p15.1q26.12). Based on array-CGH results, we characterized the exact genomic regions involved and compared the clinical features of both patients with previous reports on similar pericentric inversions and regional differences within 10p and 10q. The fact that both products of recombination are viable indicates a potentially high recurrence risk of unbalanced offspring. This report of unbalanced rearrangements in chromosome 10 in 2 generations confirms the importance of screening for terminal imbalances in patients with idiopathic intellectual disability by molecular cytogenetic techniques such as FISH, MLPA or microarrays. It also underlines the necessity for FISH to define structural characteristics of such cryptic intrachromosomal rearrangements and the underlying cytogenetic mechanisms. © 2014 S. Karger AG, Basel.
Development of PSpice modeling platform for 10 kV/100 A SiC MOSFET power module
DEFF Research Database (Denmark)
Martins, Joäo Pedro Rodrigues; Nawaz, Muhammad; Ilves, Kalle
2017-01-01
was implemented based on the already established McNutt Hefner model originally developed for discrete single-die based SiC-MOSFETs. The proposed model has been verified both with static and dynamic experimental data and at different temperatures. Moreover, the energy loss assessment has been performed...... for a variety of operating parameters (e.g., stray inductance, gate resistance), different load current and supply voltages. The model was also verified with parallel connection of several power modules in order to predict the current unbalance as a result of various parasitic elements in the test circuit....... The developed model has been further extended to study the electro-thermal behaviour under short circuit with accurate predictability, and validated with the experimental data. Finally, the operational robustness of the model was judged by simulating an arbitrary Buck, and Boost converter where the converter...
Institute of Scientific and Technical Information of China (English)
袁嵩; 于亮; 赵汝岩
2016-01-01
为了进一步了解 JP-10燃料在航空发动机燃烧室中的蒸发燃烧机理,基于 SRK 状态方程,运用数学建模的方法,对 JP-10液滴蒸发过程进行了数值模拟并分析了环境因素对液滴蒸发表面温度变化及液滴生存时间变化的影响。研究表明,气体介质与液滴间的相对速度和环境压力及温度对 JP-10液滴蒸发湿球温度、升温过程及生存时间影响明显。%In order to further understand the evaporation and combustion mechanism of the JP-10 droplet in the engine combustion chamber,based on the SRK state equation,and by means of mathematical modeling,we simulated the evaporation process of the JP-10 droplet and analyzed the influences of environmental factors on the droplet surface temperature and life time.The results show that the influences of ambient pressure and temperature and relative velocity between gas and droplet on the JP-10 evaporation wet-bulb temperature,heating process and survival time are obvious.
Combining MOD10A1 and MYD10A1 Images For Snow Cover Area Monitoring
Tekeli, A. E.
2008-12-01
MOD10A1 and MYD10A1 daily snow cover maps at 500 m resolution are available from MODIS sensors on Terra and Aqua satellites. Aqua obtains the image of same region approximately three hours after Terra over Turkey region. MODIS is an optic sensor and cloud cover degrades the usability of derived snow cover maps. Moreover, spectral similarity between clouds and snow complicates their separability in visible imagery. Fortunately, dynamic behavior of clouds enables their discrimination from snow stationary on the surface. Combined use of MOD10A1 and MYD10A1 images mostly reduces the cloud cover present in one image alone and provides better representation of surface snow cover. Comparison of merged images with in situ data indicated higher hit ratios. The individual comparison of MOD10A1 and MYD10A1 images with ground data each yielded 31% hit ratio whereas, the merged images provided 38%. One-day shifts in comparisons increased hit ratios to 52 % and 46% whereas and two-day shifts gave 77 % and 79 % for MOD10A1 and MYD10A1 respectively. Merged maps yielded 54% and 83% for one and two day shifts. The improvement provided by the merging technique is found to be 7% for the present day, 7 % for one- day and 5% for two-day shifts for the whole season. Monthly decomposition resulted 25% improvement as the maximum. The snow cover product obtained by merging Terra and Aqua satellites provided higher hit ratios, as expected.
Nascimento de Souza, Raquel; Silva, Fernanda Kohn; Alves de Medeiros, Magda
2017-06-01
Spinal cord injuries (SCIs) initiate a series of molecular and cellular events in which inflammatory responses can lead to major neurological dysfunctions. The present study aims to investigate whether bee venom (BV) acupuncture applied at acupoints ST36 (Zusanli) and GV3 (Yaoyangquan) could minimize locomotor deficits and the magnitude of neural tissue losses, and change the balance between pro- and anti-inflammatory cytokines after an SCI by compression. Wistar rats were subjected to an SCI model by compression in which a 2-French Fogarty embolectomy catheter was inflated in the extradural space. The effects of BV acupuncture, in which 20 μL of BV diluted in saline (0.08 mg/kg) was injected at acupoints GV3 and ST36 [BV(ST36+GV3)-SCI] was compared with BV injected at nonacupoints [BV(NP)-SCI] and with no treatment [group subjected only to SCI (CTL-SCI)]. The BV(ST36+GV3)-SCI group showed a significant improvement in the locomotor performance and a decrease of lesion size compared with the controls. BV acupuncture at the ST36 + GV3 increased the expression of interleukin-10 (anti-inflammatory) at 6 hours and reduced the expression of interleukin-6 (proinflammatory) at 24 hours after SCI compared with the controls. Our results suggest that BV acupuncture can reduce neuroinflammation and induce recovery in the SCI compression model. Copyright © 2017. Published by Elsevier B.V.
Identification of PM10 air pollution origins at a rural background site
Reizer, Magdalena; Orza, José A. G.
2018-01-01
Trajectory cluster analysis and concentration weighted trajectory (CWT) approach have been applied to investigate the origins of PM10 air pollution recorded at a rural background site in North-eastern Poland (Diabla Góra). Air mass back-trajectories used in this study have been computed with the Hybrid Single-Particle Lagrangian Integrated Trajectory (HYSPLIT) model for a 10-year period of 2006-2015. A cluster analysis grouped back-trajectories into 7 clusters. Most of the trajectories correspond to fast and moderately moving westerly and northerly flows (45% and 25% of the cases, respectively). However, significantly higher PM10 concentrations were observed for slow moving easterly (11%) and southerly (20%) air masses. The CWT analysis shows that high PM10 levels are observed at Diabla Góra site when air masses are originated and passed over the heavily industrialized areas in Central-Eastern Europe located to the south and south-east of the site.
DEFF Research Database (Denmark)
Hansen, A; Kemp, K; Kemp, E
2001-01-01
of high dose WF10 as a single drug regimen in the hamster-to-rat xenotransplantation model and searched for possible cardiotoxic side effects. WF10 prolonged cardiac xenograft survival, but did not induce tolerence or inhibit pathological signs of acute rejection. Hamsters from the donor population...
International Nuclear Information System (INIS)
1976-01-01
Documentation for the General Electric Evaluation Model is presented. Computer codes and numerical methods common to the codes are described. It is shown how GE BWR's conform to the Acceptance Criteria of 10CFR50.46
A comparison of the basic photon and electron dosimetry data for Neptun 10PC linear accelerators
International Nuclear Information System (INIS)
Shokrani, P.; Monadi, S.
2008-01-01
In recent years the similarity of dosimetric characteristics of modern linear accelerators with the same make, model and nominal energy, has become more common. The goal of this study was to quantitatively investigate the reproducibility of the basic photon and electron dosimetry data from Neptun 10PC accelerators across the institutions. In the current study, the photon and electron dosimetry data collected during acceptance and initial commissioning of six Neptun 10PC linear accelerators are analyzed. The dates of original installations of these six machines were evenly spread out over a 5 year period and the series of measurements were conducted during an average of 1-2 months after original installations. All units had identical energies and beam modifiers. For photon beams, the collected data include depth dose data, output factors and beam profile data in water. For electron beams, in addition to depth dose data and output factors, the effective source skin distance for 10 x 10 cm field size is also presented. For most beam parameters the variation (one standard deviation), was less than 1.0% (less than 2% for 2 parameters). A variation of this magnitude is expected to be observed during annual calibration of well-maintained accelerators. In conclusion, this study is presenting a consistent set of data for Neptun 10PC linear accelerators. This consistency implies that for this model, a standard data set of basic photon and electron dosimetry could be established, as a guide for future commissioning, beam modeling and quality assurance purposes. (authors)
FDTD calculations of SAR for child voxel models in different postures between 10 MHz and 3 GHz.
Findlay, R P; Lee, A-K; Dimbylow, P J
2009-08-01
Calculations of specific energy absorption rate (SAR) have been performed on the rescaled NORMAN 7-y-old voxel model and the Electronics and Telecommunications Research Institute (ETRI) child 7-y-old voxel model in the standing arms down, arms up and sitting postures. These calculations were for plane-wave exposure under isolated and grounded conditions between 10 MHz and 3 GHz. It was found that there was little difference at each resonant frequency between the whole-body averaged SAR values calculated for the NORMAN and ETRI 7-y-old models for each of the postures studied. However, when compared with the arms down posture, raising the arms increased the SAR by up to 25%. Electric field values required to produce the International Commission on Non-Ionizing Radiation Protection and Institute of Electrical and Electronic Engineers public basic restriction were calculated, and compared with reference levels for the different child models and postures. These showed that, under certain worst-case exposure conditions, the reference levels may not be conservative.
The YORP effect on the GOES 8 and GOES 10 satellites: A case study
Albuja, Antonella A.; Scheeres, Daniel J.; Cognion, Rita L.; Ryan, William; Ryan, Eileen V.
2018-01-01
The Yarkovsky-O'Keefe-Radzievskii-Paddack (YORP) effect is a proposed explanation for the observed rotation behavior of inactive satellites in Earth orbit. This paper further explores the YORP effect for highly asymmetric inactive satellites. Satellite models are developed to represent the GOES 8 and GOES 10 satellites, both of which are currently inactive in geosynchronous Earth orbit (GEO). A simple satellite model for the GOES 8 satellite is used to analyze the short period variations of the angular velocity and obliquity as a result of the YORP effect. A more complex model for the rotational dynamics of the GOES 8 and GOES 10 satellites are developed to probe their sensitivity and to match observed spin periods and states of these satellites. The simulated rotation periods are compared to observations for both satellites. The comparison between YORP theory and observed rotation rates for both satellites show that the YORP effect could be the cause for the observed rotational behavior. The YORP model also predicts a novel state for the GOES 8 satellite, namely that it could periodically fall into a tumbling rotation state. Recent observations of this satellite are consistent with this prediction.
FBG_SiMul V1.0: Fibre Bragg grating signal simulation tool for finite element method models
Directory of Open Access Journals (Sweden)
G. Pereira
2016-01-01
Full Text Available FBG_SiMul V1.0 is a tool to study and design the implementation of fibre Bragg grating (FBG sensors solutions in any arbitrary loaded structure or application. The software removes the need for a fibre optic expert user and makes the sensor response of a structural health monitoring solution using FBG sensors more simple and fast. The software uses a modified T-Matrix method to simulate the FBG reflected spectrum based on the stress and strain from a finite element method model. The article describes the theory and algorithm implementation, followed by an empirical validation.
Energy Technology Data Exchange (ETDEWEB)
Hu, Renyu [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Demory, Brice-Olivier [Astrophysics Group, Cavendish Laboratory, J.J. Thomson Avenue, Cambridge CB3 0HE (United Kingdom); Seager, Sara; Lewis, Nikole [Department of Earth, Atmospheric and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Showman, Adam P., E-mail: renyu.hu@jpl.nasa.gov [Department of Planetary Sciences, University of Arizona, Tucson, AZ 85721 (United States)
2015-03-20
Kepler has detected numerous exoplanet transits by measuring stellar light in a single visible-wavelength band. In addition to detection, the precise photometry provides phase curves of exoplanets, which can be used to study the dynamic processes on these planets. However, the interpretation of these observations can be complicated by the fact that visible-wavelength phase curves can represent both thermal emission and scattering from the planets. Here we present a semi-analytical model framework that can be applied to study Kepler and future visible-wavelength phase curve observations of exoplanets. The model efficiently computes reflection and thermal emission components for both rocky and gaseous planets, considering both homogeneous and inhomogeneous surfaces or atmospheres. We analyze the phase curves of the gaseous planet Kepler- 7 b and the rocky planet Kepler- 10 b using the model. In general, we find that a hot exoplanet’s visible-wavelength phase curve having a significant phase offset can usually be explained by two classes of solutions: one class requires a thermal hot spot shifted to one side of the substellar point, and the other class requires reflective clouds concentrated on the same side of the substellar point. Particularly for Kepler- 7 b, reflective clouds located on the west side of the substellar point can best explain its phase curve. The reflectivity of the clear part of the atmosphere should be less than 7% and that of the cloudy part should be greater than 80%, and the cloud boundary should be located at 11° ± 3° to the west of the substellar point. We suggest single-band photometry surveys could yield valuable information on exoplanet atmospheres and surfaces.
Thermal hydraulic modelling of the Mo and Iridium irradiation facilities of the RA10 reactor
International Nuclear Information System (INIS)
Gramajo, M.; García, J.; Marcel, C.P.
2013-01-01
The RA-10 reactor is a multipurpose, open pool research reactor. The core consists of a rectangular array of MTR type fuel. The produced thermal power is 30 MW which is extracted by the refrigeration system via an ascendant flow through the core. The core reflector is D 2 O contained in a watertight tank. The design of the reactor includes a number of out-core facilities which are meant to be used for industrial, medical and research purposes. Among all the facilities, the most important ones are the Molybdenum and Iridium ones which we modeled in this work. During the normal operation of the reactor, the manipulation and the on-line extraction of the irradiation facilities is foreseen. Therefore the study of the head loss during the normal operation as well as during the extraction maneuvers plays a relevant role in the design and safety analysis. In this work a CFD commercial code is use dto perform the calculations needed to guarantee the design requirements.In addition, a full detailed geometric model for both, the Molybdenum and Iridium facilities,is used to perform the required simulations. The obtained results allow to evaluating the thermal-hydraulic performance of the proposed facilities designs. (author)
A model of mechanical interactions between heart and lungs.
Fontecave Jallon, Julie; Abdulhay, Enas; Calabrese, Pascale; Baconnier, Pierre; Gumery, Pierre-Yves
2009-12-13
To study the mechanical interactions between heart, lungs and thorax, we propose a mathematical model combining a ventilatory neuromuscular model and a model of the cardiovascular system, as described by Smith et al. (Smith, Chase, Nokes, Shaw & Wake 2004 Med. Eng. Phys.26, 131-139. (doi:10.1016/j.medengphy.2003.10.001)). The respiratory model has been adapted from Thibault et al. (Thibault, Heyer, Benchetrit & Baconnier 2002 Acta Biotheor. 50, 269-279. (doi:10.1023/A:1022616701863)); using a Liénard oscillator, it allows the activity of the respiratory centres, the respiratory muscles and rib cage internal mechanics to be simulated. The minimal haemodynamic system model of Smith includes the heart, as well as the pulmonary and systemic circulation systems. These two modules interact mechanically by means of the pleural pressure, calculated in the mechanical respiratory system, and the intrathoracic blood volume, calculated in the cardiovascular model. The simulation by the proposed model provides results, first, close to experimental data, second, in agreement with the literature results and, finally, highlighting the presence of mechanical cardiorespiratory interactions.
The BRIDGE HadCM3 family of climate models: HadCM3@Bristol v1.0
Directory of Open Access Journals (Sweden)
P. J. Valdes
2017-10-01
Full Text Available Understanding natural and anthropogenic climate change processes involves using computational models that represent the main components of the Earth system: the atmosphere, ocean, sea ice, and land surface. These models have become increasingly computationally expensive as resolution is increased and more complex process representations are included. However, to gain robust insight into how climate may respond to a given forcing, and to meaningfully quantify the associated uncertainty, it is often required to use either or both ensemble approaches and very long integrations. For this reason, more computationally efficient models can be very valuable tools. Here we provide a comprehensive overview of the suite of climate models based around the HadCM3 coupled general circulation model. This model was developed at the UK Met Office and has been heavily used during the last 15 years for a range of future (and past climate change studies, but has now been largely superseded for many scientific studies by more recently developed models. However, it continues to be extensively used by various institutions, including the BRIDGE (Bristol Research Initiative for the Dynamic Global Environment research group at the University of Bristol, who have made modest adaptations to the base HadCM3 model over time. These adaptations mean that the original documentation is not entirely representative, and several other relatively undocumented configurations are in use. We therefore describe the key features of a number of configurations of the HadCM3 climate model family, which together make up HadCM3@Bristol version 1.0. In order to differentiate variants that have undergone development at BRIDGE, we have introduced the letter B into the model nomenclature. We include descriptions of the atmosphere-only model (HadAM3B, the coupled model with a low-resolution ocean (HadCM3BL, the high-resolution atmosphere-only model (HadAM3BH, and the regional model (HadRM3B
Lo Papa, Giuseppe; Novara, Agata; Santoro, Antonino; Gristina, Luciano
2014-05-01
Estimate changes in soil organic carbon (SOC) stock after Agro Environment Measures adoption are strategically for national and regional scale. Uncertainty in estimates also represents a very important parameter in terms of evaluation of the exact costs and agro environment payments to farmers. In this study we modeled the variation of SOC stock after 10-year cover crop adoption in a vine growing area of South-Eastern Sicily. A paired-site approach was chosen to study the difference in SOC stocks. A total 100 paired sites (i.e. two adjacent plots) were chosen and three soil samples (Ap soil horizons, circa 0-30 cm depth) were collected in each plot to obtain a mean value of organic carbon concentration for each plot. The variation of soil organic carbon (SOCv) for each plot was calculated by differences between concentrations of the plot subjected to cover crops (SOC10) and the relative plot subjected to traditional agronomic practices (SOC0). The feasibility of using artificial neural networks as a method to predict soil organic carbon stock variation and the contribution of digital terrain analysis to improve the prediction were tested. We randomly subdivided the experimental values of SOC-stock difference in 80 learning samples and 20 test samples for model validation. SOCv was strongly correlated to the SOC0 concentration. Model validation using only SOCv as unique covariate showed a training and test perfection of 0.724 and 0.871 respectively. We hypothesized that terrain-driven hydrological flow patterns, mass-movement and local micro-climatic factors could be responsible processes contributing for SOC redistributions, thus affecting soil carbon stock in time. Terrain attributes were derived by digital terrain analysis from the 10 m DEM of the study area. A total of 37 terrain attributes were calculated and submitted to statistical feature selection. The Chi-square ranking indicated only 4 significant covariates among the terrain attributes (slope height
Production of ethanol from wet oxidised wheat straw by Thermoanaerobacter mathranii
DEFF Research Database (Denmark)
Ahring, B.K.; Licht, D.; Schmidt, A.S.
1999-01-01
evaluated with respect to total sugars, xylose, and 2-furfural produced. The concentration of sugars tended to be highest in hydrolysates produced at high oxygen pressures, whereas the concentration of 2-furfural was lowest in hydrolysates produced at low oxygen pressures and high carbonate concentrations...... with the commercial enzyme Celluclast(R) or with acid hydrolysis improved the ethanol yield from the hydrolysates. Treatment with Pentopan(TH) Mono BG or Pulpzyme(R) HC, both endo-1,4-beta-xylanases, had no effect neither had co-cultivation with the xylanase-producing Dictyoglomus B4. (C) 1998 Published by Elsevier...
Musa, Musa M.; Phillips, Robert S.; Laivenieks, Maris; Vieille, Claire; Takahashi, Masateru; Hamdan, Samir
2013-01-01
, the high tolerance of TeSADH to organic solvents allows TeSADH-catalyzed racemization to be conducted in media containing up to 50% (v/v) of organic solvents. © 2013 The Royal Society of Chemistry.
Energy Technology Data Exchange (ETDEWEB)
Groth, Katrina M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Zumwalt, Hannah Ruth [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Clark, Andrew Jordan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2016-03-01
Hydrogen Risk Assessment Models (HyRAM) is a prototype software toolkit that integrates data and methods relevant to assessing the safety of hydrogen fueling and storage infrastructure. The HyRAM toolkit integrates deterministic and probabilistic models for quantifying accident scenarios, predicting physical effects, and characterizing the impact of hydrogen hazards, including thermal effects from jet fires and thermal pressure effects from deflagration. HyRAM version 1.0 incorporates generic probabilities for equipment failures for nine types of components, and probabilistic models for the impact of heat flux on humans and structures, with computationally and experimentally validated models of various aspects of gaseous hydrogen release and flame physics. This document provides an example of how to use HyRAM to conduct analysis of a fueling facility. This document will guide users through the software and how to enter and edit certain inputs that are specific to the user-defined facility. Description of the methodology and models contained in HyRAM is provided in [1]. This User’s Guide is intended to capture the main features of HyRAM version 1.0 (any HyRAM version numbered as 1.0.X.XXX). This user guide was created with HyRAM 1.0.1.798. Due to ongoing software development activities, newer versions of HyRAM may have differences from this guide.
A model of vulcanian explosions
International Nuclear Information System (INIS)
Woods, A.W.
1995-01-01
We present a model of the initial stages of the explosive eruption of magma from a volcanic conduit as occurs in Vulcanian style eruptions. We assume there is a volatile rich (1-10 wt%) mixture of magma, vaporised groundwater and exsolved volatiles, trapped at high pressure (1-100 atm) just below a plug in a volcanic conduit. If the plug disrupts, there is an explosive eruption in which a rarefaction wave propagates into the conduit allowing the volatile rich mixture to expand and discharge into the atmosphere ahead of the vent. Typically, the explosions are so rapid that coarse grained ejecta (>0.5 mm) do not remain in thermal equilibrium with the gas, and this leads to significantly lower velocities and temperatures than predicted by an equilibrium model. Material may erupt from the vent at speeds of 100-400 m s -1 with an initial mass flux of order 10 7 -10 9 kg s -1 , consistent with video observations of eruptions and measurements of the ballistic dispersal of large clasts. (orig.)
Bubble column fermenter modeling: a comparison for pressure effects
Energy Technology Data Exchange (ETDEWEB)
Shioya, S; Dang, N D.P.; Dunn, I J
1978-01-01
Two models which describe the oxygen transfer, oxygen uptake, and axial mixing in a bubble column fermenter are described. Model I includes no pressure effects and can be solved analytically. Model II incorporates the influence of hydrostatic pressure on oxygen solubility and gas expansion and must be solved numerically. The liquid phase oxygen concentration profiles from both models are compared to ascertain for what parametric conditions and for what maximum column height Model I is valid. Results show that for many situations Model I can approximate the oxygen profiles in a 10 m column within 20%. As the transfer and uptake rates increase, the deviation of Model I can reach 80% for a 10 m column. 7 figures.
Neutrino masses in the SO(10) model with intermediate stage of the symmetry breaking
International Nuclear Information System (INIS)
Svetovoj, V.B.
1982-01-01
An effect for the neutrino masses of an intermediate stage in the symmetry spontaneous breaking, different from SU(5), is investigated in some detail for the SO(1O) model. There are two possibilities depending on the composition of the Higgs sector: i) msub(ν) approximately msub(f)(Msub(W)/Msub(1)); ii) msub(ν) approximately msub(f)sub(b)/Msub(1))(M/Msub(1)), where M, M 1 and Msub) are the scales of the breaking of the original SO(10) simmetry, the intermediate symmetry, and the standard SUsub(c)(3)xSUsub(L)(2)xU(1) symmetry, respectively, and msub(f) is a typical fermion mass. It as shown that a Majorana mass of the right neutrino (νsub(R)) of a purely loop origin would result in a too large mass of the usual neutrinos, so a tree-graph contribution to the mass of νsub(R) is necessary. Numerical estimates for the neutrino masses are discussed [ru
Modeling and Performance Analysis of 10 Gbps Inter-satellite Optical Wireless Communication Link
Singh, Mehtab
2017-12-01
Free-space optical (FSO) communication has the advantages of two of the most predominant data transmission technologies - optical fiber communication and wireless communication. Most of the technical aspects of FSO are similar to that of optical fiber communication, with major difference in the information signal propagation medium which is free space in case of FSO rather than silica glass in optical fiber communication. One of the most important applications of FSO is inter-satellite optical wireless communication (IsOWC) links which will be deployed in the future in space. The IsOWC links have many advantages over the previously existing microwave satellite communication technologies such as higher bandwidth, lower power consumption, low cost of implementation, light size, and weight. In this paper, modeling and performance analysis of a 10-Gbps inter-satellite communication link with two satellites separated at a distance of 1,200 km has been done using OPTISYSTEM simulation software. Performance has been analyzed on the basis of quality factor, signal to noise ratio (SNR), and total power of the received signal.
Directory of Open Access Journals (Sweden)
Mehmet Küçükoğlu
2013-06-01
Full Text Available Abstract: In this paper, the experimental data on elastic scattering of the 16O+16O reaction for the energy range 5-10 MeV/nucleon have been analyzed within the optical model (OM formalism by using the phenomenological potential forms in Fresco code. When developing the shape of the nuclear potential for the calculations, we have used the Woods-Saxon (WS or Woods-Saxon squared (WS2 potentials for the imaginary part together with a WS2 type real part. Although most of the previous OM analyses using phenomenological potentials have provided reasonably good fits with the experimental measurements, none of them could completely relate the behavior of the imaginary potential to the energy of the projectile yet. However, we have managed to introduce two analyses that can keep the real potential parameters almost constant and suggest a linear expression for the depth of the imaginary part of the nuclear potential depending on the incidence energy. Thus, 16O+16O system within this wide energy range has been described globally by the optical potentials having a deep, attractive real potential part and a weaker, energy dependent absorptive imaginary potential part. It has been also shown that, our calculations with these potential forms can reproduce the experimental elastic scattering angular distributions successfully and the maxima and minima are predicted correctly for most of the energies. Key words: 16O+16O reaction, optical model, elastic scattering, cross-section, phenomenological potentials. 5-10MeV/nükleon Bölgesinde 16O+16O Esnek Saçılmasının Analizi için Global bir Optik Model Yaklaşımının Tanıtılması Özet: Bu çalışmada 5-10 MeV/nükleon enerji aralığında 16O+16O reaksiyonunun deneysel esnek saçılma verileri, optik model (OM formalizmi altında, Fresco kodunda fenomenolojik potansiyel formları kullanılarak analiz edilmektedir. Hesaplamalar için nükleer potansiyelin şekli oluşturulurken gerçel kısım için Woods
Santos, Léonard; Thirel, Guillaume; Perrin, Charles
2018-04-01
In many conceptual rainfall-runoff models, the water balance differential equations are not explicitly formulated. These differential equations are solved sequentially by splitting the equations into terms that can be solved analytically with a technique called operator splitting. As a result, only the solutions of the split equations are used to present the different models. This article provides a methodology to make the governing water balance equations of a bucket-type rainfall-runoff model explicit and to solve them continuously. This is done by setting up a comprehensive state-space representation of the model. By representing it in this way, the operator splitting, which makes the structural analysis of the model more complex, could be removed. In this state-space representation, the lag functions (unit hydrographs), which are frequent in rainfall-runoff models and make the resolution of the representation difficult, are first replaced by a so-called Nash cascade and then solved with a robust numerical integration technique. To illustrate this methodology, the GR4J model is taken as an example. The substitution of the unit hydrographs with a Nash cascade, even if it modifies the model behaviour when solved using operator splitting, does not modify it when the state-space representation is solved using an implicit integration technique. Indeed, the flow time series simulated by the new representation of the model are very similar to those simulated by the classic model. The use of a robust numerical technique that approximates a continuous-time model also improves the lag parameter consistency across time steps and provides a more time-consistent model with time-independent parameters.
CXCL10/IP10 is a novel potential in vitro marker of TB infection
Directory of Open Access Journals (Sweden)
Ilaria Sauzullo
2009-06-01
Full Text Available Introduction IFN-γ is a pivotal cytokine in the immune response to Myc. tuberculosis, infact this is the key cytokine produced in response to antigens specific following tuberculosis exposure causing either active or latent tuberculosis (TB and this observation forms the basis of interferon gamma release assay (IGRA, but there are alternative or additional cytokines and chemokines that could be used to improve detection of Myc. tuberculosis infection.The aim of this study was to evaluate the diagnostic utility of chemokine CXCL10/IP-10 as biomarker of active TB and to compare the results with classical QuantiFERON-Gold assay . Methods CXCL10/IP-10 and IFN-γ responses to stimulation with ESAT-6 and CFP-10 were evaluated in 21 patients with active tuberculosis and in 6 healthy unexposed subjects with no history of TB or TB contact were used as controls healthy controls. QuantiFERON-TB Gold (QFT-G, Cellestis was used for the measurement of IFN-γ levels; CXCL10/IP-10 was detected by ELISA (R&D Systems . Results Of the 21 TB patients included, 11 had a QFT-G positive and 10 had negative QFT-G results.All QFT-G positive patients had increased levels of CXCL10/IP-10 (median, pg/ml in both ESAT-6 and CFP-10 stimulated samples patients compared to healthy controls (1807 and 1111 vs 251 and 188 of controls, respectively (p<0.001 for both. The patients with active TB and QFT-G negative exhibited higher concentrations of CXCL10/IP-10 following antigen stimulation (837 pg/ml for ESAT-6;1674 pg/ml for CFP-10 (p<0.001. Conclusion Our study showed that in all patients with active TB, the CXCL10/IP-10 is expressed in higher amounts than IFN-γ following Myc. tuberculosis antigen-specific stimulation, and CXCL10/IP-10 appeared to be even more sensitive than QuantiFERON TB-Gold in TB patients with negative IFN-γ response. The measurement of chemokine CXCL10/IP-10, although not specific for tuberculosis, may have potential as an alternative or additional marker
ModelArchiver—A program for facilitating the creation of groundwater model archives
Winston, Richard B.
2018-03-01
ModelArchiver is a program designed to facilitate the creation of groundwater model archives that meet the requirements of the U.S. Geological Survey (USGS) policy (Office of Groundwater Technical Memorandum 2016.02, https://water.usgs.gov/admin/memo/GW/gw2016.02.pdf, https://water.usgs.gov/ogw/policy/gw-model/). ModelArchiver version 1.0 leads the user step-by-step through the process of creating a USGS groundwater model archive. The user specifies the contents of each of the subdirectories within the archive and provides descriptions of the archive contents. Descriptions of some files can be specified automatically using file extensions. Descriptions also can be specified individually. Those descriptions are added to a readme.txt file provided by the user. ModelArchiver moves the content of the archive to the archive folder and compresses some folders into .zip files.As part of the archive, the modeler must create a metadata file describing the archive. The program has a built-in metadata editor and provides links to websites that can aid in creation of the metadata. The built-in metadata editor is also available as a stand-alone program named FgdcMetaEditor version 1.0, which also is described in this report. ModelArchiver updates the metadata file provided by the user with descriptions of the files in the archive. An optional archive list file generated automatically by ModelMuse can streamline the creation of archives by identifying input files, output files, model programs, and ancillary files for inclusion in the archive.
Romero-Moya, Damià; Santos-Ocaña, Carlos; Castaño, Julio; Garrabou, Gloria; Rodríguez-Gómez, José A; Ruiz-Bonilla, Vanesa; Bueno, Clara; González-Rodríguez, Patricia; Giorgetti, Alessandra; Perdiguero, Eusebio; Prieto, Cristina; Moren-Nuñez, Constanza; Fernández-Ayala, Daniel J; Victoria Cascajo, Maria; Velasco, Iván; Canals, Josep Maria; Montero, Raquel; Yubero, Delia; Jou, Cristina; López-Barneo, José; Cardellach, Francesc; Muñoz-Cánoves, Pura; Artuch, Rafael; Navas, Plácido; Menendez, Pablo
2017-07-01
Coenzyme Q 10 (CoQ 10 ) plays a crucial role in mitochondria as an electron carrier within the mitochondrial respiratory chain (MRC) and is an essential antioxidant. Mutations in genes responsible for CoQ 10 biosynthesis (COQ genes) cause primary CoQ 10 deficiency, a rare and heterogeneous mitochondrial disorder with no clear genotype-phenotype association, mainly affecting tissues with high-energy demand including brain and skeletal muscle (SkM). Here, we report a four-year-old girl diagnosed with minor mental retardation and lethal rhabdomyolysis harboring a heterozygous mutation (c.483G > C (E161D)) in COQ4. The patient's fibroblasts showed a decrease in [CoQ 10 ], CoQ 10 biosynthesis, MRC activity affecting complexes I/II + III, and respiration defects. Bona fide induced pluripotent stem cell (iPSCs) lines carrying the COQ4 mutation (CQ4-iPSCs) were generated, characterized and genetically edited using the CRISPR-Cas9 system (CQ4 ed -iPSCs). Extensive differentiation and metabolic assays of control-iPSCs, CQ4-iPSCs and CQ4 ed -iPSCs demonstrated a genotype association, reproducing the disease phenotype. The COQ4 mutation in iPSC was associated with CoQ 10 deficiency, metabolic dysfunction, and respiration defects. iPSC differentiation into SkM was comprom