Directory of Open Access Journals (Sweden)
Rubens Ribeiro da Silva
2007-01-01
Full Text Available O presente estudo foi conduzido com o objetivo de avaliar o comportamento inicial de plântulas de Theobroma grandiflorum (Willd. ex Spreng. Schum. (cupuaçu, em função de diferentes níveis de sombreamento. Ao final de 50 dias, após a emergência, as plântulas de cupuaçu foram submetidas a três níveis de sombreamento, sendo: 0% de sombreamento, 50% de sombreamento e Sombra Natural. O crescimento das mudas foi conduzido em delineamento de blocos casualizados, com 15 repetições, sendo cada planta considerada como uma repetição. Foram avaliados a altura, o diâmetro e o número de folhas aos 60, 82, 103, 124, 145 dias após a emergência das plântulas. A Massa Seca de Folhas (MSF, Massa Seca do Caule (MSC, Massa Seca da Raiz (MSR e Massa Seca Total (MST, Relação parte aérea/raiz (PA/R e relação Altura da planta/Diâmetro do colo (A/D, foram avaliadas no final do experimento. O crescimento inicial de Theobroma grandiflorum foi corroborado com os padrões da espécie, que ocorre no interior das matas primárias, tendo melhor desenvolvimento dos parâmetros avaliados em condições de 50% de sombreamento. A condição de 50% de sombreamento pode ser recomendada para a formação de mudas de Theobroma grandiflorum, devido o seu melhor desempenho em altura, diâmetro, número de folhas e alocação de massa nas partes da planta.The objective of this work was to evaluate the initial growth of sapling of Theobroma grandiflorum (cupuaçú, in function of different levels of solar radiation. Fifty days, after the emergency, the saplings were submitted to three levels of shade, being: 0%, 50% and natural shade. Sapling development was carried out in randomized block design with 15 repetitions (15 saplings. The sapling height, lap diameter and the numbers of leaves being evaluated on the 60st, 82nd, 103rd, 124th, 145 days after sapling emergence. The Dry Mass of the leaves (DML, Dry Mass of the stem (DMS, Dry Mass of the root (DMR and Dry
Lima, Milena Campelo Freitas de
2013-01-01
Theobroma grandiflorum ? uma esp?cie nativa da Amaz?nia com elevado potencial econ?mico, que pertence ao mesmo g?nero que o cacau (Theobroma cacao). Seu fruto, conhecido como cupua?u, ? o maior no g?nero Theobroma, chegando a atingir at? 4 kg em massa. A base econ?mica dessa esp?cie concentra-se no mesocarpo (polpa), bastante conhecido e comercializado para a produ??o de sucos, n?ctares, sorvetes entre outros. No processo de obten??o da polpa do cupua?u s?o gerados subprodutos que corresponde...
Directory of Open Access Journals (Sweden)
Alves Rafael M.
2003-01-01
Full Text Available The aim of this research was to study the mating system of a natural population of Theobroma grandiflorum (cupuassu from Nova Ipixuna, Pará state, using microsatellite markers. Eight polymorphic microsatellite loci were analyzed in eight families, each represented by 10 six-month old seedlings derived from open-pollinated pods. The estimation for the multilocus outcrossing rate (m = 1.0 and individual outcrossing rate ( = 1.0 for this population suggests that T. grandiflorum may be a perfect outbreeding (allogamous species. Likewise, for the studied population the estimate for single locus outcrossing rate (S was elevated (0.946, but lower than m, confirming the likely outcrossing character of the species and suggesting the occurrence of 5.4% biparental inbreeding rate (m - S. The estimation of genetic divergence (st between allelic frequencies in ovules and pollen revealed a deviation from random mating in 75% of the evaluated loci. Likewise, the estimate of correlation of paternity (P = 0.930 and the mean coefficient of co-ancestrality within families (XY = 0.501 indicated that the outcrossings were predominantly correlated, and the offspring were full-sibs. These results suggested that for this particular population of T. grandiflorum, the sampling strategy for genetic conservation and breeding should adopt specific models for families derived from correlated outcrossing (full-sibs and not the ones usually adopted in classic outcrossing species breeding programs (half-sibs.
Directory of Open Access Journals (Sweden)
Lucas Ferraz Dos Santos
Full Text Available Cupuassu (Theobroma grandiflorum [Willd. ex Spreng.] Schum is a species of high economic importance in Brazil with great potential at international level due to the multiple uses of both its seeds and pulp in the industry of sweets and cosmetics. For this reason, the cupuassu breeding program focused on the selection of genotypes with high pulp and seed quality-selection associated with the understanding of the mechanisms involved in fruit formation. Gene expression is one of the most used approaches related to such understanding. In this sense, quantitative real-time PCR (qPCR is a powerful tool, since it rapidly and reliably quantifies gene expression levels across different experimental conditions. The analysis by qPCR and the correct interpretation of data depend on signal normalization using reference genes, i.e. genes presenting a uniform pattern of expression in the analyzed samples. Here, we selected and analyzed the expression of five genes from cupuassu (ACP, ACT, GAPDH, MDH, TUB to be used as candidates for reference genes on pulp and seed of young, maturing and mature cupuassu fruits. The evaluation of the gene expression stability was obtained using the NormFinder, geNorm and BestKeeper programs. In general, our results indicated that the GAPDH and MDH genes constituted the best combination as reference genes to analyze the expression of cupuassu samples. To our knowledge, this is the first report of reference gene definition in cupuassu, and these results will support subsequent analysis related to gene expression studies in cupuassu plants subjected to different biotic or abiotic conditions as well as serve as a tool for diversity analysis based on pulp and seed quality.
Inhibition of Acetylcholinesterase and Fatty Acid Composition in Theobroma grandiflorum Seeds
Directory of Open Access Journals (Sweden)
Casandra Valentina Itriago
2017-07-01
Full Text Available Theobroma grandiflorum is an important fruit tree from Sterculiaceae family, native to the Brazilian Amazon, known in the region as cupuaçu. The seeds have a high fat content (24% with characteristics that resemble those of cocoa (Theobroma cacao butter with potential applications in the cosmetic, pharmaceutical and food industries. The main objective of this work was to explore the seed fats from T. grandiflorum that were analyzed for fatty acid composition by Gas Chromatography with Flame Ionization Detector (GC-FID and to analyze their activity for acetylcholinesterase inhibition. Chromatographic analysis provided detection of nine fatty acids. The major fatty acids found in the species were oleic (40.0%, stearic (32.7%, arachidic (10.4% and palmitic (8.0%. The acetylcholinesterase inhibition by fats from seeds was over 40.48%. DOI: http://dx.doi.org/10.17807/orbital.v0i0.894
Directory of Open Access Journals (Sweden)
Giorgini Augusto Venturieri
2011-03-01
Full Text Available Cupuassu (Theobroma grandiflorum, a specie native to Amazonia, has been planted commercially in Brazil to satisfy the demand for the flavorful juice obtained from the pulp around its seeds. The trees are notorious for low and irregular fruit production. Data gathered over two seasons from trees in a germplasm collection in Pará, Brazil, showed that some of them fruited more regularly than others. Differences in fruit production correlated to differences in flower production. Tree-to-tree variation in flower production, fruit production, and consistency of both over time suggest considerable scope for improving yields by selection. Hand pollinations resulted in a much higher frequency of fruit set than open pollinations, indicating that lack of effective pollination is also a reason for low yield. However, attempts to increase the level of effective pollination are handicapped by low knowledge about the pollinators of cupuassu and their behavior.Cupuaçu (Theobroma grandiflorum é uma espécie nativa da Amazônia que vem sendo plantada comercialmente no Brasil para satisfazer a demanda pelo seu suco, de sabor marcante, obtido da polpa que envolve as suas sementes. As árvores não notórias pela sua baixa e irregular produtividade. Dados obtidos de dois períodos produtivos, de árvores de uma coleção de germoplasma no estado do Pará, Brasil, mostraram que algumas delas frutificam mais irregularmente que outras. Diferenças na produção de frutos foram correlacionadas à diferenças na produção de flores. Variações entre plantas nas produções de flores e de frutos, e a repetibilidade de ambos ao longo do tempo sugerem melhoria das colheitas por seleção. Polinizações manuais resultaram em aumento no pegamento dos frutos, indicando que a falta de polinizador efetivo é também um causa da produtividade baixa. Entretanto, tentativas para aumentar o nível de polinização efetiva são dificultadas pelo pouco conhecimento sobre os
da Costa, Russany Silva; Teixeira, Camilo Barroso; Gabbay Alves, Taís Vanessa; Ribeiro-Costa, Roseane M; Casazza, Alessandro A; Aliakbarian, Bahar; Converti, Attilio; Silva Júnior, José O C; Perego, Patrizia
2018-04-16
Cupuassu (Theobroma grandiflorum Schum.) is a popular Amazonian fruit because of its intense aroma and nutritional value, whose lipid fraction is alternatively used in cosmetics. To preserve active principles and ensure their controlled release, extract was microencapsulated by spray drying. Influence of spray-drying conditions on microencapsulation of cupuassu seed by-product extract was investigated according to a 3 3 -Box Behnken factorial design, selecting inlet temperature, maltodextrin concentration and feed flowrate as independent variables, and total polyphenol and flavonoid contents, antiradical power, yields of drying and microencapsulation as responses. Fitting the results by second-order equations and modelling by Response Surface Methodology allowed predicting optimum conditions. Epicatechin and glycosylated quercetin were the major microencapsulated flavonoids. Microparticles showed satisfactory antiradical power and stability at 5 °C or under simulated gastrointestinal conditions, thus they may be used to formulate new foods or pharmaceuticals.
Molecular characterisation of a germplasm bank for Theobroma genus using the RAPD technique
Directory of Open Access Journals (Sweden)
Yovany Moreno
2004-07-01
Full Text Available RAPD markers (Random Amplified Polymorphic DNA were used for analysing 145 individuals (128 T. grandiflorum and 17 T. bicolor from the ex situ Theobroma genus germplasm bank at Instituto Sinchi, located at San José del Guaviare. 5 primers able to generated polymorphism were selected from an initial set of 20, generating 114 bands that enable to us to distinguish between more than 99% of individuals analysed: 57 bands for T. grandiflorum (84.2% polymorphic, 45 bands for T. bicolor (26.7% polymorphic and 12 bands shared between the two species (58.3% polymorphic. A high degree of intra-specific similarity particularly in T. bicolor was established from the similarity matrix obtained by using the Dice index and represented in a UPGMA dendrogram and the principal components analysis (PCA. The comparison of this analysis with a previous morpho-agronomic evaluation of some T. grandiflorum individuals revealed that the groups generated on the basis of its agronomic and morphological traits were heterogeneous at molecular level. The obtained information will be used as a tool in strategies regarding maintenance, enrichment and use of the germplasm bank. Key words: Theobroma grandiflorum, Theobroma bicolour, RAPD, molecular characterisation.
Directory of Open Access Journals (Sweden)
Quintero Lorena
2004-12-01
Full Text Available Mediante la utilización de marcadores RAPD (Random Amplified Polymorphic DNA, se analizaron 145 materiales (128 de T. grandiflorum y 17 de T. bicolor pertenecientes al banco de germoplasma ex situ del género Theobroma del Instituto Sinchi, localizado en San José del Guaviare. A partir de un número inicial de 20, se seleccionaron los 5 cebadores capaces de generar mayor número de polimorfismos para generar 114 bandas que lograron distinguir entre más del 99% de los materiales analizados: 57 bandas para T. grandiflorum (84,2% polimórficas, 45 bandas para T. bicolor (26,7% polimórficas y 12 bandas compartidas entre las dos especies (58,3% polimórficas. A partir de la matriz de semejanza generada utilizando el índice de Dice, representada en un dendrograma UPGMA, y el análisis de componentes principales, se determinó un alto grado de semejanza intraespecífica en los materiales analizados, particularmente en T. bicolor. Luego de comparar este análisis con el morfoagronómico previamente realizado en algunos materiales de T. grandiflorum, se encontró que los grupos generados por dicha evaluación morfológica y agronómica son heterogéneos a nivel molecular. La información obtenida se utilizará como herramienta para la toma de decisiones en cuanto a las estrategias de mantenimiento, enriquecimiento y uso del banco. Palabras clave: Theobroma grandiflorum, Theobroma bicolor, RAPD, caracterización molecular.RAPD markers (Random Amplified Polymorphic DNA were used for analysing 145 individuals (128 T. grandiflorum and 17 T. bicolor from the ex situ Theobroma genus germplasm bank at Instituto Sinchi, located at San José del Guaviare. 5 primers able to generated polymorphism were selected from an initial set of 20, generating 114 bands that enable to us to distinguish between more than 99% of individuals analysed: 57 bands for T. grandiflorum (84.2% polymorphic, 45 bands for T. bicolor (26.7% polymorphic and 12 bands shared between
Directory of Open Access Journals (Sweden)
MARIA TERESA DE ALVARENGA FREIRE
2016-01-01
Full Text Available Cupuaçu ( Theobroma grandiflorum Schum. is an exotic fruit with a promising economic potential, particularly due to its strong aroma and creamy texture. This study aimed to produce sweetened cupuaçu puree and evaluate the effects of packaging corrosion on its sensory properties and shelf - life in tinplated cans. After 240 days of storage, the commercially sterile product had average sensory analysis scores of 5.89 ± 0.21, 5.39 ± 0.30, 5.45 ± 0.21 and 5.49 ± 0.25, for appearance, aroma, flavor and overall appreciation, respectively. Sensory acceptance scores did not change during storage (p>0.05. Corrosion potential and low tin and iron levels in the product, which are parameters used to evaluate food - packaging interaction, demonstrated the product remained food - safe throughout its shelf - life. Tinplate is a promising packaging material for sweetened cupuaçu puree due to its mechanical and protective properties. Furthermore, tin plating is an economically viable food technology to extend the shelf - life of cupuaçu products and expand its domestic and international markets.
International Nuclear Information System (INIS)
Vriesmann, Lucia C.; Silveira, Joana L.M.; Petkowicz, Carmen L. de O
2009-01-01
The pulp obtained from the fruit of cupuassu (Theobroma grandiflorum) was extracted with hot aqueous 0.1% citric acid to give fraction 0.1CA-2 in 15% yield. This was the predominant component polysaccharide, 91% of which was composed of starch, by an iodine test and monosaccharide composition, and its 13 C NMR spectrum was consistent with that of a high amylose starch. The content of amylose found in fraction 0.1CA-2 was 71%. This value is higher than those of common starches of cereal grains, tubers, roots, and other fruits. The fraction was submitted to rheological examination, gels being prepared on heating with concentrations of 4 to 7% (w/w). A non-Newtonian behavior was observed, and gel viscosity and strength depended on the concentration. The presence of starch, as well as the presence of previously investigated pectin, conferred the high viscosity and gelling capability of the pulp
Energy Technology Data Exchange (ETDEWEB)
Vriesmann, Lucia C.; Silveira, Joana L.M. [Universidade Federal do Parana, Departamento de Bioquimica e Biologia Molecular, CP 19046, CEP 81531-990, Curitiba-PR (Brazil); Petkowicz, Carmen L. de O [Universidade Federal do Parana, Departamento de Bioquimica e Biologia Molecular, CP 19046, CEP 81531-990, Curitiba-PR (Brazil)], E-mail: clop@ufpr.br
2009-03-01
The pulp obtained from the fruit of cupuassu (Theobroma grandiflorum) was extracted with hot aqueous 0.1% citric acid to give fraction 0.1CA-2 in 15% yield. This was the predominant component polysaccharide, 91% of which was composed of starch, by an iodine test and monosaccharide composition, and its {sup 13}C NMR spectrum was consistent with that of a high amylose starch. The content of amylose found in fraction 0.1CA-2 was 71%. This value is higher than those of common starches of cereal grains, tubers, roots, and other fruits. The fraction was submitted to rheological examination, gels being prepared on heating with concentrations of 4 to 7% (w/w). A non-Newtonian behavior was observed, and gel viscosity and strength depended on the concentration. The presence of starch, as well as the presence of previously investigated pectin, conferred the high viscosity and gelling capability of the pulp.
Reacción a Moniliophthora roreri en Theobroma spp. en Caquetá, Colombia
Directory of Open Access Journals (Sweden)
Armando Sterling Cuéllar
2015-09-01
Full Text Available El objetivo de este estudio fue evaluar in situ la reacción de 50 materiales genéticos de tres especies de Theobroma(T. cacao, T. grandiflorum y T. bicolor a la inoculación controlada de tres aislados autóctonos de Moniliophthora roreri (agente causal de la moniliasis del cacao en el Departamento de Caquetá (Amazonia colombiana. Las variables incidencia de la enfermedad (IMr, severidad externa (SE y severidad interna (SI, se evaluaron nueve semanas después de la inoculación de mazorcas de 2 a 3 meses de edad con una suspensión de esporas de 1,2 x 105 esporas/mL. La enfermedad se evidenció en las tres especies de Theobroma, sin embargo, ésta no se presentó en 13 de los 50 materiales genéticos evaluados, representados así: seis T. grandiflorum, cinco T. bicolor y dos T. cacao. Los materiales genéticos de T. bicolor y T. grandiflorum fueron los menos afectados comparados con los de T. cacao. Se encontraron diferencias significativas para IMr, SE y SI entre las tres especies de Theobroma y entre los 50 materiales genéticos. Diferencias significativas entre los aislados solo ocurrieron para SE. La incidencia y la severidad de la enfermedad entre materiales genéticos, fueron influenciadas por el patógeno aislado. Los materiales genéticos con menor reacción a M. roreri pueden ser utilizados en programas de mejoramiento por resistencia a la moniliasis.
Stability of cupuaçu (Theobroma grandiflorum nectar during storage
Directory of Open Access Journals (Sweden)
Margarida Cortez Vieira
2014-10-01
Full Text Available A shelf-life study on cupuaçu nectar (Theobroma grandiflorum was carried out in two parts. Part I studied the microbial stability of the regular nectar (batch R and the same nectar fortified with synthetic ascorbic acid (AA (batch F, pasteurized at 90 °C for 3 min and hot filled in glass bottles. Total Plate Count (TPC, yeast and molds as well as pH, total soluble solids (TTS, titratable acidity and hidroxymethylfurfural (HMF were followed along 43 storage days at 4, 25 and 35 °C. At the end of the storage period neither TPC nor molds or yeast had recovered the initial loads observed before pasteurization, for both R and F batches. Right after pasteurization, acidity increased slightly, pH decreased from 3.52 to 3.3, and TSS increased from 18.7 to 19.0 °Brix, with all stabilizing afterwards.Part II evaluated ascorbic (AA and dehydroascorbic (DHAA acids’ stabilization in the two batches, R and F, and dissolved oxygen (DO was monitored. Both batches were stored at the same temperatures as in Part I for two months. For batch R, the AA degradation results followed a reversible first order reaction (EaAA(R=-34±6 kJ/mol, kAA(R25°C=0.006±0.003 days-1, C0AA(R=0.92±0.01 and C∞AA(R= 0.43±0.19. For the (F nectar, the experimental data fitted a first order model well (EaAA(F=30±17 kJ/mol, kAA(F25°C =0.0016±0.0004 days-1. DO was modeled as a fractional conversion model (EaDO= 67±17 kJ/mol, kDO25°C= 1.94±0.94 days-1, C0DO=0.97±0.03 and C∞DO= 0.55±0.01. For both nectars, storage at environmental temperatures was preferred (AA retention above 80% to refrigeration, due to the slower rate of diffusion of DO at lower temperatures.
Ornellas, Roberta Maria Santos; Santos, Tiza Teles; Arcucio, Leonardo Borges; Sandes, Sávio Henrique Cicco; Oliveira, Mayara Messias; Dias, Cristiano Villela; de Carvalho Silva, Samuel; Uetanabaro, Ana Paula Trovatti; Vinderola, Gabriel; Nicoli, Jacques Robert
2017-01-01
In the present study, nine lactic acid bacteria isolated from the fermentation process of "cupuaçu" (Theobroma grandiflorum) were selected for probiotic use. In vitro (resistance to gastrointestinal environment, in vitro antagonism and co-aggregation with pathogens) and in vivo (intestinal colonization and ex vivo antagonism in germ-free mice, cumulative mortality, translocation to liver and spleen, histopathological examination of liver and ileum and mRNA cytokine gene expression during an experimental infection with S. Typhimurium) assays were used. Among the nine Lactobacillus strains isolated from the "cupuaçu" fermentation, L. plantarum 81 and L. plantarum 90 were selected as potential probiotics based on better results obtained in in vitro evaluations (production of diffusible inhibitory compounds and co-aggregation) as well as in vivo experiments (resistance to gastrointestinal environment, ex vivo antagonism, higher survival after enteropathogen challenge, lower hepatic translocation of enteropathogen, lower histopathological lesions in ileum and liver and anti-inflammatory pattern of immunological response). Concluding, L. plantarum 81 and L. plantarum 90 showed in vitro and in vivo capacities for probiotic use through different mechanisms of protection and its origin would allow an easier adaptation in an alimentary matrix for its administration.
Directory of Open Access Journals (Sweden)
Marcela Vicente Vieira Andrade Gonçalves
2013-12-01
Full Text Available Cupuaçu, uma das principais e mais consumidas frutas da região amazônica brasileira, pertence à família Sterculiacea, cuja denominação binomial é Theobroma grandiflorum schum. É uma fruta típica da Amazônia, sendo cultivada nos estados do Pará, Maranhão e Tocantins. Esta fruta apresenta crescente utilização no Brasil para o mercado interno e externo, sendo comumente comercializada como polpa congelada. Apesar de sua importância, há poucos dados de caracterização e contaminação da polpa de cupuaçu. Amostras de polpa de cupuaçu foram avaliadas quanto à viscosidade aparente, tensão de cisalhamento, umidade, cinzas, nitrogênio total, extrato etéreo, acidez, sólidos solúveis e pH. Os resultados demonstram a necessidade de aprimorar as boas práticas agrícolas e de fabricação e implantação de sistemas de controle de qualidade para minimização dos riscos associados à contaminação por micro-organismos.
BRINE SHRIMP LETHALITY BIOASSAY OF GLAUCIUM GRANDIFLORUM VAR. GRANDIFLORUM
A. SARI, Ç. ÜNSAL, İ. SARIOĞLU, A. SARI, Ç. ÜNSAL, İ. SARIOĞLU
2013-01-01
Türkiye'nin 3 farklı bölgesinden toplanan Glaucium grandiflorum Boiss. et Huet var. grandiflorum örneklerinin toprak üstü kısımlarından elde edilen alkaloit ekstreleri ve bu ekstrelerden elde edilen majör alkaloitler allokriptopin, protopİn, (+)-izokoridin, (+)-korİdin üzerinde brİne shrimp lethality testi yapılarak sitotoksisiteleri İncelenmiştir. Glaucium grandiflorum var. grandiflorum türünün 3 örneği de önemli oranda sitotoksik aktİvite göstermiştir. Allokriptopin, protopin, (+)-izok...
Directory of Open Access Journals (Sweden)
Maria das Graças Rodrigues Ferreira
2009-10-01
Full Text Available Entre as fruteiras amazônicas, destaca-se o cupuaçuzeiro, espécie de recente domesticação que vêm sendo valorizada por suas características de sabor e aroma. Um dos fatores determinantes para produção de mudas é a recomendação do substrato mais apropriado e, para espécies nativas, esta informação ainda é escassa. O objetivo deste trabalho foi avaliar o efeito de diferentes substratos na velocidade de germinação das sementes e no crescimento das mudas decupuaçu. O trabalho foi realizado em casa-de-vegetação, sendo testados sete substratos: terra vegetal + areia (1:1, terra vegetal, bioplant®, bioclone®, plugmix®, areia e vermiculita. Foram avaliadas as características: índice de velocidade de emergência (IVE, comprimento da raiz (CR, comprimento da parte aérea (CPA, biomassa seca da raiz (BSR e biomassa seca da parte aérea (BSPA, em delineamento experimental inteiramente casualizado com sete tratamentos, com quatro repetições de 15 sementes. As médias dos efeitos de substrato foram agrupadas pelo teste de Scott-Knott e a recomendação dos substratos foi realizada com o auxílio da técnicamultivariada de variáveis canônicas. O substrato bioclone® se destacou na maioria das características de germinação e qualidade das mudas avaliadas.The cupuassu (Theobroma grandiflorum stands out as an important recently domesticated Amazon fruit. Although the substrate is a prime factor for plantlet development, there are few recommendations for cupuassu plantlet production. The objective of this work was to evaluate the influence of different substrates on cupuassu germination and seedling growth. Seven substrates were tested in greenhouse conditions: vegetable soil + sand (1:1, vegetable soil, bioplant®, bioclone®, plugmix®, sand and vermiculite. The following germination and seedling traits were evaluated: germination speedindex, length and dry mass of roots and aerial parts; using a completely randomized design
Directory of Open Access Journals (Sweden)
Rafael Moysés Alves
2010-03-01
Full Text Available Este trabalho teve por objetivo a seleção entre e dentro de progênies de irmãos completos de cupuaçuzeiro. Foram avaliadas 21 progênies de irmãos completos, em dois experimentos, com cinco plantas por parcela. Os experimentos foram avaliados ao nível de indivíduos, em cada safra, para os caracteres: produção de frutos, polpa e semente, bem como resistência à vassoura-de-bruxa. Para efeito de seleção, também foi considerado o grau de parentesco das matrizes. As análises foram conduzidas via metodologia de modelos lineares mistos, como delineamento em blocos incompletos, desbalanceados com tratamentos comuns. Foram estimados os parâmetros genéticos e os valores genotípicos ajustados de progênies, bem como os valores genéticos aditivos e genotípicos individuais. Os resultados demonstraram que as progênies 12; 13; 18; 20; 21 e 24 tiveram os melhores desempenhos para as variáveis de produção. Entre elas, as progênies 12; 13 e 18 foram as que mais se destacaram. Foram selecionadas três matrizes da progênie 18, duas matrizes da progênie 12 e uma matriz de cada uma das progênies 13; 20 e 21. É possível concluir que essas matrizes, juntamente com materiais selecionados em outras áreas experimentais, apresentam potencial para compor um pomar de sementes clonais, estabelecido em lote isolado de outros plantios, onde será produzida uma população melhorada de primeiro ciclo que se constituirá na nova cultivar de cupuaçuzeiro.This paper had as objective the selection among and within full sib families of Theobroma grandiflorum. A total of 21 full sibs progenies were appraised, in two experiments, with five plants for plot. The experiments were appraised at the individuals' level, in each crop, for the traits: production of fruits, pulp and seed and resistance to witch's broom disease. The degree of genetic relationship of the candidates was also considered. The analyses were performed through the methodology of mixed
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2005-09-01
Full Text Available The seasonal dynamics of Arbuscular Mycorrhizal Fungi (AMF was investigated in the rhizosphere of two fruit species in a terra firme (upland ecosystem in Central Amazonia. Two host species (Theobroma grandiflorum and Paullinia cupana and nine sampling months (August, September and December/1998, February, April, May and December/1999, February and May/2000 were studied in a completely randomized design, with five replications, set in a 2 x 9 factorial experiment. Soil (0-20 cm depth and root samples were collected between August 1998 and May 2000. The mean percent colonization of AMF for both species reached maximal values in February and May 2000 (rainy season. In April and May 1999, February and May 2000 (rainy season the highest AMF spore numbers were registered. The pluvial precipitation was significantly positively correlated with AMF number spores for both fruit species, and significant positive correlation only with AMF colonization of P. cupana. Soil moisture content was positively correlated with colonization and spore numbers of AMF for both species evaluated. AMF colonization and AMF spore numbers of T. grandiflorum were positively correlated with soil Mg and K concentrations. AMF spore numbers of T. grandiflorum were also negatively correlated with effective cation exchange capacity (ECEC. AMF colonization and AMF spore numbers in the rhizosphere of P. cupana were positively correlated with pH and Mn concentrations. AMF colonization was also positively correlated with AMF spore numbers for both species evaluated. In conclusion, this study showed that AMF colonization and sporulation are seasonal and dependent on host plant species, pluvial precipitation, soil moisture content and soil chemistry in Central Amazonia conditions.A dinâmica sazonal de fungos micorrízicos arbusculares (FMA foi investigada na rizosfera de duas espécies frutíferas em um ecossistema de terra firme na Amazônia Central. Adotou-se o delineamento
Directory of Open Access Journals (Sweden)
Maria Clideana Cabral Maia
2011-06-01
Full Text Available
The cupuaçuzeiro (Theobroma grandiflorum, species native from the Amazon region, has been domesticated presenting a broad genetic variability, and thus favorable conditions for establishing of strategies to breeding and genetic conservation. The aim of this work was to evaluate 36 half-sib progenies of Theobroma grandiflorum obtained from a stratified mass selection in farmers areas based on primary components of yield. The experiment for selection of elite progenies was set up in a randomized complete block design with three replications and four plants per plot. The fruit traits (length and width, in cm and components of production (average weight of fruit/plant; average weight of pulp with seeds/plant and average weight of pulp/plant, in g were evaluated. The data were analyzed through the methodology of REML/BLUP using the Selegen software. Analysis of grouping was performed using the matrix of genetic euclidean distances and Mahalanobis. The experimental population allowed the selection of superior parents for formation of base population to be used in the genetic improvement of cupuaçu. Among the 36 analyzed lineages only the genotypes 9, 10 and 18 showed genetic divergence and they can be recommended with some lineage of group 1 that demonstrates agronomic superiority to form base population of experimental clones with high genetic dissimilarity.
doi: 10.4336/2011.pfb.31.66.123
O cupuaçuzeiro, espécie nativa da região Amazônica, encontra-se em processo de domesticação, apresentando ampla variabilidade genética e condições favoráveis para o estabelecimento de estratégias de melhoramento e conservação. O objetivo foi avaliar geneticamente 36 progênies de meios-irmãos de cupuaçu oriundos de seleção massal estratificada emDirectory of Open Access Journals (Sweden)
José Pereira da Silva Junior
2006-05-01
Full Text Available O objetivo deste trabalho foi avaliar a colonização micorrízica arbuscular em pupunha (Bactris gasipaes Kunth e cupuaçu (Theobroma grandiflorum (Willd ex Spring K. Schum cultivados em sistema agroflorestal e em monocultivo na Amazônia Central, em duas épocas do ano, e também identificar características anatômicas da formação dessa simbiose nessas espécies. Foram realizadas coletas de solo e raízes em duas estações, seca e chuvosa. A colonização micorrízica arbuscular no cupuaçu e na pupunha é alterada pelo sistema de manejo adotado, com taxas maiores de colonização no monocultivo. A densidade total dos esporos de fungos micorrízicos arbusculares sob o cupuaçu não é alterada pelo sistema de manejo ou pela época do ano, ao contrário do que ocorre sob a pupunha. Nessa cultura, a densidade de esporos foi maior sob sistema agroflorestal no período seco. A colonização micorrízica na pupunha apresenta dois padrões anatômicos, Paris e Arum, enquanto no cupuaçu ocorre o padrão Arum.The objective of this work was to evaluate the arbuscular mycorrhizal colonization in peach palm (Bactris gasipaes Kunth and cupuaçu (Theobroma grandiflorum (Willd ex Spring K. Schum, in agroforestry systems and monoculture in the Central Amazon region, and to identify anatomic characteristics of mycorrhizal colonization in these species. Soil and root samples were collected in the field, in the dry and rainy season. Mycorrhizal root colonization of cupuaçu and peach palm is affected by the management systems, with higher colonization rates in the monoculture system. Total spore density of the arbuscular mycorrhizal fungi under cupuaçu is not affected by management systems or season, but under peach palm this variation is season dependent. Mycorrhizal colonization of Arum and Paris types occur in peach palm, and only Arum type occurs in cupuaçu.
Directory of Open Access Journals (Sweden)
Abraham Damian Giraldo-Zuniga
2010-03-01
Full Text Available En este trabajo fueron obtenidos experimentalmente la cinética del secado de la pulpa de cupuaçu en forma de rodajas con espesor de 0,5 cm. El secado fue realizado utilizándose un secador laboratorial de bandejas, a las temperaturas de 50, 60 y 70 ºC y a la velocidad del aire de secado de 1,5 m/s. De acuerdo con los datos de la cinética del secado se puede observar que cuanto mayor es la temperatura del secado mayor es la velocidad del secado. El tiempo requerido para secar el producto hasta una humedad del 20%, fueron 9,2, 8,1 y 7,3 horas para las temperaturas de secado de 50, 60 y 70 ºC respectivamente. Las curvas experimentales del secado fueron ajustados al modelo difusional de Fick considerándose la muestra como una lámina infinita y al modelo de Page. Los dos modelos se ajustaron bien a los datos experimentales. Los coeficientes de difusión del modelo de Fick variaron de 1.171 a 1.561 m/s².This work examined experimentally the kinetics of drying cupuaçu pulp (Theobroma grandiflorum slices. The experimental runs were driven in a laboratory dryer, at temperatures of 50, 60 and 70 ºC and an air drying velocity of 1.5 m/s. According to the kinetics study, increasing the temperature led to a decrease in drying time. The required drying times were 9.2, 8.1 and 7.3 hours for drying temperatures of 50, 60 and 70 ºC respectively. The experimental drying curves were adjusted to Fick's diffusional model for an infinite lamina with shrinkage and Page model. The diffusion coefficients of the Fick model varied between 1.171 and 1.561 m/s².
Origin and domestication of native Amazonian crops
Clément, R. Charles; De Cristo-Araujo, Michelly; Coppens D'Eeckenbrugge, Géo; Alves Pereira, Allessandro; Picanço-Rodrigues, Doriane
2010-01-01
Molecular analyses are providing new elements to decipher the origin, domestication and dispersal of native Amazonian crops in an expanding archaeological context. Solid molecular data are available for manioc (Manihot esculenta), cacao (Theobroma cacao), pineapple (Ananas comosus), peach palm (Bactris gasipaes) and guaraná (Paullinia cupana), while hot peppers (Capsicum spp.), inga (Inga edulis), Brazil nut (Bertholletia excelsa) and cupuassu (Theobroma grandiflorum) are being studied. Emerg...
Directory of Open Access Journals (Sweden)
Chunhua eMa
2016-05-01
Full Text Available Background: Platycodon grandiflorum is the only species in the genus Platycodon of the family Campanulaceae, which has been traditionally used as a medicinal plant for its lung-heat-clearing, antitussive, and expectorant properties in China, Japanese and Korean. Oleanane-type triterpenoid saponins were the main chemical components of P. grandiflorum and platycodin D was the abundant and main bioactive component, but little is known about their biosynthesis in plants. Hence, P. grandiflorum is an ideal medicinal plant for studying the biosynthesis of Oleanane-type saponins. In addition, the genomic information of this important herbal plant is unavailable.Principal Findings:A total of 58,580,566 clean reads were obtained, which were assembled into 34,053 unigenes, with an average length of 936 bp and N50 of 1,661 bp by analyzing the transcriptome data of P. grandiflorum. Among these 34,053 unigenes, 22,409 unigenes (65.80% were annotated based on the information available from public databases, including Nr, NCBI, Swiss-Prot, KOG and KEGG. Furthermore, 21 candidate cytochrome P450 genes and 17 candidate UDP-glycosyltransferase genes most likely involved in triterpenoid saponins biosynthesis pathway were discovered from the transcriptome sequencing of P. grandiflorum. In addition, 10,626 SSRs were identified based on the transcriptome data, which would provide abundant candidates of molecular markers for genetic diversity and genetic map for this medicinal plant.Conclusion:The genomic data obtained from P. grandiflorum, especially the identification of putative genes involved in triterpenoid saponins biosynthesis pathway, will facilitate our understanding of the biosynthesis of triterpenoid saponins at molecular level.
International Nuclear Information System (INIS)
Pantoja, Samantha Siqueira; Conceição, Leyvison Rafael V. da; Costa, Carlos E.F. da; Zamian, José R.; Rocha Filho, Geraldo N. da
2013-01-01
Highlights: • We obtained biodiesel from açai, cupuaçu, passion fruit and linseed oil. • Determined the properties of biodiesel, such as kinematic viscosity, cold filter plugging point and oxidative stability. • Evaluated the influence of antioxidants on biodiesel. • The PG antioxidant was more efficient than BHA and TBHQ for the açaí biodiesel. - Abstract: In the present paper, methyl esters were obtained from the transesterification of cupuaçu fat lipids (Theobroma grandiflorum) (Willd. ex Spreng.) (K. Schum.), açaí (Euterpe oleracea), passion fruit (Passiflora edulis) and linseed (Linum usitatissimum L.) oils, using a basic catalyst. The triglycerides were characterized by their fatty acid composition, and the biodiesels were characterized according to standard methods. The critical properties, such as the cold filter plugging point, kinematic viscosity and oxidative stability, of the biodiesels were studied. The influence of butyl-hydroxyanisole (BHA), propyl gallate (PG) and tert-butyl hydroquinone (TBHQ) antioxidants on the açaí, passion fruit and linseed biodiesels was evaluated at concentrations from 500 to 4000 ppm. PG was found to be the most efficient antioxidant for the studied biodiesels
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de [Universidade Federal, Rio de Janeiro, RJ (Brazil). Inst. de Quimica]. E-mail: ladetec@iq.gov.br; Cabral, Jose Augusto; Ferreira, Carlos Alberto Cid [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil); Simoneit, Bernd R.T. [Oregon State Univ., Corvallis, OR (United States). College of Oceanic and Atmospheric Sciences. Petroleum and Environmental Geochemistry Group; Elias, Vladimir O. [Analytical Solution, Rio de Janeiro, RJ (Brazil)
2003-10-01
The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ({sup 1}H and {sup 13}C NMR, IR). (author)
Determination of high molecular mass compounds from Amazonian plant's leaves
International Nuclear Information System (INIS)
Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de; Simoneit, Bernd R.T.
2003-01-01
The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ( 1 H and 13 C NMR, IR). (author)
[Preliminary study on the effect of climate factors on pollen fertility in Platycodon grandiflorum].
Shi, Feng-hua; Zhang, Lei; Wei, Jian-he
2011-06-01
To have a better utilization of male sterile lines in heterozygotic breeding of Platycodon grandiflorum and provide theoretical basis for Platycodon grandiflorum hyboridization. The pollen viability was detected by the means of aceto carmine dyeing, and the correlation analysis between climate factors of each anther development stage and pollen viability was estimated by Pearson coefficients. Pollen viability variation range of male-sterile line GP1BC1-12 was 0% - 27%. That of male-sterile line GP12BC4-10 and chifeng germplasm was respectively 1.3% - 17.9% and 75.9% - 98.5%. Further linear regression analysis between climate factors of each anther development stage and pollen viability indicated that the degree of sensitivity varied with different germplasm of Platycodon grandiflorum. Among three germplasm, male sterile line GP12BC4-10 was the most stable one to the climate factors, and the male-sterile line GP1BC1-12 was the most sensitive one. Temperature and solar irradiation are the most important climate factors to affect pollen viability in Platycodon grandflorum, and microspore mother cells stage (MMC) is its sensetive stage.
Ferraz Dos Santos, Lucas; Moreira Fregapani, Roberta; Falcão, Loeni Ludke; Togawa, Roberto Coiti; Costa, Marcos Mota do Carmo; Lopes, Uilson Vanderlei; Peres Gramacho, Karina; Alves, Rafael Moyses; Micheli, Fabienne; Marcellino, Lucilia Helena
2016-01-01
The cupuassu tree (Theobroma grandiflorum) (Willd. ex Spreng.) Schum. is a fruitful species from the Amazon with great economical potential, due to the multiple uses of its fruit´s pulp and seeds in the food and cosmetic industries, including the production of cupulate, an alternative to chocolate. In order to support the cupuassu breeding program and to select plants presenting both pulp/seed quality and fungal disease resistance, SSRs from Next Generation Sequencing ESTs were obtained and used in diversity analysis. From 8,330 ESTs, 1,517 contained one or more SSRs (1,899 SSRs identified). The most abundant motifs identified in the EST-SSRs were hepta- and trinucleotides, and they were found with a minimum and maximum of 2 and 19 repeats, respectively. From the 1,517 ESTs containing SSRs, 70 ESTs were selected based on their functional annotation, focusing on pulp and seed quality, as well as resistance to pathogens. The 70 ESTs selected contained 77 SSRs, and among which, 11 were polymorphic in cupuassu genotypes. These EST-SSRs were able to discriminate the cupuassu genotype in relation to resistance/susceptibility to witches' broom disease, as well as to pulp quality (SST/ATT values). Finally, we showed that these markers were transferable to cacao genotypes, and that genome availability might be used as a predictive tool for polymorphism detection and primer design useful for both Theobroma species. To our knowledge, this is the first report involving EST-SSRs from cupuassu and is also a pioneer in the analysis of marker transferability from cupuassu to cacao. Moreover, these markers might contribute to develop or saturate the cupuassu and cacao genetic maps, respectively.
Directory of Open Access Journals (Sweden)
Lucas Ferraz Dos Santos
Full Text Available The cupuassu tree (Theobroma grandiflorum (Willd. ex Spreng. Schum. is a fruitful species from the Amazon with great economical potential, due to the multiple uses of its fruit´s pulp and seeds in the food and cosmetic industries, including the production of cupulate, an alternative to chocolate. In order to support the cupuassu breeding program and to select plants presenting both pulp/seed quality and fungal disease resistance, SSRs from Next Generation Sequencing ESTs were obtained and used in diversity analysis. From 8,330 ESTs, 1,517 contained one or more SSRs (1,899 SSRs identified. The most abundant motifs identified in the EST-SSRs were hepta- and trinucleotides, and they were found with a minimum and maximum of 2 and 19 repeats, respectively. From the 1,517 ESTs containing SSRs, 70 ESTs were selected based on their functional annotation, focusing on pulp and seed quality, as well as resistance to pathogens. The 70 ESTs selected contained 77 SSRs, and among which, 11 were polymorphic in cupuassu genotypes. These EST-SSRs were able to discriminate the cupuassu genotype in relation to resistance/susceptibility to witches' broom disease, as well as to pulp quality (SST/ATT values. Finally, we showed that these markers were transferable to cacao genotypes, and that genome availability might be used as a predictive tool for polymorphism detection and primer design useful for both Theobroma species. To our knowledge, this is the first report involving EST-SSRs from cupuassu and is also a pioneer in the analysis of marker transferability from cupuassu to cacao. Moreover, these markers might contribute to develop or saturate the cupuassu and cacao genetic maps, respectively.
Ferraz dos Santos, Lucas; Moreira Fregapani, Roberta; Falcão, Loeni Ludke; Togawa, Roberto Coiti; Costa, Marcos Mota do Carmo; Lopes, Uilson Vanderlei; Peres Gramacho, Karina; Alves, Rafael Moyses
2016-01-01
The cupuassu tree (Theobroma grandiflorum) (Willd. ex Spreng.) Schum. is a fruitful species from the Amazon with great economical potential, due to the multiple uses of its fruit´s pulp and seeds in the food and cosmetic industries, including the production of cupulate, an alternative to chocolate. In order to support the cupuassu breeding program and to select plants presenting both pulp/seed quality and fungal disease resistance, SSRs from Next Generation Sequencing ESTs were obtained and used in diversity analysis. From 8,330 ESTs, 1,517 contained one or more SSRs (1,899 SSRs identified). The most abundant motifs identified in the EST-SSRs were hepta- and trinucleotides, and they were found with a minimum and maximum of 2 and 19 repeats, respectively. From the 1,517 ESTs containing SSRs, 70 ESTs were selected based on their functional annotation, focusing on pulp and seed quality, as well as resistance to pathogens. The 70 ESTs selected contained 77 SSRs, and among which, 11 were polymorphic in cupuassu genotypes. These EST-SSRs were able to discriminate the cupuassu genotype in relation to resistance/susceptibility to witches’ broom disease, as well as to pulp quality (SST/ATT values). Finally, we showed that these markers were transferable to cacao genotypes, and that genome availability might be used as a predictive tool for polymorphism detection and primer design useful for both Theobroma species. To our knowledge, this is the first report involving EST-SSRs from cupuassu and is also a pioneer in the analysis of marker transferability from cupuassu to cacao. Moreover, these markers might contribute to develop or saturate the cupuassu and cacao genetic maps, respectively. PMID:26949967
REGISTRO DA COCHONILHA-ROSADA-DO-HIBISCO INFESTANDO FRUTÍFERAS EM MACEIÓ, ALAGOAS, BRASIL
Directory of Open Access Journals (Sweden)
SÔNIA MARIA FORTI BROGLIO
2015-01-01
Full Text Available This study reported for the first time the occurrence of the pink hibiscus mealybug Maconelli-coccus hirsutus (Green, 1908 (Hemiptera: Pseudococcidae in Maceió, Alagoas, Brazil attacking the following fruit species: soursop (Annona muricata L. (Annonaceae, guava (Psidium guajava L. (Myrtaceae, mango (Mangifera indica L. (Anacardiaceae, carambola (Averrhoa carambola L. (Oxalidaceae, acerola (Malpighia glaba L. (Malpighiaceae, cajazeiro (Spondias lutea L. (Anacardiaceae and cupuaçuzeiro (Theobroma gran-diflorum (Willd. ex Spreng. Schum. (Malvaceae. The percentages of injured plants were recorded for each plant species in the field. Damaged plants showed short internodes, wrinkled leaves, fruit deformation, and sooty mold developed on the honeydew excreted by the mealybugs. Infested plant structures were taken to the Laboratory of Entomology of the Center for Agricultural Sciences, of the Federal University of Alagoas, where the mealybug species was identified through morphological characteristics. The following injury percentages were recorded on the plants: soursop (100%, guava (10%, mango (10%, carambola (100%, acerola (100%, cajá (50% and cupuaçu (100%. The mealybug collected in Maceió, AL; Brazil was identified as Maconelli-coccus hirsutus (Green, 1908 (Hemiptera: Pseudococcidae. It was the first record of this species in the state of Alagoas and infestation by pink hibiscus mealybug on the host plants mango, acerola and cajazeiro in Brazil.
Treatment of quinoa (chenopodium quinoa Willd) with Colchicina
International Nuclear Information System (INIS)
Gandarillas Santa Cruz, H.
1984-01-01
The sample no. 559, coming from the Bank of Germoplasma of Quinoa (Chenopodium quinoa Willd) of the Experimental Station at Patacamaya, located in the province Aroma of the La Paz department Bolivia, was treated with an aqueous solution of 0.4% of Colchicina. The treatment did not give the expected result, due, probably, to the very special behaviour of the Quinoa (Chenopodium quinoa Willd) during the process of mitosis
Determinação de compostos de massa molecular alta em folhas de plantas da Amazônia
Directory of Open Access Journals (Sweden)
Siqueira Denilson Soares de
2003-01-01
Full Text Available The fractIons of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae, caapi (Banisteriopsis caapi - Malpighiaceae, cocoa (Theobroma cacao - Sterculiaceae, Brazil nut (Bertholletia excelsa - Lecytidaceae, cupuaçu (Theobroma grandiflorum - Sterculiaceae, marupá (Simaruba amara - Simaroubaceae and rubber tree (Hevea brasiliensis - Euphorbiaceae, were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data (¹H and 13C NMR, IR.
Phytopharmacological Profile of Jasminum grandiflorum Linn. (Oleaceae).
Arun, Mittal; Satish, Sardana; Anima, Pandey
2016-04-01
Plants are the real basis towards animal life and are also central to people's livelihood. The contributions of the plants in performing varied religious celebrations and in other multiple beneficiaries like medicine, human happiness as well as in treating deadly diseases can never be neglected. In treating diseases, the plants and their constituents are better choice than any other synthetic chemical. The nature has been kind enough to provide the human beings with various types of medicinal plants and in the real sense these form the storehouse of curing almost all the ailments. Consequently, most of the drugs which are being used in preparing formulations have their origin and roots in the plants which form the chief natural source of medicines. Even in modern era, the plant-derived drugs are being extensively used, either in their original or semi-synthetic form. It is because their natural phytoconstituents are highly innocuous posing relatively fewer or no side effects. Based upon their observations, analysis and experience, our ancestors used many plants for medicinal purposes and thus their efforts need to be supported by scientific evidence. Jasminum grandiflorum Linn. is one of such important plants. It has been extensively used by the tribes all over India to treat different diseases which mainly include body pains, toothache, stomach ache, ulcers, and sexual impotency. Chemistry of the plant revealed the presence of mainly secoiridoids, terpenoids, flavonoids and tannins. Not much scientific support was given to the folklore claims for this plant but some of its traditional uses were investigated like spasmolytic, wound healing, antimicrobial, angiotensin converting enzyme inhibitor, antiulcer and antioxidant activities. This article is the review of research works done on the plant Jasminum grandiflorum Linn. to date. As a part of it the local names, morphology, traditional claims, chemistry and pharmacological activities have been discussed.
New acylated flavone and cyanogenic glycosides from Linum grandiflorum
DEFF Research Database (Denmark)
Mohammed, Magdy M. D.; Christensen, Lars Porskjær; Ibrahim, Nabaweya A.
2009-01-01
The first investigation of Linum grandiflorum resulted in the isolation of one new acylated flavone O-diglycoside known as luteolin 7-O-a-D-(6000-E-feruloyl)glucopyranosyl (1!2)--D-glucopyranoside, and one new cyanogenic glycoside known as 2-[(30-isopropoxy-O--D-glucopyranosyl)oxy]-2......-methylbutanenitrile, together with four known flavonoid glycosides, three known cyanogenic glycosides and one alkyl glycoside. The new compounds were structurally elucidated via the extensive 1D, 2D NMR and DIFNOE together with ESI-TOFCID-MS/MS and HR-MALDI/MS....
Directory of Open Access Journals (Sweden)
Kassia C.V.W. Spindola
Full Text Available Abstract In hybrid cultivated form, Dendranthema grandiflorum (Ramat. Kitam., Asteraceae, flowers (Chrysanthemum morifolium Ramat. were utilized in the production of extracts, which were analyzed for larvicidal activity against Aedes aegypti third instar larvae. Methanol and dichloromethane extracts showed LC50 values of 5.02 and 5.93 ppm, respectively. Using GC–MS, phytochemical analyses of the dichloromethane extract showed the presence of triterpenoids and fatty acids, while flavonoids and caffeoylquinic acids were shown to occur in the methanol extract by ESI Fourier Transform Ion Cyclotron Resonance Mass Spectrometry (ESI-FT-ICR-MS. Triterpenoids and fatty acids are well known insecticidal compounds. From this study, it can be concluded that D. grandiflorum grown for floriculture, as an agribusiness, can have additional applications as raw material for the production of insecticidal products.
Anti-HIV-1 activities of the extracts from the medicinal plant Linum grandiflorum Desf
DEFF Research Database (Denmark)
Mohammed, Magdy M. D.; Christensen, Lars Porskjær; Ibrahim, Nabaweya A.
2009-01-01
As part of our screening of anti-AIDS agents from natural sources e.g. Ixora undulata, Paulownia tomentosa, Fortunella margarita, Aegle marmelos and Erythrina abyssinica, the different organic and aqueous extracts of Linum grandiflorum leaves and seeds were evaluated in vitro by the microculture...... tetrazolium (MTT) assay. The activity of the tested extracts against multiplication of HIV-1 wild type IIIB, N119, A17, and EFVR in acutely infected cells was based on inhibition of virus-induced cytopathicity in MT-4 cells. Results revealed that both the MeOH and the CHCl3 extracts of L. grandiflorum have...... significant inhibitory effects against HIV-1 induced infection with MT-4 cells. The MeOH extract of the leaves is more potent than other extracts against MT-4 cell cultures infected with the wild type HIV-1, strain IIIB with an ED50 of 46 ± 6 µM, while the CHCl3 extract of the seeds is more potent than other...
Reproductive Organography of Bougainvillea spectabilis Willd
Bougainvillea spectabilis Willd. is of prime importance for horticulture, as well as potentially for pharmaceutical industries, agriculture and environmental industries. However, its floral development is not yet well understood. A detailed study on floral structure and floral organography in the sp...
Sveinsson, Saemundur; Gill, Navdeep; Kane, Nolan C; Cronk, Quentin
2013-07-24
Transposable elements (TEs) and other repetitive elements are a large and dynamically evolving part of eukaryotic genomes, especially in plants where they can account for a significant proportion of genome size. Their dynamic nature gives them the potential for use in identifying and characterizing crop germplasm. However, their repetitive nature makes them challenging to study using conventional methods of molecular biology. Next generation sequencing and new computational tools have greatly facilitated the investigation of TE variation within species and among closely related species. (i) We generated low-coverage Illumina whole genome shotgun sequencing reads for multiple individuals of cacao (Theobroma cacao) and related species. These reads were analysed using both an alignment/mapping approach and a de novo (graph based clustering) approach. (ii) A standard set of ultra-conserved orthologous sequences (UCOS) standardized TE data between samples and provided phylogenetic information on the relatedness of samples. (iii) The mapping approach proved highly effective within the reference species but underestimated TE abundance in interspecific comparisons relative to the de novo methods. (iv) Individual T. cacao accessions have unique patterns of TE abundance indicating that the TE composition of the genome is evolving actively within this species. (v) LTR/Gypsy elements are the most abundant, comprising c.10% of the genome. (vi) Within T. cacao the retroelement families show an order of magnitude greater sequence variability than the DNA transposon families. (vii) Theobroma grandiflorum has a similar TE composition to T. cacao, but the related genus Herrania is rather different, with LTRs making up a lower proportion of the genome, perhaps because of a massive presence (c. 20%) of distinctive low complexity satellite-like repeats in this genome. (i) Short read alignment/mapping to reference TE contigs provides a simple and effective method of investigating
Directory of Open Access Journals (Sweden)
Agustín Gonzáles Coral
2011-12-01
Full Text Available El objetivo del estudio fue evaluar el comportamiento de cuatro especies de frutales amazónicos bajo un modelo de diversificación instalada en la parcela del Sr. Ezequiel García Tapullima (UTM 9548994; 0669126. El suelo del área es desde franco (0-20cm a franco arcilloso (20-40 cm, pH fuertemente ácido y porcentaje (% de materia orgánica de medio a bajo. La metodología del trabajo consistió en Investigación Acción Participativa. Se instaló un modelo diversificado (5m x 5m con plantones de macambo (Theobroma bicolor, caimito (Pouteria caimito, copoazú (Theobroma grandiflorum y cacao (Theobroma cacao, sembrados con una densidad de 400 plantas por hectárea (5m x 5m. A los 15 meses de instalado, se evaluó el porcentaje de prendimiento, mediciones biométricas trimestrales del crecimiento en 10 individuos por especie, elegidos al azar de un área de 0.5 hectáreas. Se encontró que el 80% de plantas de las cuatro especies se encontraban en estado de foliación. Las especies que presentaron mejor comportamiento fueron T. bicolor y P. caimito con una altura de 293.1 cm y 193.2 cm; y un diámetro basal promedio de 5.8 cm y 2.1 cm respectivamente, T. grandiflorum presentó los menores registros con una altura promedio de 84.3 cm y diámetro basal de 1.4 cm.
Characterization and Isolation of a New Flavonoid from Viburnum grandiflorum
Directory of Open Access Journals (Sweden)
Ghias Uddin
2015-06-01
Full Text Available In the present study a new flavoniod 1 along with Betulin 2 Betulinic acid 3, Oleanolic acid 4 andUrsolic acid 5 were isolated from the aerial part of Viburnum grandiflorum Wall. ex DC as white amorphous powder from the chloroform fraction. On the bases of different modern spectroscopic techniques such as EIMS, UV, IR, NMR, HSQC, HMBC, COSY and NOESY the structure of compound 1 was elucidate as 6,7-bis (propenyloxy-2-ethoxy-5-hydroxy-3-(4-methoxyphenyl-4H-chromen-4-one (Grandinoid.
Directory of Open Access Journals (Sweden)
Pham Anh Tuan
2014-08-01
Full Text Available To improve the production of chlorogenic acid (CGA in hairy roots of Platycodon grandiflorum, we induced over-expression of Arabidopsis thaliana transcription factor production of anthocyanin pigment (AtPAP1 using an Agrobacterium rhizogenes-mediated transformation system. Twelve hairy root lines showing over-expression of AtPAP1 were generated. In order to investigate the regulation of AtPAP1 on the activities of CGA biosynthetic genes, the expression levels of seven P. grandiflorum CGA biosynthetic genes were analyzed in the hairy root line that had the greatest accumulation of AtPAP1 transcript, OxPAP1-1. The introduction of AtPAP1 increased the mRNA levels of all examined CGA biosynthetic genes and resulted in a 900% up-regulation of CGA accumulation in OxPAP1-1 hairy roots relative to controls. This suggests that P. grandiflorum hairy roots that over-express the AtPAP1 gene are a potential alternative source of roots for the production of CGA.
Directory of Open Access Journals (Sweden)
Juan Carlos Suárez-Salazar
2016-12-01
Full Text Available The objective of this work was to evaluate the variability of photosynthetic pigment content and daily stomatal conductance was evaluated in relation to environmental variables in Copoazú (Theobroma grandi orum ecotypes. The ecotypes used were part of the germoplasm bank of the University of the Amazon (Colombia. The study was carried out during the year 2015. Four leaves of the average stratum of four plants were collected for each ecotype, to extract and read at different levels of absorbance and determine the content of photosynthetic pigments. During the hours of 04:00 a.m. to 6:00 p.m., the stomatal conductance (gs was monitored for environmental variables (relative humidity, air temperature, radiation and vapor pressure de cit (VPD. An analysis of variance was made using the Tukey test, correlations and regressions were made between gs and environmental variables. The contents of chlorophyll a, b, total and carotenoids among ecotypes were different (P<0.0001, the ecotype UA-31 presented the highest values, contrasting with the ecotype UA-37. Concerning gs, the interaction ecotype*hour showed signi cant differences (P<0.0001 .The ecotypes that presented the highest values of gs were UA-67 and UA-039, (P<0.0001, radiation (-0.91, P<0.0001 and DPV (-0.94; P<0.0001 0.0001.The results suggest that ecotypes UA-039 and UA-31 were the most suitable in terms of gaseous exchange and content of photosynthetic pigments.
Sit-and-wait pollination in the spring flowering woodland plant, Trillium grandiflorum
Directory of Open Access Journals (Sweden)
Barrett, Spencer C.H.
2011-07-01
Full Text Available In animal-pollinated plants, reproductive success is commonly limited by pollen availability, which can occur in environments where pollinator activity is scarce or variable. Extended floral longevity to maximize a plant’s access to pollinators may be an adaptation to such uncertain pollination environments. Here, we investigated the effects of flower exposure time to pollinators on female fertility (fruit and seed set in the bee-pollinated woodland herb Trillium grandiflorum, a species with long-lived flowers (~17-21 d that blooms in early spring when pollinator activity is often variable. We experimentally exposed flowers to pollinators for different amounts of time to determine the extent to which floral longevity influenced reproductive success. The amount of time that flowers were exposed to pollinators significantly increased fruit set and seed set per flower, but not seed set per fruit. Our results provide experimental evidence that long floral life spans may function as a ‘sit-and-wait’ pollination strategy to increase the amount of exposure time to pollinators and promote seed set in the unpredictable pollination environments often experienced by early spring ephemerals. In large populations with infrequent pollinator visitation, as commonly occurs in T. grandiflorum, pollination may be a largely stochastic process.
Nagarajappa, Ramesh; Batra, Mehak; Sharda, Archana J; Asawa, Kailash; Sanadhya, Sudhanshu; Daryani, Hemasha; Ramesh, Gayathri
2015-01-01
To assess and compare the antimicrobial potential and determine the minimum inhibitory concentration (MIC) of Jasminum grandiflorum and Hibiscus rosa-sinensis extracts as potential anti-pathogenic agents in dental caries. Aqueous and ethanol (cold and hot) extracts prepared from leaves of Jasminum grandiflorum and Hibiscus rosa-sinensis were screened for in vitro antimicrobial activity against Streptococcus mutans and Lactobacillus acidophilus using the agar well diffusion method. The lowest concentration of every extract considered as the minimum inhibitory concentration (MIC) was determined for both test organisms. Statistical analysis was performed with one-way analysis of variance (ANOVA). At lower concentrations, hot ethanol Jasminum grandiflorum (10 μg/ml) and Hibiscus rosa-sinensis (25 μg/ml) extracts were found to have statistically significant (P≤0.05) antimicrobial activity against S. mutans and L. acidophilus with MIC values of 6.25 μg/ml and 25 μg/ml, respectively. A proportional increase in their antimicrobial activity (zone of inhibition) was observed. Both extracts were found to be antimicrobially active and contain compounds with therapeutic potential. Nevertheless, clinical trials on the effect of these plants are essential before advocating large-scale therapy.
Directory of Open Access Journals (Sweden)
Rehman ur Ateeq
2015-01-01
Full Text Available Dieback of mango caused by Lasiodiplodia theobromae is among several diseases responsible for low crop production in Pakistan. To further complicate the issue, resistance in L. theobromae is emerging against different fungicides. L. theobromae was isolated from diseased samples of mango plants collected from various orchards in the Multan District. The efficacy of different fungicides viz. copper oxychloride, diethofencarb, pyrachlostrobin, carbendazim, difenoconazole, mancozeb, and thiophanate-methyl was evaluated in vitro using a poison food technique. Thiophanate-methyl at all concentrations was found to be the most effective among five systemic fungicides against L. theobromae, followed by carbendazim, difenoconazole and diethofencarb. The fungicides, i.e., thiophanate-methyl, difenoconazole, carbendazim and diethofencarb showed maximum efficacy with increasing concentration. The isolates of L. theobromae showed some resistance development against the tested fungicides when compared with previous work. These investigations provide new information about chemical selection for the control of holistic disease in mango growing zones of Pakistan.
Marx, F.; Maia, J.G.S.
1983-01-01
Summary At the beginning of on inventory of the chemical composition of regional fruits and vegetables of the Amazon, analytical methods were adapted for the high performance liquid chromatography (HPLC) determination of pro-vitamin A (β—carotene), vitamin C (ascorbic acid) and vitamin E (tocopherol) The first analyses indicate as excellent sources of β—carotene, Mauritia flexuosa L., Astrocaryum tucuma Mart. and Cucurbita pepa L.; of asco bic acid Theobroma grandiflorum (Culis ex Spreng.) Sc...
Directory of Open Access Journals (Sweden)
Armando Sterling Cuéllar
2015-07-01
Full Text Available This study aimed to evaluate the early growth of three rubber tree clones (Hevea brasiliensis (FX 4098, FDR 5788, and control IAN 873 in four planting systems with cupuasu (Theobroma grandiflorum and banana trees (Musa AAB at two localities in Caquetá (Colombian Amazonia. A completely randomized block design with three replications and split-plot arrangement, analyzed with a general linear mixed model, was used at each locality. Total height (AT, trunk circumference (CT, canopy area (AC and leaf area index (IAF were evaluated one and two years after establishment of rubber trees. Trunk circumference was the variable most correlated with different growth indices (r ≥ 0.94. Four growth indices were strongly influenced by temporal and clonal variation and by planting system (p < 0.01. The only significant differences between the two localities were for AC (p < 0.05. System x clone interaction was significant for IAF (p < 0.01. After two years, the highest growth indices were observed in rubber tree clone FX 4098 (AT = 4.43 m; CT = 13.00 cm, AC = 4.62 m2; LAI = 1.37, and in two of the three agroforestry systems (AT ≥ 4.08 m, CT ≥ 11.43 cm, AC ≥ 4.01 m2; IAF ≥ 1.54 compared with the control system (monoculture.
Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
[Comparative study on the erect and fallen types of Platycodon grandiflorum (Jacq.) DC].
Gao, W; Tang, X; Li, Z; Xiao, P
1997-03-01
Based on botanica characters, phenophase, yield and content of active constituents, the erect and fallen types of platycodon grandiflorum were compared. The results show that the comprehensive characters of erect type are better than those of fallen type and the erect type is therefore good for popularization. Some specific characters of the fallen type are better than those of the erect type, and the fallen type is therefore to be preserved as one of the germ plasm resources.
Abbey, Marcie J; Patil, Vinit V; Vause, Carrie V; Durham, Paul L
2008-01-17
Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation.
Genetic variability in Asparagus racemosus (Willd.) from Madhya ...
African Journals Online (AJOL)
Random amplified polymorphic DNA (RAPD) markers were used to assess genetic diversity in Asparagus racemosus (Willd.) an important medicinal plant collected from 7 different locations covering Madhya Pradesh. High level of genetic similarity was observed in the collected accessions. 4 random primers generated a ...
Lin, Yuan-Chuan; Lin, Chih-Hsueh; Yao, Hsien-Tsung; Kuo, Wei-Wen; Shen, Chia-Yao; Yeh, Yu-Lan; Ho, Tsung-Jung; Padma, V Vijaya; Lin, Yu-Chen; Huang, Chih-Yang; Huang, Chih-Yang
2017-06-09
Platycodon grandiflorum (PG) is a Chinese medical plant used for decades as a traditional prescription to eliminate phlegm, relieve cough, reduce inflammation and lower blood pressure. PG also has a significant effect on the cardiovascular systems. The aqueous extract of Platycodon grandiflorum (JACQ.) A. DC. root was screened for inhibiting Ang II-induced IGF-IIR activation and apoptosis pathway in H9c2 cardiomyocytes. The effects were also studied in spontaneously hypertensive rats (five groups, n=5) using low and high doses of PG for 50 days. The Ang II-induced IGF-IIR activation was analyzed by luciferase reporter, RT-PCR, western blot and surface IGF-IIR expression assay. Furthermore, the major active constituent of PG was carried out by high performance liquid chromatography-mass spectrometry (HPLC-MS). Our results indicate that a crude extract of PG significantly suppresses the Ang II-induced IGF-IIR signaling pathway to prevent cardiomyocyte apoptosis. PG extract inhibits Ang II-mediated JNK activation and SIRT1 degradation to reduce IGF-IIR activity. Moreover, PG maintains SIRT1 stability to enhance HSF1-mediated IGF-IIR suppression, which prevents cardiomyocyte apoptosis. In animal models, the administration of PG markedly reduced this apoptotic pathway in the heart of SHRs. Taken together, PG may be considered as an effective treatment for cardiac diseases in hypertensive patients. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.
Cerón Salazar, Ivonne Ximena
2013-01-01
En esta tesis se presenta un análisis del diseño del proceso para la obtención de extractos ricos en antioxidantes a partir de cinco frutas tropicales (Cordata matisia, Physalis peruviana, Solanum betaceum, Theobroma grandiflorum, Renealmia alpinia). Se utilizaron procedimientos de simulación basado en la caracterización experimental para evaluar el rendimiento de las diferentes tecnologías para las etapas de pretratamiento, extracción y concentración utilizando el software Aspen Plus. Se...
Sulphur depletion altered somatic embryogenesis in Theobroma ...
African Journals Online (AJOL)
Somatic embryogenesis is a useful tool for Theobroma cacao improvement and propagation. Depending on culture medium composition, different morphogenetic structures (including somatic embryo) occur in response to alteration of genes expression patterns and biochemical changes. The effect of SO42- ion deficiency ...
Abbey, Marcie J.; Patil, Vinit V.; Vause, Carrie V.; Durham, Paul L.
2008-01-01
Ethnopharmacological relevance Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. Aim of the study To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Results Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24 h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Conclusions Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation. PMID:17997062
Energy Technology Data Exchange (ETDEWEB)
Sena Gomes, A.R.
1987-01-01
Relative humidity, flooding, temperature, wind, and SO/sub 2/ variously influenced physiological processes and growth of tropical woody plants, with emphasis on three Theobroma cacao varieties and three Hevea brasiliensis families. Stomata were smaller and more numerous in Theobroma than in Hevea. In Theobroma, but not Heavea, stomatal frequency decreased from the leaf base to the apex and from the midrib outward. Stomata of Theobroma cacao var. Catongo opened in high relative humidity (RH) and closed in low RH. The more open stomata in high RH were associated with high rates of photosynthesis, low leaf water potential, high water use efficiency (WUE), and low transpiration rate (TR). Variations in TR and WUE were correlated with changes in vapor pressure deficit. Other responses included stomatal closure, decreased chlorophyll content, leaf epinasty, production of hypertrophied lenticels and adventitious roots, and acceleration of ethylene production. Responses to flooding varied with species, Theobroma varieties and Hevea families. Effects of temperature regimes on growth varied with species, varieties and families, plant parts, growth parameters, and time of harvesting. Optimal temperatures for dry weight increase of stems or roots of Theobroma cacao var. Comum were 22.2 C; and 33.3 C for dry weight increase or relative growth rates of leaves or seedlings. Optimal temperatures for growth varied for Hevea families. Wind injured leaves of Theobroma cacao, with more injury by wind of 6.0 than 3.0 m s/sup -1/. Stomata were more open on windy than on calm days, but tended to close at high wind speeds. Wind lowered transpiration rate but the reduction was not correlated with leaf dehydration. SO/sub 2/ at 0.5, 1.0, or 1.5 ppm for 24 h did not injure Theobroma leaves but reduced dry weight increment of leaves of var. Catongo but not Catongo/Sial.
A review on plant Cordia obliqua Willd. (Clammy cherry).
Gupta, Richa; Gupta, Ghanshyam Das
2015-01-01
Cordia obliqua Willd. plant (Common name-Clammy Cherry) belongs to family Boraginaceae. It is a medium-sized deciduous tree and very vigorous in growth. According to traditional system, it possesses anthelmintic, purgative, diuretic, expectorant, antipyretic, hepatoprotective and analgesic action. The fruits are edible and used as pickle. The gum obtained from mucilage is used for pasting sheets of paper and as matrix forming material in tablet formulations. Phytochemical investigations show the presence of alkaloids, flavonoids, phenolics, tannins and reducing sugar. Evaluation of pharmacological activities confirmed C. obliqua plant as antimicrobial, hypotensive, respiratory stimulant, diuretic and anti-inflammatory drug. A number of traditional activities of this plant still need scientific approval which will increase its medicinal potential. This review presents the Pharmacognostic properties, phytochemical constituents, traditional uses and biological activities reported for the plant and it will be helpful to explore the knowledge about Cordia obliqua Willd. for the researchers.
Directory of Open Access Journals (Sweden)
Bruna Mezzalira da Silva
2016-01-01
Full Text Available RESUMO: Quinze primers ISSR (entre sequências simples repetidas foram utilizados para avaliar a diversidade genética entre e dentro de pomares comerciais de Theobroma grandiflorum (Willd. ex Spreng. K. Schum. Para isso, foram analisados sessenta indivíduos, distribuídos nos três cultivos. Um total de 102 bandas foi amplificado, com uma porcentagem de 52,0% de polimorfismo em nível de espécie e média de 6,8 alelos por primer ISSR. A média do Índice de Conteúdo Polimórfico (PIC foi de 0,55. Em relação aos índices de diversidade gênica de Nei (H e de Shannon (I, os cultivos analisados apresentaram os valores: SAR H = 0,114 e I = 0,177; SSL H = 0,108 e I = 0,162 e SEC H = 0,104 e I = 0,156, considerados valores de moderados a baixos. A AMOVA revelou 34,91% da variância total entre os cultivos e 65,09% dentro deles. Os marcadores moleculares ISSR revelaram que há diversidade genética dentro de cada cultivo comercial estudado, portanto é possível selecionar genótipos superiores que poderão ser utilizados para originar cultivos mais uniformes. Esse resultado tem sido considerado de grande relevância, por fornecer ferramentas para a implementação de programas de melhoramento e delineamento de estratégias de conservação ex situ e in situ.
Carvalho, S.M.P.; Heuvelink, E.
2001-01-01
The effects of greenhouse climate and plant density on external quality of chrysanthemum (Dendranthema grandiflorum syn. Chrysanthemum morifolium) are reviewed. The external quality aspects analysed in this paper are stem morphology (length, diameter and "strength"), leaf morphology (number and
da Silva, Rangeline Azevedo; Souza, Gustavo; Lemos, Lívia Santos Lima; Lopes, Uilson Vanderlei; Patrocínio, Nara Geórgia Ribeiro Braz; Alves, Rafael Moysés; Marcellino, Lucília Helena; Clement, Didier; Micheli, Fabienne
2017-01-01
The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR) of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI− bands). The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC) ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted. PMID:28187131
Directory of Open Access Journals (Sweden)
Rangeline Azevedo da Silva
Full Text Available The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI- bands. The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted.
Cohen, Kelly de Oliveira; Jackix, Marisa de Nazaré Hoelz
2005-01-01
O cupuaçu (Theobroma grandiflorum Schum), que é um fruto amazônico, vem conquistando a cada ano mais espaço no mercado nacional e internacional com a comercialização de sua polpa. Suas sementes, consideradas como subproduto, vem despertando interesse não só no mundo científico como pelas indústrias. Sabe-se que, a partir das sementes, pode-se obter produtos análogos aos oriundos das sementes de cacau, seguindo as mesmas etapas de processamento. Dentre esses produtos tem-se o liquor de cupuaçu...
International Nuclear Information System (INIS)
Li Zhineng; Liu Guofeng; Bao Manzhu
2006-01-01
The dry seeds of Platanus acerifolia Willd. were irradiated by different doses of 60 Co γ-rays, and the effect of the radiation on M 1 were investigated. Results showed that the seed germination rate, emerged seedling rate and survival seedling rate of Platanus aceriflia Willd. Decreased with dose increase at the dose of 50-400 Gy, as well as the plant height, fresh weight and length of root. The radiation inhibited the seeding growth significantly. Compared with CK, the true leaf emerging time of samples irradiated at 50-250 Gy was late for 2, 5, 9 and 14d, respectively. But the young seedlings of samples treated at 300-400 Gy were severely twisted and abnormal, and gradually died after 15d. Based on the data of seeding rate and root growth, it is concluded that the semi-lethal radiation dose of Platanus acerifolia Willd. dry seed was 50 Gy, and the suitable dose range for radiation breeding was 50 to 250 Gy. (authors)
PROPAGACIÓN in vitro DE Geranium chilloense WILLD. EX KUNTH. PARA LA OBTENCIÓN DE PLANTAS COMPLETAS
Benavides, Thaly; Córdova, Adriana; Vaca, Ivonne
2016-01-01
Geranium chilloense Willd. ex Kunth es conocida con el nombre de Geranio de los Chillos, es una planta ornamental silvestre, nativa de Los Andes se encuentra distribuida en las quebradas del Distrito Metropolitano de Quito y forma parte de la historia de la flora nativa de Quito ya que ha sido descrita desde la expedición de Alexander Humboldt y Aimé Bonpland en 1802. El presente estudio presenta un protocolo de propagación in vitro de Geranium chilloense Willd. ex Kunth, para la ...
A review on plant Cordia obliqua Willd. (Clammy cherry)
Richa Gupta; Ghanshyam Das Gupta
2015-01-01
Cordia obliqua Willd. plant (Common name-Clammy Cherry) belongs to family Boraginaceae. It is a medium-sized deciduous tree and very vigorous in growth. According to traditional system, it possesses anthelmintic, purgative, diuretic, expectorant, antipyretic, hepatoprotective and analgesic action. The fruits are edible and used as pickle. The gum obtained from mucilage is used for pasting sheets of paper and as matrix forming material in tablet formulations. Phytochemical investigations show ...
Directory of Open Access Journals (Sweden)
Mulyadi A T
2012-11-01
Full Text Available Acacia mangium Willd is one of the promising wood species, it is a fast growing species and can be used as raw materials for pulp, furniture and wood working. Musi Hutan Persada Company has planted Acacia mangium Willd in large scale for pulp processing raw materials and for wood working industry. The faculty of forestry of the Nusa Bangsa University in collaboration with the Musi Hutan Persada have examined the effect of “Sonic Bloom” to the Acacia mangium Willd germination and seedling growth. The results of the research are the following : (1 The seed germination with “Sonic Bloom” provided percented of germination of 82%, better than those without “Sonic Bloom”, i.e. only 34%; (2 With Sonic Bloom, the height of 80-days old seedling is 129.6 cm higher than those without “Sonic Bloom”of only 90.7 cm ; (3 the diameter of 80-days old seedling with “Sonic Bloom” is 0,24 cm higher than those without “Sonic Bloom” harving diameters of only 0.19 cm.The study concludes that sonic bloom treatment is very useful for the seed germination and the growth of Acacia mangium Willd seedling Key Words : Sonic Bloom, persemaian, Acacia mangium, perkecambahan, bibit Normal 0 false false false IN X-NONE X-NONE
International Nuclear Information System (INIS)
Uranga, Carla C.; Beld, Joris; Mrse, Anthony; Córdova-Guerrero, Iván; Burkart, Michael D.; Hernández-Martínez, Rufina
2016-01-01
The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.
Energy Technology Data Exchange (ETDEWEB)
Uranga, Carla C., E-mail: curanga@cicese.edu.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico); Beld, Joris, E-mail: joris.beld@drexelmed.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Mrse, Anthony, E-mail: amrse@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Córdova-Guerrero, Iván, E-mail: icordova@uabc.edu.mx [Universidad Autónoma de Baja California (UABC), Calzada Universidad 14418 Parque Industrial Internacional Tijuana, Tijuana, B.C. 22390 (Mexico); Burkart, Michael D., E-mail: mburkart@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Hernández-Martínez, Rufina, E-mail: ruhernan@cicese.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico)
2016-04-01
The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.
Directory of Open Access Journals (Sweden)
Zongliang Lu
Full Text Available BACKGROUND: The extract of Platycodon grandiflorum has been reported to have effective spermicidal activity. This study was designed to evaluate the spermicidal and contraceptive activity, as well as the safety, of Platycodin D (PD, a major saponin in Platycodon grandiflorum. METHODS: Using the computer-aided sperm analysis (CASA test criteria, the sperm-immobilizing activity of PD was studied using highly motile human sperm. The sperm viability was assessed by fluorescent staining using SYBR-14 (living sperm and propidium iodide (dead sperm. The sperm membrane integrity was assessed by evaluating the hypo-osmotic swelling (HOS and examinations by transmission electron microscopy (TEM and scanning electron microscopy (SEM. The in vivo contraceptive efficacy was evaluated in rats using post-intrauterine PD application. The comet assay was employed to determine whether PD caused DNA damage in the sperm. Vaginal biopsies were also performed to determine whether the PD gel induced vaginal inflammation. RESULTS: A dose-dependent effect of PD on the sperm motility and viability was observed. The maximum spermicidal effect was observed with a 0.25 mM concentration of PD. More than 70% of the PD-treated sperm lost their HOS responsiveness at a concentration of 0.20 mM PD, indicating that PD caused injury to the sperm plasma membrane. TEM and SEM revealed significant damage to both the head and tail membranes of the sperm. PD decreased the fertility to zero in rats, was non-DNA damaging and was not harmful to the vaginal tissue in the rats. CONCLUSION: PD has significant spermicidal activity that should be explored in further studies.
Second generation bioethanol production from Saccharum spontaneum L. ssp. aegyptiacum (Willd.) Hack.
Danilo Scordia; Salvatore L. Consentino; Thomas W. Jeffries
2010-01-01
Saccharum (Saccharum spontaneum L. ssp. aegyptiacum (Willd.) Hack.), is a rapidly growing, wide ranging high-yield perennial, suitable for second generation bioethanol production. This study evaluated oxalic acid as a pretreatment for bioconversion. Overall sugar yields, sugar degradation products, enzymatic glucan hydrolysis and ethanol production were studied as...
Directory of Open Access Journals (Sweden)
Rafael Moysés Alves
2008-09-01
seleção recorrente para melhorar, gradativamente, o nível de resistência. Parece suficiente considerar na seleção apenas o número de vassouras, não sendo necessário considerar o peso. A correlação entre resistência no fruto e na inflorescência foi alta (0.84, indicando algum controle genético comum aos dois caracteres. Foram identificadas progênies superiores, simultaneamente, para produção de frutos e resistência à vassoura.This paper deals with the genotypic evaluation of Theobroma grandiflorum progenies in the Pará State for the characters number of fruits (NF in four harvests, intensity of occurrence of witch's broom disease in the inflorescences (WBI and in the fruits (WBF and weight of branches with witch's broom (WWB. Also, it presents estimates of genetic parameters that allow to infer on the genetic control and level of genetic variability in the appraised germplasm. All the characters presented considerable genetic variability, with coefficients of genetic variation varying from 27% to 88% at progenies level and from 38% to 123% at individual level. This reveals excellent possibilities for the selection in that hybrid experimental population. The estimates of individual narrow sense heritabilities, in a harvest, varied from 25% to 54% and the individual repeatabilities for NF was equal at 35%. With the four accomplished harvests the individual heritability increased to 48%, providing selective accuracy of 70%, for the individuals' selection. The gain in efficiency, when using more than five crops is practically worthless. For NF, genetic gains above 60% can be obtained with the selection of the best five individuals. Individuals with annual production of 17 fruits can be selected, value which is much more superior to the general average of 10 fruits, found in the commercial plantations. Superior genetic gains can be obtained with clone propagation of the best individuals in relation to the sexual propagation and for the best individual the
Molecular genetic diversity in a core of cocoa ( Theobroma cacao L ...
African Journals Online (AJOL)
This study aimed to assess the genetic variability in groups of 11 clones of Theobroma cacao L., from different geographical regions, based on microsatellite markers, with the interest to characterize germplasm for breeding. The products of the amplification of these materials with 15 simple sequence repeat (SSR) markers ...
Kamil, Fatima H.; Saeed, Esam E.; El-Tarabily, Khaled A.; AbuQamar, Synan F.
2018-01-01
Dieback caused by the fungus Lasiodiplodia theobromae is an important disease on mango plantations in the United Arab Emirates (UAE). In this study, 53 actinobacterial isolates were obtained from mango rhizosphere soil in the UAE, of which 35 (66%) were classified as streptomycetes (SA) and 18 (34%) as non-streptomycetes (NSA). Among these isolates, 19 (12 SA and 7 NSA) showed antagonistic activities against L. theobromae associated with either the production of diffusible antifungal metabolites, extracellular cell-wall-degrading enzymes (CWDEs), or both. Using a “novel” mango fruit bioassay, all isolates were screened in vivo for their abilities to reduce lesion severity on fruits inoculated with L. theobromae. Three isolates, two belonging to Streptomyces and one to Micromonospora spp., showed the strongest inhibitory effect against this pathogen in vitro and were therefore selected for tests on mango seedlings. Our results revealed that the antifungal action of S. samsunensis UAE1 was related to antibiosis, and the production of CWDEs (i.e., chitinase) and siderophores; whilst S. cavourensis UAE1 and M. tulbaghiae UAE1 were considered to be associated with antibiotic- and CWDE-production, respectively. Pre-inoculation in greenhouse experiments with the most promising actinobacterial isolates resulted in very high levels of disease protection in mango seedlings subsequently inoculated with the pathogen. This was evident by the dramatic reduction in the estimated disease severity indices of the mango dieback of individual biocontrol agent (BCA) applications compared with the pathogen alone, confirming their potential in the management of mango dieback disease. L. theobromae-infected mango seedlings treated with S. samsunensis showed significantly reduced number of defoliated leaves and conidia counts of L. theobromae by 2- and 4-fold, respectively, in comparison to the other two BCA applications. This indicates that the synergistic antifungal effects of S
Saha, A; Mandal, P; Dasgupta, S; Saha, D
2008-05-01
Lasiodiplodia theobromae, a common tea (Camellia sinensis) pathogen, usually does not sporulate or sporulates poorly in common media, which makes spore production difficult. In this study the effects of culture media, carbon source, nitrogen source, temperature, pH and light on mycelial growth and sporulation were evaluated. Among several carbon sources tested, glucose and sucrose were found superior for growth. Potassium nitrate supplemented media showed maximum growth amongst the tested inorganic nitrogen sources while peptone produced maximum growth among the tested organic nitrogen sources. Tea root extract supplemented potato dextrose agar medium was found to be the most suitable for mycelial growth and sporulation of L. theobromae. The fungus grow at temperatures ranging from 40 to 36 degrees C, with optimum growth at 28 degrees C and no growth was noted at 40 degrees C. There was no significant effect of different light period on growth of L. theobromae, but light enhanced sporulation. The fungus grow at pH 3.0-8.0 and optimum growth was observed at pH 6.0. Tea root extract supplemented potato dextrose agar medium with pH 6.0 was the most suitable for production of conidia of L. theobromae at 28 degrees C. Hence this media may be recommended for inoculum production for further studies.
Armazenamento de sementes de Erythrina velutina willd
Directory of Open Access Journals (Sweden)
Kelina Bernardo Silva
2011-08-01
Full Text Available O trabalho teve como objetivo avaliar o efeito de diferentes embalagens e ambientes de armazenamento na manutenção da qualidade fisiológica de sementes de Erythrina velutina Willd.. O experimento foi conduzido no Laboratório de Análise de Sementes do Departamento de Fitotecnia do Centro de Ciências Agrárias da Universidade Federal da Paraíba (CCA-UFPB, localizado no município de Areia (PB. As sementes de Erythrina velutina Willd. foram coletadas embaixo de árvores matrizes, no mesmo município e levadas para o laboratório, onde se realizou a homogeneização e acondicionamento em embalagens de papel, pano e vidro e, posterior armazenamento em condições não controladas de laboratório (±25ºC, geladeira (6 ± 2ºC e câmara fria (4 ± 2ºC, por um período de 225 dias. Antes e após os intervalos de 45 dias foram retiradas amostras de cada embalagem e ambiente de armazenamento para avaliação das seguintes características: teor de água, emergência (porcentagem e índice de velocidade, comprimento e massa seca de epicótilo, hipocótilo e raiz das plântulas normais. O delineamento experimental utilizado foi inteiramente ao acaso com quatro repetições de 25 sementes para cada teste. As sementes de mulungu são ortodoxas e acondicionando-as nas embalagens de papel, pano ou vidro podem ser armazenadas nos ambientes de laboratório, geladeira e câmara fria, durante 225 dias sem perdas significativas na emergência das plântulas.
Nysius cymoides (Spinola on Chenopodium quinoa Willd. cultivated in Italy
Directory of Open Access Journals (Sweden)
S. Bocchi
2016-12-01
Full Text Available Quinoa (Chenopodium quinoa Willd. (Family: Amaranthaceae – APG classification is an Andean grain recently introduced on the European market and cultivated in experimental fields. In one of these experimental fields, in San Giorgio Piacentino (Italy, a heavy bug infestation was observed. The species was identified as Nysius cymoides (Spinola (Heteroptera Lygaeidae, a polyphagous species known as a pest of different crops. It occurs in the Mediterranean area from the sea level to the alpine meadows.
Directory of Open Access Journals (Sweden)
Felipe Eng
Full Text Available Jasmonic acid is a plant hormone that can be produced by the fungus Lasiodiplodia theobromae via submerged fermentation. From a biotechnological perspective jasmonic acid is a valuable feedstock as its derivatives serve as important ingredients in different cosmetic products and in the future it may be used for pharmaceutical applications. The objective of this work was to improve the production of jasmonic acid by L. theobromae strain 2334. We observed that jasmonic acid formation is dependent on the culture volume. Moreover, cultures grown in medium containing potassium nitrate as nitrogen source produced higher amounts of jasmonic acid than analogous cultures supplemented with ammonium nitrate. When cultivated under optimal conditions for jasmonic acid production, L. theobromae secreted several secondary metabolites known from plants into the medium. Among those we found 3-oxo-2-(pent-2-enyl-cyclopentane-1-butanoic acid (OPC-4 and hydroxy-jasmonic acid derivatives, respectively, suggesting that fungal jasmonate metabolism may involve similar reaction steps as that of plants. To characterize fungal growth and jasmonic acid-formation, we established a mathematical model describing both processes. This model may form the basis of industrial upscaling attempts. Importantly, it showed that jasmonic acid-formation is not associated to fungal growth. Therefore, this finding suggests that jasmonic acid, despite its enormous amount being produced upon fungal development, serves merely as secondary metabolite.
Agung, Muhammad Budi; Budiarsa, I. Made; Suwastika, I. Nengah
2017-02-01
Cocoa bean is one of the main commodities from Indonesia for the world, which still have problem regarding yield degradation due to pathogens and disease attack. Developing robust cacao plant that genetically resistant to pathogen and disease attack is an ideal solution in over taking on this problem. The aim of this study was to identify Theobroma cacao genes on database of cacao genome that homolog to response genes of pathogen and disease attack in other plant, through in silico analysis. Basic information survey and gene identification were performed in GenBank and The Arabidopsis Information Resource database. The In silico analysis contains protein BLAST, homology test of each gene's protein candidates, and identification of homologue gene in Cacao Genome Database using data source "Theobroma cacao cv. Matina 1-6 v1.1" genome. Identification found that Thecc1EG011959t1 (EDS1), Thecc1EG006803t1 (EDS5), Thecc1EG013842t1 (ICS1), and Thecc1EG015614t1 (BG_PPAP) gene of Cacao Genome Database were Theobroma cacao genes that homolog to plant's resistance genes which highly possible to have similar functions of each gene's homologue gene.
Directory of Open Access Journals (Sweden)
S. Kazemipour
2016-02-01
Full Text Available Dendranthema grandiflorum L. is one of the widely cultivated flowers around the world for producing of cut flowers. Nanometer-sized silver particles are used in various applications as an anti-microbial compound. This experiment was carried out to study the effects of silver nanoparticles (0, 5, 10 and 20 mg/L and sodium silicate (0, 50, 100 and 150 mg/L on longevity and quality of cut chrysanthemum (Dendranthema grandiflorum L. flowers. A factorial experiment was conducted based on randomized complete block design with 16 treatments, 3 replications, 48 plots and 192 cut flowers. The cut flowers were pulsed for 24 h with pulse solutions and then transported to 300 mg L-1 8-hidroxy quinoline sulfate and 3% sucrose. The characteristics such as vase life, loss of fresh weight, number of bacterial colonies in stem, lipid peroxidation, and activity of superoxide dismutase (SOD were measured. Results showed that all treatments had positive effects on the vase life of flowers. Pulse solution with 10 mg/L silver nanoparticles and 100 mg/L sodium silicate and interaction between them, increased vase life compared to the control (3.21, 4.46 and 8.50 days, respectively. In addition, the flowers pulsed with silver nanoparticles and sodium silicate exhibited higher activity of SOD, compared to control. The present study showed that using proper concentrations of silver nanoparticles and sodium silicate can enhance the vase life of cut chrysanthemum flowers.
Directory of Open Access Journals (Sweden)
Rafael Sampaio Octaviano de Souza
2008-10-01
Full Text Available Numerous plant species are used throughout the world to achieve the modified states of conscientiousness. Some of them have been used for the therapeutic purposes, such as Mimosa tenuiflora (Willd Poir. (family Mimosaceae known as "jurema-preta", an hallucinogenic plant traditionally used for curing and divination by the Indians of northeastern Brazil. In this review, several aspects of the use, phytochemistry, and pharmacology of this plant are considered.Numerosas espécies de plantas são usadas para alterar estados de consciência. Algumas são utilizadas para fins terapêuticos, como Mimosa tenuiflora (Willd Poir. (Mimosaceae conhecida como "jurema-preta", uma planta alucinógena, tradicionalmente utilizada pelos índios no nordeste do Brasil. Nesta revisão, são considerados diversos aspectos do uso, fitoquímica e farmacologia desta planta.
Directory of Open Access Journals (Sweden)
Castillo Daynet Sosa del
2016-04-01
Full Text Available Flowery cushion gall of cacao is a disease complex with six types. Fusarium decemcellulare have been isolated from both flowery and green point galls and recognized as the etiological agent of the disease. In the present work we: i identified by ITS-rDNA sequencing and/or taxonomy the cultivable fungal species or Operative Taxonomic Units (OTUs associated with the five symptoms of cushion galls in cacao from Venezuela, and ii determined the gall inducing capacity on cacao peeled seeds after 45 days of inoculation with suspensions of mycelia/ spores from distinct isolate types. The whole isolate collection rendered an abundance of 113 isolates with a richness of 39 OTUs (27 and eight identified at the species or genera levels, respectively, and in unidentified fungi. The dominant recovered species (≈36% were F. decemcellulare and Lasiodiplodia theobromae. Some isolates of F. decemcellulare, L. theobromae, F. equiseti, Fusarium spp., F. solani, F. incarnatum, Rhizocthonia solani and Penicillium sp. were pathogenic. Some other isolates of the first six mentioned taxa behave as non-pathogenic. Furthermore, pathogenic and non-pathogenic isolates can also co-occur within a single plant and gall type. Moreover, 2-5 species within a single gall symptom in a single tree were identified (not necessarily at the same point in the tree, indicating a broad diversity of co-occurring taxa.
Data from proteome analysis of Lasiodiplodia theobromae (Botryosphaeriaceae
Directory of Open Access Journals (Sweden)
Carla C. Uranga
2017-08-01
Full Text Available Trunk disease fungi are a global problem affecting many economically important fruiting trees. The Botryosphaeriaceae are a family of trunk disease fungi that require detailed biochemical characterization in order to gain insight into their pathogenicity. The application of a modified Folch extraction to protein extraction from the Botryosphaeriaceae Lasiodiplodia theobromae generated an unprecedented data set of protein identifications from fragmentation analysis and de novo peptide sequencing of its proteome. This article contains data from protein identifications obtained from a database-dependent fragmentation analysis using three different proteomics algorithms (MSGF, Comet and X! Tandem via the SearchGUI proteomics pipeline program and de novo peptide sequencing. Included are data sets of gene ontology annotations using an all-Uniprot ontology database, as well as a Saccharomyces cerevisiae-only and a Candida albicans-only ontology database, in order to discern between those proteins involved in common functions with S. cerevisiae and those in common with the pathogenic yeast C. albicans. Our results reveal the proteome of L. theobromae contains more ontological categories in common to C. albicans, yet possesses a much wider metabolic repertoire than any of the yeasts studied in this work. Many novel proteins of interest were identified for further biochemical characterization and annotation efforts, as further discussed in the article referencing this article (1. Interactive Cytoscape networks of molecular functions of identified peptides using an all-Uniprot ontological database are included. Data, including raw data, are available via ProteomeXchange with identifier PXD005283.
Directory of Open Access Journals (Sweden)
Salomão Rocha Martim
2013-10-01
Full Text Available During the freezing of fruits pulps, the enzyme activity is not finished completely. Sensory, nutritional and coloring changes may occur on fruits due to the action of oxidative enzymes such as peroxidase and polyphenoloxidase. The frozen cupuaçu pulps, sold in Brazil, have a shelf life of one year and become browned during this period. The aim of this study was to evaluate the effect of frozen storage on the physicochemical characteristics, polyphenoloxidase activity and soluble and ionically bound peroxidases presented in the pulps of four new cupuaçu genotypes over twelve months. The cupuaçu genotypes developed by the West Amazonian Agroforestry Research Center (EMBRAPA were pulped, frozen and stored at – 30 °C. The polyphenoloxidase of the four cupuaçu genotypes showed an increase in activity according to the storage time with peaks in the sixth, ninth and tenth months, but the peroxidases exhibited oscillations in the enzyme activity. The physicochemical properties of the pulps showed variations during the twelve months of storage under freezing. The vitamin C content of D 28-10 and P 3-10 genotypes decreased from the fourth and tenth months, respectively. Moreover P 9-8 e B 28-7 genotypes remained stable. In relation the acidity of citric acid, the B-28-7, D 28-10 and P 9-8 samples were not different, but P 3-10 genotype presented a reduction. The pH and total soluble solids of all genotypes decreased over the study period. There was an increase in sugar concentration of B 28-7, P 3-10 and P 9-8 genotypes, except for D 28-10 sample which remained unchanged. All genotypes were in accordance with physical-chemicals standards required by legislation, except for P 3-10 genotype that showed a lower acidity. In respect of the enzymatic parameters, there were variations in the activity of peroxidase and polyphenoloxidases of all genotypes. No congelamento de polpas de frutas a atividade enzimática não é completamente cessada. Podem ocorrer mudanças sensoriais, nutricionais e de coloração devido à ação de enzimas oxidativas, como a peroxidase e a polifenoloxidase. Considerando que as polpas de cupuaçu congeladas, comercializadas no Brasil, têm um prazo de validade de um ano e tornam-se escurecidas ao longo deste período, objetivou-se neste estudoavaliar o efeito do tempo de congelamento nas características físico-químicas e nas atividades da polifenoloxidase e peroxidases solúvel e insolúvel presentes nas polpas de quatro novos genótipos de cupuaçu, durante doze meses. Os frutos dos genótipos de cupuaçu, desenvolvidos pela Embrapa Amazônia Ocidental, foram despolpados, congelados e armazenados à temperatura de –30 ºC. A polifenoloxidase das polpas dos quatro genótipos apresentou aumento na sua atividade com picos no sexto, nono e décimo mês e as peroxidases apresentaram oscilações na atividade enzimática. As propriedades físico-químicas das polpas apresentaram variações durante os doze meses de armazenamento sob congelamento. O teor de vitamina C dos genótipos D 28-10 e P 3-10 diminuiu a partir do 4º e 10º mês, respectivamente. Por outro lado os genótipos B 28-7 e P 9-8 permaneceram estáveis. Em relação à acidez em ácido cítrico, as amostras B-28-7, D 28-10 e P 9-8 não diferiram, havendo redução no genótipo P 3-10. O valores de pH e sólidos solúveis totais de todos os genótipos diminuíram ao longo do período avaliado. Houve aumento na concentração de açúcares das polpas dos genótipos B 28-7, P 3-10 e P 9-8, com exceção da amostra D 28-10 que permaneceu inalterada. Todos os genótipos apresentaram-se dentro dos padrões físico-químicos exigidos pela legislação, com exceção do genótipo P 3-10 que apresentou acidez inferior. Em relação aos parâmetros enzimáticos, houve variações na atividade das peroxidases e polifenoloxidases de todos os genótipos avaliados.
Simulation of Quinoa (Chenopodium Quinoa Willd.) response to soil salinity using the saltmed model
DEFF Research Database (Denmark)
Razzaghi, Fatemeh; Plauborg, Finn; Ahmadi, Seyed Hamid
Quinoa (Chenopodium quinoa Willd.) is a crop with high tolerance to salinity and drought and its response to varying soil moisture and salinity levels was studied in a field lysimeter experiment. Quinoa (cv. Titicaca) was irrigated with different concentrations of saline water (0, 10, 20, 30 and 40...
Aboveground biomass equations for 7-year-old Acacia mangium Willd in Botucatu, Brazil
Ricardo A. A. Veiga; Maria A. M. Brasil; Carlos M. Carvalho
2000-01-01
The biomass of steins, leaves, and branches was determined for 152 sample trees of Acacia mangium Willd were in a 7-year-old experimental plantation in Botucatu, Sao Paulo State, Brazil. After felling, dimensional measurements were taken from each tree. Cross sections were collected in 125 sample trees at ground level (0 percent), 25 percent, 50...
Association mapping of fruit, seed and disease resistance traits in Theobroma cacao L
An association mapping approach was employed to find markers for color, size, girth and mass of fruits; seed number and butterfat content; and resistance to black pod and witches’ broom diseases in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms...
García García, Diana Paola
2011-01-01
Para este trabajo, se obtuvo harina de quinua de la variedad Nariño como materia prima en grano (Chenopodium quinoa Willd), para esto se adecuó la materia prima extrayendo las saponinas del grano y posterior secado con aire caliente. Se probó su uso en panificación utilizando mezclas de harina de quinua con harina de trigo, para conocer y aprovechar las ventajas a nivel nutricional de este grano tan poco conocido y comercializado, que puede ser fuente de proteína de calidad, utilizándose en p...
Directory of Open Access Journals (Sweden)
Manuel Alejandro Numpaque
2016-01-01
Full Text Available The microbial transformation of ferulic acid (FA offers a cleaner, more economical alternative for the natural production of flavorings and fragrances. In the present study, the biotransformation of FA using the filamentous phytopathogenic fungi Colletotrichum acutatum and Lasiodiplodia theobromae was researched. Initially, the toxicity of FA against both fungi was evaluated; the FA displayed a moderate toxicity (total inhibition at concentrations ≥ 2000 mg L-1 and apparently a detoxification mechanism was present. Afterwards, the microorganisms were incubated with the substrate at room conditions using a Czapek-Dox culture medium. The results demonstrated that the FA was mainly converted to 4-vinylguaiacol, reaching the highest abundance within the first 48 hours. To a lesser extent, acetovanillone, ethylguaiacol, and vanillin, among others, were produced. Interestingly, the compounds generated in the biotransformation of FA with C. acutatum and L. theobromae have been used as flavorings. Based on the identified metabolites, a possible metabolic pathway was proposed.
Genetic diversity and spatial structure in cacao (Theobroma cacao L.) germplasm from Bolivia
Cacao (Theobroma cacao L.) is an important economic crop widely cultivated in the Bolivian Amazon. The germplasm group used by the Bolivian farmers was called “Cacao Nacional Boliviano” (CNB). Wild cacao populations are also found in the Beni River and in the valleys of Andes foot hills. Using DNA...
Innovations in Health Value and Functional Food Development of Quinoa (Chenopodium quinoa Willd.)
Graf, Brittany L.; Rojas-Silva, Patricio; Rojo, Leonel E.; Delatorre-Herrera, Jose; Baldeón, Manuel E.; Raskin, Ilya
2015-01-01
Quinoa (Chenopodium quinoa Willd., Amaranthaceae) is a grain-like, stress-tolerant food crop that has provided subsistence, nutrition, and medicine for Andean indigenous cultures for thousands of years. Quinoa contains a high content of health-beneficial phytochemicals, including amino acids, fiber, polyunsaturated fatty acids, vitamins, minerals, saponins, phytosterols, phytoecdysteroids, phenolics, betalains, and glycine betaine. Over the past 2 decades, numerous food and nutraceutical prod...
Directory of Open Access Journals (Sweden)
Fáber de Jesús Chica Toro
2005-12-01
Full Text Available En la floricultura colombiana, cerca del 14 % de los costos de producción del crisantemo o pompón (Dendranthema grandiflorum (Ramat. Kitam., está representado por la luz complementaria requerida para controlar su floración. Con el fin de encontrar un protocolo que hiciera uso de un menor suministro de luz, en este trabajo se compararon los efectos de dos esquemas de complemento lumínico nocturno sobre algunas características precosecha y poscosecha en dos variedades comerciales tipo spider de crisantemo: Super White y Super Yellow. El esquema testigo de suplemento lumínico nocturno consistió en aportar la adición durante 28 días para la variedad Super Yellow, y 26 para la variedad Super White. La propuesta alternativa de adición lumínica nocturna consistió en interrumpir el estímulo durante una noche completa cada dos días. Tal disminución del estímulo lumínico, en aproximadamente un 30 %, no afectó el crecimiento ni las características poscosecha de las variedades evaluadas.In Colombian floriculture, nearly 14% of the production costs of chrysanthemum (Dendranthema grandiflorum (Ramat. Kitam. consists of the additional lighting required to control its flowering. In order to find a protocol that consumes a lower amount of electricity, this study compared the effects of two supplementary noctural lighting schemes on several preharvest and postharvest characteristics in two commercial varieties of chrysanthemum: Super White and Super Yellow. The control nocturnal lighting scheme consisted of providing the supplemental lighting during 28 days for the Super Yellow variety and during 26 days for the Super White variety. The alternative nocturnal lighting scheme consisted of interrupting the stimulus during one complete night every two days. This approximately 30% reduction in light stimulation did not affect either growth or postharvest characteristics of the varieties evaluated.
Low doses of gamma radiation in the management of postharvest Lasiodiplodia theobromae in mangos
Directory of Open Access Journals (Sweden)
Alice Maria Gonçalves Santos
2015-09-01
Full Text Available The postharvest life of mango is limited by the development of pathogens, especially fungi that cause rot, among which stands out the Lasiodiplodia theobromae. Several control methods have been employed to minimize the damages caused by this fungus, chemical control can leave residues to man and nature; physical control by the use of gamma radiation in combination with modified atmosphere and cold storage. The use of gamma radiation helps to reduce the severity of the pathogen assist in the ripening process of fruits, even at low doses (0.25, 0.35 and 0.45 kGy chemical properties such as pH, soluble solids, acid ascorbic, titratable acidity and also the quality parameters of the pulp showed no damage that are ideal for trade and consumption of mangoes. This treatment can be extended for use in the management of diseases such as natural infections for penducular rot complex that has as one of L. theobroma pathogens involved.
Effects of Paclobutrazol on Growth and Flowering of Bougainvillea spectabilis WILLD
KARAGÜZEL, Osman
2014-01-01
The effects of paclobutrazol were examined in respect to the growth and flowering of Bougainvillea spectabilis WILLD under conditions of long and short natural photoperiods. In the middle of July and at the beginning of November, doses of paclobutrazol; 0 (control), 10, 20, 30 and 50 mg a.e./pot soil drench, and 0 (control), 125, 250, 500 and 1000 ppm foliage spray, were applied to plants grown in 18 cm pots (h=16.5 cm). With the application of paclobutrazol in the form of soil drench and fol...
Effects of Polysaccharides from Platycodon grandiflorum on Immunity-Enhancing Activity In Vitro
Directory of Open Access Journals (Sweden)
Xiaona Zhao
2017-11-01
Full Text Available The study is aimed at investigating the immunoenhancement activity of polysaccharides from Platycodon grandiflorum polysaccharides (PGPSs in vitro. In this study, some research on lymphocyte proliferation, cell cycle, and the levels of CD4+ and CD8+ T cells were performed. Four different concentrations of PGPSs (PGPStc, PGPS60c, PGPS80c, and PGPStp were harvested and added to peripheral blood T lymphocytes. We observed significant increases in T lymphocyte proliferation at PGPStc groups individually or synergistically with phytohemagglutinin (PHA at most concentrations, and their lymphocyte proliferation rates were the highest. The active sites of PGPStc and PGPS60c were subsequently chosen. Then, we utilized flow cytometry to determine lymphocyte cell cycle distribution and levels of CD4+ and CD8+ T cells. At most time points, PGPStc could facilitate lymphocyte cell cycle progression from the G0/G1 phase to the S and G2/M phases and, simultaneously, increase the levels of CD4+ and CD8+ T cells. These results indicate that PGPStc enhances the immune functions, suggesting that PGPStc could be a potential immunopotentiator for further in vivo and clinical trial experiments.
Energy Technology Data Exchange (ETDEWEB)
Soto Moran, R L [Universidad de La Habana, La Habana (Cuba). Facultad de Fisica; Szegedi, S [Kossuth Lajos Tudomanyegyetem, Debrecen (Hungary). Fizikai Kemiai Intezete; Llopiz, J L [Universidad de La Habana, La Habana (Cuba). Instituto de Materiales y Reactivos para la Electronica
1996-05-01
By means of x-ray fluorescence and fast neutron activation analysis the nitrogen content has been determined in samples of roots, stems, leaf, flowers and grains from Quinua (Chenopodium Quinoa Willd), which was previously treated with fertilizer.
L’orobe (Vicia ervilia L. Willd.) au Maroc
El Fatehi, Salama; Ater, Mohammed
2017-01-01
Dans cette contribution nous allons présenter certains aspects de l’histoire de la nomenclature et des usages de la culture de l’orobe (Vicia ervilia L. Willd.). Bien que cette culture soit actuellement considérée comme mineure et utilisée uniquement dans l’alimentation animale, cela n’a pas été toujours le cas. A certaines époques la culture de l’orobe était plus importante et occupait une place importante parmi les légumineuses cultivées. Même si elle était peu appréciée, elle était utilisé...
International Nuclear Information System (INIS)
Soto Moran, R.L.; Szegedi, S.; Llopiz, J.L.
1996-01-01
By means of x-ray fluorescence and fast neutron activation analysis the nitrogen content has been determined in samples of roots, stems, leaf, flowers and grains from Quinua (Chenopodium Quinoa Willd), which was previously treated with fertilizer
Characterization of the legumains encoded by the genome of Theobroma cacao L.
Santana, Juliano Oliveira; Freire, Laís; de Sousa, Aurizangela Oliveira; Fontes Soares, Virgínia Lúcia; Gramacho, Karina Peres; Pirovani, Carlos Priminho
2016-01-01
Legumains are cysteine proteases related to plant development, protein degradation, programmed cell death, and defense against pathogens. In this study, we have identified and characterized three legumains encoded by Theobroma cacao genome through in silico analyses, three-dimensional modeling, genetic expression pattern in different tissues and as a response to the inoculation of Moniliophthora perniciosa fungus. The three proteins were named TcLEG3, TcLEG6, and TcLEG9. Histidine and cysteine residue which are part of the catalytic site were conserved among the proteins, and they remained parallel in the loop region in the 3D modeling. Three-dimensional modeling showed that the propeptide, which is located in the terminal C region of legumains blocks the catalytic cleft. Comparing dendrogram data with the relative expression analysis, indicated that TcLEG3 is related to the seed legumain group, TcLEG6 is related with the group of embryogenesis activities, and protein TcLEG9, with processes regarding the vegetative group. Furthermore, the expression analyses proposes a significant role for the three legumains during the development of Theobroma cacao and in its interaction with M. perniciosa. Copyright © 2015 Universidade Estadual de Santa Cruz, CNPJ: 40738999/0001-95. Published by Elsevier Masson SAS.. All rights reserved.
DEFF Research Database (Denmark)
Bendevis, Mira Arpe; Sun, Yujie; Shabala, Sergey
2014-01-01
Adaptation of quinoa (Chenopodium quinoa Willd.) to new regions demands acclimation to day-length, in addition to a host of other abiotic factors. To further elucidate the effects of photoperiod on development of quinoa, two differently adapted cultivars, Achachino (short day) from Bolivia and Ti...
Directory of Open Access Journals (Sweden)
mahin nikoo
2018-03-01
Full Text Available Introduction: One of the climate change sign is variation in greenhouse gases in the Earth's atmosphere. Carbon dioxide is the most important greenhouse gas that is released into the atmosphere by humans. It is expected that addition of carbon dioxide could effect the energy balance and global climate. Climate change is effective on agricultural productions. It is clear that different plants have different responses to Co2 variation. These responses are consisting of yield, growth characteristic and variation in root/shoot ratio of plants. On the other hand, using growing media are expanding for plants because of their advantages such as plants nutrient control, reducing the incidence of diseases and pests and increasing the quantity and quality rather than soil cultivation. Properties of various materials as substrates influence directly or indirectly on plant growth and crop production., Hydroponic method can be considered as one of the important methods to optimize water use in agriculture, especially in many countries are located in arid and semi-arid regions that have water crisis. Lisianthus is one of the most beautiful flowers with folded petals in white, blue and purple. I-ts scientific name is Eustoma grandiflorum from the family of Gentianaceae and native to North America. It has variety of annual, biennial or short-lived perennial. The aim of this study was to explore the effect of Co2 enrichment on growth response of aboveground and belowground of Eustoma grandiflorum under increasing of Co2 greenhouse gases in hydroponic culture. Materials and Methods: The experiment was done as a split-plot based on completely randomized experimental design with three replications at greenhouse of Ferdowsi University of Mashhad. The treatments were consists of three concentrations of carbon dioxide (380 as controls, 750 and 1050 ppm as main plots and two cultivars Yodel white and GCREC-blue as subplots. Some characteristic such as plant height
Directory of Open Access Journals (Sweden)
Alexandre Porte
2010-09-01
Full Text Available A literatura científica é pobre a respeito de frutas da Amazônia, como o murici, e suas características químicas devem ser estudadas. Por isso, esta pesquisa teve por proposta determinar o perfil aminoacídico das polpas de bacuri, cupuaçu e murici sob diferentes valores de pH (3,3, 5,8, 8,0 e 12,0, sem aquecimento ou com aquecimento por 12 horas/100 ºC com agitação e refluxo. Valores de pH, glicose, frutose e sacarose também foram determinados nas polpas sem aquecimento. Os nutrientes foram determinados por CLAE (Cromatografia Líquida de Alta Eficiência. As polpas de bacuri, cupuaçu e murici apresentaram valores de pH 3,2, 3,6 e 3,35, respectivamente. A sacarose foi, quantitativamente, o principal carboidrato nas polpas de cupuaçu (38,34% e bacuri (36,93%, sendo que os teores de frutose e glicose foram similares, tanto na polpa de cupuaçu (8,93% e 9,03% como na de bacuri (12,63% e 11,65%, respectivamente. Em contraste, a polpa de murici foi quase isenta de sacarose (0,57%, mas não de frutose (11,51% ou glicose (11,39%. Nas polpas sem aquecimento, os principais aminoácidos foram: ácido glutâmico (46,6 mg/kg, ácido aspártico (28,8 mg/kg e arginina (25,3 mg/kg na polpa de bacuri; ácido aspártico (56,3 mg/kg, ácido glutâmico (44,0 mg/kg e alanina (24,2 mg/kg na polpa de cupuaçu; prolina (73,5 mg/kg, ácido glutâmico (23,7 mg/kg e ácido aspártico (23,5 mg/kg na polpa de murici. O aquecimento reduziu as concentrações de todos os aminoácidos nas 3 polpas. O meio fortemente alcalino (pH 12 produziu a maior degradação de aminoácidos. Lisina foi mais sensível ao aquecimento do que outros aminoácidos em pH 12.Scientific literature presents few studies about fruits of the Amazonia, like murici, and yours chemical characteristics should be studied. Therefore, amino acid profiles of the bacuri, cupuaçu and murici pulps were determined under different values of pH (3.3, 5.8, 8.0 and 12.0 with heating (12 hours/100 ºC, with stirring and refluxing or without heating. Glucose, fructose, sucrose and pH values also were obtained in the pulps without heating. All nutrients were analised by HPLC. The pHs were: 3.2, 3.6 and 3.35 in the bacuri, cupuaçu and murici pulps, respectively. Sucrose (38.34% and 36.93% was the major carbohydrate while fructose (8.93% and 12.63% and glucose (9.03% and 11.65% shown similar percentages in the cupuaçu and bacuri pulps. Murici pulp was almost free of sucrose (0.57%, but not of fructose (11.51% or glucose (11.39%. In the pulps without heating the major amino acids were: glutamic acid (46.6 mg/kg, aspartic acid (28.8 mg/kg and arginine (25.3 mg/kg in the bacuri pulp; aspartic acid (56.3 mg/kg, glutamic acid (44.0 mg/kg and alanine (24.2 mg/kg in the cupuaçu pulp; proline (73.5 mg/kg, glutamic acid (23.7 mg/kg and aspartic acid (23.5 mg/kg in the murici pulp. The heating of the 3 pulps decresead the concentration of all amino acids. The medium strongly alkaline (pH 12 produced more degradation of the amino acids than others pHs. Lysine was more sensible to the heating than others amino acids in pH 12.
Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.
Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ~4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification pr...
Colorimetric analysis of edible flower of Dendranthema grandiflorum processed by ionizing radiation
Energy Technology Data Exchange (ETDEWEB)
Koike, Amanda C. Ramos; Rodrigues, Flavio Thihara; Fanaro, Gustavo Bernardes; Villavicencio, Anna Lucia C.H., E-mail: amandaramosk@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2013-07-01
Edible flowers can be used to add flavor, color, taste and visual appeal to culinary preparations as salads, soups, desserts and drinks. There are many edible flowers rich in minerals, vitamins, pollen, nectar and other essential nutrients that are important for human nutrition. Food irradiation is a viable technology for disinfestation of insect, to increase extending the shelf life of perishable products and improving the hygienic quality of food. The irradiation technology is a good alternative method to replace chemical fumigation of pest insects present in foods and flowers. The purpose of this study was evaluate the color of Dendranthema grandiflorum exposed low-dose ionizing radiation: 0.3 kGy, 0.4 kGy, 0.5 kGy, 0.6 kGy, 0.7 kGy, and 0.8 kGy of {sup 60}Co using colorimeter (Konica Minolta Chroma Meter CR-400), were used samples of chrysanthemum in yellow, white and red. The petals of the flowers were used for the chromaticity value. The samples of irradiated chrysanthemum (white, yellow and red) processed with 0.3 to 0.6 kGy haven't shown significantly difference when compared to the control sample, the dose of 0.3 kGy, dose it is necessary to sterilize. (author)
Colorimetric analysis of edible flower of Dendranthema grandiflorum processed by ionizing radiation
International Nuclear Information System (INIS)
Koike, Amanda C. Ramos; Rodrigues, Flavio Thihara; Fanaro, Gustavo Bernardes; Villavicencio, Anna Lucia C.H.
2013-01-01
Edible flowers can be used to add flavor, color, taste and visual appeal to culinary preparations as salads, soups, desserts and drinks. There are many edible flowers rich in minerals, vitamins, pollen, nectar and other essential nutrients that are important for human nutrition. Food irradiation is a viable technology for disinfestation of insect, to increase extending the shelf life of perishable products and improving the hygienic quality of food. The irradiation technology is a good alternative method to replace chemical fumigation of pest insects present in foods and flowers. The purpose of this study was evaluate the color of Dendranthema grandiflorum exposed low-dose ionizing radiation: 0.3 kGy, 0.4 kGy, 0.5 kGy, 0.6 kGy, 0.7 kGy, and 0.8 kGy of 60 Co using colorimeter (Konica Minolta Chroma Meter CR-400), were used samples of chrysanthemum in yellow, white and red. The petals of the flowers were used for the chromaticity value. The samples of irradiated chrysanthemum (white, yellow and red) processed with 0.3 to 0.6 kGy haven't shown significantly difference when compared to the control sample, the dose of 0.3 kGy, dose it is necessary to sterilize. (author)
Frosty pod rot (FPR), caused by Moniliophthora roreri is responsible for significant losses in Theobroma cacao. Due to the limited options for FPR management, biological control methods using Trichoderma are being studied. Combinations of three formulations and two Trichoderma isolates were studied ...
Presence of heavy metals in organic cacao (theobroma cacao l.) crop
HuamanI-Yupanqui, Hugo Alfredo; Huauya-Rojas, Miguel Ángel; Mansilla-Minaya, Luis Germán; Florida-Rofner, Nelino; Neira-Trujillo, Gilmer Milton
2013-01-01
La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...
Theobroma cacao seedlings from the genotype CCN 51 were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16 and 32 mg Cu L-1) in nutrient solution. When doses were equal or higher than 8 mg Cu L-1, after 24 h of treatment application, leaf gas exch...
Fertilisation minérale du cacaoyer ( Theobroma cacao L.) en Côte d ...
African Journals Online (AJOL)
En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point ...
Cacao (Theobroma cacao L.) is indigenous to the Amazon region of South America. The Peruvian Amazon harbors a large number of diverse cacao populations. Since the 1930s, several numbers of populations have been collected from the Peruvian Amazon and maintained as ex situ germplasm repositories in ...
Directory of Open Access Journals (Sweden)
Yuli Yetri
2016-11-01
Full Text Available Efek inhibisi korosi dan sifat-sifat adsorpsi oleh ekstrak kulit buah kakao (Theobroma cacao pada baja lunak (mild steel dalam larutan asam 1,5M HCl telah dipelajari menggunakan teknik konvensional metode berat hilang pada variasi waktu, konsentrasi dan suhu. Parameter-parameter termodinamika seperti energi aktivasi, entalpi, entropi dan perubahan energi bebas dihitung. Polarisasi elektrokimia telah dievaluasi untuk memastikan jenis inhibitor. Spektra infrared dan GCMS dilakukan untuk mengetahui senyawa ekstrak yang berperan dalam proses inhibisi. Morfologi permukaan sampel diamati dengan menggunakan scanning electro microscopy dengan energy dispersive X-ray spectroscopy (SEM-EDX . Keseluruhan hasil penelitian menunjukkan bahwa ekstrak polar kulit buah coklat dapat digunakan sebagai inhibitor korosi yang efektif pada baja karbon di lingkungan 1,5M HCl dengan pencapaian efisiensi inhibisi terkorosi sebesar 96.26% (weight loss dan 92.08% (Tafel pada konsentrasi ekstrak 2,5% selama768 jam. Mekanisme inhibisi adalah adsorpsi chemiadsorpsi berdasar tingginya nilai entalpi dan energi bebas.Effisiensi Inhibisi diketahui meningkat dengan peningkatan konsentrasi dari ekstrak serta menurun dengan peningkatan suhu. Kurva polarisasi menunjukkan inhibitor ini berperilaku sebagai inhibitor campuran dengan dominan pada inhibisi katodik. Ekstrak diadsorpsi oleh permukaan mild steel mengikuti model adsorpsi isotherm Langmuir. Kondisi permukaan mild steel menunjukan terjadinya adsorpsi di permukaan membentuk lapisan tipis di permukaan logam. Penambahan ekstrak kulit buah kakao ke dalam larutan HCl sangat efektif untuk mengurangi serangan korosi di permukaan mild steel. Kata kunci: Korosi, Inhibitor, Theobroma cacao, Mild steel, Potensiodinamik Corrosion Inhibition Efficiency Mild Steel in Acid Media with Inhibitor Peels Extract of Cacao (Theobroma cacaoABSTRACT Inhibition and adsorption properties of Theobroma cacao peel polar extract
In vitro immunomodulatory potential of Artemisia indica Willd. in chicken lymphocytes
Directory of Open Access Journals (Sweden)
Pushpa Ruwali
2018-01-01
Full Text Available Aim: Evaluation of the in vitro immunomodulatory potential of Artemisia indica Willd. methanolic extract in chicken lymphocyte culture system through lymphocyte (B and T cells proliferation assay, after standardizing the maximum non-cytotoxic dose (MNCD in chicken lymphocytes. Materials and Methods: Fresh aerial parts of A. indica Willd. (family: Asteraceae specimens were collected (altitude 1560 m, gotten authenticated, processed, dried, and Soxhlet extracted to yield methanolic extract (AME. Chicken splenocytes were isolated from spleens collected from healthy birds; lymphocytes were separated by density gradient centrifugation, percentage cell viability determined and final cell count adjusted to 107 cells/ml in RPMI-1640 medium. MNCD of AME in chicken lymphocytes was determined through 3-(4,5-dimethylthiazol-2-y1-2,5-diphenyltetrazolium bromide dye reduction assay. Immunomodulatory potential of AME was evaluated through lymphocytes proliferation or B and T cells blastogenesis assay in the presence of appropriate mitogens, namely, lipopolysaccharide (LPS and concanavalin A (Con A, respectively. Results: Maximum concentration of AME exhibiting 100% cell viability (MNCD was 200 μg/ml and was selected for further in vitro analysis. The in vitro exposure of chicken lymphocytes to 200 μg/ml dose of AME, resulted in significant (p<0.05 upregulation of 11.76% in B cell proliferation in the presence of B cell mitogen (LPS and a significant (p<0.05 increase of 12.018% T cells proliferation in the presence of the mitogen (Con A, as compared to the control. Conclusion: The significant upregulation in the proliferation of two major cell types modulating the immune system is an indication of the immunostimulatory potential of the plant. It would be worthwhile to further evaluate A. indica on relevant immunomodulatory aspects, especially the in vivo studies in a poultry system.
In vitro immunomodulatory potential of Artemisia indica Willd. in chicken lymphocytes.
Ruwali, Pushpa; Ambwani, Tanuj Kumar; Gautam, Pankaj
2018-01-01
Evaluation of the in vitro immunomodulatory potential of Artemisia indica Willd. methanolic extract in chicken lymphocyte culture system through lymphocyte (B and T cells) proliferation assay, after standardizing the maximum non-cytotoxic dose (MNCD) in chicken lymphocytes. Fresh aerial parts of A. indica Willd. (family: Asteraceae) specimens were collected (altitude 1560 m), gotten authenticated, processed, dried, and Soxhlet extracted to yield methanolic extract (AME). Chicken splenocytes were isolated from spleens collected from healthy birds; lymphocytes were separated by density gradient centrifugation, percentage cell viability determined and final cell count adjusted to 10 7 cells/ml in RPMI-1640 medium. MNCD of AME in chicken lymphocytes was determined through 3-(4,5-dimethylthiazol-2-y1)-2,5-diphenyltetrazolium bromide dye reduction assay. Immunomodulatory potential of AME was evaluated through lymphocytes proliferation or B and T cells blastogenesis assay in the presence of appropriate mitogens, namely, lipopolysaccharide (LPS) and concanavalin A (Con A), respectively. Maximum concentration of AME exhibiting 100% cell viability (MNCD) was 200 μg/ml and was selected for further in vitro analysis. The in vitro exposure of chicken lymphocytes to 200 µg/ml dose of AME, resulted in significant (p<0.05) upregulation of 11.76% in B cell proliferation in the presence of B cell mitogen (LPS) and a significant (p<0.05) increase of 12.018% T cells proliferation in the presence of the mitogen (Con A), as compared to the control. The significant upregulation in the proliferation of two major cell types modulating the immune system is an indication of the immunostimulatory potential of the plant. It would be worthwhile to further evaluate A. indica on relevant immunomodulatory aspects, especially the in vivo studies in a poultry system.
Directory of Open Access Journals (Sweden)
A. S. J. C. Ramos
2017-06-01
Full Text Available Abstract Crypticerya zeteki (Cockerell, 1914 (Hemiptera: Coccomorpha: Monophlebidae is recorded for the first time from Brazil and Maconellicoccus hirsutus (Green, 1908 (Hemiptera: Coccomorpha: Pseudococcidae is recorded for the first time from the state of Maranhão, Brazil. Both species were collected from branches, leaves and fruits of various fruit trees in the municipalities of São José de Ribamar, São Luís and Paço do Lumiar, Maranhão, Brazil. Crypticerya zeteki was collected on Citrus spp. (Rutaceae, Cocos nucifera (L. (Arecaceae, Cycas revoluta L. (Cycadaceae, Malpighia punicifolia L. (Malpighiaceae, Mangifera indica L. (Anacardiaceae, Musa paradisiaca L. (Musaceae and Theobroma grandiflorum Schum (Malvaceae, all first records for this species. Maconellicoccus hirsutus was collected on Spondias tuberosa Arruda (Anacardiaceae and M. punicifolia L. (Malpighiaceae, both new records for this species.
Factors controlling phenol content on Theobroma cacao callus culture
International Nuclear Information System (INIS)
Quiñones-Galvez, Janet; HernándezTorre, Martha de la; Quirós Molina, Yemeys; Capdesuñer Ruiz, Yanelis; Trujillo Sánchez, Reinaldo
2016-01-01
Theobroma cacao L. is known in folk medicine as an antiseptic, diuretic and antiparasitic. Foods derived from this plant are rich in natural products of high added value, including phenolic compounds. As in vitro cultivation handle is an alternative source for the production of these metabolites. The present study was conducted to obtain phenolic compounds from callus culture with embryogenic structures. Culture conditions (agitation, light and glucose) were established to increase the concentration of phenols in calluses and elicitors to achieve the increase in callus and excretion into the culture area. The accumulation of phenolic compounds was favored with the additional supplement of glucose, growth in agitation and darkness. The addition of random hydroxylated cyclodextrins allowed the increase in the specific yield of phenols and biomass. (author)
Zoochoric and hydrochoric maritime dispersal of the Opuntia monacantha (Willd. Haw. (Cactaceae
Directory of Open Access Journals (Sweden)
Angelo Martins Fraga
2012-03-01
Full Text Available Evolutionary adaptations in the morphology and physiology of cactus species have been associated to their mechanisms of dispersal and colonization. The dispersal mechanisms and modes of Opuntia monacantha (Willd. Haw. (Cactaceae were characterized in two beaches in Florianopolis, SC, Brazil. A marsupial from the genus Didelphis (Mammalia: Didelphidae was the only frugivorous and, thus, disperser of fruits, presenting specific eating places. The maritime hydrochory was due to the overwash on restinga vegetation, it is characterized by the dispersal of cladodes and fruits at various times of the year. It is here firstly described the sea action as a potential disperser for a cactus species.
Ruiz, Geraldine Avila; Xiao, Wukai; Boekel, van Tiny; Minor, Marcel; Stieger, Markus
2016-01-01
The aim of this study was to determine the influence of extraction pH on heat-induced aggregation, gelation and microstructure of suspensions of protein isolates extracted from quinoa (Chenopodium quinoa Willd). Quinoa seed protein was extracted by alkaline treatment at various pH values (pH 8
Cocoa Bean (Theobroma cacao L.Drying Kinetics Cinética del Secado de Cocoa (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Ndukwu MacManus Chinenye
2010-12-01
Full Text Available Cocoa (Theobroma cacao L. is widely produced in West Africa and South America and is a great economic tree crop, with so many industrial uses. In this work, the experimental drying kinetics of foreign species was investigated, and the experiments were carried out under isothermal conditions, using heated batch drier at 55, 70 and 81 ºC. The moisture ratio data obtained from change of moisture content with the drying time was fit to two thin layer drying model with good results. A faster drying process was observed at a higher drying temperature resulting in higher drying rates which is advantageous when evaluating costs. Fick’s second law of diffusion was used to predict effective diffusivity using experimental data assuming that the variation of diffusivity with temperature can be expressed by an Arrhenius type function, and the values of diffusivity obtained ranged from 6.137 x 10-10 to 2.1855 x 10-9 m2 s-1 for the temperature used. The Arrhenius constant (D is predicted at 8.64 x 10-4 m2 s-1 while the activation energy was predicted at 39.94 kJ mol-1.El cacao (Theobroma cacao L. es ampliamente producido en el Oeste de África y Sudamérica y es un cultivo de gran importancia económica, con muchos usos industriales. En este trabajo se investigó la cinética del secado experimental de especies foráneas, y se realizaron experimentos bajo condiciones isotérmicas, usando un secador discontinuo en caliente a 55, 70 y 81 °C. Los datos de relación de humedad obtenidos desde el cambio de contenido de humedad con el tiempo de secado se ajustaron a un modelo de secado de dos capas delgadas con buenos resultados. Se observó un proceso de secado más rápido a una temperatura de secado mayor resultando en mayores tasas de secado, lo que es ventajoso al evaluar costos. La segunda ley de difusión de Fick se usó para predecir difusividad efectiva usando datos experimentales, asumiendo que la variación de difusividad con la temperatura puede ser
Directory of Open Access Journals (Sweden)
Elisabeth de Oliveira
2006-04-01
Full Text Available Este trabalho objetivou determinar algumas características anatômicas e dimensões de fibras, elementos dos vasos, células do parênquima e dos raios da madeira da Mimosa tenuiflora (Willd. Poir. Determinaram-se, ainda, a fração parede das fibras e o porcentual das fibras, dos vasos, dos raios e das células parenquimatosas, bem como a densidade, rendimento e propriedades do carvão vegetal. Conclui-se que a madeira de Mimosa tenuiflora possui poros predominantemente solitários, geminados e múltiplos em agrupamento radial; poros distribuídos em porosidade difusa uniforme; parênquima axial paratraqueal vasicêntrico, vasicêntrico confluente, aliforme e aliforme confluente; raios multisseriados, bisseriados e, menos freqüentemente, unisseriados; e fibras de parede espessa e muito curtas. Obteve-se um rendimento de 39,68% em carvão vegetal, com teor de carbono fixo de 71,70%, densidade igual a 0,51g/cm³, carbono fixo de 71,79 e poder calórico de 6.866 cal/g.The objective of this work was to determine anatomical characteristics, and dimensions of fibers, vessels and parenchyma and ray cells of Mimosa tenuiflora (Willd. Poir wood. Fibers wall fraction, the percentage of fibers, vessels and ray and parenchyma cells, as well as density and charcoal production and properties were determined. The wood of Mimosa teniflora presents predominantly solitary, geminated and multiple porous in radial groups; porous distributed in uniform diffuse porosity; axial parenchyma paratracheal vasicentric, confluent vasicentric, aliform and confluent aliform; multiseriate, biseiat rays and, less frequently, uniseriate ones; very short fibers with thick walls. Charcoal yield was 39.68% with a 0.51g/cm³ density, 71.79% carbon content and 6886cal/g calorific value.
1H NMR study of fermented cocoa (Theobroma cacao L.) beans.
Caligiani, Augusta; Acquotti, Domenico; Cirlini, Martina; Palla, Gerardo
2010-12-08
This study reports for the first time the metabolic profile of cocoa (Theobroma cacao L.) beans using the (1)H NMR technique applied to polar extracts of fermented cocoa beans. The simultaneous detection and quantification of amino acids, polyalcohols, organic acids, sugars, methylxanthines, catechins, and phenols were obtained by assigning the major signals of the spectra for different varieties of cocoa beans (Forastero, Criollo, and Trinitario) from different countries (Ecuador, Ghana, Grenada, and Trinidad). The data set obtained, representative of all classes of soluble compounds of cocoa, was useful to characterize the fermented cocoa beans as a function of the variety and geographic origin.
Assessment of the nutritional composition of quinoa (Chenopodium quinoa Willd.).
Nowak, Verena; Du, Juan; Charrondière, U Ruth
2016-02-15
Quinoa (Chenopodium quinoa Willd.) is an ancient crop which can play an important role for worldwide food security. The current review aimed at evaluating existing compositional data which were compiled according to international standards. A limited number of data were found that met the dataset quality criteria. In general, high variations in nutrient contents of quinoa were observed per 100g edible portion on fresh weight basis, for example: protein (9.1-15.7g), total fat (4.0-7.6g) and dietary fiber (8.8-14.1g). The variations of nutrient values among different varieties and among different data sources were considerable. The results show the nutritional potential of quinoa but they also demonstrate that more high-quality analytical data of quinoa are needed, especially for minerals and vitamins. Copyright © 2015. Published by Elsevier Ltd.
Directory of Open Access Journals (Sweden)
Carla C. Uranga
2017-06-01
Full Text Available Many basic science questions remain regarding protein functions in the pathogen: host interaction, especially in the trunk disease fungi family, the Botryosphaeriaceae, which are a global problem for economically important plants, especially fruiting trees. Proteomics is a highly useful technology for studying protein expression and for discovering novel proteins in unsequenced and poorly annotated organisms. Current fungal proteomics approaches involve 2D SDS-PAGE and extensive, complex, protein extraction methodologies. In this work, a modified Folch extraction was applied to protein extraction to perform both de novo peptide sequencing and peptide fragmentation analysis/protein identification of the plant and human fungal pathogen Lasiodiplodia theobromae. Both bioinformatics approaches yielded novel peptide sequences from proteins produced by L. theobromae in the presence of exogenous triglycerides and glucose. These proteins and the functions they may possess could be targeted for further functional characterization and validation efforts, due to their potential uses in biotechnology and as new paradigms for understanding fungal biochemistry, such as the finding of allergenic enolases, as well as various novel proteases, including zinc metalloproteinases homologous to those found in snake venom. This work contributes to genomic annotation efforts, which, hand in hand with genomic sequencing, will help improve fungal bioinformatics databases for future studies of Botryosphaeriaceae. All data, including raw data, are available via the ProteomeXchange data repository with identifier PXD005283. This is the first study of its kind in Botryosphaeriaceae.
Ahmad, Mohammad Parwez; Hussain, Arshad; Siddiqui, Hefazat Hussain; Wahab, Shadma; Adak, Manoranjan
2015-03-01
Lipopolysaccharide (LPS) induced oxidative stress and impairment of normal physiological function generally categorized by increased anxiety and reduced mobility. Therefore, the present study was to find out the effect Methanolic extract of Asparagus racemosus (MEAR ) in lipopolysaccharide (LPS)-induced oxidative stress in rats . LPS-induced oxidative stress in rats was measured by locomotor activity by photoactometer test, anxiety with elevated plus maze test and also studied the oxidative stress markers, nitric oxide and cytokines. The obtained data shows that LPS markedly exhausted (pAsparagus racemosus Willd. is a functionally newer type of cerebroprotective agent.
The Age of Chocolate: a biogeographic history of Theobroma and Malvaceae
Directory of Open Access Journals (Sweden)
James Edward Richardson
2015-11-01
Full Text Available Dated molecular phylogenies of broadly distributed lineages can help to compare patterns of diversification in different parts of the world. An explanation for greater Neotropical diversity compared to other parts of the tropics is that it was an accident of the Andean orogeny. Using dated phylogenies, of chloroplast ndhF and nuclear DNA WRKY sequence datasets, generated using BEAST we demonstrate that the diversification of the genera Theobroma and Herrania occurred from 12.7 (11.6-14.9 [95% HPD] million years ago (Ma and thus coincided with Andean uplift from the mid-Miocene and that this lineage had a faster diversification rate than other major clades in Malvaceae. We also demonstrate that Theobroma cacao, the source of chocolate, diverged from its most recent common ancestor 9.9 (7.7-12.9 95% HPD Ma, in the mid-to late-Miocene, suggesting that this economically important species has had ample time to generate significant within-species genetic diversity that is useful information for a developing chocolate industry. In addition, we address questions related to the latitudinal gradient in species diversity within Malvaceae. A faster diversification rate is an explanation for the greater species diversity at lower latitudes. Alternatively, tropical conditions may have existed for longer and occupied greater areas than temperate ones meaning that tropical lineages have had more time and space in which to diversify. Our dated molecular phylogeny of Malvaceae demonstrated that at least one temperate lineage within the family diverged from tropical ancestors then diversified at a rate comparable with many tropical lineages in the family. These results are consistent with the hypothesis that Malvaceae are more species rich in the tropics because tropical lineages within the family have existed for longer and occupied more space than temperate ones, and not because of differences in diversification rate.
Directory of Open Access Journals (Sweden)
Amiyatun Naini
2011-11-01
Full Text Available Nylon thermoplastic resin is material of choice for the making of flexible. This denture do not use wire retention, but has the physical properties of water absorption. In the oral cavity, it will always be in contact with food and beverages consumed. One of the foods that are consumed by the public is chocolate. This study aimed to determine the effect of cocoa (Theobroma cacao L on color stability of the thermoplastic nylon denture base. The study sample was thermoplastic nylon (valplast with a size of 10x10x2 mm soaked in the chocolate solution for 7 and 14 days. As the control, the sample soaked with distilled water. The color testing stability used was densitometer. There were significant differences between the control group (distilled water and the chocolate solution. This was due to dissolved components/tannin having a capillary flow diffusion into thermoplastic nylons that causing discoloration. The conclusion of this study, there was the effect of cocoa (Theobroma cacao L against the color stability of the nylon thermoplastic denture base. The longer time of immersion of nylon thermoplastic the greater the change in color.
Niether, Wiebke; Maldonado, Carla; Silva, Erika; Schneider, Monika; Gerold, Gerhard
2013-01-01
Cocoa (Theobroma cacao L.) grows naturally as an understory tree in tropical forests and produces well under shaded and non-shaded conditions. It is cultivated by small scale farmers in South America under various conditions, ranging from monocultures to different kinds of agroforestry systems. While in monocultures it is exposed to direct sunlight, one or various tree species shade the cocoa in agroforestry systems. Also organic cocoa cultivation is becoming more and more popular due to prem...
Potencial de actividad antioxidante de extractos fenólicos de Theobroma cacao L. (cacao)
Quiñones Gálvez, Janet; Trujillo Sánchez, Reinaldo; Capdesuñer Ruiz, Yanelis; Quirós Molina, Yemeys; Hernández de la Torre, Martha
2013-01-01
Introducción: Theobroma cacao L. (cacao), familia Sterculiaceae, es una planta rica en fenoles, los cuales en las plantas son de especial interés por su potente actividad antioxidante, dada esencialmente por sus propiedades redox, que pueden desempeñar un papel importante en la absorción y neutralización de los radicales libres. Objetivos: seleccionar un clon promisorio en la producción de compuestos fenólicos, determinar los órganos con mayor contenido de fenoles, establecer el cultivo in vi...
Directory of Open Access Journals (Sweden)
Renata Piwowarczyk
2011-01-01
Full Text Available A new locality of Orobanche coerulescens Stephan ex Willd. in the Wyżyna Małopolska upland (Garb Pińczowski hummock in central Poland is presented. Over 290 specimens were recorded in a xerothermic grassland of the class Festuco-Brometea comprising species of the class Koelerio glaucae-Corynephoretea canescentis on alkaline, sandy soil. O. coerulescens is extinct at the majority of its localities in Poland and only two localities are known at present.
Directory of Open Access Journals (Sweden)
Carla C. Uranga
2016-09-01
Full Text Available The data described herein is related to the article with the title “Fatty acid esters produced by Lasiodiplodia theobromae function as growth regulators in tobacco seedlings” C.C. Uranga, J. Beld, A. Mrse, I. Cordova-Guerrero, M.D. Burkart, R. Hernandez-Martinez (2016 [1]. Data includes nuclear magnetic resonance spectroscopy and GC–MS data used for the identification and characterization of fatty acid esters produced by L. theobromae. GC–MS traces are also shown for incubations in defined substrate, consisting in Vogel׳s salts supplemented with either 5% grapeseed oil or 5% glucose, the two combined, or 5% fructose. Traces for incubations in the combination of 5% grapeseed oil and 5% glucose for different fungal species are also included. Images of mycelium morphology when grown in 5% glucose with or without 5% grapeseed oil are shown due to the stark difference in mycelial pigmentation in the presence of triglycerides. High concentration gradient data for the plant model Nicotiana tabacum germinated in ethyl stearate (SAEE and ethyl linoleate (LAEE is included to show the transition between growth inhibition and growth induction in N. tabacum by these compounds. Keywords: NMR, GC–MS, Fatty acid esters, Ethyl stearate, Ethyl linoleate, Growth inhibition, Growth induction
Cacao (Theobroma cacao L.) is a native crop of the Americas; however severe losses due to frosty pod (FP) [Moniliophthora roreri (Cif. and Par.)], and black pod (BP) [Phytophthora palmivora (Butl.) Butl.] have reduced cacao in the Americas to only 13.0% of world production. Agronomic practices to co...
Innovations in Health Value and Functional Food Development of Quinoa (Chenopodium quinoa Willd.).
Graf, Brittany L; Rojas-Silva, Patricio; Rojo, Leonel E; Delatorre-Herrera, Jose; Baldeón, Manuel E; Raskin, Ilya
2015-07-01
Quinoa ( Chenopodium quinoa Willd., Amaranthaceae) is a grain-like, stress-tolerant food crop that has provided subsistence, nutrition, and medicine for Andean indigenous cultures for thousands of years. Quinoa contains a high content of health-beneficial phytochemicals, including amino acids, fiber, polyunsaturated fatty acids, vitamins, minerals, saponins, phytosterols, phytoecdysteroids, phenolics, betalains, and glycine betaine. Over the past 2 decades, numerous food and nutraceutical products and processes have been developed from quinoa. Furthermore, 4 clinical studies have demonstrated that quinoa supplementation exerts significant, positive effects on metabolic, cardiovascular, and gastrointestinal health in humans. However, vast challenges and opportunities remain within the scientific, agricultural, and development sectors to optimize quinoa's role in the promotion of global human health and nutrition.
Falque, M.; Lesdalons, C.; Eskes, A.B.
1996-01-01
We compared the influence of pollination intensity (PI) on fruit set and seed number per pod in two cacao (Theobroma cacao L.) clones, IFC5 (Forastero Lower-Amazon Amelonado), which is self-compatible and known to produce a high number of seeds per pod under open pollination, and SCA6 (Forastero
Presencia de metales pesados en cultivo de cacao (Theobroma cacao L.) orgánico
Huamaní-Yupanqui, Hugo Alfredo; Huauya-Rojas, Miguel ángel; Mansilla-Minaya, Luis Germán; Florida-Rofner, Nelino; Neira-Trujillo, Gilmer Milton
2012-01-01
La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...
Quinoa (Chenopodium quinoa Willd.): composition, chemistry, nutritional, and functional properties.
Abugoch James, Lilian E
2009-01-01
Quinoa (Chenopodium quinoa Willd.), which is considered a pseudocereal or pseudograin, has been recognized as a complete food due to its protein quality. It has remarkable nutritional properties; not only from its protein content (15%) but also from its great amino acid balance. It is an important source of minerals and vitamins, and has also been found to contain compounds like polyphenols, phytosterols, and flavonoids with possible nutraceutical benefits. It has some functional (technological) properties like solubility, water-holding capacity (WHC), gelation, emulsifying, and foaming that allow diversified uses. Besides, it has been considered an oil crop, with an interesting proportion of omega-6 and a notable vitamin E content. Quinoa starch has physicochemical properties (such as viscosity, freeze stability) which give it functional properties with novel uses. Quinoa has a high nutritional value and has recently been used as a novel functional food because of all these properties; it is a promising alternative cultivar.
Touihri, Imen; Boukhris, Maher; Marrakchi, Naziha; Luis, José; Hanchi, Belgacem; Kallech-Ziri, Olfa
2015-01-01
Allium roseum L. (Alliaceae) endemic mediterranean specie was represented in the North Africa by 12 different taxa. In the present study, chemical composition, antiproliferative, antioxidant and antimicrobial activities of the essential oil extracted from A. roseum var. grandiflorum Briq. bulbs collected in the North of Tunisia were investigated. Chemical characterization has shown methyl methanethiosulfinate as major sulphurous compounds. A. roseum bulbs essential oil provides interesting antiproliferative activity against two human colonic adenocarcinoma HT29 and CACO2 cell lines in dose-dependent manner with a half-maximal inhibition (IC50) of 4.64 µg/mL and 8.22 µg/mL respectively. The antioxidant activity, as determined by FRAP assay, was 285 µmol equivalent Trolox/g of essential oil. The scavenging effect on DPPH radicals of essential oil was estimated as IC50 values at 156 µg/mL. The inhibition of superoxide anion production in a model of cancer cell lines was significant for both lines HT29 and CACO2 with IC50 of 20.25 µg/mL and 29.12 µg/mL respectively. Allium roseum essential oil exhibited antibacterial and antifungal activities with a high effectiveness against Candida albicans given by an MIC value of 0.019 mg/mL. This biological effect appears to be related mainly to the presence of organosulfur compounds.
Lifescience Database Archive (English)
Full Text Available Theobroma cacao ... 2n=20 ... 2011 Sanger (WGS), Roche/454 , Illumina 26 Gb 326 Mb 16.7x... Newbler 4,792 25,912 EUGene following specific training for T. cacao 28,798 CIRAD; http://cocoagendb.cirad.fr Dec2010 Dec2010 10.1038/ng.736 21186351 ...
Costa, Marion P; Monteiro, Maria Lucia G; Frasao, Beatriz S; Silva, Vitor L M; Rodrigues, Bruna L; Chiappini, Claudete C J; Conte-Junior, Carlos A
2017-01-01
Although the demand for goat milk products has been growing, they have lower consumer acceptability than products derived from cow milk. However, the addition of cupuassu pulp can be used to improve the formulation of these products. For this reason, the aim of this study was to investigate the influence of new goat milk yogurt manufactured with cupuassu pulp on physicochemical properties, consumers' perceptions, and overall consumer acceptance. In addition, the effect of antioxidant health information on consumer acceptance and purchase intention of cupuassu goat milk yogurts was evaluated. The results demonstrated a positive expectation regarding linking and familiarity to goat milk products and products with cupuassu pulp. The pH, total phenolic content, lightness, redness, yellowness, and apparent viscosity were potentially affected by the addition of cupuassu, with the highest concentration of cupuassu (10%) exhibiting the greatest changes in parameters. Based on principal component analysis, partial least squares regression, and just-about-right and penalty analysis, the addition of cupuassu pulp improved some sensory attributes of goat milk yogurt, such as cupuassu aroma, cupuassu flavor, yellow color, consistency, and viscosity, which positively influenced product acceptance. In addition, antioxidant health information increased the acceptance and purchase intention of cupuassu goat milk yogurts. Taking into account the parameters investigated in this study, the best scoring formulation was goat milk yogurt with 10% cupuassu pulp. Our results suggest that cupuassu pulp can be considered a potential ingredient to improve the sensory and texture properties of goat milk yogurt. Furthermore, the antioxidant health information could be a sensory strategy to increase the acceptance of cupuassu goat milk yogurts. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Andrea Marronato
2016-12-01
Full Text Available Ingredients of natural origin may represent alternatives for formulating sunscreens, without compromising their effectiveness. The literature has shown the antioxidant potential of compounds existing in murumuru (Astrocaryum murmuru, cupuaçu (Theobroma grandiflorum and cocoa (Theobroma cacao butters that recommends further investigation. The objectives of this research were: (1 to develop bioactive photoprotective formulations containing cocoa, murmuru or cupuaçu butters in association with a physical sunscreen (titanium dioxide (TiO2 and (2 determine the possible photoprotective activity of butters and their interactions with the sunscreen. Cocoa, cupuaçu and murumuru butter were individually associated to TiO2 in O / W emulsions. The anti-UVA and UVB efficacy in vitro was estimated by diffuse transmittance analysis in a Labsphere® UV2000S, using quartz plates and Transpore® tape to obtain the SPF (sun protection factor and critical wavelength. Photoprotective formulations containing titanium dioxide and bioactive butters were obtained using Aristoflex® AVC and triglycerides of caprylic capric acid (GTCC. The SPF of the samples containing only TiO2 and formulations containing cocoa, murumuru or cupuassu butters associated with TiO2 ranged from 4 to 5. The critical wavelength values for these formulations ranged from 383.0 to 386.7 nm. The results indicated no increase in the SPF value for formulations containing vegetable butters. The critical wavelength values indicated their potential to absorb part of the UVA radiation.
Origin and Domestication of Native Amazonian Crops
Directory of Open Access Journals (Sweden)
Doriane Picanço-Rodrigues
2010-01-01
Full Text Available Molecular analyses are providing new elements to decipher the origin, domestication and dispersal of native Amazonian crops in an expanding archaeological context. Solid molecular data are available for manioc (Manihot esculenta, cacao (Theobroma cacao, pineapple (Ananas comosus, peach palm (Bactris gasipaes and guaraná (Paullinia cupana, while hot peppers (Capsicum spp., inga (Inga edulis, Brazil nut (Bertholletia excelsa and cupuassu (Theobroma grandiflorum are being studied. Emergent patterns include the relationships among domestication, antiquity (terminal Pleistocene to early Holocene, origin in the periphery, ample pre-Columbian dispersal and clear phylogeographic population structure for manioc, pineapple, peach palm and, perhaps, Capsicum peppers. Cacao represents the special case of an Amazonian species possibly brought into domestication in Mesoamerica, but close scrutiny of molecular data suggests that it may also have some incipiently domesticated populations in Amazonia. Another pattern includes the relationships among species with incipiently domesticated populations or very recently domesticated populations, rapid pre- or post-conquest dispersal and lack of phylogeographic population structure, e.g., Brazil nut, cupuassu and guaraná. These patterns contrast the peripheral origin of most species with domesticated populations with the subsequent concentration of their genetic resources in the center of the basin, along the major white water rivers where high pre-conquest population densities developed. Additional molecular genetic analyses on these and other species will allow better examination of these processes and will enable us to relate them to other historical ecological patterns in Amazonia.
Development and evaluation of emulsifying systems of the material grease from Brazilian flora
Directory of Open Access Journals (Sweden)
Douglas Dourado
2015-10-01
Full Text Available Context: Oils and butter of seed from Brazilian biodiversity are extending the range of innovative products for cosmetics development. They have a fat potential similar to skin composition, leading to the improved performance of these product. Aims: Improve the emulsions spreadability through prior screening of grease composition and studying the viscosity, and the emulsions accelerated stability. Methods: Emulsions were formulated using oils from semiarid plants from Bahia: Syagrus coronate, Pachira retusa, and Pachira aquatica, so as to compare them with oils already standard in the production of cosmetics. Spreadability and stability tests were made comparing the results. The same criteria were used with Amazon seed butter: Virola surinamensis, Butyrospermum parkii, Astrocaryum murumuru, Theobroma cacao and Theobroma grandiflorum. For the emulsions screening and performance, a system was developed for oil/ butter, following tests of accelerated stability, viscosity, and spreadability. Results: The combined system of spreadability was optimized using screening. Emollients containing oleic and palmitic acids, and light chain fatty acids obtained good spreadability. The oil emulsion containing Pachira retusa and Virola surinamensis butter had a higher viscosity. Conclusions: With high content of fatty acids such as oleic, palmitic or the light chain fatty acids obtain an appropriated appearance, texture, and spreadability for cosmetic use. Thus, oils with a low fatty acid content may be combined with butter that have a high fatty acid content and vice-versa. Analyzing and strategically combining grease composition, one can optimize the performance of cosmetic formulations.
Deploying the carbonization of cupuacu rind for energy use
Energy Technology Data Exchange (ETDEWEB)
Santos, Eyde Cristianne Saraiva dos; Mendonca, Marco Antonio de Freitas [Universidade Federal do Amazonas (DEAS/FCA/UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias. Dept. de Engenharia Agricola e Solos; Araujo, Moises Silva; Moura, Rodolfo Pessoa de Melo [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias; Seye, Omar; Mota, Sheila Cordeiro [Universidade Federal do Amazonas (CDEAM/UFAM), Manaus, AM (Brazil). Centro de Desenvolvimento Energetico Amazonico; Azevedo, Daniel de Menezes [Universidade Federal do Amazonas (DPAV/FCA/UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias. Dept. de Producao Animal e Vegetal
2008-07-01
The State of Amazonas presents one of the smallest deforestation index (0,04%), due mainly to the the development model adopted in the state, which contributes for the preservation of the forest. Farming activities are important to the local economy, and among several native species commercially cultivated, one deserves special attention, namely, the fruit of cupuacuzeiro (Theobroma grandiflorum), since it is highly appreciated and consumed in Amazon region. The residuum produced from its improvement (rind), when gathered next to the plantation can cause the proliferation of phytopathogenic agents, resulting in economic prejudices to the producers. Aiming to use its rind for energy use, it has been proceeded a study of carbonization in igloo-like oven, at the Experimental Farm of the Federal University of Amazon. The duration of rind carbonization took 25 hours, and the energy characteristics for energy use has been proven to be acceptable, as for example the calorific capacity of 23, 8 MJ/kg. (author)
Directory of Open Access Journals (Sweden)
Norbert Kunert
2015-07-01
Full Text Available Native fruiting plants are widely cultivated in the Amazon, but little information on their water use characteristics can be found in the literature. To explore the potential impacts of plantations on local to regional water balance, we studied plant water use characteristics of two native fruit plants commonly occurring in the Amazon region. The study was conducted in a mixed fruit plantation containing a dicot tree species (Cupuaçu, Theobroma grandiflorum and a monocot palm species (Açai, Euterpe oleracea close to the city of Manaus, in the Central Amazon. Scaling from sap flux measurements, palms had a 3.5-fold higher water consumption compared to trees with a similar diameter. Despite the high transpiration rates of the palms, our plantation had only one third of the potential water recycling capacity of natural forests in the area. Converting natural forest into such plantations will thus result in significantly higher runoff rates.
Energy Technology Data Exchange (ETDEWEB)
Silva, Antonio Cleuder Lima da [Manaus Energia S/A., Manaus, AM (Brazil); Santos, Eyde Cristiane Saraiva dos [Universidade Federal do Amazonas (FCA/UFAM), Manaus, AM (Brazil). Faculdade de Ciencias Agrarias. Dept. de Engenharia Agricola e Solos], e-mail: eyde_cristianne@yahoo.com.br
2008-07-01
The application of the charcoal of agroforestry residue for the generation of electric energy, for being renewable power plant and possessing technology for application, comes being evidenced. In this research the potential of generation of electric energy was estimated, in the main producing cities of the State of Amazonas of the fruit of the cupuacuzeiro (Theobroma grandiflorum Wild. Ex. Spreng. Shum.), using the rind carbonized in technology of gasification, substitution of diesel. The charcoal of the rind of the fruit of the cupuacuzeiro presents to be able calorific next to the one to the deriving coal of the wood. Known the annual production of each one the cities, the amount and the cost of production of the generated electric energy, determined in this research, it justifies the exploitation of this residue, for having economic advantages, when comparative with the tariff of the adopted electric energy in the region for the concessionaire. (author)
Directory of Open Access Journals (Sweden)
Salamiah, Badruzsaufari, dan Muhammad Arsyad .
2011-11-01
Full Text Available Alternative hosts and Incubation period of Botryodiplodia theobromae the causal of diplodia bark diseases on citrus. Citrus is one of the important horticulture commodities in South Kalimantan. Citrus growers in the region encounter diplodia disease caused by a genus of Botryodiplodia. There is no single method practiced today proved to be effective control for the disease. Insufficient information of the pathogen life cycle is considered to contribute in the failure of disease management. Information of the alternative hosts and incubation period of the pathogens is very crucial in the diseases management. The experiments were carried out at the Laboratory of Plant Diseases and at a Glass House of the Department of Plant Pests and Diseases of the Faculty of Agriculture, Lambung Mangkurat University in Banjarbaru from March – October 2006. The experiments were conducted in three phases, i.e. (1 identification of pathogen, (2 the study of alternative hosts, and (3 the study of incubation periods of the pathogen in the test plants. Results showed that the diplodia disease of citrus “Siam Banjar” was caused by a fungus of the genus Botryodiplodia theobromae. The pathogen can also infected chasew and avocado plants. The Incubation periods of the pathogen in citrus, chasew, and avocado were 64, 39 and 39 days, respectively.
Anti-free radical activities of kaempferol isolated from Acacia nilotica (L.) Willd. Ex. Del.
Singh, Rajbir; Singh, Bikram; Singh, Sukhpreet; Kumar, Neeraj; Kumar, Subodh; Arora, Saroj
2008-12-01
In the present study the polyphenolic compound has been isolated from methanol extract of Acacia nilotica Willd. Ex. Del. which has been identified as kaempferol (AN-5) by NMR and mass spectroscopy. The antioxidant potential of the AN-5 was demonstrated in several in vitro assays: measuring the proton radical scavenging activity (DPPH scavenging assay), hydroxyl radical scavenging activity (deoxyribose degradation assay), metal chelating activity, reducing power and inhibition of lipid peroxidation. It was found that the effect of the compound AN-5 was strongly dose dependent up to the concentrations 1-50 microg/ml in DPPH assay and 1-100 microg/ml in deoxyribose degradation assay but did not show further change above the highest concentrations.
Directory of Open Access Journals (Sweden)
Yun-Lan Li
Full Text Available Hedyotis Diffusa Willd, used in Traditional Chinese Medicine, is a treatment for various diseases including cancer, owing to its mild effectiveness and low toxicity. The aim of this study was to identify the main anticancer components in Hedyotis Diffusa Willd, and explore mechanisms underlying their activity. Hedyotis Diffusa Willd was extracted and fractionated using ethyl acetate to obtain the H-Ethyl acetate fraction, which showed higher anticancer activity than the other fractions obtained against HepG2 cells with sulforhodamine B assays. The active component of the H-Ethyl acetate fraction was identified to be 1,3-dihydroxy-2-methylanthraquinone (DMQ with much high inhibitory rate up to 48.9 ± 3.3% and selectivity rate up to 9.4 ± 4.5 folds (p<0.01 at 125 μmol/L. HepG2 cells treated with the fraction and DMQ visualized morphologically using light and fluorescence microscopy. Annexin V--fluorescein isothiocyanate / propidium iodide staining flow cytometry, DNA ladder and cell cycle distribution assays. Mechanistic studies showed up-regulation of caspase-3, -8, and -9 proteases activities (p<0.001, indicating involvement of mitochondrial apoptotic and death receptor pathways. Further studies revealed that reactive oxygen species in DMQ and the fraction treated HepG2 cells increased (p<0.01 while mitochondrial membrane potential reduced significantly (p<0.001 compared to the control by flow cytometry assays. Western blot analysis showed that Bax, p53, Fas, FasL, p21 and cytoplasmic cytochrome C were up-regulated (p<0.01, while Bcl-2, mitochondrial cytochrome C, cyclin E and CDK 2 were down-regulated dose-dependently (p<0.01. The reverse transcriptase-polymerase chain reaction showed that mRNA expressions of p53 and Bax increased (p<0.001 while that of Bcl-2 decreased (p<0.001. Pre-treatment with caspase-8 inhibitor Z-IETD-FMK, or caspase-9 inhibitor Z-LEHD-FMK, attenuated the growth-inhibitory and apoptosis-inducing effects of DMQ and the
Theobroma cacao (cacao), the source of chocolate, is a tropical understory tree. Fungal diseases such as Witches’ Broom Disease (WBD) and Frosty Pod Rot Disease (FPRD) of cacao have devastated cacao production in much of the Western Hemisphere and are threats to the main cacao producing regions in A...
Enraizaimento de estacas de Bougainvillea spectabilis Willd. com o uso de ácido indolbutírico
Elias Mendes Costa; Arcângelo Loss; Heitor Paulo Nascimento Pereira; Jander Ferreira Almeida
2015-01-01
O uso de ácido indolbutírico (IBA) como estimulador do enraizamento em estacas de Bougainvillea spectabilis Willd. pode propiciar aumento de raízes para a formação de mudas comercializáveis. Objetivou-se avaliar o enraizamento, a formação de brotos e a sobrevivência de estacas herbáceas, lenhosas e semi-lenhosas de Bougainvillea com o uso de ácido indolbutírico (IBA). As estacas foram coletadas e tratadas com o IBA (1000 e 2000 mg/l). Aos 56 dias avaliaram-se a porcentagem de estacas vivas, e...
Flavonoids from the aerial parts of Artemisia biennis Willd
Directory of Open Access Journals (Sweden)
M. Mojarrab*
2017-11-01
Full Text Available Background and objectives: The genus Artemisia contains over 250 species all over the world. A. biennis Willd is one of the species which grows wildly in Iran. Camphor and (E-beta-farnesene have been reported as the major components of the essential oil from A. biennis. In spite of the presence of a rather wide range of reported bioactivities there is no previous phytochemical study on A. biennis. Methods: The plant was collected from Zoshk (Khorasan Razavi province, Iran. Extraction was done by maceration method using petroleum ether, dichloromethane, ethyl acetate, ethanol and equal amounts of water and ethanol (hydroethanolic extract, respectively. A combination of solid phase extraction (SPE and high pressure liquid chromatography (HPLC of the hydroethanolic extract was used to purify the compounds. Structures of the isolated compounds were elucidated by spectroscopic means, including MS and 1HNMR. Results: Three known flavonoids, luteolin, kaempferol and apigenin were isolated and identified from the hydroethanolic extract. Conclusion: Our results are in good agreement with dominant presence of derivatives of the flavones luteolin and apigenin in the genus Artemisia which has been previously reported .
Fatima Cerqueira Alvim
2009-01-01
Resumo: O fungo basidiomiceto hemibiotrófico Moniliophthora perniciosa, agente causal da doença vassoura-de-bruxa (VB) em Theobroma cacao, é o principal patógeno da lavoura cacaueira nas Américas e no Caribe. O presente trabalho apresentou como objetivo primordial identificar proteínas relacionadas com a patogenicidade deste fungo. No primeiro capítulo desta tese foi demonstrado o efeito de diferentes fontes de carbono sobre a morfologia e fisiologia do M, perniciosa. O fungo foi crescido em ...
Characterization of the Proteome of Theobroma cacao Beans by Nano-UHPLC-ESI MS/MS.
Scollo, Emanuele; Neville, David; Oruna-Concha, M Jose; Trotin, Martine; Cramer, Rainer
2018-02-01
Cocoa seed storage proteins play an important role in flavour development as aroma precursors are formed from their degradation during fermentation. Major proteins in the beans of Theobroma cacao are the storage proteins belonging to the vicilin and albumin classes. Although both these classes of proteins have been extensively characterized, there is still limited information on the expression and abundance of other proteins present in cocoa beans. This work is the first attempt to characterize the whole cocoa bean proteome by nano-UHPLC-ESI MS/MS analysis using tryptic digests of cocoa bean protein extracts. The results of this analysis show that >1000 proteins could be identified using a species-specific Theobroma cacao database. The majority of the identified proteins were involved with metabolism and energy. Additionally, a significant number of the identified proteins were linked to protein synthesis and processing. Several proteins were also involved with plant response to stress conditions and defence. Albumin and vicilin storage proteins showed the highest intensity values among all detected proteins, although only seven entries were identified as storage proteins. A comparison of MS/MS data searches carried out against larger non-specific databases confirmed that using a species-specific database can increase the number of identified proteins, and at the same time reduce the number of false positives. The results of this work will be useful in developing tools that can allow the comparison of the proteomic profile of cocoa beans from different genotypes and geographic origins. Data are available via ProteomeXchange with identifier PXD005586. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Huanglongbing (HLB), presumably caused by bacterium Candidatus Liberibacter asiaticus (CLas), is a devastating citrus disease associated with excessive pre-harvest fruit drop. Lasiodiplodia theobromae (Diplodia) is the causal organism of citrus stem end rot (SER). The pathogen infects citrus fruit ...
Directory of Open Access Journals (Sweden)
Mariana Séfora Bezerra Sousa
2011-09-01
Full Text Available O objetivo deste trabalho foi determinar a concentração dos compostos fenólicos dos resíduos de polpas de frutas tropicais acerola (Malpighia glabra L., goiaba (Psidium Guayaba L., abacaxi (Ananas comosus L., cupuaçu (Theobroma grandiflorum, bacuri (Platonia insignis e graviola (Annona muricata L., bem como avaliar a sua capacidade antioxidante in vitro, pelos métodos de captura de radicais DPPH• e ABTS+. Os resultados encontrados demonstraram elevados teores de fenólicos totais para o resíduo da polpa de acerola, com 247,62 ± 2,08 mg.100 g-1 de fenólicos totais para o extrato aquoso e 279,99 ± 3,5 mg.100 g-1 para o extrato hidroalcoólico (p The objective of this study was to determine the phenolic compound contents and evaluate the in vitro antioxidant capacity of the following extracts from tropical fruit pulp wastes: acerola (Malpighia glabra L., guava (Psidium Guayaba L., pineapple (Ananas comosus L., cupuaçu (Theobroma grandiflorum, bacury (Platonia insignis, and cherimoya (Annona muricata L. using the DPPH and ABTS+ radical capture methodologies. The results showed high levels of phenolic compounds in the aqueous and hydroalcoholic extracts of the acerola pulp wastes, of 247.62 ± 2.08 mg.100 g-1 and 279.99 ± 3.5 mg.100 g-1, respectively (p < 0.05. The antioxidant activity, when measured by the DPPH method, showed that the hydroalcoholic extract of the guava wastes presented the highest values with an EC50 of 142.89 μg.mL-1, followed by the hydroalcoholic and aqueous extracts of the acerola wastes, with EC50 values of 308.07 and 386.46 μg.mL-1, respectively. When the antioxidant activity was evaluated by the ABTS method, the acerola pulp wastes showed the highest antioxidant capacity, with TEAC values of 0.518 ± 0.103 and 0.743 ± 0.127 mM.g-1 of residue for the aqueous and hydroalcoholic extracts, respectively (p < 0.05. Thus, the fruit pulp wastes studied in this work, especially acerola and guava, represented
Cryopreservation of cocoa (Theobroma cacao L.) somatic embryos by vitrification.
Adu-Gyamfi, Raphael; Wetten, Andy
2012-01-01
Losses of cultivated cocoa (Theobroma cacao L.) due to diseases and continued depletion of forests that harbour the wild progenitors of the crop make ex situ conservation of cocoa germplasm of paramount importance. In order to enhance security of in situ germplasm collections, 2-3 mm floral-derived secondary somatic embryos were cryopreserved by vitrification. This work demonstrates the most uncomplicated clonal cocoa cryopreservation. Optimal post-cryostorage survival (74.5 percent) was achieved by 5 d preculture of SSEs on 0.5 M sucrose medium followed by 60 min dehydration in cold PVS2. To minimise free radical related cryo-injury, cation sources were removed from the embryo development solution and/or the recovery medium, the former treatment resulting in a significant benefit. After optimisation with cocoa genotype AMAZ 15, the same protocol was effective across all five additional cocoa genotypes tested. For the multiplication of clones, embryos regenerated following cryopreservation were used as explant sources, and vitrification was found to maintain their embryogenic potential.
PROPAGACIÓN IN VITRO DE Acacia mangium Willd
Directory of Open Access Journals (Sweden)
LUZ ANGELA TORRES
Full Text Available Acacia Acacia mangium Willd es una de las especies forestales más plantadas por la calidad de su madera y rápido crecimiento; sin embargo, los estudios de propagación clonal son pocos. El presente trabajo tuvo como objetivo desarrollar un protocolo de micropropagacion a partir de explantes con meristemos preexistentes. Los explantes consistieron de brotes de plantas de tres meses de edad mantenidas en invernadero. La desinfección se realizó con diferentes concentraciones de hipoclorito de sodio y antibióticos, y fueron establecidos en medio MS con diferentes concentraciones (0; 0,44; 0,88 y 2,22 µM de BAP. Los brotes micropropagados fueron enraizados con diferentes dosis de ANA y AIB, finalmente los brotes, con o sin raíces, fueron transferidos a condiciones ex vitro para evaluar el porcentaje de supervivencia. Los datos mostraron que 1,0% NaOCl y cefalexina (2 mg L-1 permitieron obtener el mayor porcentaje de explantes libres de contaminación (67%. El mayor número promedio de brotes ocurrió con 2,22 µM de BAP y el mayor número promedio de raíces se observo al utilizar 2,69 µM de ANA. La adaptación de las plantas en condiciones ex vitro fue exitoso lográndose obtener un 87% de supervivencia
Cocoa is (Theobroma cacao L.) is a significant agricultural commodity in Côted’Ivoire which ranks 1st in the world cocoa export. Phytophthora pod rot (Ppr)also call Black pod is the most widespread disease of cocoa. Lost due to this disease depends on the species of the pathogen and vary globally fr...
Reena Terangpi; Ratan Basumatary; A K Tamuli; R Teron
2013-01-01
Bark of Acacia pennata is used in preparation of starter cakes among the Dimasa community of Assam state. The present study attempts to evaluate the pharmacognostical and physicochemical parameters of Acacia pennata (L.) Willd. The transverse section of the stem revealed an epidermis externally subtended by trichomes, a crashed cortical region due to massive secondary growth and large stellate pith. The physico-chemical parameters were evaluated- loss on drying (7%), total ash content (9.3%),...
SALAS LINARES, MARY JULISSA
2015-01-01
THEOBROMA CACAO GENERALIDADES DESCRIPCIÓN ORIGEN Y EXTENSIÓN CLASIFICACIÓN CIENTÍFICA VARIEDADES DEL CACAO DISTRIBUCIÓN USOS MEDICINALES EFECTO ANTICARIOGÉNICO GEL CARIES DENTAL FACTORES DE RIESGO MICROORGANISMOS IMPLICADOS EN LA CARIES DENTAL CARIES EN EL ESMALTE CLASIFICACIÓN DE LA CARIES MÉTODOS DE DETECCIÓN DE CARIES CRITERIOS ICDAS
Anticonvulsant evaluation of Rauvolfia ligustrina Willd. ex Roem. & Schult., Apocynaceae, in rodents
Directory of Open Access Journals (Sweden)
Lucindo J. Quintans-Júnior
Full Text Available The Aim of this study was to evaluated the effects of the ethanol extract of Rauvolfia ligustrina Willd. ex Roem. & Schult., Apocynaceae, roots (EER in animal models of epilepsy. The EER increased the latency for convulsions significantly different from control (p<0,05 and in the PTZ induced convulsions test on 62,5 mg/kg (i.p. decreased mortality. This effect was blocked by flumazenil administration, suggesting an involvement of GABAergic system in the anticonvulsant activity of EER. The EER had a moderate effect only against PIC- or STR-induced convulsions at doses 125 and 250 mg/kg. But in the MES test it did not demonstrate effect on this animal model. Therefore, the EER reduced the development of PTZ-induced kindling in both experimental groups. It also significantly (p<0.05 decreased the latency for convulsions and reduced its percentage. Our results suggest that EER owns anticonvulsant property.
Water use efficiency studies of Acacia senegal (L.) Willd provenances in Sudan
International Nuclear Information System (INIS)
Mustafa, A.F.; Elamin, K.H.; Salih, A.A.
1996-01-01
An experiment was conducted in 1989 to screen Acacia senegal L. Willd provenances collected from within the natural gum belt for high water use efficiency. Thirteen provenances were tested for water use efficiency and consequently 6 out of them were selected for further screening. The selection was based on their performance in the preliminary screening. Both the preliminary and the detailed study revealed that provenances 7, 3 and 11 combine high dry matter production with high water use efficiency. Water use efficiency and dry matter production appears to be negatively correlated with root length density and root/shoot ratios. Provenances 7 which exhibited the highest water use efficiency and dry matter yield had the lowest root/shoot ratio and also a low root length density. Based on these studies provenance 7 can be considered a suitable candidate for introduction into gum-belt of Sudan through for rehabilitation of this region. (author). 5 refs, 1 fig., 3 tabs
Water use efficiency studies of Acacia senegal (L.) Willd provenances in Sudan
Energy Technology Data Exchange (ETDEWEB)
Mustafa, A F; Elamin, K H [Forestry Research Section, Wad Medani (Sudan); Salih, A A [Soil Science Section, Wad Medani (Sudan)
1996-07-01
An experiment was conducted in 1989 to screen Acacia senegal L. Willd provenances collected from within the natural gum belt for high water use efficiency. Thirteen provenances were tested for water use efficiency and consequently 6 out of them were selected for further screening. The selection was based on their performance in the preliminary screening. Both the preliminary and the detailed study revealed that provenances 7, 3 and 11 combine high dry matter production with high water use efficiency. Water use efficiency and dry matter production appears to be negatively correlated with root length density and root/shoot ratios. Provenances 7 which exhibited the highest water use efficiency and dry matter yield had the lowest root/shoot ratio and also a low root length density. Based on these studies provenance 7 can be considered a suitable candidate for introduction into gum-belt of Sudan through for rehabilitation of this region. (author). 5 refs, 1 fig., 3 tabs.
Sensitivity of two quinoa (Chenopodium quinoa Willd.) varieties to progressive drought stress
DEFF Research Database (Denmark)
Sun, Yujie; Liu, Fulai; Bendevis, Mira Arpe
2014-01-01
Quinoa (ChenopodiumquinoaWilld.) is a highly nutritious Andean seed crop which shows great potential to grow under a range of hostile environments. The objective of this study was to investigate the differences of drought tolerance of a Bolivian (Achachino) and a Danish (Titicaca) variety...... increased CS for stomatal conductance, CT for transpiration and CLfor leaf water potential. Achachino showed significantly lower CT and CL when compared with Titicaca, implying that transpiration and leaf water potential were less affected under mild drought conditions in the Bolivian variety. CS...... in Achachino was significantly higher than CL and CT, which indicated that stomatal conductance declined before transpiration and leaf water potential were reduced. Such difference was found in Titicaca where reduction of leaf area had more effect on transpiration than stomatal closure. Slower growth rate...
Where it occurs in South and Central America, M. roreri (Mr) causes a destructive pod disease (frosty pod rot) on Theobroma cacao (cacao). Hand pollinated cacao pods were inoculated with Mr spores in the field and assessed for disease symptoms over a 90 day period. On average, pods showed symptoms o...
The profile of Brazilian agriculture as source of raw material to obtain organic cosmetics
Directory of Open Access Journals (Sweden)
Neila de Paula Pereira
2017-05-01
Full Text Available With one of the most notable floras in the world for sustainable research, the Brazilian Amazon region currently counts on financial incentives from the Brazilian Government for private national and foreign businesses. The ongoing implantation of a Biocosmetics Research and Development Network (REDEBIO aims to stimulate research involving natural resources from the Brazilian states that make up the zone defined as “Amazônia Legal”. The objective of this region, still under development in Brazil, is principally to aggregate value to products manufactured in small local industries through the use of sustainable technology currently being established. Certain certified raw materials already included in the country’s sustainability program, have also begun to be cultivated according to the requirements of organic cultivation (Neves, 2009. The majority are species of Amazonian vegetation: Euterpe oleracea (Açai, Orbignya martiana (Babaçu, Theobroma grandi-florum (Cupuaçu, Carapas guianensis (Andiroba, Pentaclethra macroloba (Pracaxi, Copaifera landesdorffi (Copaiba, Platonia insignis (Bacuri, Theobroma cacao (Cacao, Virola surinamensis (Ucuuba and Bertholletia excelsa (Brazil nut. These generate phytopreparations, such as oils, extracts, and dyes that are widely used in the manufacture of Brazilian organic cosmetics with scientifically proven topical and capillary benefits. In the final balance, Brazilian organic cosmetics should continue to gain force over the next few years, especially with the regulation of the organic cosmetics market that is being drafted by the Brazilian Ministry of Agriculture. Moreover, lines of ecologically aware products that provide quality of life for both for rural and metropolitan communities show a tendency to occupy greater space in the market.
K. M. Abdul RAOOF; M. Badruzzaman SIDDIQUI
2012-01-01
The present laboratory experimental study was conducted to evaluate the allelopathic potential of Tinospora cordifolia (Willd.) Miers on seed germination and seedling growth of weed plants (Chenopodium album L. Chenopodium murale L., Cassia tora L. and Cassia sophera L.). Root and aerial root aqueous extracts of Tinospora at 0.5, 1.0, 2.0 and 4.0% concentrations were applied to determine their effect on seed germination and seedling growth of test plants under laboratory conditions. Germinati...
Directory of Open Access Journals (Sweden)
Chang Ha Park
2015-06-01
Full Text Available The flowers of twenty-three cultivars of Dendranthema grandiflorum Ramat. were investigated to determine anthocyanin and carotenoid levels and to confirm the effects of the pigments on the flower colors using high-performance liquid chromatography (HPLC and electrospray ionization-mass spectrometry (ESI-MS. The cultivars contained the anthocyanins cyanidin 3-glucoside (C3g and cyanidin 3-(3ʺ-malonoyl glucoside (C3mg and the following carotenoids: lutein, zeaxanthin, β-cryptoxanthin, 13-cis-β-carotene, α-carotene, trans-β-carotene, and 9-cis-β-carotene. The cultivar “Magic” showed the greatest accumulation of total and individual anthocyanins, including C3g and C3gm. On the other hand, the highest level of lutein and zeaxanthin was noted in the cultivar “Il Weol”. The cultivar “Anastasia” contained the highest amount of carotenoids such as trans-β-carotene, 9-cis-β-carotene, and 13-cis-β-carotene. The highest accumulation of β-cryptoxanthin and α-carotene was noted in the cultivar “Anastasia” and “Il Weol”. Our results suggested that ‘Magic”, “Angel” and “Relance’ had high amounts of anthocyanins and showed a wide range of red and purple colors in their petals, whereas “Il Weol’, “Popcorn Ball’ and “Anastasia” produced higher carotenoid contents and displayed yellow or green petal colors. Interestingly, “Green Pang Pang”, which contained a high level of anthocyanins and a medium level of carotenoids, showed the deep green colored petals. “Kastelli”, had high level of carotenoids as well as a medium level of anthocyanins and showed orange and red colored petals. It was concluded that each pigment is responsible for the petal’s colors and the compositions of the pigments affect their flower colors and that the cultivars could be a good source for pharmaceutical, floriculture, and pigment industries.
Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire
2012-01-01
Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative ...
DEFF Research Database (Denmark)
Tetens, Inge
Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies was asked to provide a scientific opinion on a list of health claims pursuant to Article 13 of Regulation (EC) No 1924/2006. This opinion addresses the scientific substantiation of health...... claims in relation to caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood. The scientific substantiation is based on the information provided by the Member States in the consolidated list of Article 13 health claims and references that EFSA has received from Member States...... or directly from stakeholders. The food that is the subject of the health claim is cocoa (Theobroma cacao L.). The Panel considers that whereas the food, cocoa (Theobroma cacao L.), is not sufficiently characterised in relation to the claimed effect evaluated in this opinion, the food constituents, caffeine...
Directory of Open Access Journals (Sweden)
Camila Firmino de Azevedo
2013-01-01
Full Text Available Opuntia brasiliensis (Willd Haw. é uma Cactaceae nativa do Brasil utilizada como ornamental, que apresenta caracteres morfológicos semelhantes a outras espécies do gênero, o que dificulta sua identificação. Dessa forma, foi realizado uma descrição morfoanatômica de O. brasiliensis com o objetivo de ampliar o conhecimento sobre a organização estrutural do gênero e fornecer subsídios para a identificação da espécie, bem como observar caracteres importantes na adaptação a ambientes xerófilos. Foram feitas secções transversais e paradérmicas da raiz, caule principal e cladódios com espécimes coletados na zona rural da cidade de Serra Branca (PB, localizada na região do cariri ocidental. O. brasiliensis apresenta raiz ramificada e caule clorofilado formando um eixo principal de onde partem inúmeros cladódios delgados. Observamse pelos e epiderme unisseriada irregular na raiz, que possui córtex formado por parênquima, seguido de endoderme multisseriada e periciclo. No cilindro central da raiz, ocorrem tecidos vasculares formando cinco pólos seguidos de medula. O caule e o cladódio apresentam epiderme com paredes sinuosas, em que encontram-se estômatos paralelocíticos que apresentam câmara subestomática; e na camada subsequente, hipoderme com grande quantidade de drusas de oxalato de cálcio. O córtex é formado por parênquimas clorofiliano e aquífero, onde observam-se feixes vasculares, com raios de floema voltados para o lado externo, seguido de xilema helicoidal. Porém, nos cladódios, o parênquima clorofiliano é bem mais denso e os feixes vasculares são dispostos irregularmente, enquanto no caule estão distribuídos no sentido radial. O. brasiliensis apresenta várias características importantes na sua identificação, bem como adaptações estruturais a ambientes xerófilos
Directory of Open Access Journals (Sweden)
Marina A. Correa de Restrepo
2002-01-01
Full Text Available ABSTRACTGrowth in different culture media and temperature as well as its antagonic roleagainst Fusarium oxysporumSchlencht f. sp. dianthi(Prill & Del Snyder & Hansen, werestudied on an isolated of the fungi Theobroma grandiflorum(Spreng K. Schum. Lowgrowth and the presence of abundat moniloid cells were detected when the fungi wascultured in PDA in microculture, with natural light and at 20ºC. Higher temperatures(27ºC and 30ºC increased growh rate. When cultured at 20ºC, in darkness, similarresults as those recorded at 30ºC in natural light were found. After a month sclerotiagrotwh was present. Culture in AMS in Petri dishes, with natural light at 20ºC showedgrowth in patches which suggests phenotype variability. Poor growth was recordedwhen cultured in AAg. Our results showed that rapid and vigorous growth isobtanined when the fungi is cultured in PDA at 30ºC in darkness producing conidiaand sclerotia. T. grandiflorumalso has an antagonic role against F.oxysporumsp. dianthi,growing faster and inihibitingits growth.
Analgesic and anti-inflammatory properties of the fruits of Vernonia anthelmintica (L Willd.
Directory of Open Access Journals (Sweden)
Alok Pandey
2014-09-01
Full Text Available Objective: To evaluation of analgesic and anti-inflammatory properties of the fruits of Vernonia anthelmintica (L Willd. (V. anthelmintica. Method: Hot plate method in mice, acetic acid induced writhing response in mice, tail immersion test and carrageenan-induced paw edema in rats and cotton pellet induced granuloma in rats method were used for screening analgesic and anti-inflammatory properties of the fruit of V. anthelmintica (family: Asteraceae. Results: The result of the study showed that the ethanolic extract of V. anthelmintica (100 and 200 mg/kg body weight, p.o. fruits possed peripheral and central analgesic activity in animal model. The V. anthelmintica fruits extract showed in vivo anti-inflammatory activity on acute and chronic anti-inflammatory activity models in rats. Conclusions: On the basis of result it can be concluded that saponins, steroids, tannins and flavonoids are the major constituents that are present in the fruits of V. anthelmintica which may be responsible for its analgesic and anti-inflammatory activity.
Performance of Azolla caroliniana Willd. and Salvinia auriculata Aubl. on fish farming effluent.
Toledo, J J; Penha, J
2011-02-01
The increasing release of untreated fish farming effluents into water courses that flow to the Pantanal wetlands in Mato Grosso (Brazil) may drive this ecosystem to eutrophication. Therefore, the growth of Azolla caroliniana Willd. and Salvinia auriculata Aubl. in fish farming effluent and their effect on its quality were evaluated for 48 days in a greenhouse. The results were compared to those obtained in a nutrient rich solution (Hoagland ½ medium). Azolla caroliniana showed lower relative growth rate in fish farming effluent (0.020 d-1) than in Hoagland ½ medium (0.029 d-1). However, S. auriculata grew slightly better in fish farming effluent (0.030 d-1) than in Hoagland ½ medium (0.025 d-1). The species apparently contributed to reduce nitrate and phosphate concentration in Hoagland ½ medium. However, in fish farming effluent, only electrical conductivity and pH were reduced by plants compared to the control without plants. Thus, A. caroliniana and S. auriculata show low potential for improving effluent quality.
Henarejos-Escudero, Paula; Guadarrama-Flores, Berenice; Guerrero-Rubio, M Alejandra; Gómez-Pando, Luz Rayda; García-Carmona, Francisco; Gandía-Herrero, Fernando
2018-01-17
Betalains are water-soluble plant pigments of hydrophilic nature with promising bioactive potential. Among the scarce edible sources of betalains is the grain crop quinoa (Chenopodium quinoa Willd), with violet, red, and yellow grains being colored by these pigments. In this work, callus cultures have been developed from differently colored plant varieties. Stable callus lines exhibited color and pigment production when maintained on Murashige and Skoog medium supplemented with the plant growth regulators 6-benzylaminopurine (8.88 μM) and 2,4-dichlorophenoxyacetic acid (6.79 μM) with a reduction of the nitrogen source to 5.91 mM. Pigment analysis by HPLC-DAD and ESI-MS/MS fully describes the content of individual pigments in the cell lines and allows the first report on the pigments present in quinoa seedlings. Phyllocactin and vulgaxanthin I are described as novel pigments in the species and show the potential of C. quinoa culture lines in the production of compounds of nutritional value.
Constituents of Artemisia indica Willd. from Uttarakhand Himalaya: A source of davanone.
Haider, S Zafar; Mohan, Manindra; Andola, Harish Chandra
2014-07-01
The genus Artemisia is important due to its medicinal properties as well as vital aroma compounds of commercial value. The aim of the study was to explore the potential of the essential oil of Artemisia indica wildly growing in Uttarakhand. The aerial parts of Artemisia indica Willd. (Asteraceae), collected from wild growing habitat of Garhwal Himalaya, Uttarakhand (north of India) at full flowering stage were hydro-distilled and gave pale yellow oil with the yield of 0.8% (v/w). The obtained essential oil was analyzed by GC and GC-MS and identified 32 components, amounting 95.42% of the oil. Among detected compounds, the principal component was found to be davanone (30.80%), followed by β-pinene (15.30%) and germacrene-D (5.82%). To the best of our knowledge, this is the first report on A. indica from Himalayan region of India, which detected davanone as major component. The species, collected from a specific location, can be explored for isolation of davanone for its industrial utilization and as alternate source of Artemisia pallens, which have already established commercial value.
Directory of Open Access Journals (Sweden)
Rosidah R Radam
2016-08-01
Full Text Available The activity of sawmill have been long enough done by local society because very assistive and add production socialize, some of owner of bandsaw/sawmill also make this effort as effort remain to and there is also making it as effort peripheral. Intention of this research is to know industrial and rendemen productivity of sawmill of acacia wide leaf wood (Acacia mangium Willd. The method that being used is method of direct measurement and observation in industrial location of sawmill of acacia wide leaf wood and method of direct interview and also record data that related to this research. The analyse data is productivity calculation, rendemen and waste. Productivity mean of industrial sawmill of acacia wide leaf wood is equal to 6,38 m3/day or 0,0160 m3/hours. Rendemen mean of industrial sawmill of acacia wide leaf wood is equal to 80,011%. Mean of industrial disposal of sawmill of acacia wide leaf wood is equal to 19,99% (1,62 m3, this matter is caused by a quality wood of good Acacia (not many experiencing of handicap of wood. From result of research suggested to conduct research of continuation hit influence of other factor to productivity and rendemen at acacia wide leaf wood sawmill like age, environmental work (arrange situation, and the worker education. Keyords : productivity, rendemen, waste, sawmill, acacia wide leaf wood (Acacia mangium Willd
DEFF Research Database (Denmark)
Razzaghi, Fatemeh; Ahmadi, Seyed Hamid; Jacobsen, Sven-Erik
2012-01-01
Drought and salinity reduce crop productivity especially in arid and semi-arid regions, and finding a crop which produces yield under these adverse conditions is therefore very important. Quinoa (Chenopodium quinoa Willd.) is such a crop. Hence, a study was conducted in field lysimeters to invest...... matter. Increasing salinity from 20 to 40 dS m-1 did not further decrease the seed number per m2 and seed yield, which shows that quinoa (cv. Titicaca) acclimated to saline conditions when exposed to salinity levels between 20 and 40 dS m-1....
Energy Technology Data Exchange (ETDEWEB)
NONE
2010-07-01
Ornamental crops are high-cash crops, grown under greenhouse conditions in semi-arid regions in Israel where a reduction in the native population of arbuscular mycorrhizal fungi (AMF) is expected due to routine soil disinfection. The application of AMF inoculum to the soil has been shown to be effective at improving plant growth and enhancing plant resilience to abiotic and biotic stresses. One of our aims is to introduce mycorrhizal application to ornamental crops, and a test case is presented here for two cultivars of lisianthus (Eustoma grandiflorum), one of the major ornamental crops grown in Israel. Several different methods of AMF application and their effects on growth, yield and vase life were examined in lisianthus grown in two different semi-arid locations in southern Israel. AMF enhanced lisianthus growth and yield, especially when introduced to the growth medium during seeding and to the pit hole during planting. Significantly enhanced growth and yield parameters included flowering stem length (58 {+-} 0.7 and 65.1 {+-} 0.7 cm for control and AMF treated, respectively) and number of flowering stems per square meter (73 {+-} 9 and 106 {+-} 6 for control and AMF treated, respectively); positive but non-significant effects were recorded on stem weight, number of flowers per stem and vase life of cut flowers. Yield enhancement was recorded under both low and regular phosphorus conditions. Although not significant, higher resilience against two pathogenic fungi was also recorded following AMF inoculation (23 {+-} 13 and 41 {+-} 10 surviving plants for control and AMF treated, respectively). Hence, AMF is suggested to be a useful growth amendment for promotion of lisianthus commercial production, and may potentially be applied to additional ornamental crops. (Author) 23 refs.
International Nuclear Information System (INIS)
Mostafa, I.Y.; El-Ashmawi, A.M.; Fahim, M.M.; Kararah, M.A.
1984-01-01
Radiosensitivity of Botryodiplodia theobromae Pat. increased with the increase in doses of gamma radiation. Young cultures (7 days old) were less sensitive to radiation than old ones (48 days); lethal doses being 800 and 600 Krad respectively. Rot development was greatly reduced when inoculated banana fruits were exposed to 300 Krad. Disease development was checked for 10 days in inoculated fruits exposed to 400 Krad. The combined treatment of 200 p.p.m. T B Z and 100 or 200 Krad gamma radiation was more effective in reducing disease incidence than either treatments alone. No deleterious effects occurred in banana fruits that were irradiated with the low doses of gamma radiation
Directory of Open Access Journals (Sweden)
Hilaíres Lima Maciel
2015-12-01
Full Text Available Objetivou-se identificar localmente os diferentes arranjos, práticas e manejos agroflorestais, desenvolvidos pelos agricultores da região do Médio Maracá no município do Mazagão. Para a pesquisa foram adotadas observações diretas desenvolvida em duas etapas: a primeira constou de pesquisa e revisão bibliográficas. A segunda etapa da pesquisa foi realizada em campo. Identificou-se que as tipologias Quintal Florestal possuem área média 0,5 ha e a agrossilvicultura com área média de 5,5 ha. Quanto às espécies utilizadas o açaizeiro (Euterpe oleracea, o cupuaçuzeiro (Theobroma Grandiflorum, e a bacabeira (Oenocarpus bacaba, apresentaram maior frequência na composição dos sistemas pesquisados. Entre os lotes constatou-se uma média de 10 de espécies frutíferas por lote, quanto às essências florestais a média variou de 10 a 15 espécies. Nesta perspectiva, resgatar práticas e manejos tradicionais baseadas empiricamente nos princípios dos sistemas agroflorestais, se reveste de grande importância para apoiar implantação de sistemas produtivos com base na agroecologia.Agroforestry arrangements in the context of agroecology: The case of the farmers of the Middle Maracá region in the municipality of Mazagão, state AmapáAbstract: Aim to locally identify the different arrangements, practices and agroforestry management practices developed by farmers of the Middle Maracá region in the city of El Jadida. For research direct observations developed in two stages were adopted: the first consisted of research and bibliographic review. The second stage of the research was carried out in the field. It was found that the Forest Yard types have average size 0.5 ha and agroforestry with an average area of 5.5 ha. As for the species used the açaí (Euterpe oleracea, the cupuaçu (Theobroma grandiflorum, and the bacabeira (Oenocarpus bacaba, had a higher frequency in the composition of the investigated systems. Among the lots found an
Physical interactions between cupuassu and cocoa fats
Directory of Open Access Journals (Sweden)
Gioielli, L. A.
2003-09-01
Full Text Available Cupuassu (Theobroma grandiflorum, Sterculiaceae is an Amazonian native fruit and nowadays is cultivated only in Amazonian region. The seeds that come to about 16% of the dry weight can be used to derive a cocoa butter like product and the content of fat in the seeds is about 60% dry weight. In general, these fats are similar to those of cocoa, although they show difference in some physical properties. The objective of this study was to analyse some physical and crystallization properties of the cupuassu fat, cocoa butter and some mixtures between the two fats. The analyses performed were: dropping point, solid fat content, hardness index and Jensen cooling curve. The results suggested some advantages of the use of cupuassu fat, as lower crystallization time and smoothness than cocoa butter. The mixtures showed compatibility, cocoa butter showed bigger solid fat content at room temperature than cupuassu fat and the mixtures. Cupuassu fat had a lower dropping point than cocoa butter. The possible use of cupuassu fat and the mixtures could be in fillings and cold weather chocolate productsCupuassu (Theobroma grandiflorum, Sterculiaceae es una fruta nativa amazónica que hoy día sólo se cultiva en esta región. Las semillas con un 16%, aproximadamente, del peso seco, tienen, aproximadamente, el 60% de grasa y pueden usarse como sustituto de manteca de cacao. En general, estas grasas son similares a las del cacao, aunque muestran diferencias en algunas de sus propiedades físicas. El objetivo de este estudio fue analizar algunas propiedades físicas y de cristalización de la grasa de cupuassu, de la manteca de cacao y de mezclas de las dos grasas. Los análisis realizados fueron: punto de goteo, contenido en grasa sólida, índice de dureza y la curva de enfriamiento de Jensen. El tiempo de cristalización inferior y la mayor suavidad que muestra la grasa de cupuassu frente a la manteca de cacao, sugieren algunas ventajas del uso de la misma
Schumacher, Andrea B; Brandelli, Adriano; Macedo, Fernanda C; Pieta, Luiza; Klug, Tâmmila V; de Jong, Erna V
2010-03-01
Quinoa (Chenopodium quinoa Willd) is a good source of vitamin E containing high quality protein. A dark chocolate with the addition of 12, 16 or 20% quinoa was developed. The protein concentration of the products increased as the percentage of quinoa increased. The product containing 20% quinoa showed only 9% increase in vitamin E, while the quantity of polyphenols decreased from 23.5 to 18 μmol pirocatechin/g. The amount of essential amino acids was improved in samples containing quinoa. Cysteine, tyrosine and methionine increased by 104, 72, 70%, respectively in chocolate containing 20% quinoa. The amino acid pattern was as per WHO standards, which was adequate to human needs. The chocolate with quinoa was approved by 92% of the sensory panel. All the samples showed an index of acceptance above 70%. Quinoa could be used at the levels evaluated in this study adding its potential health benefit to the dark chocolate.
Directory of Open Access Journals (Sweden)
Luty Gomezcaceres Perez
2013-03-01
Full Text Available A desidratação osmótica é uma operação unitária importante para transformar os frutos perecíveis em novos produtos com valor agregado e com maior vida de prateleira. A aplicação dos modelos matemáticos confiáveis permite prever o comportamento dos diversos fenômenos que ocorrem durante o processo de secagem, o que implica na redução do custo operacional. A polpa do cupuaçu é comumente usada para preparar sucos e sorvetes, mas durante a safra é produzida em grande quantidade, que muitas vezes, é descartada devido ao custo de produção ser mais alto do que o da comercialização. O objetivo desse estudo foi investigar o efeito da solução binária e da ternária na taxa da secagem por convecção e avaliar a adequação dos modelos matemáticos na descrição das curvas da secagem do cupuaçu. No experimento, a pré-desidratação foi feita com solução binária (sacarose a 40 ºBrix e ternária (80% de sacarose/20% de cloreto de sódio, durante três horas em temperatura ambiente, seguida pela secagem convencional na estufa (ar circulante a 65 ºC, até peso constante. Os dados experimentais foram ajustados utilizando os modelos de Page e Midilli, Kucuk e Yapar. A solução binária usada na pré-secagem reduziu o tempo da subseqüente secagem convencional. Com variação de 99,64 a 99,77% no coeficiente de determinação (R², o modelo de Page apresentou o melhor ajuste aos dados experimentais.The osmotic dehydration is an important unitary operation to transform the perishable fruits in new products with added value and longer shelf life. The application of reliable mathematical models allows prediction the behavior of various phenomena that occur during the drying process, which implies in reduction of operating cost. The cupuaçu pulp is commonly used to prepare juices and ice creams, but during the crop it is produced in large quantity, which is often discarded because of the cost of production is higher than the selling price. The aim of this study was to investigate the effect of binary and ternary solutions at the rate of convective drying and evaluate the adequacy of mathematical models to describe the drying curves of the cupuaçu. In the experiment, osmotic dehydration was carried out with binary (sucrose at 40 ºBrix and ternary (80% sucrose/20% sodium chloride solutions for three hours at room temperature, followed by conventional drying in an oven (air-circulating at 65 °C to constant weight. The experimental data were adjusted using the models of Page and Midilli, Kucuk and Yapar. The binary solution used during pre-drying, reduced the time of the subsequent conventional drying. Varying from 99.64 to 99.77% in the coefficient of determination (R², the Page model showed a better adjustment to experimental data.
A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6.
Saski, Christopher A; Feltus, Frank A; Staton, Margaret E; Blackmon, Barbara P; Ficklin, Stephen P; Kuhn, David N; Schnell, Raymond J; Shapiro, Howard; Motamayor, Juan Carlos
2011-08-16
The fermented dried seeds of Theobroma cacao (cacao tree) are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS) II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105) span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map assembly. A comparison between the two T. cacao
A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6
Directory of Open Access Journals (Sweden)
Kuhn David N
2011-08-01
Full Text Available Abstract Background The fermented dried seeds of Theobroma cacao (cacao tree are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Results Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105 span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map
Venkatesagowda, Balaji; Ponugupaty, Ebenezer; Barbosa-Dekker, Aneli M; Dekker, Robert F H
2017-12-18
The coconut kernel-associated fungus, Lasiodiplodia theobromae VBE1, was grown on coconut cake with added coconut oil as lipase inducer under solid-state fermentation conditions. The extracellular-produced lipases were purified and resulted in two enzymes: lipase A (68,000 Da)-purified 25.41-fold, recovery of 47.1%-and lipase B (32,000 Da)-purified 18.47-fold, recovery of 8.2%. Both lipases showed optimal activity at pH 8.0 and 35 °C, were activated by Ca 2+ , exhibited highest specificity towards coconut oil and p-nitrophenyl palmitate, and were stable in iso-octane and hexane. Ethanol supported higher lipase activity than methanol, and n-butanol inactivated both lipases. Crude lipase immobilized by entrapment within 4% (w/v) calcium alginate beads was more stable than the crude-free lipase preparation within the range pH 2.5-10.0 and 20-80 °C. The immobilized lipase preparation was used to catalyze the transesterification/methanolysis of coconut oil to biodiesel (fatty acyl methyl esters (FAMEs)) and was quantified by gas chromatography. The principal FAMEs were laurate (46.1%), myristate (22.3%), palmitate (9.9%), and oleate (7.2%), with minor amounts of caprylate, caprate, and stearate also present. The FAME profile was comparatively similar to NaOH-mediated transesterified biodiesel from coconut oil, but distinctly different to petroleum-derived diesel. This study concluded that Lasiodiplodia theobromae VBE1 lipases have potential for biodiesel production from coconut oil.
Erythrina velutina Willd. - Fabaceae: Árvore de múltiplos usos no nordeste brasileiro
Directory of Open Access Journals (Sweden)
Laércio Wanderley dos Santos
2014-05-01
Full Text Available 800x600 O mulungu (Erythrina velutina Willd. é uma árvore que ocorre no nordeste do Brasil e usada como medicinal, madeireira, artesanal, ornamental e como componente de sistema agroflorestais. A partir de consulta a Bases Bibliográficas foi realizada uma revisão sobre a espécie tratando os aspectos taxonômicos e botânicos, composição química e aplicações na fitoterapia, propagação e conservação. Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Calibri","sans-serif";}
Performance of Azolla caroliniana Willd. and Salvinia auriculata Aubl. on fish farming effluent
Directory of Open Access Journals (Sweden)
JJ. Toledo
Full Text Available The increasing release of untreated fish farming effluents into water courses that flow to the Pantanal wetlands in Mato Grosso (Brazil may drive this ecosystem to eutrophication. Therefore, the growth of Azolla caroliniana Willd. and Salvinia auriculata Aubl. in fish farming effluent and their effect on its quality were evaluated for 48 days in a greenhouse. The results were compared to those obtained in a nutrient rich solution (Hoagland ½ medium. Azolla caroliniana showed lower relative growth rate in fish farming effluent (0.020 d-1 than in Hoagland ½ medium (0.029 d-1. However, S. auriculata grew slightly better in fish farming effluent (0.030 d-1 than in Hoagland ½ medium (0.025 d-1. The species apparently contributed to reduce nitrate and phosphate concentration in Hoagland ½ medium. However, in fish farming effluent, only electrical conductivity and pH were reduced by plants compared to the control without plants. Thus, A. caroliniana and S. auriculata show low potential for improving effluent quality.
Muniz, C.R.; Freire, F.C.O.; Viana, F.M.P.; Cardoso, J.E.; Correia, D.; Jalink, H.; Kema, G.H.J.; Silva, G.F.; Guedes, M.I.F.
2012-01-01
Members of Botryosphaeriaceae family are associated with serious diseases in different plants 18 across the world. In cashew nut plants (Anacardium occidentale L.), the fungus Lasiodiplodia 19 theobromae causes a severe group of symptoms related to gummosis that results in decreased nut 20
SHADING AND SUBSTRATE ON THE PRODUCTION OF SEEDLINGS OF Erythrina velutina Willd.
Directory of Open Access Journals (Sweden)
Laércio Wanderley dos Santos
2013-12-01
Full Text Available http://dx.doi.org/10.5902/1980509812341Erythrina velutina Willd. (Fabaceae is used in traditional medicine in northeastern Brazil for its sudorificproperties, soothing, emollient, pectoral and local anesthetic. The aim of this study was to evaluate theeffect of substrate and shading on seedlings of Erythrina velutina. The experimental design was completelyrandomized in factorial scheme 5 x 2 (five substrates and two shades, with four replications and 10 plantsin each plot. The substrates were arisco, arisco + cattle manure 2:1 v/v, arisco + cattle manure 3:1 v/v, sand+ cattle manure 2:1 v/v, sand + cattle manure 3:1 v/v. The shadings were 0% shading (full sunlight and50% shading. The characteristics evaluated were stem diameter, height, leaf area, green and dry biomass ofroots and shoots, height/diameter and Dickson quality index.There was no significant difference in diameterbetween the different substrates. The environment in full sun favored the diameter and the root biomasswhereas the height was favored by shade. The substrates with cattle manure in its composition favorsthe development of plants of Erythrina velutina and higher seedling quality are produced in full sun andsubstrate arisco + cattle manure in the ratio 2:1
Angioni, Alberto; Barra, Andrea; Arlorio, Marco; Coisson, Jean Daniel; Russo, Maria T; Pirisi, Filippo M; Satta, Maurizio; Cabras, Paolo
2003-02-12
The chemical composition of the essential oil of the Sardinian dwarf curry plant [Helichrysum italicum G. Don ssp. microphyllum (Willd) Nym] was studied. Genetic analysis suggested the presence of two chemotypes; morphological and chemical differences confirmed the presence of two chemotypes (A and B). The maximum yields were 0.18 and 0.04% (v/w) for flowering tops and stems, respectively. The concentrations of nerol and its esters (acetate and propionate), limonene, and linalool reach their highest values during the flowering stage both in flowers and in stems. Besides the essential oil, type B showed an interesting antifungal activity.
Directory of Open Access Journals (Sweden)
Fernando Luíz de Oliveira Corrêa
2006-12-01
Full Text Available Objetivou-se com este trabalho avaliar a produção de serapilheira em diferentes coberturas frutíferas e florestais componentes de um sistema agroflorestal multiestratificado localizado no município de Ouro Preto do Oeste, RO, Brasil. As espécies avaliadas foram: mangueira (Mangifera indica L., fruta-pão (Artocarpus altilis (Parkinson Fosberg, cupuaçuzeiro (Theobroma grandiflorum Schum, abacateiro (Persea americana Mill., cacaueiro (Theobroma cacao L. sombreado com gliricídia (Gliricidia sepium (Jacq. Walp. e as espécies florestais, a bandarra (Schizolobium amazonicum Huber ex Ducke e a teca (Tectona grandis L.f.. Como referência foi utilizada uma área de vegetação natural (capoeira, de 8 anos de idade. A deposição anual de serapilheira entre o período de outubro de 2002 e setembro de 2003 foi de 13,38 t ha-1 para a vegetação natural, 4,02 t ha-1 para bandarra, 3,43 t ha-1 para gliricídia, 2,86 t ha-1para abacateiro, 2,54 t ha-1 para fruta-pão, 1,40 t ha-1 para o cupuaçuzeiro, 1,16 t ha-1 para o cacaueiro, 1,12 t ha-1 para mangueira e 1,07 t ha-1 para a teca. A vegetação natural, a bandarra e o cacaueiro apresentaram uma maior deposição no período seco (verão, enquanto que a fruta-pão, cupuaçuzeiro, mangueira, teca, gliricídia e abacateiro as maiores deposições foram no período chuvoso (inverno. Por outro lado a serapilheira acumulada sobre o solo foi de 14,61 t ha-1 na mangueira, 12,8 t ha-1 na bandarra, 12,73 t ha-1 na vegetação natural, 12,04 t ha-1, no abacateiro, 9,87 t ha-1 no cacaueiro/gliricídia, 9,88 t ha-1 no cupuaçuzeiro, 9,05 t ha-1 na fruta-pão e 7,39 t ha-1 na teca.One study was made to evaluate litter production in different fruitful coverings and forest components of a multistrata agroforestry system located in Ouro Preto do Oeste district (RO, Brazil. The studied species were: mango tree (Mangifera indica L., breadfruit tree (Artocarpus altilis (Parkinson Fosberg, cupuassu tree (Theobroma
International Nuclear Information System (INIS)
Kim, Ji Young; Kim, Dong Hee; Kim, Hyung Gyun; Song, Gyu-Yong; Chung, Young Chul; Roh, Seong Hwan; Jeong, Hye Gwang
2006-01-01
Adhesion molecules play an important role in the development of atherogenesis and are produced by endothelial cells after being stimulated with various inflammatory cytokines. This study examined the effect of saponins that were isolated from the roots of Platycodon grandiflorum A. DC (Campanulaceae), Changkil saponins (CKS), on the cytokine-induced monocyte/human endothelial cell interaction, which is a crucial early event in atherogenesis. CKS significantly inhibited the TNFα-induced increase in monocyte adhesion to endothelial cells as well as decreased the protein and mRNA expression levels of vascular adhesion molecule-1 and intercellular cell adhesion molecule-1 on endothelial cells. Furthermore, CKS significantly inhibited the TNFα-induced production of intracellular reactive oxygen species (ROS) and activation of NF-κB by preventing IκB degradation and inhibiting IκB kinase activity. Overall, CKS has anti-atherosclerotic and anti-inflammatory activity, which is least in part the result of it reducing the cytokine-induced endothelial adhesion to monocytes by inhibiting intracellular ROS production, NF-κB activation, and cell adhesion molecule expression in endothelial cells
Theobroma cacao is a tree cultivated in the tropics around the world for its seeds that are the source of both chocolate and cocoa butter. The cacao genome sequencing project initiated as a collaboration between USDA, Mars, Inc. and IBM has generated a great deal of transcriptome and genome sequenc...
Directory of Open Access Journals (Sweden)
Edson de Almeida Cardoso
2008-08-01
Full Text Available This research work had as objective to evaluate the effect of different substrates on emergence and seedlings development of Erythrina velutina Willd. The experiment was carried out at the greenhouse of the Laboratory of Vegetable Ecology in the Center of Agrarian Sciences - Federal University of Paraíba. The substrates evaluated were washed sand; washed sand + vermiculite in the proportions of 1:1, 3:1 and 1:3; vegetable earth, vegetable earth + washed sand in the proportions of 1:1, 3:1 and 1:3, vegetable earth + vermiculite in the proportions of 1:1, 3:1 and 1:3, vermiculite, bioclone®, bioplant® and plugmix®. The experimental design was completely randomized with fifteen treatments (substrates and four replications of 25 seeds. The effect was evaluated through percent of emergence, first count, emergence velocity index, medium time and relative frequency of emergency, length and dry mass of the root and it leaves aerial of the seedling. The substrates sand and vermiculite had the best results and are recommended for conduction of tests of emergency of mulungu seedlings.Com o objetivo de avaliar a influência de diferentes substratos na emergência e desenvolvimento de plântulas de Erythrina velutina Willd. foi conduzido um experimento em casa de vegetação pertencente ao Laboratório de Ecologia Vegetal do Centro de Ciências Agrárias da Universidade Federal da Paraíba. Foram comparados os substratos areia lavada; areia lavada + vermiculita na proporção de 1:1, 3:1 e 1:3; terra vegetal, terra vegetal + areia lavada na proporção de 1:1, 3:1 e 1:3, terra vegetal + vermiculita na proporção de 1:1, 3:1 e 1:3, vermiculita, bioclone®, bioplant® e plugmix®. O delineamento utilizado foi o inteiramente casualizado com 15 tratamentos (substratos e quatro repetições de 25 sementes. Foram avaliados os seguintes parâmetros: porcentagem de emergência, primeira contagem, índice de velocidade, tempo médio e frequência relativa de
Hanada, Rogério E; de Jorge Souza, T; Pomella, Alan W V; Hebbar, K Prakash; Pereira, José O; Ismaiel, Adnan; Samuels, Gary J
2008-11-01
The new species Trichoderma martiale was isolated as an endophyte from sapwood in trunks of Theobroma cacao (cacao, Malvaceae) in Brazil. Based on sequences of translation-elongation factor 1-alpha (tef1) and RNA polymerase II subunit (rpb2) T. martiale is a close relative of, and morphologically similar to, T. viride, but differs in the production of discrete pustules on corn meal-dextrose agar (CMD) and SNA, in having a faster rate of growth, and in being a tropical endophyte. This new species was shown, in small-scale, in situ field assays, to limit black pod rot of cacao caused by Phytophthora palmivora, the cause of black pod disease.
Antioxidant effects of an ozonized theobroma oil formulation on damaged-inflammatory rat skin
Energy Technology Data Exchange (ETDEWEB)
Sanchez, Y.; Diaz, M.F.; Hernandez, F.; Gila, D.; Ga, G.
2011-07-01
The aim of this study was to determine whether a cosmetic formulation elaborated with ozonized theobroma oil may exert beneficial effects in the restoring of the antioxidant activity on the skin of rats previously irradiated with ultraviolet light. 0.5 g of the formulation was applied on the skin of rats for five days. Superoxide dismutase (SOD), glutathione peroxidase (GPx) and catalase (CAT) activity were determined in a homogenate of rat skin. Malondialdehyde (MDA), conjugated dienes (CD) and total hydroperoxide (THP) content were determined as biomarkers of oxidative stress. Using these parameters, antioxidant and oxidant activity, redox index and oxidative stress grade were determined. The total antioxidant activity was significantly increased while the redox index, total oxidant activity and oxidative stress grade decreased significantly in damaged rats treated with the formulation. These results show the antioxidant properties of the cosmetic formulation due to the stimulation of antioxidant enzymes such as SOD and GPx, preventing skin injury induced by ultraviolet irradiation. (Author).
Choi, Jae Ho; Hwang, Yong Pil; Han, Eun Hee; Kim, Hyung Gyun; Park, Bong Hwan; Lee, Hyun Sun; Park, Byung Keun; Lee, Young Chun; Chung, Young Chul; Jeong, Hye Gwang
2011-09-01
Mucin overproduction is a hallmark of chronic airway diseases such as chronic obstructive pulmonary disease. In this study, we investigated the inhibition of acrolein-induced expression of mucin 5, subtypes A and C (MUC5AC) by Changkil saponin (CKS) in A549 cells. Acrolein, a known toxin in tobacco smoke and an endogenous mediator of oxidative stress, increases the expression of airway MUC5AC, a major component of airway mucus. CKS, a Platycodon grandiflorum root-derived saponin, inhibited acrolein-induced MUC5AC expression and activity, through the suppression of NF-κB activation. CKS also repressed acrolein-induced phosphorylation of ERK1/2, JNK1/2, and p38MAPK, which are upstream signaling molecules that control MUC5AC expression. In addition, the MAPK inhibitors PD98059 (ERK1/2), SP600125 (JNK1/2), and SB203580 (p38 MAPK), and a PKC delta inhibitor (rottlerin; PKCδ) inhibited acrolein-induced MUC5AC expression and activity. CKS repressed acrolein-induced phosphorylation of PKCδ. Moreover, a reactive oxygen species (ROS) inhibitor, N-acetylcysteine, inhibited acrolein-induced MUC5AC expression and activity through the suppression of PKCδ and MAPK activation, and CKS repressed acrolein-induced ROS production. These results suggest that CKS suppresses acrolein-induced MUC5AC expression by inhibiting the activation of NF-κB via ROS-PKCδ-MAPK signaling. Copyright © 2011 Elsevier Ltd. All rights reserved.
Ramírez Bojórquez, Oscar Horacio
2016-01-01
Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Economía Agrícola Esta investigación busca determinar los beneficios económicos que reportara la implementación de un sistema de riego tecnificado asociado al cultivo de la quinua (Chenopodium quinoa Willd.) en la zona del Callejón de Huaylas. Aprovechando las ventajas comparativas que presenta el cultivo de la quinua en nuestro medio, en un mercado de precios crecientes, alta demanda en el mercado interno y grandes p...
Directory of Open Access Journals (Sweden)
Yánez Yánez Wilfrido
2016-11-01
Full Text Available The research was conducted at the Center for Research, Graduate Studies and Amazon Conservation (CIPA of the Amazon State University, Ecuador. The purpose was to assess the effect of enriched compost Germination, day and day’s emergency transplantation two species of tropical origin and breadfruit Theobroma cacao. The experimental field is located in the province of Napo, 16'-1 and S and 77º 36'' 58'y 76'' W, at an altitude of 556 meters, with temperature between 18 and 32oC, average annual precipitation above 3000mm and relative humidity between 87 and 89%. An experimental design with five treatments in a randomized complete block design with three replications was applied. Treatments consisted of compost (1 MS, (2 lactic acid bacteria, (3 commercial yeast, (4 a combination thereof and (5 only compost, witness. It was determined that the compost mixture (T4 as a whole, has the greatest effect on the parameters of the seeds. Germination was found that in two of the T3 and T4 treatments significantly decreased the number of days to germination, in relation to the witness, 33 days and 13 days Artocarpus altilis, Theobroma cacao. The number of emerged plants, increase in both species with the addition of EM, lactic acid bacteria and commercial yeast (T4. a reduction is also reported in the days to transplant species studied to be significant particularly in cocoa. It was also determined that most bioburden corresponded to bacteria.
Karyotype variation in cultivars and spontaneous cocoa mutants (Theobroma cacao L.).
Figueiredo, G S F; Melo, C A F; Souza, M M; Araújo, I S; Zaidan, H A; Pires, J L; Ahnert, D
2013-10-18
Four mutant cocoa accessions with morphological changes and a cultivar sample were karyomorphologically characterized. Slides were prepared by enzymatic digestion of the root meristem and squashed in 45% acetic acid, followed by 2% Giemsa staining. The chromosome number of 2n = 20 was seen in all accessions. The karyotype formula for Cacau Comum and Cacau Rui was 2n = 20m. Submetacentric chromosomes were observed in Cacau Pucala and Cacau Jaca, both with 2n = 18m + 2sm, but the karyotype formula for Cacau Sem Vidro was 2n = 16m + 4sm. Satellites were located on the long arm of the 1st and 2nd chromosome pairs of Cacau Comum, whereas Cacau Pucala had satellites on the 6th chromosome pair. Greater karyotypic variation in Cacau Sem Vidro was found, whose 1st and 2nd chromosome pairs had satellites on the long arm and 6th and 10th pairs had satellites on the short arm. Analysis revealed a lower average chromosome length in Cacau Comum (1.53 ± 0.026 µm) and a higher length in Cacau Sem Vidro (2.26 ± 0.038 µm). ANOVA revealed significant difference (P Theobroma cacao.
Directory of Open Access Journals (Sweden)
Gláucia Cordeiro
2010-04-01
Abstract. The study of the insects associated with branches and stems girdled by Oncideres saga (Dalman is important to know its possible natural enemies. Therefore, these work had the objective of register the insects associated with branches and stems girdled of Acacia mangium Willd. by this twig girdler beetle, in Coimbra, state of Minas Gerais, Brazil. Stems and branches of A. mangium were collected in January/2007 to April/2007. This material has been inspected, stored in plastic bags, and kept in a room with controlled conditions (25.4 ± 0.3°C and 66.7 ± 1.4%. It was noted the presence of a non-determined species of Scolytidae and the emergence of four species of Cerambycidae: Engyum quadrinotatum Thomsom; Eburodacrys sexmaculata (Olivier; Achryson surinamum (Linnaeus and Neoclytus pusillus (Laporte & Gory. It can be concluded that studies are needed with the objective of verify the behavior of these insects in relation with twig girdler O. saga.
Tang, Yao; Li, Xihong; Zhang, Bing; Chen, Peter X; Liu, Ronghua; Tsao, Rong
2015-01-01
Quinoa (Chenopodium quinoa Willd.) is known for its exceptional nutritional value and potential health benefits. The present study identified the composition of different forms of extractable phenolics and betacyanins of quinoa cultivars in white, red and black, and how they contribute to antioxidant activities. Results showed that at least 23 phenolic compounds were found in either free or conjugated forms (liberated by alkaline and/or acid hydrolysis); the majority of which were phenolic acids, mainly vanillic acid, ferulic acid and their derivatives as well as main flavonoids quercetin, kaempferol and their glycosides. Betacyanins, mainly betanin and isobetanin, were confirmed for the first time to be the pigments of the red and black quinoa seeds, instead of anthocyanins. Darker quinoa seeds had higher phenolic concentration and antioxidant activity. Findings of these phenolics, along with betacyanins in this study add new knowledge to the functional components of quinoa seeds of different cultivar background. Crown Copyright © 2014. Published by Elsevier Ltd. All rights reserved.
Antimicrobial, Cytotoxic, Phytotoxic and Antioxidant Potential of Heliotropium strigosum Willd.
Khurm, Muhammad; Chaudhry, Bashir A; Uzair, Muhammad; Janbaz, Khalid H
2016-07-28
Background: Heliotropium strigosum Willd. (Chitiphal) is a medicinally important herb that belongs to the Boraginaceae family. Traditionally, this plant was used in the medication therapy of various ailments in different populations of the world. The aim of the study is to probe the therapeutic aspects of H. strigosum described in the traditional folklore history of medicines. Methods: In the present study, the dichloromethane crude extract of this plant was screened to explore the antimicrobial, cytotoxic, phytotoxic and antioxidant potential of H. strigosum . For antibacterial, antifungal and antioxidant activities, microplate alamar blue assay (MABA), agar tube dilution method and diphenyl picryl hydrazine (DPPH) radical-scavenging assay were used, respectively. The cytotoxic and phytotoxic potential were demonstrated by using brine shrimp lethality bioassay and Lemna minor assay. Results: The crude extract displayed positive cytotoxic activity in the brine shrimp lethality assay, with 23 of 30 shrimps dying at the concentration of 1000 µg/mL. It also showed moderate phytotoxic potential with percent inhibition of 50% at the concentration of 1000 µg/mL. The crude extract exhibited no significant antibacterial activity against Staphylococcus aureus , Shigella flexneri , Escherichia coli and Pseudomonas aeruginosa . Non-significant antifungal and radical scavenging activity was also shown by the dichloromethane crude extract. Conclusion: It is recommended that scientists focus on the identification and isolation of beneficial bioactive constituents with the help of advanced scientific methodologies that seems to be helpful in the synthesis of new therapeutic agents of desired interest.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2015-03-01
Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.Kata kunci: Theobroma cacao L., polifenol, embrio somatik, kalus, flavonoid, katekin, in vitro recalcitance
Directory of Open Access Journals (Sweden)
Sara Bumrungsri
2008-07-01
Full Text Available An exotic ambrosia beetle, Euplatypus parallelus (F. was collected from infested Pterocarpus indicus Willd. trees in Prince of Songkla University. Larvae and eggs were found in simple galleries with a single branch. Either a single male or a male and a female were found in each gallery. Half of these infested trees were previously attacked by long-horned beetles probably Aristobia horridula (Hope (Coleoptera: Cerambycidae, while some of them appeared to be healthy. Fusarium oxysporum Schlecht.:Fr. was isolated from frass, sapwood samples and insect larvae, and might be a cause of death of P.indicus.
Ecophysiological Analysis of Drought and Salinity Stress Quinoa (Chenopodium Quinoa Willd.
Directory of Open Access Journals (Sweden)
Bosque Sanchez, H.
2000-01-01
Full Text Available We have studied the relative influence of drought and salinity stress, with similar soil water potentials on growth, water relations and photosynthetic rate of quinoa (Chenopodium quinoa Willd., testing at the same time certain techniques of stress physiology studies. As treatments, we have imposed two levels of salinity stress (S1 = 3852, 8 mg. V-1 NaCI and S2 = 8051.2 mg. V-1 NaCI and two of levels of drought stress with-0.159 MPa (D1 and -0, 279 MPa (D2 of soil water potentials (f^, and the control (c treatment without stress (65 % of volumetric soil water content, i. e. ¥m = -0.059 MPa. Our results of the greenhouse experiment have shown that quinoa has better relative and absolute growth rate in saline conditions, and the plant have developed adaptations mechanisms to drought through higher water use efficiency and high root/shoot ratio. The stomatal resistance and leaf water potential were higher as higher were the stress conditions. The variable chlorophyll fluoresence to maximal chlorophyll fluorescence-ratio (Fv/Fm and the fluorescence quenching analysis (photochemical : qP and non-photochemical : qN have shown the plants under drought stress are less protected against photoinhibition. Finally the use of Dynamic Diffusion Porometer has limitations for studies of plants species with salt bladders as quinoa.
Assa, A.; Noor, A.; Yunus, M. R.; Misnawi; Djide, M. N.
2018-03-01
Concentrations of some heavy metals (Pb, Cu, Cd, As and Hg) were assessed for cocoa beans (Theobroma cacao L) originating from East Luwu, South Sulawesi, Indonesia after five-day fermentation. Consisting of PB 123, BR 25, and MCC 02 cocoa clones, the spectrophotometric analysis showed that concentrations of Pb, Cd, As and Hg in the cocoa beans over the three clones was below the detection limits of 0.100; 0.050, 0.010 and 0.005 mg/kg. For Cu, they were 19.343; 10.391, and 18.594 mg/kg respectively, but still below the maximum critical levels, established by the European Food Safety Authority (EFSA). Concentrations of those five heavy metals in the bean shells were found to be parallel to those in the cocoa beans, except for Pb.
Genetic diversity and population structure of a protected species: Polygala tenuifolia Willd.
Peng, Yan Qun; Fan, Ling Ling; Mao, Fu Ying; Zhao, Yun Sheng; Xu, Rui; Yin, Yu Jie; Chen, Xin; Wan, De Guang; Zhang, Xin Hui
2018-03-01
Polygala tenuifolia Willd. is an important protected species used in traditional Chinese medicine. In the present study, amplified fragment length polymorphism (AFLP) markers were employed to characterize the genetic diversity in wild and cultivated P. tenuifolia populations. Twelve primer combinations of AFLP produced 310 unambiguous and repetitious bands. Among these bands, 261 (84.2%) were polymorphic. The genetic diversity was high at the species level: percentage of polymorphic loci (PPL)=84.2%, Nei's gene diversity (h)=0.3296 and Shannon's information index (I)=0.4822. Between the two populations, the genetic differentiation of 0.1250 was low and the gene flow was relatively high, at 3.4989. The wild population (PPL=81.9%, h=0.3154, I=0.4635) showed a higher genetic diversity level than the cultivated population (PPL=63.9%, h=0.2507, I=0.3688). The results suggest that the major factors threatening the persistence of P. tenuifolia resources are ecological and human factors rather than genetic. These results will assist with the design of conservation and management programs, such as in natural habitat conservation, setting the excavation time interval for resource regeneration and the substitution of cultivated for wild plants. Copyright © 2018 Académie des sciences. Published by Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
D. Franciskievicz
2013-11-01
Full Text Available This work aimed to present the results of initial development in nursery of 4 genetic materials of cupuaçu trees, being one a material without selection (control and three clones of cupuaçu tree resistant to the fungus Moniliophthora perniciosa, causal agent of Witches' Broom. The seeds from Embrapa Amazônia Oriental (Belém - PA were put in seed bed for germination. After 25 days of seedling emergence these were transplanted in to plastic bags, arranged in a shade house (60%, and containing agricultural substrate and forest humus (1: 3. At the end of 130 days after sowing were compared the patterns of development of girth, height and relation height / girth in a randomized block design consisting of 4 treatments and 4 replicates, each replicate consisting of 16 seedlings. Results were subjected to analysis of variance (ANOVA and the averages compared by Tukey (5%. The values obtained to girth not differ, presented as overall mean 5.08 mm, however in relation to height cultivar 215 (31cm excelled on the cultivar 174 (25 cm and control (23 cm, however their average not differ of material 186 (27 cm. As regards the height / girth the values obtained for the control and cultivars 175, 186 and 215, were respectively, 4.6, 5.2, 5.1 and 5.9 cm / mm, being cultivar 215 different to control.
Directory of Open Access Journals (Sweden)
Rita de Cássia Trindade
1999-01-01
Full Text Available The alternative use of cocoa (Theobroma cacao for wine production was tested. The pulp samples, obtained from Formosa farm, Itacaré, Brazil, were diluted, homogenized and inoculated on Sabouraud dextrose agar medium (SDA and incubated at 28º C for 5-8 days. Selected colonies were tested for the ability to ferment cocoa pulp and divided into fermentative, non-fermentative and weak/late fermentative species. Isolates characterized as fermentative were further tested in a small-scale wine production plant and identified. Species from the genus Brettanomyces constituted the main fermentative yeasts, with the exception of two Kloeckera apis samples. The final wine product was normally pale or clear, making clarification unnecessary, and with a sweet or dry pleasant flavor. The predominance of Brettanomyces species in cocoa pulp indicated its ecological importance in this environment and pointed to an active role of Brettanomyces in the deterioration process of the processed cocoa pulp.O uso alternativo de cacau (Theobroma cacao para produção de vinho foi testado. A polpa de cacau foi obtida da Fazenda Formosa, Itacaré, Brasil. As amostras de polpa foram diluídas, homogeneizadas e inoculadas em meio de Sabouraud dextrose e incubadas a 28°C por 5-8 dias. Colônias selecionadas foram testadas quanto à habilidade de fermentar a polpa de cacau e divididas em fermentadoras, não-fermentadoras e fermentadoras lentas. As amostras fermentadoras foram identificadas e testadas para produção de vinho de cacau em escala piloto. A maioria das amostras fermentadoras pertencem ao gênero Brettanomyces, com exceção de duas amostras de Kloeckera apis. O vinho obtido apresentou coloração fraca e clara, tornando a clarificação desnecessária, além de sabor doce e agradável. A predominância de espécies de Brettanomyces na polpa de cacau poderia indicar sua importância ecológica neste ambiente e sugere uma participação ativa dessas leveduras nos
Baharum, Zainal; Akim, Abdah Md; Hin, Taufiq Yap Yun; Hamid, Roslida Abdul; Kasran, Rosmin
2016-01-01
Plants have been a good source of therapeutic agents for thousands of years; an impressive number of modern drugs used for treating human diseases are derived from natural sources. The Theobroma cacao tree, or cocoa, has recently garnered increasing attention and become the subject of research due to its antioxidant properties, which are related to potential anti-cancer effects. In the past few years, identifying and developing active compounds or extracts from the cocoa bean that might exert anti-cancer effects have become an important area of health- and biomedicine-related research. This review provides an updated overview of T. cacao in terms of its potential anti-cancer compounds and their extraction, in vitro bioassay, purification, and identification. This article also discusses the advantages and disadvantages of the techniques described and reviews the processes for future perspectives of analytical methods from the viewpoint of anti-cancer compound discovery. PMID:27019680
Directory of Open Access Journals (Sweden)
Yacenia Morillo C.
2014-12-01
Full Text Available Random amplified microsatellite (RAMs markers six were used to characterize 93 genotypes of cocoa in Tumaco (Colombia. Hundred twenty seven bands were generated. The number of polymorphic loci varied between 11 and 25 for the AG and TG primers, respectively. This study differentiated the 93 genotypes into six groups with a 0.53 similarity, 0.28 mean heterozygosity (He for the population, and 0.12±0.02 genetic differentiation coefficient or Fst. A significant level of genetic diversity was evident in the T. cacao genotypes. This resource would benefit selection programs of individual trees or plant breeding programs. The genotypes clustered in a large proportion in accordance with the collection zone. This characteristic was associated with collection zones and along the rivers in the municipality of Tumaco. The RAM technique proved to be a useful tool for the determination of genetic diversity in Theobroma species.
Physiological responses of Theobroma cacao L. to water soil available in nursery stage
Directory of Open Access Journals (Sweden)
Jairo Garcia Lozano
2016-01-01
Full Text Available In the locality of El Espinal, Tolima, the effect of water stress on leaf water potential and gas exchange of plants three clones of cacao (Theobroma cacao L was evaluated. The experiment was established in a split plot design in randomized block arrangement. The main plot was four levels of available soil water, subplot grafted seedlings to three months of three clones with five repetitions. The results showed highly significant differences (P <0.01 in content of soil water, but no differences between the materials evaluated. The loss of water in the soil decreases leaf water potential (Ψf and causes stomatal closure altering gas exchange and vapor pressure deficit (DPV accentuates mainly at noon with increasing evapotranspiration. The magnitude of impact of water deficit depends on climatic variations throughout the day. The climatic variables that affect plant development, are temperature and relative humidity in the form of DPV. Net photosynthesis and growth of cocoa seedlings are physiological variables very sensitive to excess and especially to water deficit.
Biosynthesis, accumulation and degradation of theobromine in developing Theobroma cacao fruits.
Zheng, Xin-Qiang; Koyama, Yoko; Nagai, Chifumi; Ashihara, Hiroshi
2004-04-01
We have studied the purine alkaloid content and purine metabolism in Theobroma cacao fruits at differing growth stages: Stage A (young small fruit, fresh weight, ca. 2 g); stage B (medium size fruit, fresh weight, ca. 100 g) and stage C (large size, fresh weight, ca. 500 g). The major purine alkaloid in stage A fruits (mainly pericarp) was theobromine (0.7 micromol g(-1) fresh weight), followed by caffeine (0.09 micromol g(-1) fresh weight). The theobromine content of the pericarp decreased sharply with tissue age, and the caffeine content decreased gradually. A large amount of theobromine (22 micromol g(-1) fresh weight) had accumulated in seeds (mainly cotyledons) of stage C fruits. Theobromine was found also in the seed coat and placenta. Tracer experiments with [8-(14)C]adenine show that the major sites of theobromine synthesis are the young pericarp and cotyledons of T. cacao fruits. Limited amounts of purine alkaloids may be transported from the pericarp to seed tissue, but most purine alkaloids that accumulated in seeds appeared to be synthesised in cotyledons. Degradation of [8-(14)C]theobromine and [8-(14)C]caffeine to CO2 via 3-methylxanthine and ureides (allantoin and allantoic acid) was detected only in the pericarp of stage C fruits.
Confocal observations of late-acting self-incompatibility in Theobroma cacao L.
Ford, Caroline S; Wilkinson, Mike J
2012-09-01
Cocoa (Theobroma cacao) has an idiosyncratic form of late-acting self-incompatibility that operates through the non-fusion of incompatible gametes. Here, we used high-resolution confocal microscopy to define fine level changes to the embryo sac of the strongly self-incompatible cocoa genotype SCA 24 in the absence of pollination, and following compatible and incompatible pollination. All sperm nuclei had fused with the female nuclei by 48 h following compatible pollinations. However, following incompatible pollinations, we observed divergence in the behaviour of sperm nuclei following release into the embryo sac. Incomplete sperm nucleus migration occurred in approximately half of the embryo sacs, where the sperm nuclei had so far failed to reach the female gamete nuclei. Sperm nuclei reached but did not fuse with the female gamete nuclei in the residual cases. We argue that the cellular mechanisms governing sperm nucleus migration to the egg nucleus and those controlling subsequent nuclear fusion are likely to differ and should be considered independently. Accordingly, we recommend that future efforts to characterise the genetic basis of LSI in cocoa should take care to differentiate between these two events, both of which contribute to failed karyogamy. Implications of these results for continuing efforts to gain better understanding of the genetic control of LSI in cocoa are discussed.
Gabbay Alves, Taís Vanessa; Silva da Costa, Russany; Aliakbarian, Bahar; Casazza, Alessandro Alberto; Perego, Patrizia; Carréra Silva Júnior, José Otávio; Ribeiro Costa, Roseane Maria; Converti, Attilio
2017-03-01
The cocoa extract (Theobroma cacao L.) has a significant amount of polyphenols (TP) with potent antioxidant activity (AA). This study aims to optimise microencapsulation of the extract of cocoa waste using chitosan and maltodextrin. Microencapsulation tests were performed according to a Box-Behnken factorial design, and the results were evaluated by response surface methodology with temperature, maltodextrin concentration (MD) and extract flowrate (EF) as independent variables, and the fraction of encapsulated TP, TP encapsulation yield, AA, yield of drying and solubility index as responses. The optimum conditions were: inlet temperature of 170 °C, MD of 5% and EF of 2.5 mL/min. HPLC analysis identified epicatechin as the major component of both the extract and microparticles. TP release was faster at pH 3.5 than in water. These results as a whole suggest that microencapsulation was successful and the final product can be used as a nutrient source for aquatic animal feed. Highlights Microencapsulation is optimised according to a factorial design of the Box-Behnken type. Epicatechin is the major component of both the extract and microcapsules. The release of polyphenols from microcapsules is faster at pH 3.5 than in water.
Thomas, Sarah E; Crozier, Jayne; Catherine Aime, M; Evans, Harry C; Holmes, Keith A
2008-07-01
Fungal endophytes were isolated from healthy stems and pods of Theobroma gileri, an alternative host of the frosty pod rot pathogen of cacao. Non-sporulating isolates were grouped into 46 different morphological species according to their colony morphology. Many of these morphospecies were assumed to be basidiomycetes and, therefore, were of particular interest. Basidiomycetous endophytes have received far less attention than ascomycetes and also have potential as biological control agents of the basidiomycetous pathogens of T. cacao: Moniliophthora roreri (frosty pod rot pathogen) and M. perniciosa (witches' broom disease). The morphospecies were further characterised by molecular analyses. Amplification of the nuLSU was undertaken for phylogenetic placement of these non-sporulating cultures and revealed a total of 31 different taxa of which 15 were basidiomycetes belonging to the class Agaricomycetes, and 16 ascomycetes primarily belonging to the Sordariomycetes.
Energy Technology Data Exchange (ETDEWEB)
Cathey, H.M.; Heggestad, H.E.
1973-01-01
Eight cultivars of poinsettia, Euphorbia pulcherrima Willd., were evaluated for sensitivity to ..cap alpha..-cyclopropyl-..cap alpha.. (4-methoxyphenyl)-5-pyrimidine methanol (ancymidol) and protection from ozone and sulfur dioxide injury afforded by applications of ancymidol and (2-chloroethyl) trimethyl ammonium chloride (chlormequat). Foliar sprays of ancymidol were at least 80 to 500 times and the soil drench 1000 times more active than chlormequat in retarding stem elongation. The diam of the bracts was reduced, but branching increased more on plants treated with ancymidol than on untreated plants. The cv. Annette Hegg (AH) was more sensitive to ozone fumigations than was Eckespoint C-1' (C-1). Sulfur dioxide also caused more injury to AH than to C-1. Ancymidol and chlormequat reduced visible injury induced by ozone and sulfur dioxide.
Directory of Open Access Journals (Sweden)
Maria Inés Genovese
2009-12-01
Full Text Available Polyphenolic compounds seem to be related to the health benefits produced by the cocoa due to their antioxidant properties. Cupuassu powder, prepared from Theobroma grandiflorum seeds, is a very promising cocoa powder substitute. In order to assess the potential health benefits of the cupuassu powder, a comparison was performed between cocoa, chocolate, and cupuassu powders in relation to the content of total phenolic compounds, flavonoids and DPPH scavenging capacity of methanolic extracts. Cupuassu "chocolates" (milk, dark, and white were also analyzed. Mineral, lipid, protein, and moisture determinations were made in cocoa and cupuassu powders and in cupuassu "chocolates". Results showed that the phenolic contents of cocoa and chocolate powders are more than three times higher than those of cupuassu powder; however, flavonoid contents were significantly lower. The DPPH scavenging capacity varied hugely among the different samples, from 0.5 (white cupuassu "chocolate" to 120 (cocoa powder μg of Trolox equivalent per 100 g (FW, and presented a significant correlation (r = 0.977 with the total phenolic contents but not with the flavonoid contents (r = -0.035.Os compostos polifenólicos têm sido implicados nos efeitos benéficos à saúde promovidos pelo cacau devido às suas propriedades antioxidantes. Cupuaçu em pó, preparado a partir de sementes de Theobroma grandiflorum, é um substituto promissor para o cacau em pó. Com a finalidade de verificar os benefícios potenciais para a saúde deste produto, foi efetuada uma avaliação do cacau e cupuaçu em pó, bem como de "chocolates" de cupuaçu, com relação ao conteúdo de compostos fenólicos, flavonóides e capacidade anti-radical livre dos extratos metanólicos. Os conteúdos de minerais, lipídeos, proteínas e umidade foram determinados em cacau e cupuaçu em pó, assim como nos "chocolates" de cupuaçu. Os resultados mostraram que os conteúdos de compostos fenólicos no cacau e no
Bascuñán-Godoy, Luisa; Reguera, Maria; Abdel-Tawab, Yasser M; Blumwald, Eduardo
2016-03-01
Water deficit stress followed by re-watering during grain filling resulted in the induction of the ornithine pathway and in changes in Quinoa grain quality. The genetic diversity of Chenopodium quinoa Willd. (Quinoa) is accompanied by an outstanding environmental adaptability and high nutritional properties of the grains. However, little is known about the biochemical and physiological mechanisms associated with the abiotic stress tolerance of Quinoa. Here, we characterized carbon and nitrogen metabolic changes in Quinoa leaves and grains in response to water deficit stress analyzing their impact on the grain quality of two lowland ecotypes (Faro and BO78). Differences in the stress recovery response were found between genotypes including changes in the activity of nitrogen assimilation-associated enzymes that resulted in differences in grain quality. Both genotypes showed a common strategy to overcome water stress including the stress-induced synthesis of reactive oxygen species scavengers and osmolytes. Particularly, water deficit stress induced the stimulation of the ornithine and raffinose pathways. Our results would suggest that the regulation of C- and N partitioning in Quinoa during grain filling could be used for the improvement of the grain quality without altering grain yields.
Biological effects of hydrolyzed quinoa extract from seeds of Chenopodium quinoa Willd.
Meneguetti, Quele Adriana; Brenzan, Mislaine Adriana; Batista, Marcia Regina; Bazotte, Roberto Barbosa; Silva, Daniel Rodrigues; Garcia Cortez, Diógenes Aparício
2011-06-01
An extract from seeds of Chenopodium quinoa Willd. (quinoa), termed hydrolyzed quinoa (HQ), was obtained by enzymatic hydrolysis from seeds of the quinoa variety BRS-Piabiru. Analysis of the physical and chemical properties of quinoa and HQ showed that the hydrolyzed extract is rich in essential amino acids, particularly those with branched chains (leucine, isoleucine, and valine). In addition, we evaluated the biological effects of HQ, particularly the toxicological potential. For this purpose, male Wistar rats were assigned randomly to four groups: (1) sedentary supplemented group, which received HQ (2,000 mg/kg); (2) sedentary control group, non-supplemented; (3) exercised supplemented group (i.e., rats subjected to aerobic physical exercise that received HQ [2,000 mg/kg]); and (4) exercised control group (i.e., rats subjected to aerobic physical exercise, non-supplemented). After 30 days, all groups were analyzed for levels of serum glucose, cholesterol, triacylglycerol, total protein, albumin, uric acid, and urea and activities of the enzymes alkaline phosphatase, aspartate aminotransferase, and alanine aminotransferase. Body weight gain, dietary intake, and lipid deposition were also analyzed. The results showed no hepatic and renal toxicity of HQ. Moreover, decreased food intake, body weight, fat deposition, and blood triacylglycerol level were observed in the supplemented groups (sedentary and exercised supplemented groups). These results suggest a potential use of HQ in human nutrition.
Predicting the Potential Distribution of Polygala tenuifolia Willd. under Climate Change in China.
Directory of Open Access Journals (Sweden)
Hongjun Jiang
Full Text Available Global warming has created opportunities and challenges for the survival and development of species. Determining how climate change may impact multiple ecosystem levels and lead to various species adaptations is necessary for both biodiversity conservation and sustainable biological resource utilization. In this study, we employed Maxent to predict changes in the habitat range and altitude of Polygala tenuifolia Willd. under current and future climate scenarios in China. Four representative concentration pathways (RCP2.6, RCP4.5, RCP6.0, and RCP8.5 were modeled for two time periods (2050 and 2070. The model inputs included 732 presence points and nine sets of environmental variables under the current conditions and the four RCPs in 2050 and 2070. The area under the receiver-operating characteristic (ROC curve (AUC was used to evaluate model performance. All of the AUCs were greater than 0.80, thereby placing these models in the "very good" category. Using a jackknife analysis, the precipitation in the warmest quarter, annual mean temperature, and altitude were found to be the top three variables that affect the range of P. tenuifolia. Additionally, we found that the predicted highly suitable habitat was in reasonable agreement with its actual distribution. Furthermore, the highly suitable habitat area was slowly reduced over time.
Directory of Open Access Journals (Sweden)
Daniel Moreto Silvestre
2013-09-01
Full Text Available We evaluated the phytotoxic effects that the hexane, ethyl acetate and methanol extracts from leaves and branches of the species Turnera ulmifolia L. and Turnera diffusa Willd. ex Schult. (Turneraceae, at concentrations of 1.25, 2.50, 3.75 and 5.00 mg ml-1, have on seed germination and seedling development in cucumber (Cucumis sativus L.. None of the extracts tested prevented germination, although the ethyl acetate extracts of T. diffusa, at 3.75 and 5.00 mg ml-1, reduced the mean germination speed and time to germination. Hexane extracts of both species reduced the main root length, number of secondary roots and hypocotyl length. In the ethyl acetate and methanol extracts, the number of secondary roots and hypocotyl length varied by species and concentration. Ethyl acetate extracts of T. ulmifolia at 2.50 mg ml-1. Comparatively, T. diffusa extracts inhibited development to a greater degree, thus presenting greater allelopathic potential, than did T. ulmifolia extracts.
KARAKTERISASI DAN SKRINING FITOKIMIA DAUN SINGKIL (Premna corymbosa Rottl & Willd
Directory of Open Access Journals (Sweden)
Risa Supriningrum
2017-10-01
Full Text Available Empirically, singkil leaves are used as uric acid medicine. Preliminary research data on the characterization of simplicia and singkil leaf extract (Premna corymbosa Rottl & Willd have not been reported. The purpose of this research is to know the characteristics of simplicia and young and old leaf extracts and their chemical content. The simplisia extraction was done by maceration using 70% ethanol solvent. The research stages are starting from sampling, plant determination, simplisia making, maceration extraction, characteristic examination and phytochemical screening. Result of characterization of simplicia, macroscopic of singkil leaves have green color, tip of tapered leaf, root of blunt leaf, rompang, jagged leaf edge, round and round leaves shape, pinnate leaf bone, thin leaf meat, leaf length 10.9 to 15 cm. Leaf width 6.3 to 9.6 cm. Microscopic observations found fragments of stodata type identifiers of diasitik, parasitic, spiral vein formation, hair cover, glandular trichomes. Water content of young leaves 8%, 5.5% old leaves, 3% water soluble sari content, 1.5% old leaves, 2% ethanol soluble sugary leaves, 1.5% leaflets, young leaf ash content 4,86%, old leaf of 7.01%, ash content of young leaf acid 2,20% and old leaf 3,14%. Moisture content of young leaves 17,5%, 17% old leaves, 0% water soluble leaf extract, 1% old leaf, soluble ethanol extract 0,5%, old leaf 4%, young leaf ash content 38, 5%, 11.6% old leaves, ash content of young leaf acids 1.51%, old leaves 2.33%. Secondary metabolites of simplicia and extracts are known to contain flavonoids, tannins, saponins and steroids / terpenoids.
Martínez-Márquez, Ascensión; Morante-Carriel, Jaime Alfredo; Bru-Martínez, Roque
2017-01-01
Cocoa, Theobroma cacao L. is one of the main tropical industrial crops. Cocoa has a very high level of interfering substances, such as polysaccharides and phenolic compounds that could prevent the isolation of suitable protein. Efficient methods of protein extraction are a priority to successfully apply proteomic analyses. We compared and evaluated two methods (A and B) of tissue preparation for total protein extract by phenol/SDS extraction protocol. The difference in the application of the ...
Enraizaimento de estacas de Bougainvillea spectabilis Willd. com o uso de ácido indolbutírico
Directory of Open Access Journals (Sweden)
Elias Mendes Costa
2015-07-01
Full Text Available O uso de ácido indolbutírico (IBA como estimulador do enraizamento em estacas de Bougainvillea spectabilis Willd. pode propiciar aumento de raízes para a formação de mudas comercializáveis. Objetivou-se avaliar o enraizamento, a formação de brotos e a sobrevivência de estacas herbáceas, lenhosas e semi-lenhosas de Bougainvillea com o uso de ácido indolbutírico (IBA. As estacas foram coletadas e tratadas com o IBA (1000 e 2000 mg/l. Aos 56 dias avaliaram-se a porcentagem de estacas vivas, enraizadas e com brotos; o número de brotos e de raízes por estaca e o comprimento da maior raiz e maior broto. As menores porcentagens de enraizamento foram verificadas nas estacas sem o uso de IBA. Maiores diferenças foram verificadas para as estacas lenhosas. O uso do IBA favorece o enraizamento de estacas de Bougainvillea, com melhor desempenho para as estacas lenhosas e na concentração de 2000 mg/l de IBA
Vega-Gálvez, Antonio; Miranda, Margarita; Vergara, Judith; Uribe, Elsa; Puente, Luis; Martínez, Enrique A
2010-12-01
Quinoa, Chenopodium quinoa Willd., is an Amaranthacean, stress-tolerant plant cultivated along the Andes for the last 7000 years, challenging highly different environmental conditions ranging from Bolivia, up to 4.500 m of altitude, to sea level, in Chile. Its grains have higher nutritive value than traditional cereals and it is a promising worldwide cultivar for human consumption and nutrition. The quinoa has been called a pseudo-cereal for botanical reasons but also because of its unusual composition and exceptional balance between oil, protein and fat. The quinoa is an excellent example of 'functional food' that aims at lowering the risk of various diseases. Functional properties are given also by minerals, vitamins, fatty acids and antioxidants that can make a strong contribution to human nutrition, particularly to protect cell membranes, with proven good results in brain neuronal functions. Its minerals work as cofactors in antioxidant enzymes, adding higher value to its rich proteins. Quinoa also contains phytohormones, which offer an advantage over other plant foods for human nutrition. Copyright © 2010 Society of Chemical Industry.
Choi, Yoonho; Kang, Sehyeon; Cha, Song-Hyun; Kim, Hyun-Seok; Song, Kwangho; Lee, You Jeong; Kim, Kyeongsoon; Kim, Yeong Shik; Cho, Seonho; Park, Youmie
2018-01-01
A green synthesis of gold and silver nanoparticles is described in the present report using platycodon saponins from Platycodi Radix ( Platycodon grandiflorum) as reducing agents. Platycodin D (PD), a major triterpenoidal platycodon saponin, was enriched by an enzymatic transformation of an aqueous extract of Platycodi Radix. This PD-enriched fraction was utilized for processing reduction reactions of gold and silver salts to synthesize gold nanoparticles (PD-AuNPs) and silver nanoparticles (PD-AgNPs), respectively. No other chemicals were introduced during the reduction reactions, providing an entirely green, eco-friendly, and sustainable method. UV-visible spectra showed the surface plasmon resonance bands of PD-AuNPs at 536 nm and PD-AgNPs at 427 nm. Spherically shaped nanoparticles were observed from high-resolution transmission electron microscopy with average diameters of 14.94 ± 2.14 nm for PD-AuNPs and 18.40 ± 3.20 nm for PD-AgNPs. Minor triangular and other polygonal shapes were also observed for PD-AuNPs along with spherical ones. Atomic force microscopy (AFM) images also demonstrated that both nanoparticles were mostly spherical in shape. Curvature-dependent evolution was employed to enhance the AFM images and precisely measure the sizes of the nanoparticles. The sizes were measured as 19.14 nm for PD-AuNPs and 29.93 nm for PD-AgNPs from the enhanced AFM images. Face-centered cubic structures for both nanoparticles were confirmed by strong diffraction patterns from high-resolution X-ray diffraction analyses. Fourier transform infrared spectra revealed the contribution of -OH, aromatic C=C, C-O, and C-H functional groups to the synthesis. Furthermore, the catalytic activity of PD-AuNPs was assessed with a reduction reaction of 4-nitrophenol to 4-aminophenol in the presence of sodium borohydride. The catalytic activity results suggest the potential application of these gold nanoparticles as catalysts in the future. The green strategy reported in this
WATER AND SODIUM CHLORIDE EFFECTS ON Mimosa Tenuiflora (WILLD. POIRET SEED GERMINATION
Directory of Open Access Journals (Sweden)
Ivonete Alves Bakke
2006-01-01
Full Text Available Water shortage and saline soils of the Brazilian semi-arid northeastern region are limiting factors to the development of many plants. Jurema preta (Mimosa tenuiflora (Willd. Poiret is a small, multiple use tree that abundantly colonizes unfavorable sites, including environments with severe water stress. This work had the objective of investigating the tolerance of jurema preta seeds to water and salt stresses during germination. Seeds germination in polyethylene glycol (PEG-6000 and sodium chloride (NaCl solutions was analyzed under five different osmotic potentials (0.0; -0.3, -0.6, -0.9 and -1.2MPa, in order to simulate water and salt stress, respectively, in four 100-seed replications for each treatment. Seeds were placed into 10cmx10cmx4cm boxes, and germination accomplished in BOD germinator adjusted to 30oC. The number of germinated seeds was monitored every 24 hours, and percentage and speed of seed germination were generated from these data. Mean percentage germination in the control treatment was ~95%, reducing to 63-53% at -0.9 to -1.2-MPa PEG solutions, and to 27- 9.5% at NaCl solutions at equivalent osmotic potentials. Velocity of germination index was more affected, and decreased up to 1/8 of the control, at -0.6 MPa. Jurema preta seeds showed lower tolerance to NaCl than to water stress, and this species can be classified as a glycophyte.
Kolano, B; Gardunia, B W; Michalska, M; Bonifacio, A; Fairbanks, D; Maughan, P J; Coleman, C E; Stevens, M R; Jellen, E N; Maluszynska, J
2011-09-01
The chromosomal organization of two novel repetitive DNA sequences isolated from the Chenopodium quinoa Willd. genome was analyzed across the genomes of selected Chenopodium species. Fluorescence in situ hybridization (FISH) analysis with the repetitive DNA clone 18-24J in the closely related allotetraploids C. quinoa and Chenopodium berlandieri Moq. (2n = 4x = 36) evidenced hybridization signals that were mainly present on 18 chromosomes; however, in the allohexaploid Chenopodium album L. (2n = 6x = 54), cross-hybridization was observed on all of the chromosomes. In situ hybridization with rRNA gene probes indicated that during the evolution of polyploidy, the chenopods lost some of their rDNA loci. Reprobing with rDNA indicated that in the subgenome labeled with 18-24J, one 35S rRNA locus and at least half of the 5S rDNA loci were present. A second analyzed sequence, 12-13P, localized exclusively in pericentromeric regions of each chromosome of C. quinoa and related species. The intensity of the FISH signals differed considerably among chromosomes. The pattern observed on C. quinoa chromosomes after FISH with 12-13P was very similar to GISH results, suggesting that the 12-13P sequence constitutes a major part of the repetitive DNA of C. quinoa.
Directory of Open Access Journals (Sweden)
Giuditta De Santis
2016-08-01
Full Text Available Seeds of the Andean seed crop quinoa (Chenopodium quinoa Willd. usually contain saponins in the seed coat. Saponins give a bitter taste sensation and are a serious antinutritional factor, therefore selection of sweet genotypes with a very low saponin content in the seeds is a main breeding goal. The objective of this work was to identify, within germplasm lines of quinoa, previously selected for production and quality traits, superior genotypes low in saponins. For this purpose the total saponin content was determined in seeds of eight lines of quinoa and one variety (cv. Regalona Baer as a control, previously evaluated over a 2-year period in a Southern Italy environment. Significant variation for the saponin content was observed among the evaluated genotypes. The total saponin content ranged from 0.10 to 1.80%, with the Q12 genotype showing the lowest value, suggesting the possibility of selecting genotypes sweet to be used in subsequent genetic improvement programs. Based on these results, in fact, it was possible to identify, among the accessions previously selected, particularly suitable for growing in Mediterranean area, some genotypes with high yields of seed (2.5 tha–1, on average, high protein (17%, on average and fibres (13%, on average and low content in saponins (0.57%, on average.
Directory of Open Access Journals (Sweden)
Hernán Jair Andrade
2014-08-01
Full Text Available Carbon sequestration potential of rubber (Hevea brasiliensis plantations was estimated in two production systems: monoculture and agroforestry system with copoazú (Theobroma grandiflorum, on farms of Florencia, El Doncello and Belén de los AndaquÃes, in northeastern Colombian Amazon, department of Caquetá. The plantations were classified into three age classes, according to their productive stage: 1-7, 8-20 and > 20 years. The carbon storage was estimated using the methodology proposed by Andrade and Ibrahim (2003 and recommended by IPCC (2003. Tree carbon sinks were evaluated: above and below ground biomass, and necromass. The highest proportion of carbon storage was found in biomass, with 95 and 92% in monoculture plantations and agroforestry systems, respectively. In both types of production systems, carbon storage is a function of tree age and density. The carbon stored in monoculture plantations was higher than in agroforestry systems, due to a greater density of rubber trees in the first production system. This study confirms that rubber plantations have potential to capture and store atmospheric carbon. With this information, the issue of participating in carbon markets of the rubber production chain can be addressed, and therefore strengthen in the region’s competitiveness and sustainability.
AMAZON RAINFOREST COSMETICS: CHEMICAL APPROACH FOR QUALITY CONTROL
Directory of Open Access Journals (Sweden)
Mariko Funasaki
2016-02-01
Full Text Available The market for natural cosmetics featuring ingredients derived from Amazon natural resources is growing worldwide. However, there is neither enough scientific basis nor quality control of these ingredients. This paper is an account of the chemical constituents and their biological activities of fourteen Amazonian species used in cosmetic industry, including açaí (Euterpe oleracea, andiroba (Carapa guianensis, bacuri (Platonia insignis, Brazil nut (Bertholletia excelsa, buriti (Mauritia vinifera or M. flexuosa, cumaru (Dipteryx odorata, cupuaçu (Theobroma grandiflorum, guarana (Paullinia cupana, mulateiro (Calycophyllum spruceanum, murumuru (Astrocaryum murumuru, patawa (Oenocarpus bataua or Jessenia bataua, pracaxi (Pentaclethra macroloba, rosewood (Aniba rosaeodora, and ucuuba (Virola sebifera. Based on the reviewed articles, we selected chemical markers for the quality control purpose and evaluated analytical methods. Even though chromatographic and spectroscopic methods are major analytical techniques in the studies of these species, molecular approaches will also be important as used in food and medicine traceability. Only a little phytochemical study is available about most of the Amazonian species and some species such as açaí and andiroba have many reports on chemical constituents, but studies on biological activities of isolated compounds and sampling with geographical variation are limited.
Andrušíková, Petra
2016-01-01
Bachelor thesis contains characteristic of species Theobroma cacao. In this work is described origin and history, processing and world market with cocoa beans. In work is compared cultivation at plantation in agroforestry and monoculture systems. There is compared the benefits and disadvantages of usage of this systems. In the work is mentioned some informations about world organization, which are interested in agroforestry and also agroforestry certification.
Pengaruh Kadar Air dan Persamaan Model Bet untuk Prediksi Masa Simpan Kakao (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Rita Hayati
2017-04-01
Full Text Available Effect of moisture content and BET equation to the shelf life of cocoa (Theobroma cacao L. has been conducted. Increasing the quality of cocoa beans is with proper post-harvest handling, including how the harvest, the level of ripeness, curing, fermenting, drying up storage. The purpose of this study was to determine the water content and the appropriate levels of critical in determining the shelf life of cocoa. The benefits of this research are as information for farmers in determining the shelf life of cocoa in order to design a storage area corresponding to the respiratory system owned by cocoa. The results showed that the effect of fermentation facilitator (Staphilococcus cerevisiae and drying temperature on water content showed that the fermentation facilitator (Staphilococcus cerevisiae highly significant effect on water content. The drying temperature is also highly significant effect on water content. BET equation obtained was Y = 2,912x + 1.238 (R2 = 0.965, Y = 2,897x + 1.353 (R2 = 0.968 and Y = 2,806x + 1.89 (R2 = 0.954.
Directory of Open Access Journals (Sweden)
Margarita Miranda
2012-06-01
Full Text Available This study explored the diversity of the quinoa crop in Chile from a nutritional perspective. Nutritional properties, minerals, vitamins, and saponin content were assessed in seeds of six Chilean quinoa (Chenopodium quinoa Willd. ecotypes grown in three main production areas with distinctive climatic and edaphic conditions: Ancovinto and Cancosa in the North-Altiplano or High Plateau, Cáhuil and Faro in the central coastal area, and Regalona and Villarrica in the south of the country. There were significant differences (P La diversidad en el cultivo de la quinoa (Chenopodium quinoa Willd. de Chile fue explorada desde una perspectiva nutricional. En este contexto las propiedades nutricionales como también los contenidos de minerales, vitaminas y saponina fueron evaluados en las semillas de seis ecotipos chilenos de quínoa, cultivados en las tres principales zonas de producción con condiciones edafoclimáticas distintas: Ancovinto y Cancosa del altiplano del norte, Cáhuil y Faro de la zona costera central y, Regalona y Villarrica en el sur del país. Hubo diferencias significativas (P < 0.05 en todas las propiedades nutricionales de las semillas de todas las zonas. El ecotipo Villarrica tenia el mayor contenido de proteína (16.10 g 100 g-1 MS y de vitamina E y C (4.644 ± 0.240 y 23.065 ± 1.119 mg 100 g-1 MS, respectivamente. El mayor contenido de vitamina B1 (0.648 ± 0.006 mg 100 g-1 MS y B3 (1.569 ± 0.026 mg 100 g-1 MS fue encontrado en el ecotipo Regalona, y el mayor contenido de vitamina B2 (0.081 ± 0.002 mg 100 g-1 MS en el ecotipo Ancovinto. El K fue el mineral más abundante con un valor de 2325.56 mg 100 g-1 MS en el ecotipo Cancosa. El contenido de saponina fluctuó entre 0.84 g 100 g-1 MS en el ecotipo Villarrica y 3.91 g 100 g-1 MS en el ecotipo Cáhuil. Hubo diferencias significativas entre los ecotipos chilenos de quínoa cultivados bajo diferentes condiciones climáticas. No obstante, las semillas de quinoa de cualquier
Ecophysiological characteristics and cadmium accumulation in Downy Oak (Quercus pubescens Willd.
Directory of Open Access Journals (Sweden)
Cocozza C
2012-10-01
Full Text Available Heavy metals provoke environmental pollution with potentially toxic effects on human and plants systems. Recently, investigations are conducted on plants that may play a relevant role on pollutants absorption or stabilization, focusing on fast growing tree species in agronomic conditions; little is known on the effects of contaminants on tree species colonizing abandoned fields to be used in restoration ecology. The effects of Cd on photosynthetic performance and metal accumulation were investigated in Quercus pubescens Willd. seedlings grown in pots containing a mixture of sand, clay, turf and Cd-treatments (0, 25 and 75 mg kg-1 dry soil. The studied photosynthetic parameters (Asat= net phytosynthesis; Rday= day respiration; Γcomp= CO2 compensation point; Vcmax= maximum carboxylation rate; Jmax = electron transport rate; TPU = triose phosphate use; Ci/Ca = ratio of intercellular (Ci to ambient (Ca [CO2] (Ci/Ca; Jmax/Vcmax = ratio; (gsmax = maximum stomatal conductance; (lg = stomatal conductance estimated relative to the photosynthetic rate; (Fv/Fm = maximum quantum yield of PSII photochemistry; (ΔF/F’m = effective photochemical efficiency varied progressively with increasing Cd concentration in the soil, highlighting a negative impact on photosynthetic potential and PSII functioning. Approximately 10% of added Cd was found to be extractable from the substrate, at the maximum concentration applied, with about 12 and 0.75 as bioaccumulation and translocation factors, respectively. Analogously, Cd accumulated up to 34, 30 and 46 mg kg−1 in leaves, stem and roots, respectively. While it is not possible to extrapolate from the present study with seedlings to effects on mature pine trees, there are clear implications for regeneration in soils contaminated with heavy metals, which may lead to ecosystem deterioration.
Medina-Meza, Ilce G; Aluwi, Nicole A; Saunders, Steven R; Ganjyal, Girish M
2016-11-16
Quinoa (Chenopodium quinoa Willd) contains 2 to 5% saponins in the form of oleanane-type triterpenoid glycosides or sapogenins found in the external layers of the seeds. These saponins confer an undesirable bitter flavor. This study maps the content and profile of glycoside-free sapogenins from 22 quinoa varieties and 6 original breeding lines grown in North America under similar agronomical conditions. Saponins were recovered using a novel extraction protocol and quantified by GC-MS. Oleanolic acid (OA), hederagenin (HD), serjanic acid (SA), and phytolaccagenic acid (PA) were identified by their mass spectra. Total saponin content ranged from 3.81 to 27.1 mg/g among the varieties studied. The most predominant sapogenin was phytolaccagenic acid with 16.72 mg/g followed by hederagenin at 4.22 mg/g representing the ∼70% and 30% of the total sapogenin content. Phytolaccagenic acid and the total sapogenin content had a positive correlation of r 2 = 0.88 (p quinoa in food products. The multivariate analysis showed no correlations between origin of seeds and saponin profile and/or content.
Directory of Open Access Journals (Sweden)
Alberto de J. Oliveros-Bastidas
2013-01-01
Full Text Available Dipteryx odorata (Aubl. Willd. is a tall arboreal species native to Central and Northern South America. This paper describes the chemical characterization and phytotoxic potential of polar and non-polar extracts from D. odorata seeds. Structural determinations were accomplished by chemical derivatization and analyzed by GC/MS. The chemical composition of the non-polar fraction (hexane and dichloromethane presented fatty acids as major constituent. Medium polar and polar fractions (ethyl acetate and ethanol: water contained carboxylic acid and high 6,7-Dyhidroxycoumarin-β-D-glucopyranoside content, not previously reported for seeds of D. odorata. Extracts showed a significant level of phytotoxic activity, correlated to the content of coumarin derivatives, predominantly in the polar fraction.
Presencia de metales pesados en cultivo de cacao (Theobroma cacao L. orgánico
Directory of Open Access Journals (Sweden)
Hugo Alfredo Huamaní-Yupanqui
2012-12-01
Full Text Available La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L. es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron análisis de correlación de Pearson entre los contenidos de plomo y cadmio disponibles en el suelo con variables foliares (P, Mg, Ca, Zn, Cd, Pb y del suelo (arena, arcilla y K. En los suelos, sólo en el caso de potasio se presentan deficiencias; mientras que en el tejido foliar se presentaron deficiencias de N, P, K, Mg y Zn. Los valores promedio de cadmio y plomo disponible en los suelos fueron 0.53 y 3.02 ppm y en las hojas de cacao de 0.21 y 0.58 ppm respectivamente.
Evaluation of growth and flowering of Chenopodium quinoa Willd. under Polish conditions
Directory of Open Access Journals (Sweden)
Krzysztof Gęsiński
2012-12-01
Full Text Available The material presented refers to the estimation of growth and the flowering (Chenopodium quinoa Willd. under Polish conditions. The species has been a South-American pseudocereal cultivated in the traditional form in the Andean region for over 5 thousand years. Its advantage, apart from low soil and climate requirements, is that it shows high nutritive value. The Chenopodium quinoa protein is especially valuable with its amino acid composition which is better balanced than that of wheat or maize. It shows a better share of egzogenic aminoacids. Field examinations were carried out in 1999-2001 at the Experiment Station of Cultivar Testing at Chrząstowo. The experiment involved two cultivars from two various growing regions: America and Europe. Analyses were made to include development stages, plant growth dynamics, inflorescences development dynamics, inflorescence habit and flowering. Differences were recorded in the growth and development models of the cultivars researched. The European cultivar had a short compact inflorescence with a short flowering period, reaching 120 cm. American cultivar plants were high (160 cm; they showed a slower continuous growth, loose big-in-size inflorescence, and a long period of flowering. The plants ended their growing season over the flowering stage or seed formation. The adequate growth, the course of flowering and, as a result, a stable yielding of the European cultivar make the group suitable for the cultivation under Polish conditions. This breeding group should also be the parent material for the cultivation of the Polish cultivar of Chenopodium quinoa.
Directory of Open Access Journals (Sweden)
Caroline da Cruz Vasconcelos
2017-03-01
Full Text Available O uso de extratos vegetais tem sido amplamente estudado como controle biológico alternativo de doenças de plantas, especialmente aquelas causadas por fungos patogênicos. Nesse sentido, o objetivo do presente estudo foi avaliar a atividade antifúngica in vitro do extrato bruto etanólico obtido de folhas de algodão (Gossypium arboreum L., Malvaceae em diferentes concentrações sob o desenvolvimento micelial do fungo fitopatogênico Lasiodiplodia theobromae. O ensaio foi conduzido nos Laboratórios de Microbiologia/Fitopatologia/Genética e de Cultivo/Isolamento da Universidade do Estado do Amapá/UEAP, em Macapá, Amapá. Em um Delineamento Inteiramente Casualizado (DIC, seis tratamentos e seis repetições foram organizados: T1 (controle negativo – BDA (Batata-Dextrose-Ágar + 0 mg.mL-1 (extrato foliar; T2 - BDA + 5 mg.mL-1 (extrato foliar; T3 - BDA + 10 mg.mL-1 (extrato foliar; T4 - BDA + 20 mg.mL-1 (extrato foliar; T5 - BDA + 2,5 mL de etanol e T6 (controle positivo - BDA + 2,5 mL de fungicida comercial (Derosal®. As variáveis inibição do crescimento micelial (ICM, índice de velocidade de crescimento micelial (IVCM e área abaixo da curva de cobertura de crescimento micelial (AACCM foram calculadas ao final do experimento. Os resultados mostraram que o extrato bruto etanólico das folhas de G. arboreum não apresentou atividade antifúngica in vitro frente ao fungo L. theobromae nas concentrações testadas. O extrato induziu o crescimento micelial do fungo, especialmente na concentração 10 mg.mL-1, a qual apresentou condição ideal para o desenvolvimento das estruturas do fungo. Palavras-chave: Malvaceae, extrato vegetal, controle biológico, fitopatógeno.
Dispersão zoocórica e hidrocórica marítima de Opuntia monacantha (Willd. Haw. (Cactaceae
Directory of Open Access Journals (Sweden)
Maurício Lenzi
2011-12-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n1p47 Adaptações evolutivas na morfologia e fisiologia das cactáceas têm sido associadas aos seus mecanismos de dispersão e colonização. Os mecanismos e modos de dispersão de Opuntia monacantha (Willd. Haw. (Cactaceae foram caracterizados em duas praias de Florianópolis, SC, Brasil. Um marsupial do gênero Didelphis (Mammalia: Didelphidae foi o único frugívoro e, portanto, dispersor de frutos, apresentando locais específicos para alimentação. A hidrocoria marítima ocorreu após a invasão marinha sobre a vegetação de restinga, caracterizando-se pela dispersão de cladódios e frutos em várias épocas do ano. Descreve-se pela primeira vez a ação do mar como potencial dispersor para uma espécie de cactos.
Energy Technology Data Exchange (ETDEWEB)
Carvalho, Loretta Ennes de; Lima, Maria da Paz; Maximo, Ariane da Costa; Pereira, Elaine Cristina da Silva; Moreira, Wagner Alan dos Santos [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil). Coordenacao de Pesquisas em Tecnologia e Inovacao; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Quimica; Veras, Solange de Mello [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias; Souza, Maria Geralda de, E-mail: mdapaz@inpa.gov.br [Empresa Brasileira de Pesquisa Agropecuaria (EMBRAPA), Manaus, AM (Brazil)
2012-07-01
The chemical composition of Spathelia excelsa (Krause) R. S. Cowan and Brizicky was investigated and the limonoids harrisonin (1) and deacetylspathelin (2), alkaloids folinin and casimiroin mixture (3a,b), plus a further casimiroin (3b) were identified in methanol extract from root. The CH{sub 2}Cl{sub 2} extract from the rachis yielded protolimonoid 3{beta}-angeloyl-21,24-epoxy-7{alpha},21{alpha},23{alpha},25-tetrahydroxy-4{alpha},4{beta},8{beta},10{beta}-tetramethyl -25-dimethyl-14,18-cyclo-5{alpha},13{alpha},14{alpha},17{alpha}-cholestane (4), and methanol extract, the limonoids limonin diosphenol (5) and perforatin (6), as well as the chromone biflorin (7). Harrisonin and biflorin were isolated for the first time in this genus. On the antifungal assay against witches' broom (Moniliophthora perniciosa) compound 3b was found to be active. (author)
Energy Technology Data Exchange (ETDEWEB)
Carvalho, Loretta Ennes de; Lima, Maria da Paz; Maximo, Ariane da Costa; Pereira, Elaine Cristina da Silva; Moreira, Wagner Alan dos Santos [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil). Coordenacao de Pesquisas em Tecnologia e Inovacao; Ferreira, Antonio Gilberto [Universidade Federal de Sao Carlos (UFSCAR), SP (Brazil). Dept. de Quimica; Veras, Solange de Mello [Universidade Federal do Amazonas (UFAM), Manaus, AM (Brazil). Fac. de Ciencias Agrarias; Souza, Maria Geralda de, E-mail: mdapaz@inpa.gov.br [Empresa Brasileira de Pesquisa Agropecuaria (EMBRAPA), Manaus, AM (Brazil)
2012-07-01
The chemical composition of Spathelia excelsa (Krause) R. S. Cowan and Brizicky was investigated and the limonoids harrisonin (1) and deacetylspathelin (2), alkaloids folinin and casimiroin mixture (3a,b), plus a further casimiroin (3b) were identified in methanol extract from root. The CH{sub 2}Cl{sub 2} extract from the rachis yielded protolimonoid 3{beta}-angeloyl-21,24-epoxy-7{alpha},21{alpha},23{alpha},25-tetrahydroxy-4{alpha},4{beta},8{beta},10{beta}-tetramethyl -25-dimethyl-14,18-cyclo-5{alpha},13{alpha},14{alpha},17{alpha}-cholestane (4), and methanol extract, the limonoids limonin diosphenol (5) and perforatin (6), as well as the chromone biflorin (7). Harrisonin and biflorin were isolated for the first time in this genus. On the antifungal assay against witches' broom (Moniliophthora perniciosa) compound 3b was found to be active. (author)
Directory of Open Access Journals (Sweden)
Sueli Mendonça Netto
Full Text Available Rauvolfia ligustrina Willd. ex Roem. & Schult. (Apocynaceae, popularly known as "arrebenta-boi" and "paratudo". In behavioral screening ethanol extract of R. ligustrina roots demonstrated depressant effect on the CNS and anticonvulsant properties. The purpose of this study was to characterize the putative anxiolytic-like effects of the ethanol extract of Rauvolfia ligustrina roots (EER using the elevated plus maze (EPM and the hole-board apparatus in rodents. This extract, administered intraperitoneally, in different doses (3.9, 7.8 and 15.6 mg/kg was able to increase significantly the number of entries (p < 0.05, as well as the time spent in the open arms of the EPM, indicating an anxiolytic-like effect. Additionally, EER-treated (3.9 and 7.8 mg/kg increased significantly the number of border visit and head-dipping. This data suggest an anxiolytic effect of EER in animal models of anxiety.
Directory of Open Access Journals (Sweden)
Donald Livingstone
2017-12-01
Full Text Available Cacao (Theobroma cacao L. is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.
Livingstone, Donald; Stack, Conrad; Mustiga, Guiliana M; Rodezno, Dayana C; Suarez, Carmen; Amores, Freddy; Feltus, Frank A; Mockaitis, Keithanne; Cornejo, Omar E; Motamayor, Juan C
2017-01-01
Cacao ( Theobroma cacao L.) is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.
Directory of Open Access Journals (Sweden)
Hassoon Waleed Hameed
2018-01-01
Full Text Available Quinoa (Chenopodium quinoa Willd is a native food plant of the Andean region of South America. Quinoa seeds have remarkable nutritional properties, not only from its high protein content, but also from its good amino acid balance. The aim of the study was evaluate the influence of quinoa seed moisture content (10, 12, 14, 16 and 18% and temperature (-20, 3, 20 and 40°C, with the initial grain moisture content of 10.5% on grinding process. Especially the particle size distributions and grinding energy indices were determined. The results showed that the increase of seed moisture content from 10 to 16% caused an increase the specific grinding energy from 6.9 to 8.3 kJ·kg-1, beside of this as the moisture increased the average particle also increased. The highest changes were observed in the fraction of coarse particles (above 1.0 mm. Interestingly, the mass fraction of fine particles (below 0.2 mm also increased. Other grinding indices also confirmed an increase the grinding energy requirements with the increase seed moisture content. The temperature of seed has little influence on quinoa grinding process. The highest grinding energy requirements were observed when the frozen seeds were ground.
Choi, Yoonho; Kang, Sehyeon; Cha, Song-Hyun; Kim, Hyun-Seok; Song, Kwangho; Lee, You Jeong; Kim, Kyeongsoon; Kim, Yeong Shik; Cho, Seonho; Park, Youmie
2018-01-17
A green synthesis of gold and silver nanoparticles is described in the present report using platycodon saponins from Platycodi Radix (Platycodon grandiflorum) as reducing agents. Platycodin D (PD), a major triterpenoidal platycodon saponin, was enriched by an enzymatic transformation of an aqueous extract of Platycodi Radix. This PD-enriched fraction was utilized for processing reduction reactions of gold and silver salts to synthesize gold nanoparticles (PD-AuNPs) and silver nanoparticles (PD-AgNPs), respectively. No other chemicals were introduced during the reduction reactions, providing an entirely green, eco-friendly, and sustainable method. UV-visible spectra showed the surface plasmon resonance bands of PD-AuNPs at 536 nm and PD-AgNPs at 427 nm. Spherically shaped nanoparticles were observed from high-resolution transmission electron microscopy with average diameters of 14.94 ± 2.14 nm for PD-AuNPs and 18.40 ± 3.20 nm for PD-AgNPs. Minor triangular and other polygonal shapes were also observed for PD-AuNPs along with spherical ones. Atomic force microscopy (AFM) images also demonstrated that both nanoparticles were mostly spherical in shape. Curvature-dependent evolution was employed to enhance the AFM images and precisely measure the sizes of the nanoparticles. The sizes were measured as 19.14 nm for PD-AuNPs and 29.93 nm for PD-AgNPs from the enhanced AFM images. Face-centered cubic structures for both nanoparticles were confirmed by strong diffraction patterns from high-resolution X-ray diffraction analyses. Fourier transform infrared spectra revealed the contribution of -OH, aromatic C=C, C-O, and C-H functional groups to the synthesis. Furthermore, the catalytic activity of PD-AuNPs was assessed with a reduction reaction of 4-nitrophenol to 4-aminophenol in the presence of sodium borohydride. The catalytic activity results suggest the potential application of these gold nanoparticles as catalysts in the future. The green strategy
Ekstraksi Pektin dari Kulit Kakao (Theobroma cacao L. Menggunakan Amonium Oksalat
Directory of Open Access Journals (Sweden)
Cut Erika
2013-06-01
Full Text Available Cocoa (Theobroma cocoa L is one of the local superior commodities in Aceh Province. The production of cocoa continues to increase significantly every year. Cocoa Pod husk is a waste product of cocoa beans industry, which is containing pectin with concentration ranged between 2-10%. Pectin extraction is one of the potential researches to increase economic value of cocoa pod husks. This study aimed to determine the effect of extraction time and pH on the characteristics of cocoa pod husk pectin. Pectin was extracted from cocoa pod husks using ammonium oxalate, extraction time (60 and 120 min and pH (2.6, 3.6 and 4.6. The use of ammonium oxalate produced high yield of pectin ranged from 6.63 to 12.75%, moisture content was 7,36 to 10,77%, methoxyl content was 5.19 to 5.70%, anhydrogalacturonic acid of 59.84 to 63.14%, the esterification degree was 48.43 to 51.43 % and relative viscosity was 40 – 186,6 cP. The extraction time for 60 minutes at pH 3,6 showed a higher yield compared to 120 min at pH 4,6. Pectin on the extraction time of 60 minutes at pH 3.6 had the highest relative viscosity was 186,6 cP, and the lowest viscosity of pectin obtained at pH 2.6 and extraction time of 60 min which was 40 cP. Keywords: cocoa pod husks, ammonium oxalate, extraction time, pH
Directory of Open Access Journals (Sweden)
Hartati Imamuddin
2012-10-01
Full Text Available Soil pollution has been so attracting considerable public attentions over the last decades. Phytoremediation is an emerging technology that uses plants to clean up pollutant soils. The study was carried out in gold mining Cikotok, Banten. Sengon buto (Enterolobium cyclocarpum, (Willd which is used as cyanogenic plant, compost and microbes inoculant is as stimulator to growththis plant. The experiment consist of K0 as control (plant without compost, K1 as plant + compost and K2 as plant+compost + microbe inoculant, with 3 replicated. The objectives of this experiment were to investigate the potential for phytoremediation of cyanide contaminated soils using hyperaccumulator/cyanogenic plants and to assess the fate and transport of cyanide compounds in soils.The results showed that compost and microbe were able to stimulate growth of Sengon Buto after 7 months planting and to reduce cyanide until 66% Total bacteria in the study was relatively stable but NFB bacteria was decline.
Yildiz, Ilyas; Sen, Ozkan; Erenler, Ramazan; Demirtas, Ibrahim; Behcet, Lutfi
2017-11-01
Cynanchum acutum L. subsp. sibiricum (Willd.) Rech. f. was extracted with hexane, acetone, methanol and water individually. A sample was heated in water then extracted with ethyl acetate. Among the extracts, the ethyl acetate extract exhibited the most antiproliferative activity, so isolation of bioactive compounds was carried out from this extract. A new compound, kaempferol-3-O-β-xylopyranosyl-(1-2)-β-rhamnopyranoside (1) along with five known compounds, quercetin-3-O-β-xyloside (2), kaempferol-3-O-β-glucoside (3), quercetin-3-O-β-glucoside (4), kaempferol-3-O-β-rhamnopyranoside (5), and kaempferol-3-O-β-d-neohesperidoside (6) were isolated from ethyl acetate extract. The structures were elucidated by spectroscopic techniques, basically 1D NMR, 2D NMR and LC-TOF/MS. Antiproliferative effects of isolated compounds were determined by xCELLigence using the HeLa (human uterus carcinoma) cell lines. Compound 2 and compound 5 revealed the good antiproliferative activity against HeLa cell lines.
Actividad antibacteriana de la cáscara de cacao, Theobroma cacao L
Directory of Open Access Journals (Sweden)
Oscar Cuéllar G.
2012-12-01
Full Text Available Objetivo. Evaluar la actividad antibacteriana de diferentes fracciones de la cáscara de cacao (Theobroma cacao L.. Materiales y métodos. Se evaluó la actividad antibacteriana mediante el método de difusión en agar de diferentes fracciones de la cáscara de cacao, empleando cepas autóctonas y de referencia ATCC. Posteriormente, se hizo un análisis de estas fracciones por cromatografía líquida de alta eficiencia y cromatografía de gases acoplada a espectrometría de masas. Resultados. La fracción clorofórmica presentó actividad antibacteriana frente a Bacillus cereus ATCC 11778 y Streptococcus agalactiae (autóctona, con porcentajes de inhibición de 34.90% (100 μg/μl y 52.40% (100 μg/μl respectivamente. También se evidenció una concentración mínima inhibitoria de 512 μg/ml frente a Bacillus cereus ATCC 11778 y de 128 μg/ml frente a Streptococcus agalactiae. Conclusiones. Este trabajo es el primer reporte a saber en Colombia sobre actividad antibacteriana in vitro de la cáscara de cacao, el cual resulta ser un avance importante para esta agroindustria. Esta investigación abre paso a otros estudios relacionados para establecer el espectro de inhibición frente a otros microorganismos.
Kang, Heerim; Lee, Chang Hyung; Kim, Jong Rhan; Kwon, Jung Yeon; Son, Myoung-Jin; Kim, Jong-Eun; Lee, Ki Won
2017-02-01
Cacao beans from Theobroma cacao are an abundant source of polyphenols, particularly flavonoids. Previous studies demonstrated that cacao flavanols decrease pro-inflammatory cytokines resulting in the alleviation of allergic symptoms. We sought to investigate the effects of cacao extract (CE) on Dermatophagoides farinae extract (DFE)-induced atopic dermatitis (AD)-like symptoms. CE attenuated DFE-induced AD-like symptoms as assessed by skin lesion analyses, dermatitis score, and skin thickness. Histopathological analysis revealed that CE suppressed DFE-induced immune cell infiltration into the skin. These observations occurred concomitantly with the downregulation of inflammatory markers including serum immunoglobulin (Ig) E, chemokine; thymus and activation-regulated chemokine and macrophage-derived chemokine as well as the skin-derived cytokines interleukin (IL)-4, IL-5, and interferon-γ. CE also significantly alleviated transepidermal water loss and increased skin hydration. These results suggest that CE, a natural phytochemical-rich food, has potential therapeutic efficacy for the treatment of AD. Copyright © 2016. Published by Elsevier Ltd.
Pharmacognostical and phytochemical evaluation of the leaves of Ziziphus xylopyrus (Retz Willd
Directory of Open Access Journals (Sweden)
Upendra B Gandagule
2013-01-01
Full Text Available Background: The fruit decoction of Ziziphus xylopyrus (Retz Willd. is used toward increase sterility in woman intended birth control in some parts of Rajasthan, India. This plant is widely used in Turkish medicines as a potent sedative. One to two inches of the fresh stem bark of this species are chewed with 1-2 peppers, and the sap swallowed once a day for 5 days in the treatment of cough. Standardization is one of the challenges in herbal medicine. It is essential to evaluate the herbal plants scientifically and proper documentation should be made to know their medicinal properties. Materials and Methods: Leaf samples of Z. xylopyrus were studied as recommended by World Health Organization for morphological, microscopic, physicochemical, phytochemical, powder characteristics and other methods for standardization. Results: Morphologically the leaves are obovate or orbicular in shape, pinnate venation having aromatic odour and pungent taste. Microscopically leaves showed the presence of ground tissue, vascular strand, xylem and phloem. The crystals are mostly rosette type. Microscopic examination of powder showed the presence of stomata, covering trichomes, sclerenchyma, collenchyma, epidermal cells and vascular strands. Phytochemical screening of the plant part with various solvents revealed the presence of alkaloids, carbohydrates, steroids and sterol, glycosides, saponins, flavonoids, phenolic compounds, triterpenoids in it. Physicochemical parameters such as ash value extractive values were also determined and results showed that water soluble extractive value to be higher than alcohol soluble extractive value. Conclusion: Results may be helpful for further confirmation of selected species and in future these characters may be compared with the new batch of the same plant materials.
Rodríguez López, Carlos M; Wetten, Andrew C; Wilkinson, Michael J
2010-06-01
*Relatively little is known about the timing of genetic and epigenetic forms of somaclonal variation arising from callus growth. We surveyed for both types of change in cocoa (Theobroma cacao) plants regenerated from calli of various ages, and also between tissues from the source trees. *For genetic change, we used 15 single sequence repeat (SSR) markers from four source trees and from 233 regenerated plants. For epigenetic change, we used 386 methylation-sensitive amplified polymorphism (MSAP) markers on leaf and explant (staminode) DNA from two source trees and on leaf DNA from 114 regenerants. *Genetic variation within source trees was limited to one slippage mutation in one leaf. Regenerants were far more variable, with 35% exhibiting at least one mutation. Genetic variation initially accumulated with culture age but subsequently declined. MSAP (epigenetic) profiles diverged between leaf and staminode samples from source trees. Multivariate analysis revealed that leaves from regenerants occupied intermediate eigenspace between leaves and staminodes of source plants but became progressively more similar to source tree leaves with culture age. *Statistical analysis confirmed this rather counterintuitive finding that leaves of 'late regenerants' exhibited significantly less genetic and epigenetic divergence from source leaves than those exposed to short periods of callus growth.
Directory of Open Access Journals (Sweden)
Xinkui Liu
2018-01-01
Full Text Available Background. As one of the most frequently diagnosed cancer diseases globally, colorectal cancer (CRC remains an important cause of cancer-related death. Although the traditional Chinese herb Hedyotis diffusa Willd. (HDW has been proven to be effective for treating CRC in clinical practice, its definite mechanisms have not been completely deciphered. Objective. The aim of our research is to systematically explore the multiple mechanisms of HDW on CRC. Methods. This study adopted the network pharmacology approach, which was mainly composed of active component gathering, target prediction, CRC gene collection, network analysis, and gene enrichment analysis. Results. The network analysis showed that 10 targets might be the therapeutic targets of HDW on CRC, namely, HRAS, PIK3CA, KRAS, TP53, APC, BRAF, GSK3B, CDK2, AKT1, and RAF1. The gene enrichment analysis implied that HDW probably benefits patients with CRC by modulating pathways related to cancers, infectious diseases, endocrine system, immune system, nervous system, signal transduction, cellular community, and cell motility. Conclusions. This study partially verified and predicted the pharmacological and molecular mechanism of HDW against CRC from a holistic perspective, which will also lay a foundation for the further experimental research and clinical rational application of HDW.
Directory of Open Access Journals (Sweden)
Rakesh Kumar
2017-10-01
Full Text Available ABSTRACT Oxidative stress, being the main cause of most of the human diseases, has always been the highlight of research worldwide. This stress can be overcome by administration of natural polyphenols. The Acacia catechu Willd. has many refrences available in Ayurveda as important disease curative plant. Its leaves are investigated for ameliorating oxidative stress in present work. Leaves of A. catechu were extracted with 80% methanol to get methanol extract (AME. It was assessed for antioxidant activity using DPPH, ABTS, CUPRAC, ferric ion reducing, superoxide scavenging and peroxyl radical scavenging assays. DNA protective activity was also investigated using plasmid nicking assay. Further, antiproliferative activity was determined using MTT assay in various human cancer cell lines. The quantification of polyphenols was done by UHPLC analysis. Results confirmed that polyphenols of A. catechu were successful in normalizing oxidative stress. AME was found to be most effective in scavenging ABTS radicals while least effective in scavenging ferric ions. UHPLC analysis showed abundance of ellagic acid, rutin and quercetin in AME. Further, AME showed maximum antiproliferative activity against Hep G2 cancer cells. It is concluded that the polyphenols from A. catechu effectively remediates oxidative stress and hence can be used in curing numerous dreadful diseases.
Directory of Open Access Journals (Sweden)
Floresha Sela
2015-04-01
Full Text Available Chemical composition and antimicrobial activity of leaves and berries essential oils from Juniperus foetidissima Willd. (Cupressaceae grown in R. Macedonia (RM was investigated. GC/FID/MS analysis was carried out and 93 components were identified, representing 89.7-96.5% of the oils. The major components of the berries essential oil were α-pinene (19.2%, limonene (24.9% and cedrol (23.1%, followed by smaller amounts of b-funebrene, trans-caryophyllene, germacrene D and d-cadinene. The composition of the leaves essential oil was variable depending on the region of collection. Accordingly, samples originated from southeastern RM contained essential oil with α-pinene (67.6% and limonene (10.0%, from central part of RM with limonene (17.9-27.1% and cedrol (28.8-33.9%, while samples from southwestern RM contained oil with terpinen-4-ol (19.1%, cis-thujone (8.3%, germacrene D (11.0% and d-cadinene (6.3% as predominant components in the oil. Antimicrobial screening of the essential oils was made by disc diffusion and broth dilution method against 16 bacterial strains of Gram-positive and Gram-negative bacteria and one strain of Candida albicans. The leaves essential oil showed stronger antimicrobial activity against Staphylococcus aureus, Streptococcus pyogenes and Haemophilus influenzae (MIC = 125 ml/ml and moderate activity against Campylobacter jejuni (MIC > 500 ml/ml. Other investigated bacterial strains and Candida albicans were completely resistant to the antimicrobial activity of J. foetidissima essential oils.
Yao, Yang; Yang, Xiushi; Shi, Zhenxing; Ren, Guixing
2014-05-01
Quinoa (Chenopodium quinoa Willd.) is a pseudocereal from South Americas that has received increased interest around the world because it is a good source of different nutrients and rich in saponins. However, the saponins in quinoa seeds planted in China were poorly known. We obtained 4 quinoa saponin fractions, Q30, Q50, Q70, and Q90, and 11 saponins were determined by HPLC-MS. Q50 possessed 8 individual saponins and had the highest content of saponins. We further evaluated the anti-inflammatory activity on RAW 264.7 murine macrophage cells of the 4 fractions. The 4 fractions not only dose-dependently decreased the production of inflammatory mediators NO but also inhibited the release of inflammatory cytokines including tumor necrosis factor-α and interleukin-6 in lipopolysaccharide-induced RAW264.7 cells. These results suggest that quinoa saponins may be used as functional food components for prevention and treatment of inflammation. Our findings demonstrate that saponins from the quinoa have the potential to anti-inflammation by suppressing the release of inflammatory cytokines. © 2014 Institute of Food Technologists®
Directory of Open Access Journals (Sweden)
Josileide Gonçalves Borges
2014-01-01
Full Text Available Gomas produzidas por microrganismos são usadas como modificadores de alimentos e a biomassa residual para isolamento de seus constituintes. O objetivo deste trabalho foi produzir e caracterizar biomassa extracelular por fermentação submersa com Lasidioplodia theobromae isolado de cacau da Bahia com morte descendente. Foram testadas quatro fontes de carbono fermentadas a 28 ºC, 180 rpm por 72 horas. A que resultou em maior produção de biomassa foi avaliada quanto à variação da concentração e pH. As frações obtidas foram caracterizadas por infravermelho (FTIR e análise por termogravimetria (TG, composição centesimal e monossacarídica. A fermentação submersa da sacarose comercial a 40 g.L-1 em pH 4,0 por L. theobromae resultou em máxima produção da fração I (8,64g.L-1, e a 50g.L-1, pH 5,0, da fração II (23,69 g.L-1. Os espectros de FTIR mostraram presença de grupos amino, poliois e ésteres, e nas análises termogravimétricas observaram-se três eventos de perda de massa em diferentes intensidades. As frações contêm mesma composição em proporções diferenciadas, sendo fontes de proteínas (19,88-29,45%, lipídios (11,07-28,79%, cinzas (3,55-3,88%, e carboidratos (30,16-37,96% compostos unicamente de glicose e manose em diferentes proporções, portanto ambas glucomananas. As frações apresentam propriedades e potencial desejáveis para ampla utilização em processos biotecnológicos de alta relevância científica.
Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.
Livingstone, Donald; Royaert, Stefan; Stack, Conrad; Mockaitis, Keithanne; May, Greg; Farmer, Andrew; Saski, Christopher; Schnell, Ray; Kuhn, David; Motamayor, Juan Carlos
2015-08-01
Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ∼4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification project was undertaken using RNAseq data from 16 diverse cacao cultivars. RNA sequences were aligned to the assembled transcriptome of the cultivar Matina 1-6, and 330,000 SNPs within coding regions were identified. From these SNPs, a subset of 6,000 high-quality SNPs were selected for inclusion on an Illumina Infinium SNP array: the Cacao6kSNP array. Using Cacao6KSNP array data from over 1,000 cacao samples, we demonstrate that our custom array produces a saturated genetic map and can be used to distinguish among even closely related genotypes. Our study enhances and expands the genetic resources available to the cacao research community, and provides the genome-scale set of tools that are critical for advancing breeding with molecular markers in an agricultural species with high genetic diversity. © The Author 2015. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
Dormancy overcoming, temperatures and substrates on germination of Mimosa tenuiflora Willd seeds
Directory of Open Access Journals (Sweden)
Clarisse Pereira Benedito
2017-03-01
Full Text Available Mimosa tenuiflora Willd., popularly known as jurema-preta, is an arboreal species of great importance for the brazilian Northeast due to its uses as a medicinal plant and in the restoration of degraded soils. No information is available in the Rules for Seed Analysis and the Instructions for Seed Analysis of Forest Species regarding ideal conditions for of this species. Thus, this study aimed at evaluating the influence of pre-germination treatments, in addition to verifying the germination performance at different temperatures and in different substrates. In both experiments, four replicates of 25 seeds were used for each treatment. In experiment I, seeds were submitted to the following methods for overcoming dormancy: witness - Intact seeds (T1 immersion in water at 100 °C for 1 (T2, 2 (T3, 3 (T4, 4 (T5, 5 (T6 and 6 min (T7, immersion in concentrated sulfuric acid for 1 (T8, 4 (T9, 7 (T10, 10 (T11 and 13 min (T12, scarification on sandpaper n° 80 (T13 and lopping in the region opposite the micropyle (T14. In experiment II, seed germination was evaluated in four types of substrates: between sand, paper on, paper roll and between vermiculite and at six different temperatures: 20, 25, 30, 35, 40 °C and alternating between 20 and 30 °C. Immersion in hot water for 1, 2, 3, 4, 5 and 6 min, sulfuric acid treatment for 10 and 13 min, sand paper and lopping were the most appropriate treatments to overcome seed dormancy. The seed germination of M. Tenuiflora should be carried out at 25 °C on paper roll substrate.
Genetic variation in bioaccumulation and partitioning of cadmium in Theobroma cacao L.
Lewis, Caleb; Lennon, Adrian M; Eudoxie, Gaius; Umaharan, Pathmanathan
2018-06-02
Cadmium (Cd) is a non-essential heavy metal that is toxic to both plants and animals and chocolates have been identified as a contributor to the human dietary Cd intake. One hundred accessions representing the various genetic groups and hybrid populations in Theobroma cacao L. held at the International Cocoa Genebank, Trinidad were evaluated for leaf and bean cadmium levels with three tree replications. Representative samples of soil from the drip zone around each tree were evaluated for bioavailable cadmium. Although there were significant differences (P ≤ 0.05) among genetic groups for leaf and bean Cd much of the variation was between accessions. There was a 13-fold variation in bean Cd and a 7-fold variation in leaf Cd between accessions despite the bioavailable Cd in the soil being uniform. There were differences in the level of partitioning into beans evident by significant variation (P ≤ 0.05) in bean Cd as a percentage of the cumulative leaf and bean Cd concentration (15-52%) between accessions. Although in general there was a higher concentration of cadmium in the testa than the cotyledon of the cocoa bean there was considerable genetic variation. These results point to the potential of using a genetic strategy to mitigate cadmium within cocoa beans either through breeding or through the use of low cadmium uptake rootstocks in grafting. The results will fuel further work into the understanding of mechanisms and genetics of cadmium uptake and partitioning in cocoa. Copyright © 2018. Published by Elsevier B.V.
Association mapping of seed and disease resistance traits in Theobroma cacao L.
Motilal, Lambert A; Zhang, Dapeng; Mischke, Sue; Meinhardt, Lyndel W; Boccara, Michel; Fouet, Olivier; Lanaud, Claire; Umaharan, Pathmanathan
2016-12-01
Microsatellite and single nucleotide polymorphism markers that could be used in marker assisted breeding of cacao were identified for number of filled seeds, black pod resistance and witches' broom disease resistance. An association mapping approach was employed to identify markers for seed number and resistance to black pod and witches' broom disease (WBD) in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms (SNPs) were assessed on 483 unique trees in the International Cocoa Genebank Trinidad (ICGT). Linkage disequilibrium (LD) and association mapping studies were conducted to identify markers to tag the phenotypic traits. Decay of LD occurred over an average 9.3 cM for chromosomes 1-9 and 2.5 cM for chromosome 10. Marker/trait associations were generally identified based on general linear models (GLMs) that incorporated principal components from molecular information on relatedness factor. Seven markers (mTcCIR 8, 66, 126, 212; TcSNP368, 697, 1370) on chromosomes 1 and 9 were identified for number of filled seeds (NSEED). A single marker was found for black pod resistance (mTcCIR280) on chromosome 3, whereas six markers on chromosomes 4, 5, 6, 8, and 10 were detected for WBD (mTcCIR91, 183; TcSNP375, 720, 1230 and 1374). It is expected that this association mapping study in cacao would contribute to the knowledge of the genetic determinism of cocoa traits and that the markers identified herein would prove useful in marker assisted breeding of cacao.
Suwastika, I. Nengah; Pakawaru, Nurul Aisyah; Rifka, Rahmansyah, Muslimin, Ishizaki, Yoko; Cruz, André Freire; Basri, Zainuddin; Shiina, Takashi
2017-02-01
Chloroplast genomes typically range in size from 120 to 170 kilo base pairs (kb), which relatively conserved among plant species. Recent evaluation on several species, certain unique regions showed high variability which can be utilized in the phylogenetic analysis. Many fragments of coding regions, introns, and intergenic spacers, such as atpB-rbcL, ndhF, rbcL, rpl16, trnH-psbA, trnL-F, trnS-G, etc., have been used for phylogenetic reconstructions at various taxonomic levels. Based on that status, we would like to analysis the diversity of chloroplast genome within species of local cacao (Theobroma cacao L.) from Central Sulawesi. Our recent data showed, there were more than 20 clones from local farming in Central Sulawesi, and it can be detected based on phenotypic and nuclear-genome-based characterization (RAPD- Random Amplified Polymorphic DNA and SSR- Simple Sequences Repeat) markers. In developing DNA marker for this local cacao, here we also included analysis based on the variation of chloroplast genome. At least several regions such as rpl32-TurnL, it can be considered as chloroplast markers on our local clone of cocoa. Furthermore, we could develop phylogenetic analysis in between clones of cocoa.
Spafford, Helen; Ching, Alexander; Manley, Megan; Hardin, Chelsea; Bittenbender, Harry
2016-01-01
The Chinese rose beetle (Adoretus sinicus Burmeister (Coleoptera: Scarabaeidae)) is an introduced, widely-established pest in Hawai’i. The adult beetles feed on the leaves of cacao (Theobroma cacao L.), which can lead to defoliation and even death of young trees. We evaluated the impact of five commercially available products with different active ingredients (imidacloprid, azadirachtin, Beauveria bassiana (Bals.-Criv.) Vuill., kaolin clay, and pyrethrin) and the presence or absence of weed mat cover in reducing adult beetle feeding on sapling cacao in the field. The use of weed mat cover reduced feeding damage compared to the untreated control, as did foliar application of imidacloprid, azadirachtin, and B. bassiana. In the laboratory, field-collected adult beetles were presented cacao leaf samples dipped in one of the five products and compared to a control. Beetles exposed to pyrethrin died rapidly. Among the other treatments, only exposure to imidacloprid significantly reduced survival relative to the control. Beetles fed very little on leaf samples with azadirachtin but their longevity was not significantly reduced. Imidacloprid, azadirachtin, and weed mat application had the most promise for reducing adult Chinese rose beetle feeding damage in young cacao and deserve further investigation for successful management of this significant pest. PMID:27348004
A comparison of tissue preparation methods for protein extraction of cocoa (Theobroma cacao L. pod
Directory of Open Access Journals (Sweden)
Ascensión Martínez-Márquez
2017-04-01
Full Text Available Cocoa, Theobroma cacao L. is one of the main tropical industrial crops. Cocoa has a very high level of interfering substances, such as polysaccharides and phenolic compounds that could prevent the isolation of suitable protein. Efficient methods of protein extraction are a priority to successfully apply proteomic analyses. We compared and evaluated two methods (A and B of tissue preparation for total protein extract by phenol/SDS extraction protocol. The difference in the application of the two methods was that extensively washed dry powder of pod tissue were made in Method A, whereas that crude extract were prepared Method B. Extracted proteins were examined using one-dimensional electrophoresis (1-D. Results show that each extraction method isolated a unique subset of cocoa pod proteome. Principal component analysis showed little variation in the data obtained using Method A, while that in Methods B showed no low reproducibility, thus demonstrating that Method A is a reliable for preparing cocoa pod proteins. The protocol is expected to be applicable to other recalcitrant plant tissues and to be of interest to laboratories involved in plant proteomics analyses. A combination of extraction approaches is recommended for increasing proteome coverage when using gel-based isolation techniques.
Mutation breeding against black pod (Phytophthora pod rot) disease of cacao (Theobroma cacao)
International Nuclear Information System (INIS)
Opeke, L.K.
1977-01-01
Black pod rot disease, caused by Phytophthora palmivora, is an important disease of cacao (Theobroma cacao L.) in Nigeria and other cacao producing countries of West Africa and Latin America. A naturally occurring source of genetic resistance to the disease has not been found. This paper completes the report, the first part of which was published in Induced Mutations in Vegetatively Propagated Plants, IAEA, Vienna (1973). The survivors of the irradiated seedlings reported on in this publication were transplanted to the field along with their controls. When the Phytophthora pod disease season began in 1973, all experimental plants along with the controls were sprayed with active and freshly prepared dense sporangial suspension of P. palmivora. Observations on Phytophthora infection were recorded at two-weekly intervals for three months. Results were pooled for each set of experimental plants, after having confirmed that no marked difference appeared among individual plants of each group. Contrary to the observations recorded at the nursery stage, all experimental plants that showed no infection indicated disease infection levels normally characteristic of the F 3 Amazon cultivar of Cacao in Nigeria. Although the nursery and the field data are difficult to reconcile and interpret, it is suggested that probably temporary disease tolerance/resistance, which some irradiated plants showed at the nursery (seedling) stage, was lost as the plants matured, thus suggesting different resistance factor systems for juvenile and mature cacao trees. (author)
Amorim, Juliana C; Vriesmann, Lucia Cristina; Petkowicz, Carmen L O; Martinez, Glaucia Regina; Noleto, Guilhermina R
2016-11-01
In vitro effects of acetylated pectin (OP) isolated from cacao pod husks (Theobroma cacao L.), its partially deacetylated and de-esterified form (MOP), and a commercial homogalacturonan (PG) were investigated on murine peritoneal macrophages. MOP stood out among the studied pectins. After 48h of incubation, compared with the control group, it was able to promote significant macrophage morphological differentiation from resident to activated stage and also stimulated nitric oxide production, which reached a level of 85% of that of LPS stimulus. In the presence of the highest tested concentration of MOP (200μg·mL -1 ), the levels of the cytokines TNF-α (6h) and IL-12 and IL-10 (48h) increased substantially in relation to untreated cells. Our results show that the partial deacetylation and de-esterification of pectin extracted from cacao pod husks (T. cacao L.) produced a polymer with greater ability than its native form to activate macrophages to a cytotoxic phenotype. Like this, they provide the possibility of a therapeutic application to MOP, which could lead to a decreased susceptibility to microbial infection besides antitumor activity. Additionally, the present results also corroborate with the proposition of that the chemical modifications of the biopolymers can result in an improved molecule with new possibilities of application. Copyright © 2016 Elsevier B.V. All rights reserved.
Silva, D V; Branco, S M J; Holanda, I S A; Royaert, S; Motamayor, J C; Marelli, J P; Corrêa, R X
2016-03-04
Theobroma cacao is a species of great economic importance with its beans used for chocolate production. The tree has been a target of various molecular studies. It contains many polyphenols, which complicate the extraction of nucleic acids with the extraction protocols requiring a large amount of plant material. These issues, therefore, necessitate the optimization of the protocols. The aim of the present study was to evaluate different methods for extraction of total RNA from shoot apical meristems of T. cacao 'CCN 51' and to assess the influence of storage conditions for the meristems on the extraction. The study also aimed to identify the most efficient protocol for RNA extraction using a small amount of plant material. Four different protocols were evaluated for RNA extraction using one shoot apical meristem per sample. Among these protocols, one that was more efficient was then tested to extract RNA using four different numbers of shoot apical meristems, subjected to three different storage conditions. The best protocol was tested for cDNA amplification using reverse transcription-polymerase chain reaction; the cDNA quality was determined to be satisfactory for molecular analyses. The study revealed that with the best RNA extraction protocol, one shoot apical meristem was sufficient for extraction of high-quality total RNA. The results obtained might enable advances in genetic analyses and molecular studies using reduced amount of plant material.
Baharum, Zainal; Akim, Abdah Md; Taufiq-Yap, Yun Hin; Hamid, Roslida Abdul; Kasran, Rosmin
2014-11-10
The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH), thiobarbituric acid-reactive substances (TBARS), and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT) assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50) was 358.3±7.0 µg/mL and total phenolic content was 22.0±1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4%±1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50)=41.4±3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.
Directory of Open Access Journals (Sweden)
Zainal Baharum
2014-11-01
Full Text Available The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH, thiobarbituric acid-reactive substances (TBARS, and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50 was 358.3 ± 7.0 µg/mL and total phenolic content was 22.0 ± 1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4% ± 1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50 = 41.4 ± 3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.
Esatbeyoglu, Tuba; Wray, Victor; Winterhalter, Peter
2015-07-15
The main procyanidins, including dimeric B2 and B5, trimeric C1, tetrameric and pentameric procyanidins, were isolated from unroasted cocoa beans (Theobroma cacao L.) using various techniques of countercurrent chromatography, such as high-speed countercurrent chromatography (HSCCC), low-speed rotary countercurrent chromatography (LSRCCC) and spiral-coil LSRCCC. Furthermore, dimeric procyanidins B1 and B7, which are not present naturally in the analysed cocoa beans, were obtained after semisynthesis of cocoa bean polymers with (+)-catechin as nucleophile and separated by countercurrent chromatography. In this way, the isolation of dimeric procyanidin B1 in considerable amounts (500mg, purity>97%) was possible in a single run. This is the first report concerning the isolation and semisynthesis of dimeric to pentameric procyanidins from T. cacao by countercurrent chromatography. Additionally, the chemical structures of tetrameric (cinnamtannin A2) and pentameric procyanidins (cinnamtannin A3) were elucidated on the basis of (1)H NMR spectroscopy. Interflavanoid linkage was determined by NOE-correlations, for the first time. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
CLAUDIA LORENA CERÓN FERNANDEZ
2016-11-01
Full Text Available Quinoa (Chenopodium quinoa WILLD is a pseudocereal produced for many years in Andean regions and allows different transformations taking advantage of their nutritional qualities becoming it a food agribusiness alternative. Objective of this study was to observe physical and chemical changes from two quinoa flour varieties (Blanca dulce de Jericó and Tunkahuan during extrusion process and determine conditions (flour moisture, temperature and screw speed that allow obtain an extruded similar to precooked functional properties. Water absorption index (IAA, water solubility index (ISA and swelling power (PH was response variables. Two flour extrusion at 105°C degrees, 150 rpm screw speed and 25 to 30% moisture improved functional properties (IAA increased from 1,81 g gel/g D.M to 4,22 g gel/g D.M in Tunkahuan extruded quinoa flour and 2,00 g gel/g to 4,27 g gel MS/MS g flour in Blanca dulce de Jericó but nutriotional properties decreased as digestibility except for a carbohydrate content increase.
Phosphorus use efficiency of the gum arabi tree (Acacia senegal (L) Willd) in Sudan
International Nuclear Information System (INIS)
Elamin, K.H.; Mustafa, A.F.
1996-01-01
This study was conducted to identify gum arabic tree (Acacia senegal L. Willd) provenances with high efficiency for phosphorus uptake and use. Thirteen provenances were collected from different habitats with the gum belt of the Sudan. A preliminary trial was conducted during the period 1989-1992 at the Gezira Agricultural Research Station in Wad Medani. This study revealed that there are clear genotypic differences in phosphorus use efficiency, nitrogen yield and dry matter production. All the provenances tested also exhibited a high ability for survival under the dry climatic conditions as prevailing in the gum belt of Sudan. Based on differences in phosphorus use efficiency observed in the preliminary study, 4 provenances were selected for a detailed study. Provenance 11 and 2 represented the highly efficient group, provenance 7 the moderately efficient group and provenance 13 the low efficient group. The detailed study revealed that provenance 11 is superior to all others in terms of biomass production as well as in phosphorus use efficiency. Although the ability to take up phosphorus was low, this was compensated by having a high root length density enabling the tree to take up a quantity of phosphorus similar to that taken up by other provenances. The high ability to convert the absorbed phosphorus into a greater quantity of dry matter made this provenance the best in phosphorus use efficiency. These results suggest that provenance 11 may be a suitable candidate to be introduced into the gum belt of Sudan in support of its rehabilitation programme. (author). 13 refs, 4 figs, 5 tabs
Phosphorus use efficiency of the gum arabi tree (Acacia senegal (L) Willd) in Sudan
Energy Technology Data Exchange (ETDEWEB)
Elamin, K H; Mustafa, A F [Gezira Agricultural Research Centre, Wad Medani (Sudan). Forestry Research Section
1996-07-01
This study was conducted to identify gum arabic tree (Acacia senegal L. Willd) provenances with high efficiency for phosphorus uptake and use. Thirteen provenances were collected from different habitats with the gum belt of the Sudan. A preliminary trial was conducted during the period 1989-1992 at the Gezira Agricultural Research Station in Wad Medani. This study revealed that there are clear genotypic differences in phosphorus use efficiency, nitrogen yield and dry matter production. All the provenances tested also exhibited a high ability for survival under the dry climatic conditions as prevailing in the gum belt of Sudan. Based on differences in phosphorus use efficiency observed in the preliminary study, 4 provenances were selected for a detailed study. Provenance 11 and 2 represented the highly efficient group, provenance 7 the moderately efficient group and provenance 13 the low efficient group. The detailed study revealed that provenance 11 is superior to all others in terms of biomass production as well as in phosphorus use efficiency. Although the ability to take up phosphorus was low, this was compensated by having a high root length density enabling the tree to take up a quantity of phosphorus similar to that taken up by other provenances. The high ability to convert the absorbed phosphorus into a greater quantity of dry matter made this provenance the best in phosphorus use efficiency. These results suggest that provenance 11 may be a suitable candidate to be introduced into the gum belt of Sudan in support of its rehabilitation programme. (author). 13 refs, 4 figs, 5 tabs.
Energy Technology Data Exchange (ETDEWEB)
Hwang, Yong Pil [Department of Toxicology, College of Pharmacy, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Department of Pharmaceutical Engineering, International University of Korea, Jinju (Korea, Republic of); Choi, Jae Ho; Kim, Hyung Gyun; Khanal, Tilak; Song, Gye Young [Department of Toxicology, College of Pharmacy, Chungnam National University, Daejeon 305-764 (Korea, Republic of); Nam, Myoung Soo [College of Agriculture and Life Sciences, Chungnam National University, Daejeon (Korea, Republic of); Lee, Hyun-Sun [Molecular Cancer Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon (Korea, Republic of); Chung, Young Chul; Lee, Young Chun [Division of Food Science, International University of Korea, Jinju (Korea, Republic of); Jeong, Hye Gwang, E-mail: hgjeong@cnu.ac.kr [Department of Toxicology, College of Pharmacy, Chungnam National University, Daejeon 305-764 (Korea, Republic of)
2013-03-01
AMP-activated protein kinase (AMPK) plays a central role in controlling hepatic lipid metabolism through modulating the downstream acetyl CoA carboxylase (ACC) and sterol regulatory element-binding protein-1c (SREBP-1c) pathway. Saponins, particularly platycodin D, from the roots of Platycodon grandiflorum (Changkil saponins, CKS) have a variety of pharmacological properties, including antioxidant and hepatoprotective properties. The aim of this study was to investigate the effects of CKS on hepatic lipogenesis and on the expression of genes involved in lipogenesis, and the mechanisms involved. CKS attenuated fat accumulation and the induction of the lipogenic genes encoding SREBP-1c and fatty acid synthase in the livers of HFD-fed rats and in steatotic HepG2 cells. Blood biochemical analyses and histopathological examinations showed that CKS prevented liver injury. CKS and platycodin D each increased the phosphorylation of AMPK and acetyl-CoA carboxylase in HFD-fed rats and HepG2 cells. The use of specific inhibitors showed that platycodin D activated AMPK via SIRT1/CaMKKβ in HepG2 cells. This study demonstrates that CKS or platycodin D alone can regulate hepatic lipogenesis via an AMPK-dependent signalling pathway. - Highlights: ► CKS attenuated fat accumulation in HFD-fed rats and in steatotic HepG2 cells. ► CKS and its major component, platycodin D, inhibited the levels of SREBP-1 and FAS. ► CKS and platycodin D increased the phosphorylation of AMPK and ACC. ► Platycodin D activated AMPK via SIRT1/CaMKKβ in HepG2 cells.
[Cocoa (Theobroma cacao L.) hulls: a posible commercial source of pectins].
Barazarte, Humberto; Sangronis, Elba; Unai, Emaldi
2008-03-01
Commercial exploitation of cocoa (Theobroma cacao L.) generates a volume of hulls that could be used in the production of pectins on an industrial scale. Therefore, pectins from cocoa hulls were extracted at different pH and temperature conditions, and their main chemical characteristics were evaluated. EDTA at 0.5% was used for the extraction at pHs 3, 4 and 5 and temperatures of 60, 75 and 90 degrees C, under a 3 2 factorial design. The response variables were yield, content of anhydrous galacturonic acid (AGA), content of metoxil, degree of esterification and equivalent weight of the pectins extracted. The strength of the pectic gel was determined with a TA-XT2 texturometer. Strawberry jam was made with the pectin extracted, and its acceptability was determined using a 7-point hedonic scale. The results obtained were as follows: an extraction yield from 2.64 to 4.69 g/100 g; an AGA content between 49.8 and 64.06 g/100 g; a content of metoxil between 4.72 and 7.18 g/100 g; a degree of esterification between 37.94 and 52.20%; an equivalent weight from 385.47 to 464.61 g/equivalent of H+, and a degree of gelation between 28.64 and 806.03 g force. The pectin extracted at pH 4 and 90 degrees C showed a gelation power of 422.16 g force, purity 62.26 g/100 g of AGA, and a yield of extraction of 3.89 g/100 g and allowed to prepare ajam with an average level of liking of "like moderately". Pectins from cocoa hulls show potential application in the food industry, but it is necessary to optimize the extraction parameters to increase its yield.
Latha, P; Prakasam, V; Jonathan, E I; Samiyappan, R; Natarajan, C
2013-07-01
Physic nut (Jatropha curcas) is an important commercial bio-diesel plant species and is being advocated for development of waste and dry land. The collar and root rot caused by Lasiodiplodia theobromae is an important soil borne disease which causes considerable yield loss in this crop. In this study, the effects of culture media, temperature, photoperiod, carbon and nitrogen sources and pH on mycelial growth and pycnidial production were evaluated. Among the growth media tested, potato dextrose agar supported the highest growth followed by potato sucrose agar and corn meal agar. Among several carbon sources tested, carboxy methyl cellulose and sucrose were found superior for growth and pycnidial production. The nitrogen sources viz., ammonium oxalate and ammonium dihydrogen phosphate were recorded maximum mycelial growth and pycnidial production. The fungus grows at pH 5.0-9.0 and optimum growth was observed at pH 7.0.
Estudo do liquor de cupuaçu Study of cupuassu liquor
Directory of Open Access Journals (Sweden)
Kelly de Oliveira Cohen
2005-03-01
Full Text Available O cupuaçu (Theobroma grandiflorum Schum, que é um fruto amazônico, vem conquistando a cada ano mais espaço no mercado nacional e internacional com a comercialização de sua polpa. Suas sementes, consideradas como subproduto, vem despertando interesse não só no mundo científico como pelas indústrias. Sabe-se que, a partir das sementes, pode-se obter produtos análogos aos oriundos das sementes de cacau, seguindo as mesmas etapas de processamento. Dentre esses produtos tem-se o liquor de cupuaçu, semelhante ao liquor de cacau que é um dos ingredientes da formulação do chocolate. Este trabalho teve como objetivo o estudo da obtenção e caracterização física, química e físico-química do liquor de cupuaçu. Obteve-se três amostras de liquor de cupuaçu, cada qual partindo de lotes diferentes de fermentação. Foram avaliados a composição centesimal e o comportamento reológico. O liquor de cupuaçu apresentou alto teor de lipídios (63,93 a 66,51% e alto valor calórico (677,35 a 691,17kcal/100g. O teor de proteínas variou de 8,95 a 10,31%. A viscosidade plástica de Casson diminuiu com o aumento de temperatura. A distribuição do tamanho das partículas influenciou nas diferenças de viscosidades entre as amostras, havendo maior redução de viscosidade plástica com o aumento da temperatura nas amostras que apresentaram maior diâmetro de partículas. A gordura de cupuaçu apresentou comportamento newtoniano à 40ºC.Cupuassu (Theobroma grandiflorum Schum is an amazon fruit, that each year is conquering more space in national and international market with the commercialization of its pulp. Its seeds, considered as subproducts, are arousing interest not only in the scientific world but also in the industry. It's known that from those seeds, it can be obtained analogous products as those cocoa seeds, following the same stages of processing. Among those products there is the cupuassu liquor, similar to cocoa liquor that is one
International Nuclear Information System (INIS)
Castillo Portela, Grolamys; Eng Sanchez, Felipe; Nogueiras Lima, Clara
2014-01-01
Lasiodiplodia theobromae is a fungus, which has been reported by some authors as a high yield producer of the phytohormone jasmonic acid (JA). An indigenous strain of this fungus has been used for producing a fermentation broth with a high JA concentration by the Cuban Research Institute for Sugar Cane Derivatives (ICIDCA), registered as BIOJAS. The broth has been applied to some agricultural crops and demonstrated its economic feasibility as plant growth regulator and biological control of various phytopathogenic microorganisms and pests. Both fermentation broth and biomass from this fungus contain some other metabolites having bioactive properties, for instance, fatty acids. This paper shows the composition and quantification of fatty acids in the biomass using Gas Chromatography (GC) and the identification of substances profile in fermentation broth by Gas Chromatography coupled to Mass Spectrometry (GC-MS). The most fatty acids in the biomass are palmitic, stearic, oleic, linoleic and linolenic acids, being oleic acid the major component. On the other hand, 2,32 % of fatty acid esters; 2,47 % of alkenes; 14,40 % of alcohols; 30,15 % of aldehydes and 21,73 % of paraffins were detected in the composition of fermentation broth
Leal, Gildemberg Amorim; Gomes, Luiz Humberto; Efraim, Priscilla; de Almeida Tavares, Flavio Cesar; Figueira, Antonio
2008-08-01
Fermentation of Theobroma cacao (cacao) seeds is an absolute requirement for the full development of chocolate flavor precursors. An adequate aeration of the fermenting cacao seed mass is a fundamental prerequisite for a satisfactory fermentation. Here, we evaluated whether a controlled inoculation of cacao seed fermentation using a Kluyveromyces marxianus hybrid yeast strain, with an increased pectinolytic activity, would improve an earlier liquid drainage ('sweatings') from the fermentation mass, developing a superior final product quality. Inoculation with K. marxianus increased by one third the volume of drained liquid and affected the microorganism population structure during fermentation, which was detectable up to the end of the process. Introduction of the hybrid yeast affected the profile of total seed protein degradation evaluated by polyacrylamide gel electrophoresis, with improved seed protein degradation, and reduction of titrable acidity. Sensorial evaluation of the chocolate obtained from beans fermented with the K. marxianus inoculation was more accepted by analysts in comparison with the one from cocoa obtained through natural fermentation. The increase in mass aeration during the first 24 h seemed to be fundamental for the improvement of fermentation quality, demonstrating the potential application of this improved hybrid yeast strain with superior exogenous pectinolytic activity.
Krishnamoorthy, C; Rajamani, K
2013-12-15
A field experiment to study the influence of fertigation of N, P and K fertilizers on biometric characters of cocoa (Theobroma cacao L.) was conducted at the Department of Spices and Plantation Crops, Horticultural College and Research Institute, Tamil Nadu Agricultural University, Coimbatore during January 2010 to December 2011. The experiment was laid out with thirteen treatments replicated three times in a randomized block design. A phenomenal increase in growth parameters such as trunk girth, canopy spread and weight of the pruned branches removed, leaf fresh weight and leaf dry weight was observed with increasing levels of NPK as well as methods of fertilizer application in this study. Among the various treatments, fertigation with 125% 'Recommended Dose of Fertilizers' (125:50:175 g NPK plant year(-1)) as Water Soluble Fertilizers (WSF) through drip irrigation increased all vegetative growth parameters like trunk girth increment (1.62 cm), canopy spread increment (66.79 cm), leaf fresh weight (3.949 g), leaf dry weight (2.039 g), weight of the pruned branches removed (fresh weight 7.628 kg plant(-1)) and dry weight (4.650 kg plant(-1)).
Study of Seed Germination by Soaking Methode of Cacao (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2014-12-01
Full Text Available Study of germination methods conduct to get information about seed viability based on germination rate, percentage of germination and vigority. Germination methods was studied to get the efficiency and effectivity of germination, easy to handle, low costs with high vigority. Sand and gunny sack methods for germination, need extensive place and 3-4 days germination period after planting. This research will study the alternative of germination method with soaking. This method can be accelerating germination rate and effectively place usage without decreasing the quality of cacao seedling.The research was done at Kaliwining Experimental Station, Indonesian Coffee and Cocoa Research Institue. This research consist of two experiment was arranged based on factorial completely random design. First experiment will observed to compared germination rate and the second experiment will observed seedling quality between soaking and wet gunny sack germination method.The results showed that length of radicel on soaking method longer than wet gunny sack method. Growth of radicel started from 2 hours after soaking, moreover length of radicel at 4 hours after soaking have significant different value with gunny sack method. On 24 hours after soaking have 3,69 mm and 0,681 mm on wet gunny sack treatment. Except lengt of hipocotyl, there is not different condition between seedling that out came from soaking and wet gunny sack method. Length of hipocotyl on 36 hours after soaking have 9,15 cm and significant different between wet gunny sack germination method that have 5,40 cm. Keywords : seed germination, soaking method, Theobroma cacao L., cocoa seedlings
Araujo Abad, Lourdes Salomé
2016-01-01
The objective of this work was to verify the performance parameters of the analytical method of atomic absorption spectroscopy with graphite furnace for quantification of cadmium in cocoa (Theobroma cacao) almond, for which a protocol was prepared, analyzes were performed on the certified reference material (MRC), the concentration of cadmium in dry cocoa beans four farms (Farm A, B, C and D) located in the cocoa zone of the country, Flavio Alfaro Manabí, was determined an...
Directory of Open Access Journals (Sweden)
Thiago Édson Ribeiro da Silva
2008-10-01
Full Text Available The objective of this work was to evaluated a procedure for somatic embryogenesis and regeneration of cacao (Theobroma cacao L. elite clones. Petal explants from cacao clones TSH 565 and TSH 1188 were cultured on PCG and SCG-2 media, for calli growth. Somatic embryos were formed on the surface of embryogenic calli after transfer to embryo development (ED medium. Clone TSH 565 showed a higher embryogenic potential than TSH 1188. The best combination of carbon source for embryo induction in ED medium was genotype-specific. Embryogenic callus formations increased in micropore tape-sealed Petri dishes, irrespective of cacao genotype. Mature somatic embryos were successfully converted into plantlets.O objetivo deste trabalho foi avaliar um procedimento para embriogênese somática e regeneração de clones elite de cacau. Pétalas dos clones de cacau TSH 565 e TSH 1188 foram cultivadas em meios PCG e SCG-2 para o crescimento de calos. Embriões somáticos desenvolveram-se na superfície dos calos embriogênicos, após a transferência para o meio ED. O clone TSH 565 apresentou maior potencial embriogênico do que o TSH 1188. A melhor combinação de fonte de carbono quanto à indução de embriões em meio ED foi específica do genótipo. A formação de calos embriogênicos foi superior em placas de Petri seladas com fita hipoalergênica, independentemente do genótipo. Embriões maduros de ambos os genótipos foram convertidos em plântulas.
International Nuclear Information System (INIS)
Le Quang Luan; Vo Thi Thu Ha; Le Hai; Nguyen Quoc Hien; Nguyen Duy Hang; Nguyen Tuong Ly Lan; Le Huu Tu
2003-01-01
The solution of chitosan (10%) and alginate (4%) were irradiated at doses of 10-250 kGy for degradation and the products were used for testing of plant growth promotion effect. The chitosan and alginate irradiated at 100 kGy and 75 kGy, respectively showed the strongest growth-promotion effect for plants namely L. latifolium, E. grandiflorum and C. morifolium in tissue culture. For shoot multiplication, the suitable concentrations are found to be ca. 50-200 mg/l for C. morifolium, 70-100 mg/l for L. latifolium and 30-100 mg/l E. grandiflorum with irradiated chitosan, while with irradiated alginate, it was 30-200 mg/l, 30-50 mg/l and 10-200 mg/l, respectively. The optimum concentrations for C. morifolium, E. grandiflorum, L. latifolium incubated on rooting medium are ca. 100 mg/l, 30 mg/l and 40 mg/l, respectively for irradiated chitosan and 100 mg/l for irradiated alginate. After acclimatizing for 30 days in the greenhouse, the survival ratio of the transferred C. morifolium, E. grandiflorum, L. latifolium plantlets treated with irradiated chitosan was improved 18%, 39% and 13%, respectively. (author)
Gene flow and genetic diversity in cultivated and wild cacao (Theobroma cacao) in Bolivia.
Chumacero de Schawe, Claudia; Durka, Walter; Tscharntke, Teja; Hensen, Isabell; Kessler, Michael
2013-11-01
The role of pollen flow within and between cultivated and wild tropical crop species is little known. To study the pollen flow of cacao, we estimated the degree of self-pollination and pollen dispersal distances as well as gene flow between wild and cultivated cacao (Theobroma cacao L.). We studied pollen flow and genetic diversity of cultivated and wild cacao populations by genotyping 143 wild and 86 cultivated mature plants and 374 seedlings raised from 19 wild and 25 cultivated trees at nine microsatellite loci. A principal component analysis distinguished wild and cultivated cacao trees, supporting the notion that Bolivia harbors truly wild cacao populations. Cultivated cacao had a higher level of genetic diversity than wild cacao, presumably reflecting the varied origin of cultivated plants. Both cacao types had high outcrossing rates, but the paternity analysis revealed 7-14% self-pollination in wild and cultivated cacao. Despite the tiny size of the pollinators, pollen was transported distances up to 3 km; wild cacao showed longer distances (mean = 922 m) than cultivated cacao (826 m). Our data revealed that 16-20% of pollination events occurred between cultivated and wild populations. We found evidence of self-pollination in both wild and cultivated cacao. Pollination distances are larger than those typically reported in tropical understory tree species. The relatively high pollen exchange from cultivated to wild cacao compromises genetic identity of wild populations, calling for the protection of extensive natural forest tracts to protect wild cacao in Bolivia.
Aime, M C; Phillips-Mora, W
2005-01-01
The two most devastating diseases of cacao (Theobroma cacao)--the source of chocolate--in tropical America are caused by the fungi Crinipellis perniciosa (witches' broom disease) and Moniliophthora roreri (frosty pod rot or moniliasis disease). Despite the agricultural, socio-economic and environmental impact of these fungi, most aspects of their life cycles are unknown, and the phylogenetic relationships of M. roreri have yet to be conclusively established. In this paper, extensive phylogenetic analyses of five nuclear gene regions (28S rDNA, 18S rDNA, ITS, RPB1, and EF1-alpha) confirm that C. perniciosa and M. roreri are sister taxa that belong in the Marasmiaceae (euagarics). Furthermore, these taxa form part of a separate and distinct lineage within the family. This lineage includes the biotrophic fungi Moniliophthora perniciosa comb. nov. and M. roreri, as well as one undescribed endophytic species. The sister genera to Moniliophthora are Marasmius, Crinipellis and Chaetocalathus, which consist mainly of saprotrophic litter fungi.
Directory of Open Access Journals (Sweden)
Juan F Costa
2009-03-01
Full Text Available Insects are attracted to plants by visual and olfactory cues. The quinoa moth, Eurysacca melanocampta Meyrick (Lepidoptera: Gelechiidae, is the main insect pest of the quinoa crop, Chenopodium quinoa Willd. (Chenopodiales: Chenopodiaceae, in the southern Peruvian Andes, causing grain yield losses. The aim of this study was to investigate the behavioural response of adult quinoa moths to olfactory stimuli. Specifically, the objectives of this study were: 1 to determine the capacity of E. melanocampta adults of searching for quinoa plants using plant olfactory cues; 2 to determine the preference of E. melanocampta females for the odours derived from two varieties of quinoa: Amarilla de Marangani and Blanca de Junín; and 3 to assess the attraction of male quinoa moths to E. melanocampta females and the host plant in olfactometric bioassays. Adults preferred quinoa plant odour sources in choice tests when distilled water was used as a control (P La atracción de insectos hacia las plantas es causada tanto por estímulos visuales como olfativos. La polilla de la quinua, Eurysacca melanocampta Meyrick (Lepidoptera: Gelechiidae, es la principal plaga en el cultivo de quinua, Chenopodium quinoa Willd. (Chenopodiales: Chenopodiaceae, en los Andes del sur peruano causando pérdidas en la producción de granos. El objetivo de este estudio fue evaluar las respuestas conductuales frente a estímulos olfativos de adultos de la polilla de la quinua. Específicamente, los objetivos del estudio fueron: 1 estudiar la capacidad de búsqueda de plantas de quinua de los adultos de E. melanocampta utilizando plantas como estímulos olfativos; 2 determinar la preferencia de hembras de E. melanocampta por olores derivados de plantas de dos variedades de quinua: Amarilla de Marangani y Blanca de Junín; y 3 estudiar la atracción de los machos hacia hembras de E. melanocampta y hacia las plantas hospederas en bioensayos de olfatometría. Los adultos eligieron fuentes
V, Malayaman; N, Sisubalan; R P, Senthilkumar; S, Sheik Mohamed; R, Ranjithkumar; M, Ghouse Basha
2017-11-01
Phyllanthus debilis Klein ex Willd. is wild medicinal plant used in the traditional system of medicine. This plant has been actively used for hepatoprotection and to cure many diseases including jaundice and so on; which leads to complete extinction of this particular species. Therefore, the chitosan mediated cost effective cell suspension method has been developed for the production of hydrolysable tannin. The hydrolysable tannins are the main therapeutically active constituents with antioxidant, anticancer, and antimicrobial properties. An in vitro cell suspension culture was optimized by adding chitosan for production of hydrolysable tannin. According to the growth kinetics, a maximum biomass of 4.46±0.06g fresh cell weight and 1.33±0.04g dry cell weight were obtained from the optimal suspension medium consisted of MS medium+0.5mgL -1 BAP+1.5mgL -1 NAA. Chitosan was treated at the stationary phase which leads to the highest accumulation of hydrolysable tannin compared to the untreated control. Hydrolysable tannin was observed and compared using HPLC at the Rt of 4.91 in both chitosan treated and untreated cells. This is the first ever report where use of chitosan has been done to enhance the production of the hydrolysable tannin in P. debilis using cell suspension culture technique. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Farag, M.F.S.; Darwish, M.M.
2016-01-01
Man is exposed to natural radiations either from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation of animals induce biochemical alterations which depend mostly on oxidative stress. This work aimed at evaluating the radioprotective efficiency of Cocoa (Theobroma cacao L.) against whole body γ-irradiation of rats. The virtue of cocoa aqueous extract (CAE) was given to rats at a dose of 1 g/ kg for 6 weeks to determine changes in hepatic marker enzymes, lipid profile and antioxidant status. The animals exposed to γ-rays exhibited a pronounced increment in serum aspartate transaminase (AST), alanine transaminase (ALT), alkaline phosphatase (ALP) and gamma glutamyl transpeptidase (γ GT), total cholesterol (TC), triglycerides (TG), low density lipoprotein cholesterol (LDL-C) and liver thiobarbituric acid reactive substance (TBARS). On the other hand, a significant decline was demonstrated in high density lipoprotein cholesterol (HDL-C). A decrease of hepatic reduced glutathione (GSH) content, superoxides dismutase (SOD) and catalase (CAT) activities was sustained. The CAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings revealed that cocoa would exert radio-protective properties
Turcios, Ariel E; Weichgrebe, Dirk; Papenbrock, Jutta
2016-03-01
This project analyses the biogas potential of the halophyte Chenopodium quinoa Willd. In a first approach C. quinoa was grown with different concentrations of NaCl (0, 10 and 20 ppt NaCl) and the crop residues were used as substrate for biogas production. In a second approach, C. quinoa was grown with 0, 10, 20 and 30 ppt NaCl under hydroponic conditions and the fresh biomass was used as substrate. The more NaCl is in the culture medium, the higher the sodium, potassium, crude ash and hemicellulose content in the plant tissue whereas the calcium, sulfur, nitrogen and carbon content in the biomass decrease. According to this study, it is possible to produce high yields of methane using biomass of C. quinoa. The highest specific methane yields were obtained using the substrate from the plants cultivated at 10 and 20 ppt NaCl in both experiments. Copyright © 2015 Elsevier Ltd. All rights reserved.
Muslimin; Wijayanti, W.; Anshary, A.; Basri, Z.; Cruz, A. F.; Suwastika, I. N.; Shiina, T.
2018-04-01
Cacao (Theobroma cacao L.) is one major agricultural commodity from central Sulawesi, which is significantly affected by a range of pest and diseases including Cacao Pod Borer (CPB), Pod Rod Diseases (PRD), and Vascular Streak Dieback (VSD). Intensive and extensive approaches, including introduction of various new superior cultivars/clones, and development of eco-friendly agricultural system were implemented in order to overtake that problem. Here, we observed the performance of three different clones (namely: Sulawesi 1, MCC01, and Tadulako-1) in two different locations (Parigi and Poso-which located along east coast of central Sulawesi province), and under two different Agricultural management system (echo-friendly-intensive and Non-Intensive). All clones tested showed their well-adapted and suitable to local conditions. The performance of each clone can be improved by intensive management system. Based on all observed parameters (number of wet bean per pot, bean count, fat and shell percentage, and percentage of infection) it convincingly showed that intensive management system was working well in improving the quality and quantity of cacao beans production, and it fit to commercial requirements. The highest rate of infection was by Phytophthora, and no significant differences on the overall performances. Clones of Sulawesi-1 and MCC01 most likely was better than Tadulako-1.
Directory of Open Access Journals (Sweden)
Franko Telöken
2011-03-01
Full Text Available AIM: To evaluate leaf degradation and invertebrate colonization of Salix humboldtiana Willd. in a subtropical shallow lake on the coastal plain of Rio Grande do Sul, Brazil; METHODS: Litter bags containing 6.85 g of leaves were incubated in the superficial layer of sediment in the littoral region for 1, 4, 7, 14, 32, 47 and 71 days; RESULTS: After 71 days, a loss of 51% of the initial leaf weight was observed (k = 0.0100 d-1. We estimated that it would take 300 days to lose 95% of the initial weight. A total of 16040 organisms and 35 taxa were identified. Caenidae (25.9%, Oligochaeta (19%, Ostracoda (13.8%, Hydracarina (9.8%, Tanypodinae (9.7% and Coenagrionidae (7.7% were the most highly represented taxa. We observed increases in density, richness and diversity of taxa over time, with a stabilizing trend noted in the taxa diversity. Regarding the functional trophic groups (FTGs, gathering-collectors accounted for 57.6% of the community, while predators (25%, scrapers (15.8%, filtering-collectors (0.88% and shredders (0.73% were also represented. The diversity and evenness of the FTGs had stabilized by day 14; CONCLUSIONS: S. humboldtiana detritus provides a favorable habitat for a sufficient duration to support a high density and diversity of aquatic invertebrates. The small percentage of shredders indicates the minor influence of the invertebrate community on the rate of detrital degradation. The main contribution of invertebrates to detrital processing comes from the consumption of fine particulate organic matter by gathering-collectors.OBJETIVOS: Avaliar a degradação foliar de Salix humboldtiana Willd. e a colonização pela comunidade de invertebrados aquáticos em um lago raso subtropical, planície costeira do Rio Grande do Sul, Brasil; MÉTODOS: Bolsas de decomposição contendo 6,85 g de folhas foram incubadas na região litorânea, na superfície do sedimento, e retiradas após 1, 4, 7, 14, 32, 47 e 71 dias de decomposi
Brito, Isabelle L; de Souza, Evandro Leite; Felex, Suênia Samara Santos; Madruga, Marta Suely; Yamashita, Fábio; Magnani, Marciane
2015-09-01
The aim of this study was to develop a gluten-free formulation of quinoa (Chenopodium quinoa Willd.)-based cookies using experimental design of mixture to optimize a ternary mixture of quinoa flour, quinoa flakes and corn starch for parameters of colour, specific volume and hardness. Nutritional and sensory aspects of the optimized formulation were also assessed. Corn starch had a positive effect on the lightness of the cookies, but increased amounts of quinoa flour and quinoa flakes in the mixture resulted in darker product. Quinoa flour showed a negative effect on the specific volume, producing less bulky cookies, and quinoa flour and quinoa flakes had a positive synergistic effect on the hardness of the cookies. According the results and considering the desirability profile for colour, hardness and specific volume in gluten-free cookies, the optimized formulation contains 30 % quinoa flour, 25 % quinoa flakes and 45 % corn starch. The quinoa-based cookie obtained was characterized as a product rich in dietary fibre, a good source of essential amino acids, linolenic acid and minerals, with good sensory acceptability. These findings reports for the first time the application of quinoa processed as flour and flakes in mixture with corn starch as an alternative ingredient for formulations of gluten-free cookies-type biscuits.
Abderrahim, Fatima; Huanatico, Elizabeth; Segura, Roger; Arribas, Silvia; Gonzalez, M Carmen; Condezo-Hoyos, Luis
2015-09-15
Physical features, bioactive compounds and total antioxidant capacity (TAC) of coloured quinoa varieties (Chenopodium quinoa Willd.) from Peruvian Altiplano were studied. Quinoa seeds did not show a pure red colour, but a mixture which corresponded to different fractal colour values (51.0-71.8), and they varied from small to large size. Regarding bioactive compounds, total phenolic (1.23-3.24mg gallic acid equivalents/g) and flavonol contents (0.47-2.55mg quercetin equivalents/g) were highly correlated (r=0.910). Betalains content (0.15-6.10mg/100g) was correlated with L colour parameter (r=-0.569), total phenolics (r=0.703) and flavonols content (r=0.718). Ratio of betaxanthins to betacyanins (0.0-1.41) was negatively correlated with L value (r=-0.744). Whereas, high TAC values (119.8-335.9mmol Trolox equivalents/kg) were negatively correlated with L value (r=-0.779), but positively with betalains (r=0.730), as well as with free (r=0.639), bound (r=0.558) and total phenolic compounds (r=0.676). Unexploited coloured quinoa seeds are proposed as a valuable natural source of phenolics and betalains with high antioxidant capacity. Copyright © 2015 Elsevier Ltd. All rights reserved.
Packaging of Post Acclimatized Somatic Embryogenesis Cocoa Plantlet (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Soedarsianto Soedarsianto
2009-05-01
Full Text Available Clonal plants that produced by somatic embryogenesis technique is one of the best choice to produce supperior clonal cacao (Theobroma cacao L. planting materials. The somatic embryogenesis technique is a possible way for massive propagation, the outcome is true to type plants, the architecture similarity that the seedlings but there is not segregation like seedlings plants. At present mass production started of plantlets production until post-acclimatized plantlets of somatic embryogenesis cocoa was done at Indonesian Coffee and Cocoa Research Institute. Distribution system of the planting materials to whole areas in form of as up-rooted post-acclimatized plantlet. Some problems identified to reduce probability of decreasing viability of up-rooted post-acclimatized plantlets and one of them is extreme internal water deficit. This research investigate of the influece storage condition (air tight and non-air tight and box storage (mica plastic and cardboardbox. The first experiment result show, there is no significant different between mica plastic and cardboard box usage for storage of post-acclimatized cocoa pantlet. Viability of up-rooted post acclimatized cocoa plantlet influenced exactly by air tight and non-air tight storage condition. Air tight storage condition have better viability of up-rooted post acclimatised (81,58% than non-air tight storage condition (65,00%. Leaf sanasence on air tight storage condition (10,33% lower than non-air tight storage (32,58%. There is not significantly on volume storage per plantlet between 4.416 cm3 and 12.600 cm3. Relationship between fallen leaves and cocoa planlet viability follow negative linear correlation y = -1,4719x + 104,88 (R2 = 0,9772. The second experiment treatment showed that maximal storage periode of post cclimatized cocoa plantlet just until 6 days stored (97% and not significant with 3 days one. Viability of post acclimatized cocoa plantlet decreased after 6 days storage period
Directory of Open Access Journals (Sweden)
Ana Rita Gaia Machado
2016-09-01
Full Text Available This paper examined the growth and yield performance of Lentinus citrinus on cupuaçu exocarp (Theobroma grandiflorum mixed with litter (CE + LI or rice bran (Oryza sativa (CE + RB in the ratio of 2:1 (800 g:200 g to investigate the nutritional composition and proteolytic potential of the fruiting body produced. Significance values of yield were determined on substrate combinations. In CE + LI the biological efficiency of the mushrooms was 93.5% and the content of fat (4.5%, fiber (11.0%, protein (27.0% and amino acids were higher when compared with CE + RB. Among the amino acids, the amount of glutamic acid, aspartic acid, alanine, arginine and leucine was high. The biological efficiency on CE + RB reduced to 84.2% and based on the nutritional value, carbohydrates (53.59%, energy (324.33 kcal and minerals such as zinc, iron, copper, potassium and phosphorus were higher in this substrate combination. Protease activity from fruiting body was significant in CE + LI (463.55 U/mL. This protease showed an optimal activity at 50 °C in neutral and alkaline pH with maximum stability at 30 °C at alkaline pH. This is the first report of L. citrinus fruiting body nutritional composition with potential for human food and application in industrial processes.
Liu, Yi; Shi, Zi; Maximova, Siela; Payne, Mark J; Guiltinan, Mark J
2013-12-05
The proanthocyanidins (PAs), a subgroup of flavonoids, accumulate to levels of approximately 10% total dry weight of cacao seeds. PAs have been associated with human health benefits and also play important roles in pest and disease defense throughout the plant. To dissect the genetic basis of PA biosynthetic pathway in cacao (Theobroma cacao), we have isolated three genes encoding key PA synthesis enzymes, anthocyanidin synthase (ANS), anthocyanidin reductase (ANR) and leucoanthocyanidin reductase (LAR). We measured the expression levels of TcANR, TcANS and TcLAR and PA content in cacao leaves, flowers, pod exocarp and seeds. In all tissues examined, all three genes were abundantly expressed and well correlated with PA accumulation levels, suggesting their active roles in PA synthesis. Overexpression of TcANR in an Arabidopsis ban mutant complemented the PA deficient phenotype in seeds and resulted in reduced anthocyanidin levels in hypocotyls. Overexpression of TcANS in tobacco resulted in increased content of both anthocyanidins and PAs in flower petals. Overexpression of TcANS in an Arabidopsis ldox mutant complemented its PA deficient phenotype in seeds. Recombinant TcLAR protein converted leucoanthocyanidin to catechin in vitro. Transgenic tobacco overexpressing TcLAR had decreased amounts of anthocyanidins and increased PAs. Overexpressing TcLAR in Arabidopsis ldox mutant also resulted in elevated synthesis of not only catechin but also epicatechin. Our results confirm the in vivo function of cacao ANS and ANR predicted based on sequence homology to previously characterized enzymes from other species. In addition, our results provide a clear functional analysis of a LAR gene in vivo.
New taxa and combinations in neotropical Juncus (Juncaceae)
DEFF Research Database (Denmark)
Balslev, Henrik
1983-01-01
Juncus arequipensis andJ. breviculmis are described as new species, andJ. ramboi subsp.colombianus as a new subspecies.Juncus arcticus Willd. var.mexicanus (Willd.), var.montanus (Engelm.), and var.andicola (Hook.) are proposed as new combinations.......Juncus arequipensis andJ. breviculmis are described as new species, andJ. ramboi subsp.colombianus as a new subspecies.Juncus arcticus Willd. var.mexicanus (Willd.), var.montanus (Engelm.), and var.andicola (Hook.) are proposed as new combinations....
Maughan, P J; Turner, T B; Coleman, C E; Elzinga, D B; Jellen, E N; Morales, J A; Udall, J A; Fairbanks, D J; Bonifacio, A
2009-07-01
Salt tolerance is an agronomically important trait that affects plant species around the globe. The Salt Overly Sensitive 1 (SOS1) gene encodes a plasma membrane Na+/H+ antiporter that plays an important role in germination and growth of plants in saline environments. Quinoa (Chenopodium quinoa Willd.) is a halophytic, allotetraploid grain crop of the family Amaranthaceae with impressive nutritional content and an increasing worldwide market. Many quinoa varieties have considerable salt tolerance, and research suggests quinoa may utilize novel mechanisms to confer salt tolerance. Here we report the cloning and characterization of two homoeologous SOS1 loci (cqSOS1A and cqSOS1B) from C. quinoa, including full-length cDNA sequences, genomic sequences, relative expression levels, fluorescent in situ hybridization (FISH) analysis, and a phylogenetic analysis of SOS1 genes from 13 plant taxa. The cqSOS1A and cqSOS1B genes each span 23 exons spread over 3477 bp and 3486 bp of coding sequence, respectively. These sequences share a high level of similarity with SOS1 homologs of other species and contain two conserved domains, a Nhap cation-antiporter domain and a cyclic-nucleotide binding domain. Genomic sequence analysis of two BAC clones (98 357 bp and 132 770 bp) containing the homoeologous SOS1 genes suggests possible conservation of synteny across the C. quinoa sub-genomes. This report represents the first molecular characterization of salt-tolerance genes in a halophytic species in the Amaranthaceae as well as the first comparative analysis of coding and non-coding DNA sequences of the two homoeologous genomes of C. quinoa.
Directory of Open Access Journals (Sweden)
K. M. Abdul RAOOF
2012-05-01
Full Text Available The present laboratory experimental study was conducted to evaluate the allelopathic potential of Tinospora cordifolia (Willd. Miers on seed germination and seedling growth of weed plants (Chenopodium album L. Chenopodium murale L., Cassia tora L. and Cassia sophera L.. Root and aerial root aqueous extracts of Tinospora at 0.5, 1.0, 2.0 and 4.0% concentrations were applied to determine their effect on seed germination and seedling growth of test plants under laboratory conditions. Germination was observed for 15 days after that the root length and shoot length was measured. Dry weight was measured after oven drying the seedlings. The aqueous extracts from root and aerial root had inhibitory effect on seed germination of test plants. Aqueous extracts from root and aerial root significantly inhibited not only germination and seedling growth but also reduced dry weight of the seedlings. Root length, shoot length of weed species decreased progressively when plants were exposed to increasing concentration (0.5, 1, 2 and 4%. Aqueous extract of aerial root shows the least inhibition. The pH of aqueous extracts of different parts of T. cordifolia does not show any major change when the concentration increases.
Directory of Open Access Journals (Sweden)
Rodica BERCU
2016-12-01
Full Text Available The paper presents a comparative study concerning the leaf structure of two Euphorbia species belonging to Euphorbiaceae family: Euphorbia milli var. splendens (Bojer ex Hook. Ursch & Leandri and Euphorbia pulcherrima Willd. ex Klotzsch. Anatomically, the leaves of the studied species are quite similar in the basic structure. The petiole has a single-layered epidermis, a collenchyma tissue – hypodermis - and three collateral bundles embedded in a basic tissue. Differences occur concerning the relationship between the collateral bundles. The Euphorbia pulcherrima bract petiole has almost the same structure as those of the leaf petiole. The blade is amphistomatic for Euphorbia milli var. splendes and hipostomatic for E. pulcherrima. The heterogeneous mesophyll is isobilateral in Euphorbia milli var. splendens blade and bifacial in E. pulcherrima. The vascular system of the mid rib is represented by one collateral bundle for both species, more developed in Euphorbia milli var. splendens blade. Differences appear concerning the epidermal cells cuticle thickness, the type of mesophyll, the abundance of the non-articulated laticifers and the development of the vascular system. The Euphorbia pulcherrima bract has the same organization plan structure as the leaf blade but some features differences occur.
Directory of Open Access Journals (Sweden)
Ivan José Antunes Ribeiro
1988-01-01
Full Text Available É relatada a ocorrência, pela primeira vez no Brasil, de Ceratocystis fimbriata Ell. & Halst. sobre acácia-negra. Testes de inoculação cruzada foram efetuados em casa de vegetação com o isolado obtido de acácia-negra (Acacia decurrens Willd. e outro de mangueira (Mangifera indica L.. Observou-se que ambos os isolados foram patogênicos à acácia-negra e à mangueira.Several plants of Acacia decurrens showed wilting and subsequent branche drying. The branches showed wood splitting and gum exudation. The transversally cut wood showed ashy colored pith, that desenvolved numerous perithecia when kept in a humid chamber. These perithecia were transferred aseptically to potato-dextrose-agar and the culture was classified as Ceratocystis fimbriata Ell. & Halst. Four mounth old Acacia plants inoculated with the isolate died after 14 days. The fungus was again isolated from these dead plants. Cross inoculation tests with isolate of C. fimbriata from Acacia and mango (Mangifera indica L. showed pathogenic effects for both hosts.
Directory of Open Access Journals (Sweden)
Carolina Osorio-Solano
2012-04-01
Full Text Available Moniliophthora perniciosa, agente causante de la ‘escoba de bruja’ en cacao (Theobroma cacao, presenta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cercanas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos encaminados al manejo de este patógeno y el desarrollo de materiales resistentes de cacao. En este estudio se analizaron 12 aislamientos del hongo obtenidos de diferentes materiales de cacao. Cada una de las muestras se evaluó con marcadores moleculares que tienen como blanco una región del ADN ribosomal (ADNr nuclear conocida como ITS (Internal Transcribed Spacer, una región intergénica (IGS-1 y cinco secuencias simples repetidas (SSR. El marcador IGS-1 permitió la determinación del biotipo C, no obstante se encontró una variabilidad genética evidente dentro de este biotipo, aún no registrada. El análisis de la diversidad genética de M. perniciosa por medio de marcadores microsatélite arrojó un valor total de 0.4260, una heterocigosidad total de 0.6143 y un índice de información polimórfica (PIC de 0.3407, valores considerados de rango medio a alto para los aislamientos estudiados y que estiman la variabilidad genética presente en M. perniciosa.Moniliophthora perniciosa, the founder agent of the ‘witch’s broom’ on cocoa (Theobroma cacao L. is one of the most important diseases in cocoa plantations, causing economic losses close to 70% worldwide and 40% nationwide. It shows a high genetic variability and discrepancies in its taxonomy. Characterization of the genetic diversity of biotypes is important for projects aimed towards the handling of this pathogen and the development of resistant cocoa materials. Twelve isolations of the fungus were analyzed in this study from different
Directory of Open Access Journals (Sweden)
Mirić Milenko
2005-01-01
Full Text Available White rot fungi usually decompose cell walls of attacked wood destroying tissue elements (i.e. parenchyma cells, wood fibres, tension wood, tracheas etc in different amount, depending to wood-species as well as to its' zones. Different fungi secrete specific enzymes that are responsible for certain damages. As consequence, the wood structure use to be significantly and unfixable decomposed and changed. Microscopical analyses that have been run provided clear and indicative information relating to effects of fungal activity on wood tissue. Physiological requirements of fungi are for shore of the highest importance in understanding of mechanism of decaying process in the wood. The most important factors as like temperature and concentration of H ions, as well as main nutrients as sources of carbon, nitrogen and phosphorus can affect the behaviour of wood decaying fungi. The impacts of these factors on the growth and production on mycelial mass of Stereum hirsutum (Willd. ex Fr. S.F. Gray., have been investigated. This fungus is one of the most frequent appearing on the Sessile- and Pedunculate Oak weakened trees or felled logs, behaving as parasite as well as saprophyte. As a causer of Oak sapwood white rot S. hirsutum causes significant damages of wood at forest- as well as at industrial storages.
Ruiz, Geraldine Avila; Xiao, Wukai; van Boekel, Martinus; Minor, Marcel; Stieger, Markus
2016-10-15
The aim of this study was to determine the influence of extraction pH on heat-induced aggregation, gelation and microstructure of suspensions of protein isolates extracted from quinoa (Chenopodium quinoa Willd). Quinoa seed protein was extracted by alkaline treatment at various pH values (pH 8 (E8), 9 (E9), 10 (E10) and 11 (E11)), followed by acid precipitation. The obtained protein isolates were freeze dried. The protein isolates E8 and E9 resulted in a lower protein yield as well as less protein denaturation. These isolates also had a higher protein purity, more protein bands at higher molecular weights, and a higher protein solubility in the pH range of 3-4.5, compared to the isolates E10 and E11. Heating the 10%w/w protein isolate suspensions E8 and E9 led to increased aggregation, and semi-solid gels with a dense microstructure were formed. The isolate suspensions E10 and E11, on the other hand, aggregated less, did not form self-supporting gels and had loose particle arrangements. We conclude that extraction pH plays an important role in determining the functionality of quinoa protein isolates. Copyright © 2016 Elsevier Ltd. All rights reserved.
Florez, Sergio L; Erwin, Rachel L; Maximova, Siela N; Guiltinan, Mark J; Curtis, Wayne R
2015-05-16
Theobroma cacao, the chocolate tree, is an important economic crop in East Africa, South East Asia, and South and Central America. Propagation of elite varieties has been achieved through somatic embryogenesis (SE) but low efficiencies and genotype dependence still presents a significant limitation for its propagation at commercial scales. Manipulation of transcription factors has been used to enhance the formation of SEs in several other plant species. This work describes the use of the transcription factor Baby Boom (BBM) to promote the transition of somatic cacao cells from the vegetative to embryonic state. An ortholog of the Arabidopsis thaliana BBM gene (AtBBM) was characterized in T. cacao (TcBBM). TcBBM expression was observed throughout embryo development and was expressed at higher levels during SE as compared to zygotic embryogenesis (ZE). TcBBM overexpression in A. thaliana and T. cacao led to phenotypes associated with SE that did not require exogenous hormones. While transient ectopic expression of TcBBM provided only moderate enhancements in embryogenic potential, constitutive overexpression dramatically increased SE proliferation but also appeared to inhibit subsequent development. Our work provides validation that TcBBM is an ortholog to AtBBM and has a specific role in both somatic and zygotic embryogenesis. Furthermore, our studies revealed that TcBBM transcript levels could serve as a biomarker for embryogenesis in cacao tissue. Results from transient expression of TcBBM provide confirmation that transcription factors can be used to enhance SE without compromising plant development and avoiding GMO plant production. This strategy could compliment a hormone-based method of reprogramming somatic cells and lead to more precise manipulation of SE at the regulatory level of transcription factors. The technology would benefit the propagation of elite varieties with low regeneration potential as well as the production of transgenic plants, which
Directory of Open Access Journals (Sweden)
Michelliny de Matos Bentes-Gama
2005-06-01
Full Text Available O objetivo deste estudo foi realizar a análise financeira e a simulação de risco de investimento em sistemas agroflorestais (SAFs implantados em 1987, no Campo Experimental da Embrapa Rondônia, localizado no município de Machadinho d'Oeste, RO. A análise financeira foi realizada mediante os métodos de avaliação de projetos florestais, e para a análise de risco utilizou-se a técnica de simulação de Monte Carlo, mediante o programa @RISK. Entre os arranjos testados, o SAF T1 Castanha-do-brasil-banana-pimenta-do-reino-cupuaçu apresentou o melhor desempenho financeiro em relação aos SAFs T2 Freijó-banana-pimenta-do-reino-cupuaçu e T3 Pupunha-banana-pimenta-do-reino-cupuaçu . Os custos com tratos culturais e colheita representaram mais de 70% da composição dos custos totais, e a participação da mão-de-obra foi superior a 50% nas fases de preparo da área e de manutenção (tratos culturais dos SAFs. A simulação da análise de risco indicou que as variáveis que afetaram o Valor Presente Líquido no Horizonte Infinito (VPL*, de acordo com a ordem de importância (R, foram: taxa de desconto, preço do fruto de cupuaçu (Theobroma grandiflorum, custo de colheita, preço da madeira de castanha-do-brasil (Bertholletia excelsa e o custo de tratos culturais. Apesar do alto custo de implantação e manutenção, o SAF T1 apresentou uma probabilidade de 15% de os valores do Valor Presente Líquido (VPL se concentrarem em torno de R$35.000 ha-1.ano-1.The objective of this study was to carry out the financial analysis and the risk of investment simulation in agroforestry systems (AFSs established in 1987 in the Experimental Field of Embrapa Rondônia, located in the County of Machadinho d'Oeste, RO. Financial analysis was made through the evaluation of results from the forestry enterprise evaluation methods, and the risk analysis was carried out through the Monte Carlo simulation technique by @RISK software. Among the arrangements
Energy Technology Data Exchange (ETDEWEB)
Calatayud, A.; Deltoro, V.I.; Barreno, E. [Univ. de Valencia, Inst. `Cavanilles` de Biodiversitat y Biologia Evolutiva, Burjassot (Spain); Abadia, A. [Estacion Experimental Aula Dei, CSIC, Dept. of Plant Nutrition, Zaragoza (Spain)
1999-08-01
The effects of environmental stresses on photosynthetic responses, ascorbate levels and pigment composition were investigated in samples of Parmelia quercina (Willd.) Vainio from control and polluted regions of the northern Castellon area (Valencia, Spain). In response to sustained pollutant stress in the field, lichen thalli has closed PSII traps and exhibited lower rates of electron transport and non-radiative energy dissipation. The xanthophyll concentration was not affected by exposure to atmospheric pollutants. The ascorbate concentration was lower in samples exposed to ambient air pollutants compared to control thalli. Ascorbate feeding of thalli from polluted sites stimulated electron flow, photochemical quenching and non-raditive energy dissipation. Additionally, ascorbate feeding enhances the de-epoxidation state of the xanthophyll pool in polluted thalli. The partial recovery for non-radiative energy dissipation was presumabley due to the interaction between the increased thylakoid pH gradient and de-epoxidized xanthophylls. Furhtermore, ascorbate feeding descreased photon excess in thalli from polluted sites owing to the stimulation of linear electron flow and non-radiative energy dissipation. The present study suggests that atmospheric pollutants besides their intrinsic toxicity, put on an additional burden by hampering the operation of photoprotective mechanisms. (au)
The effect of 2,4 dichlorophenoxyacetic acid on in vitro callogenesis of cocoa (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2015-08-01
Full Text Available Cocoa (Theobroma cacao L. development using modern breeding techniques can be facilitated by propagation of planting material through somatic embryogenesis. Various factors that may affect embryogenesis are the composition of culture medium and culture condition. Hormone commonly used to initiate the formation of callus is auxin with type 2.4-D (2.4 Dichlorophenoxy acetic acid. The aim of this study was to determine the effect of the addition of 2.4 -D hormoneson the process of cocoa embryogenesis. The treatments were arragged in factorial combination in completely randomized design, which consisted of two factors. Thefirst factor was the concentration of auxin 2,4-D 25 %, 50 %, 75 %, and 100 %; and the second factor was cocoa clones; Sulawesi 01 and Sulawesi 02. The resultshowed that the addition of 2.4-D hormone up to 100% on somatic embryogenesis of cocoa for Sulawesi 01 clone was not significantly different from Sulawesi 02 clone for all parameters. While on the addition of 2.4-D, there was significant difference between Sulawesi 01 and 02. Cocoa embryogenic callus using the addition of 2.4-D (25%-100% was significantly different from control. Increased concentrations of 2,4-D hormone which is applied onto media would inhibit the formation of the somatic embryo. Addition of 2.4 D 25%, encouraged towards non-embryogenic callus. Keywords: 2.4 Dichlorophenoxy acetic acid, embryogenic callus, somatic embryos, cocoa, medium culture, hormone
Britto, Dahyana Santos; Pirovani, Carlos Priminho; Andrade, Bruno Silva; Dos Santos, Tassiara Pereira; Pungartnik, Cristina; Cascardo, Júlio Cezar M; Micheli, Fabienne; Gesteira, Abelmon S
2013-09-01
In this work, we identified a gene from Theobroma cacao L. genome and cDNA libraries, named TcGlu2, that encodes a β-1,3-1,4-glucanase. The TcGlu2 ORF was 720 bp in length and encoded a polypeptide of 239 amino acids with a molecular mass of 25.58 kDa. TcGlu2 contains a conserved domain characteristic of β-1,3-1,4-glucanases and presented high protein identity with β-1,3-1,4-glucanases from other plant species. Molecular modeling of TcGlu2 showed an active site of 13 amino acids typical of glucanase with β-1,3 and 1,4 action mode. The recombinant cDNA TcGlu2 obtained by heterologous expression in Escherichia coli and whose sequence was confirmed by mass spectrometry, has a molecular mass of about 22 kDa (with His-Tag) and showed antifungal activity against the fungus Moniliophthora perniciosa, causal agent of the witches' broom disease in cacao. The integrity of the hyphae membranes of M. perniciosa, incubated with protein TcGlu2, was analyzed with propidium iodide. After 1 h of incubation, a strong fluorescence emitted by the hyphae indicating the hydrolysis of the membrane by TcGlu2, was observed. To our knowledge, this is the first study of a cacao β-1,3-1,4-glucanase expression in heterologous system and the first analysis showing the antifungal activity of a β-1,3-1,4-glucanase, in particular against M. perniciosa.
Gattward, James N; Almeida, Alex-Alan F; Souza, José O; Gomes, Fábio P; Kronzucker, Herbert J
2012-11-01
In ecological setting, sodium (Na(+)) can be beneficial or toxic, depending on plant species and the Na(+) level in the soil. While its effects are more frequently studied at high saline levels, Na(+) has also been shown to be of potential benefit to some species at lower levels of supply, especially in C4 species. Here, clonal plants of the major tropical C3 crop Theobroma cacao (cacao) were grown in soil where potassium (K(+)) was partially replaced (at six levels, up to 50% replacement) by Na(+), at two concentrations (2.5 and 4.0 mmol(c) dm(-3)). At both concentrations, net photosynthesis per unit leaf area (A) increased more than twofold with increasing substitution of K(+) by Na(+). Concomitantly, instantaneous (A/E) and intrinsic (A/g(s)) water-use efficiency (WUE) more than doubled. Stomatal conductance (g(s)) and transpiration rate (E) exhibited a decline at 2.5 mmol dm(-3), but remained unchanged at 4 mmol dm(-3). Leaf nitrogen content was not impacted by Na(+) supplementation, whereas sulfur (S), calcium (Ca(2+)), magnesium (Mg(2+)) and zinc (Zn(2+)) contents were maximized at 2.5 mmol dm(-3) and intermediate (30-40%) replacement levels. Leaf K(+) did not decline significantly. In contrast, leaf Na(+) content increased steadily. The resultant elevated Na(+)/K(+) ratios in tissue correlated with increased, not decreased, plant performance. The results show that Na(+) can partially replace K(+) in the nutrition of clonal cacao, with significant beneficial effects on photosynthesis, WUE and mineral nutrition in this major perennial C3 crop. Copyright © Physiologia Plantarum 2012.
Directory of Open Access Journals (Sweden)
Faber de Jesús Chica-Toro
2018-01-01
Full Text Available El objetivo de este estudio se centró en la construcción de las curvas de absorción-extracción bajo un sistema aeropónico para D. grandiflorum cv. Atlantis White y así plantear los periodos de máxima y mínima acumulación de nutrientes de las biomasas aérea, radical y total. El ciclo vegetativo de la planta, medido desde el día de trasplante (ddt al sistema aeropónico y el día de inicio de corte, duró 49 días. Las evaluaciones se realizaron cada semana sobre plantas en competencia absoluta. Para el promedio de la biomasa aérea se tomaron tres repeticiones, para la biomasa radical se tomó una sola muestra. La biomasa total promedio alcanzada fue de 130.9313 g planta-1, de la cual el 72.26% (94.163 g correspondió a la parte aérea y el 27.74% (36.3183 g a la radical. A partir de contenidos de nutrientes reportados en los análisis de tejidos y las biomasas se calculan los nutrientes absorbidos-extraídos. En términos generales, se observan dos etapas en la absorción de nutrientes, una primera hasta el día 21 ddt y la segunda desde el día 22 hasta el día 49 ddt. Para los elementos reportados en este estudio (N, P, K, Ca, Mg y S; su acumulación durante la primera etapa no supero el 29%, excepto el S que llegó hasta el 30.19 %. En consecuencia, la mayor cantidad de nutrientes, cerca al 70%, fueron absorbidas en la segunda etapa de desarrollo, coincidente con la fase reproductiva de la planta.
Genetic and chemical diversity of Uncaria tomentosa (Willd. ex. Schult. DC. in the Brazilian Amazon.
Directory of Open Access Journals (Sweden)
Isabela Cristina Gomes Honório
Full Text Available Uncaria tomentosa (Willd. ex Schult. DC., a plant native to the Amazon region, is used widely in popular medicine and by the pharmaceutical industry because of its anti-inflammatory activity. However, the survival of this species is endangered by deforestation and indiscriminate collection, and a preservation plan is urgently required. The objectives of this study were to determine the genetic and chemical variability between and within eight populations of U. tomentosa from the Brazilian states of Acre, Pará and Amapá, and to investigate possible correlations between genetic and geographical distances, and between geographical distances or altitude and the accumulation of bioactive oxindole alkaloids. Three sequence-related amplified polymorphism (SRAP markers were employed to fingerprint genomic DNA, and the amounts of mitraphylline and isomitraphylline in leaf samples were established by high-performance liquid chromatography. Although significant divergence existed between the tested populations (FST = 0.246, the largest genetic diversity and the highest percentage of polymorphism (95.68% was found within the population from Mâncio Lima, Acre. Gene flow was considered rather limited (Nm = 1.57, and no correlations between genetic and geographical distances were detected, suggesting that population structure followed an island model. Accumulations of mitraphylline and isomitraphylline varied in the range 32.94 to 0.57 and 3.75 to 0.36 mg g-1 dry weight, respectively. The concentration of isomitraphylline was positively influenced by altitude, such that the population collected at the site with the highest elevation (Tarauacá, Acre exhibited the greatest alkaloid content. SRAP markers were very efficient in fingerprinting genomic DNA from U. tomentosa populations and clearly showed that genetic variability within populations was greater than between populations. A conservation and management plan should prioritize the creation of germplasm
Directory of Open Access Journals (Sweden)
Iván Andrés Delgado Vargas
2016-07-01
Full Text Available The carbon stored in radical biomass of Morella pubescens (Humb. & Bonpl. ex Willd. Wilbur, was quantified, in San Pablo, Nariño, Colombia, with height of 2010 m, average annual rainfall of 1300 mm and average temperature of 17ºC. Three experimental unites: silvopastoral system pasture alley cropping (Ac in two planting distances 4x3m and 4x4m, and natural regeneration system (Rn, 7 individual ware taken by experimental unite with (diameters 5 – 7 cm, by experimental unit, the sample was taken to 70 cm and 140 cm from the tree and three depths (0-15, 15-30, and 30-45 cm. In total 24 simples/trees were taken in 21 selected individuals. The mayor quantity of radical biomass and C stock was presented in the Ac arrangement 4x3 m of 27.6 t.ha-1 (14.1 t.C.ha-1; 24 4 t.ha-1 (12.1 t.C.ha-1 distance 4x4 m and 7.5 t.ha-1 and 2.9 t.ha-1In natural regeneration. In system Ac distance 4x4 m there were not differences in C stored by tree Rn, there was a decrease by 4x3 m, thus, the differences of accumulation between the systems, can obey to the density of the sowing.
Caamal-Herrera, Isabel O; Carrillo-Cocom, Leydi M; Escalante-Réndiz, Diana Y; Aráiz-Hernández, Diana; Azamar-Barrios, José A
2018-02-08
Ocimum micranthum Willd is a plant used in traditional medicine practiced in the region of the Yucatan peninsula. In particular, it is used for the treatment of cutaneous infections and wound healing, however there are currently no existing scientific studies that support these applications. The aim of the present study was to evaluate the antimicrobial and the in vitro proliferative activity (on healthy mammalian cell lines) of the essential oil and extracts (aqueous and ethanolic) of this plant. The minimal inhibitory concentration (MIC) of essential oil and aqueous and ethanolic extracts of Ocimum micranthum leaves against Staphylococcus aureus, Bacillus subtilis, Pseudomonas aeruginosa and Candida albicans was determined using the microdilution technique. The in vitro proliferative activity of human fibroblast (hFB) and Chinese hamster ovary (CHO-K1) cells treated with these extracts was evaluated using the MTT test. The hFB cell line was also evaluated using Trypan Blue assay. Candida albicans was more susceptible to the ethanolic extract and the aqueous extract (MIC value of 5 μL/mL and 80 μL/mL respectively). In the case of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa, the MIC of the aqueous and ethanolic extract was 125 μL/mL. The aqueous extract showed a significant (p essential oil and extracts of Ocimum micranthum leaves are sufficient to cause an antiproliferative effect on the hFB cell line but do not produce an antimicrobial effect against the microorganisms evaluated. More studies are necessary to improve understanding of the mechanism of action of the compounds implicated in the bioactivities shown by the crude extracts.
Chen, Hsiao-Ling; Lan, Xiang-Zhen; Wu, Yan-Yi; Ou, Yu-Wen; Chen, Tsung Chi; Wu, Wen-Tzu
2017-12-01
Most reports have indicated the antioxidant capacity of quinoa seeds. However, the leaves of Quinoa (Chenopodium quinoa Willd.) are usually worthless and little known about their biological activities. In this study, the antioxidant and immunomodulatory potential of the quinoa leaf extracts were explored. The crude leaf extracts of quinoa were extracted using water, 50% ethanol or 95% ethanol as solvent, denoted WQL, 50% EQL and 95% EQL, respectively. The antioxidant activities of quinoa leaf extracts were assessed by the ability of 1,1-diphenyl-2-picrylhydrazyl (DPPH) scavenging and iron chelating. The total phenolic content was determined. Inhibition of nitric oxide (NO) production in the lipopolysaccharide (LPS)-induced murine macrophage RAW 264.7 cells was examined to gauge the anti-inflammatory activity. The 95% EQL showed a higher level of total phenolic content (569.5 mg GAE/g extract) and better DPPH scavenging activity. The WQL exhibited a better iron chelating capacity (28.9% at 10 mg/ml). The iron chelating activity of the 95% EQL increased in a concentration-dependent manner, which ranged from 10.9% up to 53.9%. The 50% EQL and 95% EQL significantly inhibited NO production in the LPSstimulated RAW 264.7 cells. We demonstrate that the extracts of quinoa leaves possess the biological activities of antioxidant and anti-inflammatory. Our finding suggests that the leaf extract of quinoa has potential to be utilized for natural health products. © Author(s) 2017. This article is published with open access by China Medical University.
Zhang, Yufan; Smith, Philip; Maximova, Siela N; Guiltinan, Mark J
2015-01-01
Previous work has implicated glycerol-3-phosphate (G3P) as a mobile inducer of systemic immunity in plants. We tested the hypothesis that the exogenous application of glycerol as a foliar spray might enhance the disease resistance of Theobroma cacao through the modulation of endogenous G3P levels. We found that exogenous application of glycerol to cacao leaves over a period of 4 days increased the endogenous level of G3P and decreased the level of oleic acid (18:1). Reactive oxygen species (ROS) were produced (a marker of defence activation) and the expression of many pathogenesis-related genes was induced. Notably, the effects of glycerol application on G3P and 18:1 fatty acid content, and gene expression levels, in cacao leaves were dosage dependent. A 100 mm glycerol spray application was sufficient to stimulate the defence response without causing any observable damage, and resulted in a significantly decreased lesion formation by the cacao pathogen Phytophthora capsici; however, a 500 mm glycerol treatment led to chlorosis and cell death. The effects of glycerol treatment on the level of 18:1 and ROS were constrained to the locally treated leaves without affecting distal tissues. The mechanism of the glycerol-mediated defence response in cacao and its potential use as part of a sustainable farming system are discussed. © 2014 BSPP AND JOHN WILEY & SONS LTD.
Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães
2014-11-01
Witches' broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen's transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. © 2014 American Society of Plant Biologists. All rights reserved.
Helliwell, Emily E; Vega-Arreguín, Julio; Shi, Zi; Bailey, Bryan; Xiao, Shunyuan; Maximova, Siela N; Tyler, Brett M; Guiltinan, Mark J
2016-03-01
The internalization of some oomycete and fungal pathogen effectors into host plant cells has been reported to be blocked by proteins that bind to the effectors' cell entry receptor, phosphatidylinositol-3-phosphate (PI3P). This finding suggested a novel strategy for disease control by engineering plants to secrete PI3P-binding proteins. In this study, we tested this strategy using the chocolate tree Theobroma cacao. Transient expression and secretion of four different PI3P-binding proteins in detached leaves of T. cacao greatly reduced infection by two oomycete pathogens, Phytophthora tropicalis and Phytophthora palmivora, which cause black pod disease. Lesion size and pathogen growth were reduced by up to 85%. Resistance was not conferred by proteins lacking a secretory leader, by proteins with mutations in their PI3P-binding site, or by a secreted PI4P-binding protein. Stably transformed, transgenic T. cacao plants expressing two different PI3P-binding proteins showed substantially enhanced resistance to both P. tropicalis and P. palmivora, as well as to the fungal pathogen Colletotrichum theobromicola. These results demonstrate that secretion of PI3P-binding proteins is an effective way to increase disease resistance in T. cacao, and potentially in other plants, against a broad spectrum of pathogens. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.
Clément, D; Lanaud, C; Sabau, X; Fouet, O; Le Cunff, L; Ruiz, E; Risterucci, A M; Glaszmann, J C; Piffanelli, P
2004-05-01
We have constructed and validated the first cocoa ( Theobroma cacao L.) BAC library, with the aim of developing molecular resources to study the structure and evolution of the genome of this perennial crop. This library contains 36,864 clones with an average insert size of 120 kb, representing approximately ten haploid genome equivalents. It was constructed from the genotype Scavina-6 (Sca-6), a Forastero clone highly resistant to cocoa pathogens and a parent of existing mapping populations. Validation of the BAC library was carried out with a set of 13 genetically-anchored single copy and one duplicated markers. An average of nine BAC clones per probe was identified, giving an initial experimental estimation of the genome coverage represented in the library. Screening of the library with a set of resistance gene analogues (RGAs), previously mapped in cocoa and co-localizing with QTL for resistance to Phytophthora traits, confirmed at the physical level the tight clustering of RGAs in the cocoa genome and provided the first insights into the relationships between genetic and physical distances in the cocoa genome. This library represents an available BAC resource for structural genomic studies or map-based cloning of genes corresponding to important QTLs for agronomic traits such as resistance genes to major cocoa pathogens like Phytophthora spp ( palmivora and megakarya), Crinipellis perniciosa and Moniliophthora roreri.
Bertolde, Fabiana Z; Almeida, Alex-Alan F; Pirovani, Carlos P
2014-01-01
Soil flooding causes changes in gene transcription, synthesis and degradation of proteins and cell metabolism. The main objective of this study was to understand the biological events of Theobroma cacao during soil flooding-induced stress, using the analyses of gene expression and activity of key enzymes involved in fermentation, as well as the identification of differentially expressed proteins by mass spectrometry in two contrasting genotypes for flooding tolerance (tolerant - TSA-792 and susceptible - TSH-774). Soil anoxia caused by flooding has led to changes in the expression pattern of genes associated with the biosynthesis of alcohol dehydrogenase (ADH), pyruvate decarboxylase (PDC) and lactate dehydrogenase (LDH) in leaves and roots of the two evaluated genotypes. Significant differences were observed between the enzyme activities of the two genotypes. Leaves and roots of the TSA-792 genotype showed higher ADH activity as compared to the TSH-774 genotype, whereas the activities of PDC and LDH have varied over the 96 h of soil flooding, being higher for TSA-792 genotype, at the initial stage, and TSH-774 genotype, at the final stage. Some of the identified proteins are those typical of the anaerobic metabolism-involved in glycolysis and alcoholic fermentation-and different proteins associated with photosynthesis, protein metabolism and oxidative stress. The ability to maintain glycolysis and induce fermentation was observed to play an important role in anoxia tolerance in cacao and may also serve to distinguish tolerant and susceptible genotypes in relation to this stressor.
Souza, Vânia L; de Almeida, Alex-Alan F; Souza, Jadiel de S; Mangabeira, Pedro A O; de Jesus, Raildo M; Pirovani, Carlos P; Ahnert, Dário; Baligar, Virupax C; Loguercio, Leandro L
2014-01-01
Seedlings of Theobroma cacao CCN 51 genotype were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16, and 32 mg Cu L(-1)) in nutrient solution. When doses were equal or higher than 8 mg Cu L(-1), after 24 h of treatment application, leaf gas exchange was highly affected and changes in chloroplasts thylakoids of leaf mesophyll cells and plasmolysis of cells from the root cortical region were observed. In addition, cell membranes of roots and leaves were damaged. In leaves, 96 h after treatments started, increases in the percentage of electrolyte leakage through membranes were observed with increases of Cu in the nutrient solution. Moreover, there was an increase in the concentration of thiobarbituric acid-reactive substances in roots due to lipid peroxidation of membranes. Chemical analysis showed that increases in Cu concentrations in vegetative organs of T. cacao increased with the increase of the metal in the nutrient solution, but there was a greater accumulation of Cu in roots than in shoots. The excess of Cu interfered in the levels of Mn, Zn, Fe, Mg, K, and Ca in different organs of T. cacao. Analysis of gene expression via RTq-PCR showed increased levels of MT2b, SODCyt, and PER-1 expression in roots and of MT2b, PSBA, PSBO, SODCyt, and SODChI in leaves. Hence, it was concluded that Cu in nutrient solution at doses equal or above 8 mg L(-1) significantly affected leaf gas exchange, cell ultrastructure, and transport of mineral nutrients in seedlings of this T. cacao genotype.
Directory of Open Access Journals (Sweden)
Jorge Antonio Freile Almeida
2018-01-01
Full Text Available El objetivo de la presente investigación fue analizar la relación de los microorganismos del suelo y las principales enfermedades que afectan los clones promisorios de cacao (Theobroma cacao L. en la Amazonía Ecuatoriana. Se evaluaron los clones EET-95, EET-96, EET-103 y CCN-51, respectivamente, éste último utilizado como control, para ello, se determinó la cantidad de bacterias, hongos y actinomicetos totales, expresados en unidades formadoras de colonias (UFC por gramo de suelo, presentes en la rizósfera de los tres clones de cacao, así como la aparición de las principales enfermedades que atacan al cultivo del cacao. Los datos fueron analizados estadísticamente mediante ANOVA de un factor y prueba HSD de Tukey p≤0,05. Las bacterias fueron los microorganismos de mayor asociación a los clones en este estudio, seguido de actinomicetos y hongos. El clon CCN-51 presentó la mayor cantidad de bacterias, los clones EET-96 y EET-103, presentaron mayor incidencia de actinomicetos y el clon EET-103, la mayor presencia de hongos. La enfermedad escoba de bruja, cuyo agente causal es Cripinellis perniciosa Sthael Singer., afectó en menor medida a los clones EET-103 y CCN-51, mientras que la moniliasis causada por el hongo Moniliophthora roreri (Cif & Par Evans et al., puso en evidencia al clon EET-103 con la mayor incidencia de esta enfermedad y conversivamente al clon CCN-51 con la menor incidencia del patógeno.
Caracterização genética de mulungu (Erythrina velutina Willd. em áreas de baixa ocorrência
Directory of Open Access Journals (Sweden)
Luciana Oliveira Gonçalves
Full Text Available A Erythrina velutina Willd., popularmente conhecida como mulungu, apresenta propriedades farmacológicas e se encontra em estado de raridade em regiões do Estado de Sergipe. Devido ao interesse econômico, torna-se fundamental gerar informações para definir planos de conservação e exploração sustentável. Este trabalho teve como objetivo caracterizar os indivíduos de Erythrina velutina por meio de marcadores ISSRs. Para isto foram estudados 40 indivíduos do Estado de Sergipe pertencentes a três localidades (Município de Pinhão - Caatinga; Município de Santana do São Francisco e São Cristóvão - Mata Atlântica. Ao total, foram avaliados e obtidos 149 locos a partir de 11 primers ISSR. O número mínimo de locos para estudo de diversidade em E. velutina foi de 117 de acordo com o valor do estresse de Kruskal. Na população de Santana ocorre estruturação genética espacial e a população de Pinhão não possui estruturação genética espacial, seus indivíduos estão distribuídos de forma aleatória o que compromete a sustentabilidade ao longo do tempo, e, portanto, requer ações imediatas de conservação e recuperação.
International Nuclear Information System (INIS)
Rafi, H.; Dawar, S.; Zaki, M.J.
2015-01-01
Seed priming with plant extracts and chemicals has been used as an important growth enhancement tool in crop plants. In this research, an attempt was made to understand the mechanism of various seed priming treatments on greenhouse-grown okra (Abelmoschus esculentus (L.) Moench.), sunflower (Helianthus annuus L.), peanut (Arachis hypogaea L.) and chickpea (Cicer arietinum L.) for the control of root infecting fungi like Rhizoctonia solani (Kn), Fusarium spp. and Macrophomina phaseolina (Tassi) Goid by plant parts extracts (stem, leaves and seeds) of Acacia nilotica (L.) Willd. ex Delile and Sapindus mukorossi (L) at different time intervals (5, 10, 20, 40 minutes). Results showed significant suppression of root rot fungi and significantly enhanced the growth parameters like shoot length, root length, shoot weight and root weight. Seed-priming with A. nilotica and S. mukorossi leaves extract for 10 minutes time interval was found to be effective for the control of root rot fungi and growth of all tested leguminous and non-leguminous plants. (author)
Seed size effects on the response of seedlings of Acacia asak (Forssk.) Willd to water stress
International Nuclear Information System (INIS)
El Atta, H.A.; Areef, I.M.; Ahmed, A.I.
2016-01-01
Dry tropical forests are characterized by unpredictable spells of drought and climate change. Saudi Arabia mostly falls within the arid zone and some few scattered areas fall in the semiarid zone mainly in the South Western region. Rainfall is sparse and with sporadic distribution. Drought is the most critical factor for restoration of the tree cover. Within a tree, seeds vary in size from large to small seeds. Although several researchers have studied the effect of within species variation in seed size on seedlings growth parameters, however there is a lack of knowledge regarding the effect of seed size on stress tolerance (Khurana and Singh 2000). We assumed that seedlings grown from different seed sizes from the same tree species may influence their response to water stress. Seeds of Acacia asak (Forssk.) Willd. were categorized into large, medium and small seeds on the basis of the seed weight. Seedlings from the three seed sizes were grown in potted soil and subjected to 5 levels of field water capacity (FC) (100, 75, 50, 25 and 15 percent) in the greenhouse. The Objective was to evaluate the response of seedling grown (from different seed sizes) to water stress and to understand the acclimation of seedlings to water stress. Water stress significantly reduced RWC, leaf area, and shoot length, fresh and dry weight. Significant correlations between growth parameters and water stress level were recorded. Seedlings from large seeds were heavier and comparatively less affected by drought compared to seedlings from smaller seeds. In all seedlings root length increased significantly and more biomass was allocated to roots than to shoots. However, at severe water stress (15 percent FC) no significant differences were reported between the three seedling categories. Therefore, raising of seedlings from large seeds is more appropriate for tree restoration programs under drought conditions. (author)
Morales, Andrea; Zurita-Silva, Andres; Maldonado, Jonathan; Silva, Herman
2017-01-01
HIGHLIGHTS R49 genotype displayed best performance on selected physiological parameters and highest tolerance to drought.R49 drought over-represented transcripts has exhibited 19% of genes (306 contigs) that presented no homology to published databases.Expression pattern for canonical responses to drought such as ABA biosynthesis and other genes induced in response to drought were assessed by qPCR. Global freshwater shortage is one of the biggest challenges of our time, often associated to misuse, increased consumption demands and the effects of climate change, paralleled with the desertification of vast areas. Chenopodium quinoa (Willd.) represents a very promising species, due to both nutritional content and cultivation under water constraint. We characterized drought tolerance of three Chilean genotypes and selected Genotype R49 (Salares ecotype) based upon Relative Water Content (RWC), Electrolyte Leakage (EL) and maximum efficiency of photosystem II (F v /F m ) after drought treatment, when compared to another two genotypes. Exploratory RNA-Seq of R49 was generated by Illumina paired-ends method comparing drought and control irrigation conditions. We obtained 104.8 million reads, with 54 million reads for control condition and 51 million reads for drought condition. Reads were assembled in 150,952 contigs, were 31,523 contigs have a reading frame of at least 300 nucleotides (100 aminoacids). BLAST2GO annotation showed a 15% of genes without homology to NCBI proteins, but increased to 19% (306 contigs) when focused into drought-induced genes. Expression pattern for canonical drought responses such as ABA biosynthesis and other genes induced were assessed by qPCR, suggesting novelty of R49 drought responses.
Pod Characteristics of cocoa (Theobroma cacao L. related to rocoa pod borer resistance.
Directory of Open Access Journals (Sweden)
Agung Wahyu Susilo
2015-04-01
Full Text Available The characteristics of cocoa (Theobroma cacao L. pod related to cocoa pod borer resistance (CPB had been identified in a series of study. The objective of this research is to evaluate the characteristics of cocoa pod using more diverse of genetic background to obtain selection criteria. Genetic materials for this studywere 25 cocoa clones planted in Central Sulawesi for resistance evaluation. Field evaluation of the resistance were assessed by using variable of the percentage of unextractable beans, number of larvae entry and exit holes by which the clones were grouped into 5 groups of resistance. A laboratory works were carried out to assess pod characteristics based on the number of trichomes, granules of tannin and thickness the lignified-tissue of sclerotic layer using micro-technique method at the different level of pod maturity (3.0; 3.5; 4.0 months. Correlation between groups of those variables was analyzed using canonical correlation. The result performed a positive association between the thickness of sclerotic layer at the secondary furrow with the number of entry holes and the number of entry holes through sclerotic layer. The thickness performed a higher value of the coefficient in association with the variables of canonical for pod characteristics 0.59; 0.55; 0.43 and the variables of canonical correlation for CPB resistance 0.54; 0.51; 0.39 that would presenting the characteristics of pod related to CPB resistance in 3.0, 3.5 and 4.0 months of pod maturity. Lignification at sclerotic layer was considered as genotypic expressions due to the thickness at the secondary furrow at 3.0, 3.5 and 4.0 months of pod maturity performed high value of broad-sense heritability i.e. 0.75, 0.89 and 0.92 respectively. A qualitative assessment of the lignification clearly differentiated the resistant clones of ARDACIAR 10 with the susceptible clones of ICCRI 04, KW 516, and KW 564.
Directory of Open Access Journals (Sweden)
J. S. Flores-Ruvalcaba
2005-01-01
Full Text Available En México, el crisantemo [Dendranthema x grandiflorum (Ramat Kitamura cv. Polaris White] es uno de los cultivos ornamentales que presentan la mayor superficie cultivada. Sin embargo, se desconocen sus requerimientos nutrimentales en condiciones hidropónicas, constituyendo lo anterior una mayor limitante al utilizar una alta densidad de población. Por consiguiente, se evaluó el efecto de la presión osmótica de la solución nutritiva (0.018, 0.027, 0.036 y 0.045 MPa sobre el crecimiento y floración del crisantemo, utilizando un sistema hidropónico por subrriego, en macetas con ocho plantas, equivalente a una densidad de 156.6 plantas·m-2, manejadas a un tallo por planta y una flor por tallo bajo cubierta plástica. Se concluyó que con 0.036 y 0.045 MPa de presión osmótica en la solución nutritiva, se obtiene la mayor expresión de las variables del crecimiento (altura de planta: 110 a 115 cm; diámetro de tallo: 0.6 a 0.63 cm; entrenudos por planta: 33; área foliar: 730 a 790 cm2; diámetro de inflorescencia: 11.4 cm y calidad de la flor (diámetro de la coloración amarilla central de inflorescencia: 6.5 cm con 0.036 MPa; intensidad de la coloración citada anteriormente y periodo de vida en florero: 7.3 y 17 días con 0.045 MPa, respectivamente. También, conforme se incrementó la presión osmótica de la solución nutritiva, disminuyó el periodo de trasplante a corte del cultivo (90 y 84 días con 0.036 y 0.045 Mpa, respectivamente
Aldave Palacios, Gladis Josefina
2016-01-01
Estudia las variedades de cacao (Theobroma cacao L.) CCN-51 e ICS-6, procedentes del distrito de Uchiza, provincia de Tocache, departamento de San Martín, en Perú. Efectúa el tratamiento térmico de tostado a las temperaturas de 120 y 130 °C por 40 y 50 minutos, los nibs de cacao (granos de cacao tostados y pelados) son evaluados sensorialmente por seis jueces entrenados. La evaluación estadística mediante la prueba no paramétrica de Wilcoxon no halla diferencia significativa entre los tratami...
Directory of Open Access Journals (Sweden)
Chloe See Wei Tan
2014-12-01
Full Text Available An amphotericin B-containing (AmB solid lipid nanoparticulate drug delivery system intended for oral administration, comprised of bee’s wax and theobroma oil as lipid components was formulated with the aim to ascertain the location of AmB within the lipid matrix: (a a homogenous matrix; (b a drug-enriched shell; or (c a drug enriched core. Both the drug-loaded and drug-free nanoparticles were spherical with AmB contributing to an increase in both the z-average diameter (169 ± 1 to 222 ± 2 nm and zeta potential (40.8 ± 0.9 to 50.3 ± 1.0 mV of the nanoparticles. A maximum encapsulation efficiency of 21.4% ± 3.0%, corresponding to 10.7 ± 0.4 mg encapsulated AmB within the lipid matrix was observed. Surface analysis and electron microscopic imaging indicated that AmB was dispersed uniformly within the lipid matrix (option (a above and, therefore, this is the most suitable of the three models with regard to modeling the propensity for uptake by epithelia and release of AmB in lymph.
Directory of Open Access Journals (Sweden)
Hong-hui Xie
2016-10-01
Full Text Available Genetic diversity of 23 Lasiodiplodia theobromae isolates on Morus alba and 6 isolates on Agave sisalana in Guangxi province, China, was studied by using random amplified polymorphic DNA and inter-simple sequence repeat molecular markers. Results of two molecular markers showed that the average percentage of polymorphic loci of all isolates was more than 93%. Both dendrograms of two molecular markers showed obvious relationship between groups and the geographical locations where those strains were collected, among which, the 23 isolates on M. alba were divided into 4 populations and the 6 isolates on A. sisalana were separated as a independent population. The average genetic identity and genetic distance of 5 populations were 0.7215, 0.3284 and 0.7915, 0.2347, respectively, which indicated that the genetic identity was high and the genetic distance was short in the 5 populations. Average value of the gene diversity index (H and the Shannon’s information index (I of 29 isolates were significantly higher than 5 populations which showed that genetic diversity of those isolates was richer than the populations and the degree of genetic differentiation of the isolates was higher. The Gst and Nm of 29 isolates were 0.4411, 0.6335 and 0.4756, 0.5513, respectively, which showed that the genetic diversity was rich in those isolates.
Hariadi, Yuda; Marandon, Karl; Tian, Yu; Jacobsen, Sven-Erik; Shabala, Sergey
2011-01-01
Ionic and osmotic relations in quinoa (Chenopodium quinoa Willd.) were studied by exposing plants to six salinity levels (0-500 mM NaCl range) for 70 d. Salt stress was administered either by pre-mixing of the calculated amount of NaCl with the potting mix before seeds were planted or by the gradual increase of NaCl levels in the irrigation water. For both methods, the optimal plant growth and biomass was achieved between 100 mM and 200 mM NaCl, suggesting that quinoa possess a very efficient system to adjust osmotically for abrupt increases in NaCl stress. Up to 95% of osmotic adjustment in old leaves and between 80% and 85% of osmotic adjustment in young leaves was achieved by means of accumulation of inorganic ions (Na(+), K(+), and Cl(-)) at these NaCl levels, whilst the contribution of organic osmolytes was very limited. Consistently higher K(+) and lower Na(+) levels were found in young, as compared with old leaves, for all salinity treatments. The shoot sap K(+) progressively increased with increased salinity in old leaves; this is interpreted as evidence for the important role of free K(+) in leaf osmotic adjustment under saline conditions. A 5-fold increase in salinity level (from 100 mM to 500 mM) resulted in only a 50% increase in the sap Na(+) content, suggesting either a very strict control of xylem Na(+) loading or an efficient Na(+) removal from leaves. A very strong correlation between NaCl-induced K(+) and H(+) fluxes was observed in quinoa root, suggesting that a rapid NaCl-induced activation of H(+)-ATPase is needed to restore otherwise depolarized membrane potential and prevent further K(+) leak from the cytosol. Taken together, this work emphasizes the role of inorganic ions for osmotic adjustment in halophytes and calls for more in-depth studies of the mechanisms of vacuolar Na(+) sequestration, control of Na(+) and K(+) xylem loading, and their transport to the shoot.
Directory of Open Access Journals (Sweden)
Inês Angélica Cordeiro Gomes
2008-02-01
Full Text Available Diferenças na disponibilidade de radiação podem causar modificações na estrutura e função das folhas do cafeeiro, que podem responder de maneira diferencial à radiação por alterações morfológicas, anatômicas, de crescimento e na taxa fotossintética. O objetivo deste trabalho foi avaliar características morfofisiológicas de cafeeiros (Coffea arabica L. cv. "Oeiras" sombreados por acácia (Acacia mangium Willd. na época seca e chuvosa no sul de Minas Gerais. As maiores taxas fotossintéticas e maiores espessuras da epiderme adaxial foram observadas na estação chuvosa nas linhas de cafeeiros a pleno sol. O sombreamento influenciou em menor espessura das folhas e em espaços intercelulares maiores no tecido esponjoso. Foi também verificada mudança na forma dos cloroplastos, os quais apresentaram-se mais alongados em folhas de cafeeiros a pleno sol quando relacionados aos arborizados.Light availability is one of the most important environmental factors affecting leaf structure and functions in coffee plants that can respond differently to radiation by changes in leaf anatomy, morphology, growth and photosynthetic rate. The objective of this research was evaluate some morphophysiological aspects in leaves of coffee (Coffea arabica L. cv. 'Oeiras' cropped under shelter trees in the south of Minas Gerais during the rainy and dry season. The shade caused lower leaves thickness and higher intercellular spaces in spongious tissue. There was also verified a change in chloroplast shape, which showed more elongated in coffee tree kept at full sunlight in relation to that ones maintained on shading.
TcNPR3 from Theobroma cacao functions as a repressor of the pathogen defense response.
Shi, Zi; Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J
2013-12-06
Arabidopsis thaliana (Arabidopsis) NON-EXPRESSOR OF PR1 (NPR1) is a transcription coactivator that plays a central role in regulating the transcriptional response to plant pathogens. Developing flowers of homozygous npr3 mutants are dramatically more resistant to infection by the pathogenic bacterium Pseudomonas syringae, suggesting a role of NPR3 as a repressor of NPR1-mediated defense response with a novel role in flower development. We report here the characterization of a putative NPR3 gene from the tropical tree species Theobroma cacao (TcNPR3). Like in Arabidopsis, TcNPR3 was constitutively expressed across a wide range of tissue types and developmental stages but with some differences in relative levels compared to Arabidopsis. To test the function of TcNPR3, we performed transgenic complementation analysis by introducing a constitutively expressing putative TcNPR3 transgene into an Arabidopsis npr3 mutant. TcNPR3 expressing Arabidopsis plants were partially restored to the WT pathogen phenotype (immature flowers susceptible to bacterial infection). To test TcNPR3 function directly in cacao tissues, a synthetic microRNA targeting TcNPR3 mRNA was transiently expressed in cacao leaves using an Agrobacterium-infiltration method. TcNPR3 knock down leaf tissues were dramatically more resistance to infection with Phytophthora capsici in a leaf bioassay, showing smaller lesion sizes and reduced pathogen replication. We conclude that TcNPR3 functions similar to the Arabidopsis NPR3 gene in the regulation of the cacao defense response. Since TcNPR3 did not show a perfect complementation of the Arabidopsis NPR3 mutation, the possibility remains that other functions of TcNPR3 remain to be found. This novel knowledge can contribute to the breeding of resistant cacao varieties against pathogens through molecular markers based approaches or biotechnological strategies.
León-Roque, Noemí; Abderrahim, Mohamed; Nuñez-Alejos, Luis; Arribas, Silvia M; Condezo-Hoyos, Luis
2016-12-01
Several procedures are currently used to assess fermentation index (FI) of cocoa beans (Theobroma cacao L.) for quality control. However, all of them present several drawbacks. The aim of the present work was to develop and validate a simple image based quantitative procedure, using color measurement and artificial neural network (ANNs). ANN models based on color measurements were tested to predict fermentation index (FI) of fermented cocoa beans. The RGB values were measured from surface and center region of fermented beans in images obtained by camera and desktop scanner. The FI was defined as the ratio of total free amino acids in fermented versus non-fermented samples. The ANN model that included RGB color measurement of fermented cocoa surface and R/G ratio in cocoa bean of alkaline extracts was able to predict FI with no statistical difference compared with the experimental values. Performance of the ANN model was evaluated by the coefficient of determination, Bland-Altman plot and Passing-Bablok regression analyses. Moreover, in fermented beans, total sugar content and titratable acidity showed a similar pattern to the total free amino acid predicted through the color based ANN model. The results of the present work demonstrate that the proposed ANN model can be adopted as a low-cost and in situ procedure to predict FI in fermented cocoa beans through apps developed for mobile device. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Heny Rianawati
2015-09-01
Full Text Available Machining properties is one of the parameters to determine the quality of the wood. Tests on machining properties of wood are important to know the easiness level of workmanship as raw materials of furniture industry, construction wood and other wood products. This research was aimed at determining the difference of machining properties between timo wood (Timonius sericeus (Desf K. Schum. and kabesak wood (Acacia leucophloea (Roxb. Willd. from the village of Reknamo, Kupang district, East Nusa Tenggara. Testing procedures were based on ASTM D1666 including: planning, shaping, sanding, drilling and turning. The observation of qualities of the machining were done visually by calculating the percentage of defects that arise on the surface of the samples after the machining process, then the qualities were classified into five quality classes. The results showed that the machining properties of timo wood and kabesak wood were very good and belonging to the quality of class I. The significant difference between the machining properties of both the timbers is in the sanding properties, where the average free defect of sanding timo wood is 85% while kabesak wood is 84.5%. Both timo and kabesak wood are suitable as raw material, for the variety of furniture and molding products.
Acebo-Guerrero, Y; Hernández-Rodríguez, A; Vandeputte, O; Miguélez-Sierra, Y; Heydrich-Pérez, M; Ye, L; Cornelis, P; Bertin, P; El Jaziri, M
2015-10-01
To isolate and characterize rhizobacteria from Theobroma cacao with antagonistic activity against Phytophthora palmivora, the causal agent of the black pod rot, which is one of the most important diseases of T. cacao. Among 127 rhizobacteria isolated from cacao rhizosphere, three isolates (CP07, CP24 and CP30) identified as Pseudomonas chlororaphis, showed in vitro antagonistic activity against P. palmivora. Direct antagonism tested in cacao detached leaves revealed that the isolated rhizobacteria were able to reduce symptom severity upon infection with P. palmivora Mab1, with Ps. chlororaphis CP07 standing out as a potential biocontrol agent. Besides, reduced symptom severity on leaves was also observed in planta where cacao root system was pretreated with the isolated rhizobacteria followed by leaf infection with P. palmivora Mab1. The production of lytic enzymes, siderophores, biosurfactants and HCN, as well as the detection of genes encoding antibiotics, the formation of biofilm, and bacterial motility were also assessed for all three rhizobacterial strains. By using a mutant impaired in viscosin production, derived from CP07, it was found that this particular biosurfactant turned out to be crucial for both motility and biofilm formation, but not for the in vitro antagonism against Phytophthora, although it may contribute to the bioprotection of T. cacao. In the rhizosphere of T. cacao, there are rhizobacteria, such as Ps. chlororaphis, able to protect plants against P. palmivora. This study provides a theoretical basis for the potential use of Ps. chlororaphis CP07 as a biocontrol agent for the protection of cacao plants from P. palmivora infection. © 2015 The Society for Applied Microbiology.
International Nuclear Information System (INIS)
Sumbu, K.; Mars, J.A.; Gihwala, D.
2013-01-01
Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)
Energy Technology Data Exchange (ETDEWEB)
Sumbu, K. [Department of Chemistry, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa); Mars, J.A.; Gihwala, D. [Department of Biomedical Sciences, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa)
2013-07-01
Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)
Bolognesi, A; Polito, L; Olivieri, F; Valbonesi, P; Barbieri, L; Battelli, M G; Carusi, M V; Benvenuto, E; Del Vecchio Blanco, F; Di Maro, A; Parente, A; Di Loreto, M; Stirpe, F
1997-12-01
New single-chain (type 1) ribosome-inactivating proteins (RIPs) were isolated from the seeds of Basella rubra L. (two proteins) and from the leaves of Bougainvillea spectabilis Willd. (one protein). These RIPs inhibit protein synthesis both in a cell-free system, with an IC50 (concentration causing 50% inhibition) in the 10(-10) M range, and by various cell lines, with IC50S in the 10(-8)-10(-6) M range. All three RIPs released adenine not only from rat liver ribosomes but also from Escherichia coli rRNA, polyadenylic acid, herring sperm DNA, and artichoke mottled crinkle virus (AMCV) genomic RNA, thus being polynucleotide:adenosine glycosidases. The proteins from Basella rubra had toxicity to mice similar to that of most type 1 RIPs (Barbieri et al., 1993, Biochim Biophys Acta 1154: 237-282) with an LD50 (concentration that is 50% lethal) Bougainvillea spectabilis had an LD50 > 32 mg.kg-1. The N-terminal sequence of the two RIPs from Basella rubra had 80-93% identity, whereas it differed from the sequence of the RIP from Bougainvillea spectabilis. When tested with antibodies against various RIPs, the RIPs from Basella gave some cross-reactivity with sera against dianthin 32, and weak cross-reactivity with momordin I and momorcochin-S, whilst the RIP from Bougainvillea did not cross-react with any antiserum tested. An RIP from Basella rubra and one from Bougainvillea spectabilis were tested for antiviral activity, and both inhibited infection of Nicotiana benthamiana by AMCV.
Directory of Open Access Journals (Sweden)
JOÃO TAVARES CALIXTO JÚNIOR
2011-01-01
Full Text Available Mimosa tenuiflora (Willd. (jurema preta is a xerophytic species of the shrub-arboreal habit, indicative of secondary succession stage of recovery or progressive, widely disseminated by different caatinga physiognomies of northeastern Brazil, bringing great potential. For the few studies that address their environmental performance, this study aimed to investigate structural and ecological aspects of its population, based data in diameter and height, and characterize the spatial distribution pattern of this species in the study areas. The phytosociological survey was conducted in two areas with 2 and 80 hectares of caatinga at the Experimental Station of Embrapa Semiarid, Petrolina - PE. 10 units were plotted on a random sample measuring 8.0 x 40m, and included all individuals living in diameter at soil level K 3 cm, and measured the total height of the same. Were sampled 283 and 61 individuals in 100 and 80% of plots in areas I and II respectively, inserted mostly in the first diameter classes (3.0 - 6.0 cm and 6.1 - 9.0 cm and height (2.0 - 3.0 m and 3.1 - 4 m, without trend to standard reverse-J-shape in areas. The spatial distribution, measured by the Payandeh index, reached a value of 2.4 in area I and 7.8 in area II, indicating that the species has a aggregated distribution in both areas. The calculated values for the of Liocourt quotient in areas I and II respectively, got an average of 0.67 and 1.12 with great variation, showing unbalance, despite being in progressive process of natural regeneration.
Morphology and histochemistry of glandular trichomes of Orobanche alba Stephan ex Willd
Directory of Open Access Journals (Sweden)
Aneta Sulborska
2014-04-01
Full Text Available Orobanche alba Stephan ex Willd is an achlorophyllous root parasite rare in Poland. It prefers dry and sunny slopes, xerothermic grasslands and pastures, mountain pastures, light scrubs, and rock fissures and ledges. The hosts of O. alba include Thymus polytrichus A. ern. ex Borbás, Clinopodium vulgare L. and Origanum vulgare L. The tick and fleshy 10-70 cm high stem in this species bears an inflorescence composed of zygomorphic, white or yellow “spotted” flowers covered by purple glandular trichomes. Glandular trichomes of this type are also borne on other parts of the plant, i.e. on the stem, scaly leaves, sepals, filaments, and the style. The secondary metabolites secreted by the glandular trichomes are related to defense of plants against the attack of herbivores and pathogens or act as attractants to pollinators or for fruit dispersal. The micromorphology and histochemistry of the glandular trichomes in O. alba were examined using scanning electron and light microscopes. In order to determine the type of secondary metabolites produced by the trichomes, the flowing histochemical assays were used: Sudan III and neutral red for detection of lipophilic compounds, IKI for detection of starch, and FeCl3 for detection of phenolic compounds. The peltate glandular trichomes of O. alba were characterised by a varied length (0.15‑0.48 mm and different activity phases. The trichome was composed of one larger basal epidermal cell, 1-3 hyaline stalk cells with a striated cuticle, a neck cell with a smooth cuticle on the surface, and a globose head formed of 8-18 secretory cells arranged in a circle. Many stalk cells of the trichomes, particularly those located on the corolla, contained anthocyanins, which give the trichomes dark carmine colour. In turn, the colour of the heads was dependent on trichome age: the heads were brown in older trichomes and yellow in younger hairs. Secretion was produced by both young and older trichomes. It penetrated
Allegre, Mathilde; Argout, Xavier; Boccara, Michel; Fouet, Olivier; Roguet, Yolande; Bérard, Aurélie; Thévenin, Jean Marc; Chauveau, Aurélie; Rivallan, Ronan; Clement, Didier; Courtois, Brigitte; Gramacho, Karina; Boland-Augé, Anne; Tahi, Mathias; Umaharan, Pathmanathan; Brunel, Dominique; Lanaud, Claire
2012-01-01
Theobroma cacao is an economically important tree of several tropical countries. Its genetic improvement is essential to provide protection against major diseases and improve chocolate quality. We discovered and mapped new expressed sequence tag-single nucleotide polymorphism (EST-SNP) and simple sequence repeat (SSR) markers and constructed a high-density genetic map. By screening 149 650 ESTs, 5246 SNPs were detected in silico, of which 1536 corresponded to genes with a putative function, while 851 had a clear polymorphic pattern across a collection of genetic resources. In addition, 409 new SSR markers were detected on the Criollo genome. Lastly, 681 new EST-SNPs and 163 new SSRs were added to the pre-existing 418 co-dominant markers to construct a large consensus genetic map. This high-density map and the set of new genetic markers identified in this study are a milestone in cocoa genomics and for marker-assisted breeding. The data are available at http://tropgenedb.cirad.fr. PMID:22210604
Bastos, Valdeci S; Santos, Maria Fs; Gomes, Laidson P; Leite, Analy Mo; Flosi Paschoalin, Vânia M; Del Aguila, Eduardo M
2018-03-25
Cocoa bean fermentation is a spontaneous process involving a succession of microbial activities, yeasts, lactic acid, and acetic acid bacteria. The spontaneous fermentation of cocoa beans by Theobroma cacao TSH565 clonal variety, a highly productive hybrid resistant to Moniliophthora perniciosa and Phytophthora spp., was investigated. The natural cocobiota involved in the spontaneous fermentation of this hybrid in southern Brazil, was investigated by using both a culture-dependent microbiological analysis and a molecular analysis. The changes in the physicochemical characteristics and the kinetics of substrate utilization and metabolite production during fermentation were also evaluated. Yeasts (178) and bacteria (244) isolated during fermentation were identified by partial sequencing of the ITS and 16S rDNAs, respectively. After 144 h of fermentation, the indigenous yeast community was composed of Hanseniaspora spp., Saccharomyces spp., and Pichia spp. The bacterial population comprised Lactococcus spp., Staphylococcus spp., Acetobacter spp. and Lactobacilli strains. The kinetics of substrate transformation reflected the dynamic composition of the cocobiota. Substrates such as glucose, fructose, sucrose, and citric acid, present at the beginning of fermentation, were metabolized to produce ethanol, acetic acid, and lactic acid. The results described here provide new insights into microbial diversity in cocoa bean-pulp mass fermentation and the kinetics of metabolites synthesis, and pave the way for the selection of starter cultures to increase efficiency and consistency to obtain homogeneous and best quality cocoa products. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Adriana Zulay Argüello Navarro
2016-07-01
Full Text Available The objective of this research was to quantify diazotrophic bacteria and compare physicochemically rhizospheric soils of three cocoa plantations (Theobroma cacao L. in Norte de Santander Department, Colombia; for which they were characterized, differing in cultivated area, agronomic management and crop age. From serial dilutions of the samples and using the technique of Most Probable Number (MPN, In semisolid culture media (NFb, JMV, LGI, JNFb, the diazotrophs were quantified, evaluating as positive the formation of a subsurface film in the medium contained in sealed vials; equal samples were sent to the Bioambiental laboratory (UNET for physicochemical analyzes. As a result, the evaluated samples showed deficiencies in the percentage of organic matter and elements such as Potassium, Phosphorus and Magnesium. Statistically highly significant differences in MPN were reported. The highest quantification of diazotrophs was reported in the Florilandia farm, which was characterized by drip irrigation. The highest quantification of diazotrophs was recorded in the media NFb and JMV, demonstrating a greater presence of the presumed genera Azospirillum sp. and Burkholderia sp. which are easily isolated from rhizospheric soils, unlike the genera Herbaspirillum sp. and Gluconacetobacter sp. which by their endophytic character tend to be less predominant in this type of samples. It is also concluded that the physicochemical characteristics of the soil, humidity and climatic relationships at the moment of sampling, condition the amount of root exudates and therefore are factors that conditioned the presence of diazotrophs in the samples.
Directory of Open Access Journals (Sweden)
Danilla Cristina Lemos Souza
2014-12-01
Full Text Available Um dos grandes desafios para o sistema agropecuário é estabelecer a produção agrícola aliada à conservação dos recursos genéticos, principalmente visando à proteção de Áreas de Preservação Permanente. Nesse contexto, mulungu (Erythrina velutina Willd, entre outras espécies nativas, vem sofrendo com as pressões antrópicas nos mais diversos ecossistemas, o que causa reduções em sua base genética. Este trabalho foi realizado com o objetivo de utilizar parâmetros ecológicos e genéticos populacionais como indicadores de sustentabilidade em duas populações naturais de mulungu, situadas em áreas de floresta ciliar, no Estado de Sergipe, bem como avaliar a tendência à sustentabilidade delas, visando à conservação genética da espécie. Utilizou-se a matriz de Pressão-Estado-Impacto/Efeito-Resposta (PEI/ER com a seleção de 13 indicadores, a partir do uso de marcadores moleculares RAPD e bioquímicos (enzimas nas populações, de modo a apresentá-los como informações relevantes para medir o progresso quanto à sustentabilidade e conservação de mulungu. As populações estudadas apresentaram baixa tendência à sustentabilidade, necessitando de estratégias para mudança desse status.
Establecimiento in vitro y cultivo de células de la uña de gato (Uncaria tomentosa (Willd. D.C.
Directory of Open Access Journals (Sweden)
Silvana Alvarenga Venutolo
2010-12-01
Full Text Available La Uncaria tomentosa (Willd. D.C., (uñade gato es una liana del bosque tropical,que se distribuye en forma natural en lazona Atlántica de Costa Rica, a alturasmenores de 600 msnm. La infusión dela corteza de la raíz forma parte delacervo de la medicina tradicional deCosta Rica para aliviar diversas dolencias,como son: la gastritis, la artritis; además,funciona como fortificante del sistemainmunológico y, recientemente, para tratarel cáncer y el VIH.El cultivo in vitro sedesarrolló como una herramienta para lamicropropagación de plantas en la zonade Guápiles (Pococí, como estrategiade conservación para la explotacióncomercial sostenible de la especie. En esteartículo se describen los protocolos para elestablecimiento y la micropropagación apartir de microestacas, en un medio M & S(1962 con 2 mg/L de BA, 3% de sacarosay 7 g/L de agar; así como la germinaciónin vitro en el mismo medio M & S (1962semi sólido (1,8 g/L de Phyta-Gel.Se probó el cultivo en medio líquido, en jarrasfermentadoras y en sistemas de inmersióntemporal automatizado (RITA®, y fueefectivo el método de inmersión cada treshoras, durante tres minutos. Se describe elproceso de aclimatación, el crecimiento ydesarrollo de las vitroplantas.
Directory of Open Access Journals (Sweden)
Gilvanete Maria Ferreira
2008-06-01
Full Text Available O comportamento reológico da polpa de cupuaçu integral foi determinado na faixa de temperatura de 10 a 60ºC. Os efeitos da temperatura e da taxa de deformação foram avaliados por meio de testes em cisalhamento estacionário. As análises reológicas foram conduzidas num reômetro Thermo Haake RheoStress 1. Os reogramas foram descritos pelos modelos reológicos de Ostwald-de-Waelle e o de Herschel-Bulkley. As curvas de escoamento mais bem ajustadas pelo modelo de Ostwald-de-Waelle. O produto apresentou comportamento pseudoplástico, e o índice de comportamento de fluxo (n decresceu com o aumento da temperatura. O efeito da temperatura sobre a viscosidade aparente foi descrita por uma equação tipo Arrhenius e discutida em termos de energia de ativação. Essa energia aumentou com o aumento da taxa de deformação, sendo obtidos valores na faixa de 1 a 2 kcal/gmol.The rheological behavior of the entire cupuassu pulp was determined in the temperature range 10 - 60ºC. The effects of temperature and deformation rate were evaluated by means of shear flow tests. Rheometry analyses were conducted with a Thermo Haake RheoStress 1 system. Rheograms were described by models by Ostwald-of-Waelle and Herschel-Bulkley. The Ostwald-of-Waelle model successfully represented pulp flow behavior. The product presented shear-thinning behavior and the flow behavior index (n decreased with the increase of temperature. The effect of temperature on the apparent viscosity in cupuassu pulp was described by an Arrhenius equation and discussed in terms of activation energy. The increase in shear rate caused an energy increase, and values were obtained in the range of a line from 1 to 2 kcal/gmol.
Castro, Andressa V; de Almeida, Alex-Alan F; Pirovani, Carlos P; Reis, Graciele S M; Almeida, Nicolle M; Mangabeira, Pedro A O
2015-05-01
Seeds from Theobroma cacao progenies derived from the self-pollination of 'Catongo'×'Catongo' and the crossing between CCN-10×SCA-6 were immersed for 24h in different Cd solutions (2; 4; 8; 16 and 32 mgL(-1)) along with the control treatment (without Cd). Shortly after, the seeds were sown in plastic tubes containing organic substrate and were grown in a greenhouse for 60 days. The treatment with Cd was observed to cause morphological, biochemical, molecular and ultrastructural changes in both progenies of T. cacao. There has been deformation in chloroplasts, nuclear chromatin condensation, and reduction in thickness of the mesophyll. As for 'Catongo'×'Catongo', a decrease in thickness of the epidermis was noted on the abaxial face. There has been increased guaiacol peroxidase activity in the roots of CCN-10×SCA-6, as well as in the''Catongo'×'Catongo' leaves. In the presence of Cd, CCN-10×SCA-6 showed increased expression of the genes associated with the biosynthesis of phytochelatin (PCS-1) and class III peroxidases (PER-1) in leaves, and metallothionein (MT2b), in roots. In 'Catongo'×'Catongo', there has been an increase in the expression of genes associated with the biosynthesis of PER-1 and cytosolic superoxide dismutase dependent on copper and zinc (Cu-Zn SODCyt) in leaves and from MT2b and PCS-1 and roots. There was higher accumulation of Cd in the aerial parts of seedlings from both progenies, whereas the most pronounced accumulation was seen in''Catongo'×'Catongo'. The increase in Cd concentration has led to lower Zn and Fe levels in both progenies. Hence, one may conclude that the different survival strategies used by CCN-10×SCA-6 made such progeny more tolerant to Cd stress when compared to''Catongo'×'Catongo'. Copyright © 2015. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Jaime Morante-Carriel
2017-12-01
Full Text Available En Ecuador, las plantaciones de cacao presentan bajos promedios de producción debido a la diversidad de patógenos, especialmente a la infección por Moniliophthora roreri (monilia. Se cree que existe una relación entre el ataque del hongo y el aumento de los niveles de expresión de genes codificantes de polifenol oxidasas (PPOs como mecanismo de defensa ante patógenos y herbívoros en diferentes plantas. Para la identificación de genes que codifican para PPOs, se seleccionaron hojas de cacao Nacional, provenientes de plantas resistentes y susceptibles a monilia, ubicadas en la Finca Experimental La Represa, propiedad de la Universidad Técnica Estatal de Quevedo. Se afinó un protocolo de extracción de ARN total de alta calidad para hojas de cacao recalcitrantes. Después de su retrotranscripción a ADNc, se realizaron ensayos de amplificación por PCR con diferentes primers, diseñados a partir de secuencias conservadas de PPOs. Los productos de amplificación permitieron la identificación de un gen de 961 pb, similar a un gen que codifica para la PPO predictiva de Theobroma cacao depositada en NCBI (XP_017978715.1 La identificación de este gen, es fundamental para evaluar a futuro los niveles de expresión y cuantificación en diferentes estados de desarrollo del fruto. Dicha cuantificación permitirá proponer herramientas de control para monilia y construir las bases para el mejoramiento genético del cacao Nacional.
Zeng, Huawu; Locatelli, Monica; Bardelli, Claudio; Amoruso, Angela; Coisson, Jean Daniel; Travaglia, Fabiano; Arlorio, Marco; Brunelleschi, Sandra
2011-05-25
There is a great interest in the potential health benefits of biologically active phenolic compounds in cocoa (Theobroma cacao) and dark chocolate. We investigated the anti-inflammatory potential of clovamide (a N-phenylpropenoyl-L-amino acid amide present in cocoa beans) and two phenolic extracts from unroasted and roasted cocoa beans, by evaluating superoxide anion (O(2)(-)) production, cytokine release, and NF-κB activation in human monocytes stimulated by phorbol 12-myristate 13-acetate (PMA). The effects of rosmarinic acid are shown for comparison. Clovamide and rosmarinic acid inhibited PMA-induced O(2)(-) production and cytokine release (with a bell-shaped curve and maximal inhibition at 10-100 nM), as well as PMA-induced NF-κB activation; the two cocoa extracts were less effective. In all tests, clovamide was the most potent compound and also enhanced peroxisome proliferator-activated receptor-γ (PPARγ) activity, which may exert anti-inflammatory effects. These findings indicate clovamide as a possible bioactive compound with anti-inflammatory activity in human cells.
Fister, Andrew S; Landherr, Lena; Maximova, Siela N; Guiltinan, Mark J
2018-01-01
Theobroma cacao , the source of cocoa, suffers significant losses to a variety of pathogens resulting in reduced incomes for millions of farmers in developing countries. Development of disease resistant cacao varieties is an essential strategy to combat this threat, but is limited by sources of genetic resistance and the slow generation time of this tropical tree crop. In this study, we present the first application of genome editing technology in cacao, using Agrobacterium-mediated transient transformation to introduce CRISPR/Cas9 components into cacao leaves and cotyledon cells. As a first proof of concept, we targeted the cacao Non-Expressor of Pathogenesis-Related 3 (TcNPR3) gene, a suppressor of the defense response. After demonstrating activity of designed single-guide RNAs (sgRNA) in vitro , we used Agrobacterium to introduce a CRISPR/Cas9 system into leaf tissue, and identified the presence of deletions in 27% of TcNPR3 copies in the treated tissues. The edited tissue exhibited an increased resistance to infection with the cacao pathogen Phytophthora tropicalis and elevated expression of downstream defense genes. Analysis of off-target mutagenesis in sequences similar to sgRNA target sites using high-throughput sequencing did not reveal mutations above background sequencing error rates. These results confirm the function of NPR3 as a repressor of the cacao immune system and demonstrate the application of CRISPR/Cas9 as a powerful functional genomics tool for cacao. Several stably transformed and genome edited somatic embryos were obtained via Agrobacterium -mediated transformation, and ongoing work will test the effectiveness of this approach at a whole plant level.
Scoccianti, Valeria; Bucchini, Anahi E; Iacobucci, Marta; Ruiz, Karina B; Biondi, Stefania
2016-11-01
Quinoa (Chenopodium quinoa Willd), an ancient Andean seed crop, exhibits exceptional nutritional properties and resistance to abiotic stress. The species' tolerance to heavy metals has, however, not yet been investigated nor its ability to take up and translocate chromium (Cr). This study aimed to investigate the metabolic adjustments occurring upon exposure of quinoa to several concentrations (0.01-5mM) of CrCl3. Young hydroponically grown plants were used to evaluate Cr uptake, growth, oxidative stress, and other biochemical parameters three and/or seven days after treatment. Leaves accumulated the lowest amounts of Cr, while roots and stems accumulated the most at low and at high metal concentrations, respectively. Fresh weight and photosynthetic pigments were reduced only by the higher Cr(III) doses. Substantially increased lipid peroxidation, hydrogen peroxide, and proline levels were observed only with 5mM Cr(III). Except for a significant decrease at day 7 with 5mM Cr(III), total polyphenols and flavonoids maintained control levels in Cr(III)-treated plants, whereas antioxidant activity increased in a dose-dependent manner. Maximum polyamine accumulation was observed in 1mM CrCl3-treated plants. Even though α- and γ-tocopherols also showed enhanced levels only with the 1mM concentration, tyrosine aminotransferase (TAT, EC 2.6.1.5) activity increased under Cr(III) treatment in a dose- and time-dependent manner. Taken together, results suggest that polyamines, tocopherols, and TAT activity could contribute to tolerance to 1mM Cr(III), but not to the highest concentration that, instead, generated oxidative stress. Copyright © 2016 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Maura N. Laus
2017-03-01
Full Text Available Antioxidant capacity (AC of quinoa (Chenopodium quinoa Willd. cv. Real seeds and sprouts obtained after 4 days of seed germination at 20°C and 70% humidity was evaluated using trolox equivalent antioxidant capacity (TEAC and oxygen radical absorbance capacity (ORAC assays, able to highlight reducing activity and peroxyl radical scavenging capacity, respectively; phenolic content (PC was also measured. Both TEAC and ORAC assays revealed a significantly higher (about 2- and 2.8-fold, respectively AC of 4-day-old sprouts compared to seeds; consistently, also PC values of sprouts resulted about 2.6 times higher than seeds. In order to investigate the influence of storage on AC and PC, as well as on vitamin C content (VCC, 4-day-old sprouts were subjected for 7 days at 5°C to three different conditions of controlled atmosphere storage (CAS compared with air. Interestingly, whatever the CAS conditions, storage of quinoa sprouts up to 7 days induced an increase of AC evaluated in terms of reducing activity by TEAC assay. Consistently, an increase of PC and VCC was measured during storage, positively correlated to TEAC values. Moreover, a decrease of peroxyl radical scavenging activity, measured by ORAC, was observed after 7 days of storage, in accordance with a shift of AC towards the reducing activity component. Overall, these findings indicate that sprouting approach using quinoa may provide highly antioxidant-enriched seedlings that may improve nutritional quality of diet or of functional foods. Interestingly, antioxidant properties of quinoa sprouts may be deeply influenced by storage, able to increase reducing activity by increasing phenols and vitamin C.
Análise florística e estrutural de sistemas silviagrícolas em Tomé-Açu, Pará
Directory of Open Access Journals (Sweden)
Édson Luis Bolfe
2011-10-01
Full Text Available O objetivo deste trabalho foi analisar a composição florística e estrutural de sistemas silviagrícolas em Tomé-Açu, Pará. Os dados dendrométricos foram obtidos por inventário em 40 parcelas amostrais, com três unidades cada uma, no total de 120 unidades de 10x10 m. Foi inventariada a média de 1.424,3 indivíduos por hectare, pertencentes a 27 famílias e a 54 espécies. Tendo-se considerado a variabilidade dos estágios vegetativos, os diferentes sistemas silviagrícolas (SAF foram divididos em quatro classes hierárquicas: SAF 1, SAF 2, SAF 3, e SAF 4, para estabelecer um sistema de classificação passível de ser utilizado em outras avaliações de campo e em classificações digitais por meio do sensoriamento remoto. Espécies observadas em outros sistemas da região amazônica também foram relevantes para este estudo, especialmente Theobroma cacao, T. grandiflorum e Euterpe oleracea que, juntas, apresentaram médias de frequência relativa de 51%, densidade relativa de 69,2%, dominância relativa de 50,1% e índice de valor de importância de 56,8%. Os dados médios de diversidade florística, abundância, área basal e valor de importância indicam os sistemas silviagrícolas da região de Tomé-Açu como sistemas de produção com potencial econômico e ambiental, se adotado manejo adequado e racional.
Energy Technology Data Exchange (ETDEWEB)
Fernandez V, S O
1997-12-31
The saponins and total lipids was measured in the variants of Barandales and Isluga of Chenopodium quinoa Willd and the mutants of both variants in the M{sub 2} lineage. These two variants were gamma radiated at different levels: 0, 50, 100, 150, 200, 250, 300, 350, 400 and 500 Gy in the M1 generation. At the same time the mutants with favorable agronomic characteristics were selected. The samples were growth on the field (cultivated) and the seeds were recovered (harvested), measuring the emergence agronomic variables, plant height, density and seed yield. Lipids totals and saponins were measured in the seeds. The samples of radiated seeds with gamma-ray at different levels, were dried and grinded until to obtain a powder. The lipids was extracted with diethyl-ether, and in this solution was measured the total lipid content. The saponins were extracted in a later step, concentrated and precipitated. After the precipitation step the sapogenins were hydrolized and extracted with methyl alcohol. The extracts were centifugated and the solid material was dried and weighted. Finally, the measurement of the oleanolic acid was carried out by high pressure liquid chromatography. One conversion factor permits to relate this acid with the total saponin content. (Author).
Directory of Open Access Journals (Sweden)
Lazaro Benedito da Silva
2011-06-01
Full Text Available Pela importância econômica da madeira de algumas espécies do gênero Mimosa L. ocorrentes na caatinga nordestina e pelo fato de Mimosa ophthalmocentra Mart. ex Benth. (jurema-de-imbira, às vezes, ser confundida com Mimosa tenuiflora (Willd. Poir. (jurema-preta ou vice-versa, este trabalho objetivou apresentar novos dados referentes à anatomia e densidade básica da madeira das duas espécies, visando oferecer subsídio para identificação das duas espécies, identificar caracteres anatômicos da madeira relacionando-os com o ambiente caatinga e apresentar o potencial energético que sua madeira possui. O estudo anatômico e a determinação da densidade da madeira foram realizados com amostras ao nível do peito (1,30 m acima do solo e em dois galhos com diferentes diâmetros, de espécimes ocorrentes nos municípios de Serra Talhada e Sertânia, Pernambuco, Brasil. As espécies apresentam distinção expressa através do tipo de casca, coloração do cerne e do alburno, além das características peculiares da madeira. Mimosa ophthalmocentra apresenta camadas de crescimento distintas, constituídas por linhas de parênquima axial contendo cristais, parênquima axial escasso e menor quantidade de raios por mm². Já Mimosa tenuiflora apresenta camadas de crescimento distintas, porém sem cristais, parênquima axial vasicêntrico, em faixas ou aliforme confluente, e maior percentagem de raios. Ambas apresentam algumas estruturas da madeira com as características anatômicas comuns às diversas espécies do gênero Mimosa, contribuindo assim para uma melhor caracterização do gênero. Pelos parâmetros anatômicos da madeira e pela elevada densidade básica (>0,84 g/cm³, concluiu-se que as duas espécies apresentam perspectivas seguras para a produção de álcool combustível e carvão vegetal desde a fase de lenho juvenil. Mimosa ophthalmocentra apresenta maior potencial energético, pela maior percentagem de fibras e por possuir par
Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães
2014-01-01
Witches’ broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen’s transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. PMID:25371547
Fate of 15N-labelled urea as affected by organic amendments and oils applied to rice
International Nuclear Information System (INIS)
Singh, G.R.; Singh, T.A.
1987-01-01
The present study was undertaken to explore the possibility of using 2 organic compounds (p-benzoquinone and catechol), 2 oils (neem oil (Azadirachta indica A. Juss) and linseed oil (Linum usitatissimum Linn.) oil) and 3 polyphenolic plant residues, viz. catechu (Acacia catechu (L.f.) Willd.), babul acacia (Acacia nilotica (Linn.) Willd. ex Del. sub.indica (Benth.) Brenan, syn. A. arabica (Lamk.) Willd.) and yellow myrobalan (Terminalia chebula Retz.) when applied with 15 N-tagged urea to observe their effectiveness in decreasing N losses. (author). 8 refs
Yim, Nam-Hui; Hwang, Youn-Hwan; Liang, Chun; Ma, Jin Yeul
2016-12-24
The root of Platycodon grandiflorum (PG), commonly known as Kilkyong in Korea, Jiegeng in China, and Kikyo in Japan, has been extensively used as a traditional anti-inflammatory medicine in Asia for the treatment of respiratory conditions, such as bronchitis, asthma, and tonsillitis. Platycosides isolated from PG are especially well-known for their anti-cancer effects. We investigated the involvement of autophagic cell death and other potential molecular mechanisms induced by the platycoside-containing butanol fraction of PG (PGB) in human lung carcinoma cells. PGB-induced growth inhibition and cell death were measured using a 5-diphenyl-tetrazolium bromide (MTT) assay. The effects of PGB on autophagy were determined by observing microtubule-associated protein 1 light chain 3 (LC3) redistribution with confocal microscopy. The PGB-mediated regulation of autophagy-associated proteins was investigated using Western blotting analysis. Furthermore, the anti-cancer mechanism of PGB was confirmed using chemical inhibitors. A high-performance liquid chromatography (HPLC)-DAD system was used to analyze the platycosides in PGB. In A549 cells, PGB induced significant autophagic cell death. Specifically, PGB upregulated LC3-II in a time- and dose-dependent manner, and it redistributed LC3 via autophagosome formation in the cytoplasm. PGB treatment increased the phosphorylation of AMP-activated protein kinase (AMPK) and subsequently suppressed the AKT/mammalian target of the rapamycin (mTOR) pathway. Furthermore, PGB inhibited cell proliferation by regulating the mitogen-activated protein kinase (MAPK) pathways. In this study, six types of platycosides were identified in the PGB using HPLC. PGB efficiently induced cancer cell death via autophagy and the modulation of the AMPK/mTOR/AKT and MAPK signaling pathways in A549 cells. Therefore, PGB may be an efficacious herbal anti-cancer therapy. Copyright © 2016. Published by Elsevier Ireland Ltd.
International Nuclear Information System (INIS)
Quesada Mendez, Isaac; Aristizabal Gutierrez, Fabio Ancizar; Chaves Cordoba, Bernardo
2009-01-01
The rubber yield of four Hevea brasiliensis (Willd. ex Adr. de Juss.) Muell.-Arg. clones was evaluated on the Colombian high plains in the Meta department: IAN 873 and RRIM 600 (third year of tapping being done) and PB 260 and GT 1 (first year of tapping). Six tapping systems were used, including a combination of different tapping frequencies (d/4 and d/5), Ethephon concentrations (0%, 2.5%, 3.3% and 5%) and a number of applications per year (4 to 8) were also used depending on the clone. The production figures for one commercial year were obtained from assays, using a completely random- block design (having four repetitions) independently defined for each clone: having on average 4446 g rubber/tree of produce per year for the RRIM 600 clone within a system 1/2S, d/4, 6d/7, 10m/12, ET 2.5%, Pa 7/y; 2696 g rubber/tree for the PB 260 clone with 1/2S, d/4, 6d/7, 10m/12, ET 2.5%, Pa 5/y; 3822 g rubber/tree for the IAN 873 clone, 1/2S, d/4, 6d/7, 10m/12, ET 3.3%, Pa 8/y, and 3472 g rubber/ tree for the GT 1 clone, 1/2S, d/4, 6d/7, 10m/12, ET 2.5%, Pa 5/y. The highest produce was obtained with a four-day tapping frequency.
Directory of Open Access Journals (Sweden)
Faver Álvarez Carrillo
2015-07-01
Full Text Available The impact of organic fertilizing schemes on the cocoa (Theobroma cacao L. growth and production under agroforestry systems (AFS has been scarcely studied. In this sense, in Rivera (Huila-Colombia, the effect of different management strategies for amendment application in cocoa under agroforestry systems was evaluated. Four treatments were considered: i conventional fertilizing or farmer fertilizing (chemical, T1; ii Potassium sulfate (chemical, T2; iii eco-cocoa + Super 4 (ECO-S4 (organical, T3; and iv the mixture of among the treatments with potassium sulfate + eco-cocoa (SP-ECO (chemical + organical, T4. Variance analysis, Fisher test (p<0.05 and principal components analysis (PCA were used for data comparisons. For the height of cocoa plants, there was an average increase of 22.5 cm, while for stem diameter was 4.71 cm, with significant differences between the treatments. In general, an effect of the fertilizing scheme on the agronomic parameters of cocoa evaluated was found —especially for some important variables such as number of grains per pod and average weight of the grain—. There were similar parameters between the chemical and the organic treatments. This demonstrates that organic schemes of fertilizing could be an important alternative for improving cocoa production.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2015-04-01
Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.
Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire
2012-01-01
Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR) markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.
Directory of Open Access Journals (Sweden)
Sandrine Baillon
Full Text Available Anthoptilum grandiflorum and Halipteris finmarchica are two deep-sea corals (Octocorallia: Pennatulacea common on soft bottoms in the North Atlantic where they are believed to act as biogenic habitat. The former also has a worldwide distribution. To assist conservation efforts, this study examines spatial and temporal patterns in the abundance, diversity, and nature of their faunal associates. A total of 14 species were found on A. grandiflorum and 6 species on H. finmarchica during a multi-year and multi-site sampling campaign in eastern Canada. Among those, 7 and 5 species, respectively, were attached to the sea pens and categorized as close associates or symbionts. Rarefaction analyses suggest that the most common associates of both sea pens have been sampled. Biodiversity associated with each sea pen is analyzed according to season, depth and region using either close associates or the broader collection of species. Associated biodiversity generally increases from northern to southern locations and does not vary with depth (∼ 100-1400 m. Seasonal patterns in A. grandiflorum show higher biodiversity during spring/summer due to the transient presence of early life stages of fishes and shrimps whereas it peaks in fall for H. finmarchica. Two distinct endoparasitic species of highly modified copepods (families Lamippidae and Corallovexiidae commonly occur in the polyps of A. grandiflorum and H. finmarchica, and a commensal sea anemone frequently associates with H. finmarchica. Stable isotope analyses (δ(13C and δ(15N reveal potential trophic interactions between the parasites and their hosts. Overall, the diversity of obligate/permanent associates of sea pens is moderate; however the presence of mobile/transient associates highlights an ecological role that has yet to be fully elucidated and supports their key contribution to the enhancement of biodiversity in the Northwest Atlantic.
Bertolde, F Z; Almeida, A-A F; Silva, F A C; Oliveira, T M; Pirovani, C P
2014-07-04
Theobroma cacao is a woody and recalcitrant plant with a very high level of interfering compounds. Standard protocols for protein extraction were proposed for various types of samples, but the presence of interfering compounds in many samples prevented the isolation of proteins suitable for two-dimensional gel electrophoresis (2-DE). An efficient method to extract root proteins for 2-DE was established to overcome these problems. The main features of this protocol are: i) precipitation with trichloroacetic acid/acetone overnight to prepare the acetone dry powder (ADP), ii) several additional steps of sonication in the ADP preparation and extractions with dense sodium dodecyl sulfate and phenol, and iii) adding two stages of phenol extractions. Proteins were extracted from roots using this new protocol (Method B) and a protocol described in the literature for T. cacao leaves and meristems (Method A). Using these methods, we obtained a protein yield of about 0.7 and 2.5 mg per 1.0 g lyophilized root, and a total of 60 and 400 spots could be separated, respectively. Through Method B, it was possible to isolate high-quality protein and a high yield of roots from T. cacao for high-quality 2-DE gels. To demonstrate the quality of the extracted proteins from roots of T. cacao using Method B, several protein spots were cut from the 2-DE gels, analyzed by tandem mass spectrometry, and identified. Method B was further tested on Citrus roots, with a protein yield of about 2.7 mg per 1.0 g lyophilized root and 800 detected spots.
Mardiyani, S. A.; Sunawan; Pawestri, A. E.
2018-03-01
Cocoa seeds are recalcitrant (the water content is more than 40%) that require special handling. The use of adsorbent media to reduce the decrease in the quality of cocoa seeds and extend their shelf life in this storage has not been widely done. Local adsorbent media such as sawdust, sand and ash have the potential to maintain the viability of cocoa seeds. The objective of this research was to determine the interaction of the application of neem (Azadirachta indica) as biological pesticides and the use of various natural adsorbent media in the storage of cocoa seeds (Theobroma cacao). It was an experimental study with a factorial design composed of three factors. The first factor was the medium adsorbent type for the storage of cocoa seed, which consists of three levels (river sand, ash, and sawdust). The second factor was the concentration of neem leaves for pre-storage treatment with three levels (10, 20, and 30%). The third factor was the storage time (10 and 20 days). The results of the study indicated that the combination of the three factors showed a significant interaction in the height of the plant and the diameter of the stem of the seedling at 28 days after sowing. The fresh weight of the seedlings of the seeds that were stored in ash media gave a better result than the seedlings of seeds that had been stored in the river sand and the sawdust as adsorbent media. The application of 20% extract of neem leaves gave the best influence for the seeds that were stored for 20 days.
Stark, Timo; Lang, Roman; Keller, Daniela; Hensel, Andreas; Hofmann, Thomas
2008-10-01
Besides flavan-3-ols, a family of N-phenylpropenoyl-L-amino acids (NPAs) has been recently identified as polyphenol/amino acid conjugates in the seeds of Theobroma cacao as well as in a variety of herbal drugs. Stimulated by reports on their biological activity, the purpose of this study was to investigate if these amides are absorbed by healthy volunteers after administration of a cocoa drink. For the first time, 12 NPAs were quantified in human urine by means of a stable isotope dilution analysis with LC-MS/MS (MRM) detection. A maximum amount was found in the urine taken 2 h after the cocoa consumption. The highest absolute amount of NPAs excreted with the urine was found for N-[4'-hydroxy-(E)-cinnamoyl]-L-aspartic acid (5), but the highest recovery rate (57.3 and 22.8%), that means the percentage amount of ingested amides excreted with the urine, were determined for N-[4'-hydroxy-(E)-cinnamoyl]-L-glutamic acid (6) and N-[4'-hydroxy-3'-methoxy-(E)-cinnamoyl]-L-tyrosine (13). In order to gain first insights into the NPA metabolism in vivo, urine samples were analyzed by LC-MS/MS before and after beta-glucuronidase/sulfatase treatment. As independent of the enzyme treatment the same NPA amounts were found in urine, there is strong evidence that these amides are metabolized neither via their O-glucuronides nor their O-sulfates. In order to screen for caffeic acid O-glucuronides as potential NPA metabolites, urine samples were screened by means of LC-MS/MS for caffeic acid 3-O-beta-D-glucuronide and 4-O-beta-D-glucuronide. But not even trace amounts of one of these glucuronides were detectable, thus excluding them as major NPA metabolites and underlining the importance of future investigations on a potential O-methylation or reduction of the N-phenylpropenoyl moiety in NPAs.
Directory of Open Access Journals (Sweden)
Jesús Arturo Ramírez Sulvarán
2014-03-01
Full Text Available The cocoa (Theobroma cacao L. based economyhas been considered a valid alternative to support sustainable development in northeastern Colombia. However, there is a lack of information about the cocoa production systems in the region which is needed for the implementation of effective plans to improve their performance and sustainability. Four of the main cocoa producing municipalities in the Norte de Santanderdepartment were considered for this study: Teorama, Bucarasica, Cúcuta and San Calixto. These entities were selected due to their adequate security conditions, availability of field assistants and departmental representativeness in cocoa production. The objective was to obtain basic information for local, specific and participatory actions for the sustainability of the cocoa production systems and to improve the living conditions of farmers. The methodology used was based on the farming system approach, considering the socioeconomic, technological and agro-ecologicalcomponents, and their relationships, and evaluating themaccording to the principles of sustainable agriculture. The phases covered were: (1 analysis of secondary data, (2 formulation and evaluation of sustainability indicators, (3 design, implementation and analysis of survey data and (4 validation by the farmers of the obtained information and the prioritization of problems. The results indicate that there is only one cocoa production system of a family-mercantile type, with low technology. Most farmers havelow incomes and basic needs such as health, education and public services are not met. They do not employ the agronomic and postharvest practices recommended by specialists. The water and soil resources are being degraded. In general, the farming system leans towards unsustainability and it is vital that integrative actions be taken to change this situation. / Se considera que el desarrollo de una economía basada en el cacao (Theobroma cacao L
Directory of Open Access Journals (Sweden)
R. Poyatos
2005-01-01
Full Text Available Stand transpiration was measured during the 2003 and 2004 growing seasons using heat dissipation sap flow sensors in a Scots pine (Pinus sylvestris L. and a pubescent oak (Quercus pubescens Willd. forests located in a montane area of the Eastern Pyrenees (NE Spain. The first aim of the study was to assess the differences in quantitative estimates of transpiration (Ec and the response to evaporative demand of the two stands. Over the studied period of 2003, characterised by a severe drought episode during the summer, the oak stand (Ec was only 110 mm compared to the 239 mm transpired by the Scots pine stand, although the ratio of transpiration to reference evapotranspiration (Ec/ET0 in the oak stand compares well with the expected values predicted for low leaf area index (LAI oak forests in southern Europe. Scots pine showed a strong reduction in (Ec/ET0 as the drought developed, whereas pubescent oak was less affected by soil moisture deficits in the upper soil. As a second objective, and given the contrasting meteorological conditions between 2003 and 2004 summer periods, the interannual variability of transpiration was studied in the Scots pine plot. Rainfall during the summer months (June-September in 2003 was almost 40% less than in the same interval in 2004. Accordingly, transpiration was also reduced about 25% in 2003. Finally, Scots pine data from 2003 and 2004 was used to calibrate a simple transpiration model using ET0 and soil moisture deficit (SMD as input variables, and implicitly including stomatal responses to high vapour pressure deficits (Dd and soil water status.
International Nuclear Information System (INIS)
Fernandez V, S.O.
1996-01-01
The saponins and total lipids was measured in the variants of Barandales and Isluga of Chenopodium quinoa Willd and the mutants of both variants in the M 2 lineage. These two variants were gamma radiated at different levels: 0, 50, 100, 150, 200, 250, 300, 350, 400 and 500 Gy in the M1 generation. At the same time the mutants with favorable agronomic characteristics were selected. The samples were growth on the field (cultivated) and the seeds were recovered (harvested), measuring the emergence agronomic variables, plant height, density and seed yield. Lipids totals and saponins were measured in the seeds. The samples of radiated seeds with gamma-ray at different levels, were dried and grinded until to obtain a powder. The lipids was extracted with diethyl-ether, and in this solution was measured the total lipid content. The saponins were extracted in a later step, concentrated and precipitated. After the precipitation step the sapogenins were hydrolized and extracted with methyl alcohol. The extracts were centifugated and the solid material was dried and weighted. Finally, the measurement of the oleanolic acid was carried out by high pressure liquid chromatography. One conversion factor permits to relate this acid with the total saponin content. (Author)
2068-IJBCS-Article-Saidou Ousseina
African Journals Online (AJOL)
hp
que Schoenefeldia gracilis Kunth., Aristida mutabilis Trin. et Rupr., Dactyloctenium aegyptiaca (L.) Willd., Tribulus terrestris L. (Ousseina, 2012) parsemée de plantes ligneuses (Maerua crassifolia. Forsk.,. Balanites aegyptiaca (L.) Del., Acacia senegal (L.) Willd., Acacia tortilis (Forssk.) Hayne subsp. raddiana (Savi) Brenan,.
Directory of Open Access Journals (Sweden)
Adriana Zulay Argüello-Navarro
2014-09-01
Full Text Available La adaptabilidad del cacao (Theobroma cacao L. en condiciones adversas permite sugerir que la microbiota asociada con la rizosfera desempeña una función importante para la nutrición y el desarrollo de la planta. En el trabajo se evaluó el potencial biofertilizante de bacterias fijadoras de nitrógeno (diazótrofas aisladas de suelos cacaoteros por la técnica de diluciones seriadas. Las bacterias se aislaron en medios semiselectivos (NFb, JMV, LGI, JNFb. Los aislados puros se caracterizaron morfológica y bioquímicamente y complementariamente se evaluó la capacidad de fijación biológica de nitrógeno (FBN por el método de Micro-Kjeldahl. Los aislados con mejor capacidad de fijación de nitrógeno fueron seleccionados para evaluar su potencial promotor de crecimiento durante 120 días en plantas de cacao clon CCN 51 establecidas a partir de semillas. El análisis de datos mostró que las plantas de cacao respondieron efectivamente a los tratamientos con bacterias donde las variables de crecimiento y N (% foliar incrementaron significativamente, en comparación con el testigo. Se destacó el aporte de los aislados DKA2J24, DKB3J73 presuntamente del género Burkholderia sp. y DKA1L3 semejante al género Gluconacetobacter sp., todos con un gran potencial como biofertilizantes en la prueba de bioensayo.
Directory of Open Access Journals (Sweden)
A. N. Oliveira
2004-12-01
Full Text Available As micorrizas arbusculares podem ser importantes na nutrição das plantas em solos ácidos e de baixa fertilidade, como são os da Amazônia de modo geral. Avaliaram-se a colonização radicular por fungos micorrízicos arbusculares (FMAs nativos e os teores de nutrientes em cupuaçuzeiro e guaranazeiro em um sistema agroflorestal no município de Manaus, Amazonas. Dez plantas de cada espécie foram selecionadas, das quais foram coletadas amostras de raiz, folha e solo durante o período seco e chuvoso da região de Manaus. Os guaranazeiros e os cupuaçuzeiros apresentaram maior colonização radicular por FMAs na época chuvosa. Os teores foliares de Ca, Mg, K, P, Zn, Cu e Mn nas duas espécies não foram influenciados pelas épocas de amostragem. O teor de Fe nas folhas dos cupuaçuzeiros foi maior na época chuvosa, enquanto o dos guaranazeiros, na época seca. A colonização micorrízica correlacionou-se com a concentração foliar de Ca, Mg, P e Cu nos cupuaçuzeiros e com a de Ca, Fe, Zn e Cu nos guaranazeiros.Arbuscular mycorrhiza can be important for plant nutrition in acid and low fertility soils such as those of the Amazon. The present study evaluated the mycorrhizal colonization by native arbuscular mycorrhizal fungi (AMF and nutrient concentrations of cupuassu and guarana leaves in an agroforestry system in Manaus, Amazonas State, Brazil. Ten plants of each species were selected, of which the roots, soil and leaves were sampled during the rainy and dry seasons. Guarana and cupuassu trees presented higher levels of AMF colonization during the rainy season. Ca, Mg, K, P, Zn, Cu, and Mn concentrations in both species were not affected by the season. Fe concentration was higher during the rainy season in the cupuassu leaves, but higher in the dry season in the guarana leaves. Mycorrhizal colonization correlated with Ca, Mg, P, and Cu concentrations in cupuassu plants and with Ca, Fe, Zn, and Cu in guarana plants.
Directory of Open Access Journals (Sweden)
Rey Gaston Loor Solorzano
Full Text Available Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.
Water distilled essential oils from the air dried aerial parts of Tanacetum argenteum (Lam.) Willd. subsp. argenteum (Lam.) and T. argenteum (Lam.) Willd. subsp. canum (C. Koch) Grierson were analyzed by gas chromatography (GC-FID) and gas chromatography-mass spectrometry (GC-MS). Twenty-seven and 3...
Fister, Andrew S; Mejia, Luis C; Zhang, Yufan; Herre, Edward Allen; Maximova, Siela N; Guiltinan, Mark J
2016-05-17
The pathogenesis-related (PR) group of proteins are operationally defined as polypeptides that increase in concentration in plant tissues upon contact with a pathogen. To date, 17 classes of highly divergent proteins have been described that act through multiple mechanisms of pathogen resistance. Characterizing these families in cacao, an economically important tree crop, and comparing the families to those in other species, is an important step in understanding cacao's immune response. Using publically available resources, all members of the 17 recognized pathogenesis-related gene families in the genome of Theobroma cacao were identified and annotated resulting in a set of ~350 members in both published cacao genomes. Approximately 50 % of these genes are organized in tandem arrays scattered throughout the genome. This feature was observed in five additional plant taxa (three dicots and two monocots), suggesting that tandem duplication has played an important role in the evolution of the PR genes in higher plants. Expression profiling captured the dynamics and complexity of PR genes expression at basal levels and after induction by two cacao pathogens (the oomycete, Phytophthora palmivora, and the fungus, Colletotrichum theobromicola), identifying specific genes within families that are more responsive to pathogen challenge. Subsequent qRT-PCR validated the induction of several PR-1, PR-3, PR-4, and PR-10 family members, with greater than 1000 fold induction detected for specific genes. We describe candidate genes that are likely to be involved in cacao's defense against Phytophthora and Colletotrichum infection and could be potentially useful for marker-assisted selection for breeding of disease resistant cacao varieties. The data presented here, along with existing cacao-omics resources, will enable targeted functional genetic screening of defense genes likely to play critical functions in cacao's defense against its pathogens.
DuVal, Ashley; Gezan, Salvador A.; Mustiga, Guiliana; Stack, Conrad; Marelli, Jean-Philippe; Chaparro, José; Livingstone, Donald; Royaert, Stefan; Motamayor, Juan C.
2017-01-01
Breeding programs of cacao (Theobroma cacao L.) trees share the many challenges of breeding long-living perennial crops, and genetic progress is further constrained by both the limited understanding of the inheritance of complex traits and the prevalence of technical issues, such as mislabeled individuals (off-types). To better understand the genetic architecture of cacao, in this study, 13 years of phenotypic data collected from four progeny trials in Bahia, Brazil were analyzed jointly in a multisite analysis. Three separate analyses (multisite, single site with and without off-types) were performed to estimate genetic parameters from statistical models fitted on nine important agronomic traits (yield, seed index, pod index, % healthy pods, % pods infected with witches broom, % of pods other loss, vegetative brooms, diameter, and tree height). Genetic parameters were estimated along with variance components and heritabilities from the multisite analysis, and a trial was fingerprinted with low-density SNP markers to determine the impact of off-types on estimations. Heritabilities ranged from 0.37 to 0.64 for yield and its components and from 0.03 to 0.16 for disease resistance traits. A weighted index was used to make selections for clonal evaluation, and breeding values estimated for the parental selection and estimation of genetic gain. The impact of off-types to breeding progress in cacao was assessed for the first time. Even when present at <5% of the total population, off-types altered selections by 48%, and impacted heritability estimations for all nine of the traits analyzed, including a 41% difference in estimated heritability for yield. These results show that in a mixed model analysis, even a low level of pedigree error can significantly alter estimations of genetic parameters and selections in a breeding program. PMID:29250097
McElroy, Michel S; Navarro, Alberto J R; Mustiga, Guiliana; Stack, Conrad; Gezan, Salvador; Peña, Geover; Sarabia, Widem; Saquicela, Diego; Sotomayor, Ignacio; Douglas, Gavin M; Migicovsky, Zoë; Amores, Freddy; Tarqui, Omar; Myles, Sean; Motamayor, Juan C
2018-01-01
Cacao ( Theobroma cacao ) is a globally important crop, and its yield is severely restricted by disease. Two of the most damaging diseases, witches' broom disease (WBD) and frosty pod rot disease (FPRD), are caused by a pair of related fungi: Moniliophthora perniciosa and Moniliophthora roreri , respectively. Resistant cultivars are the most effective long-term strategy to address Moniliophthora diseases, but efficiently generating resistant and productive new cultivars will require robust methods for screening germplasm before field testing. Marker-assisted selection (MAS) and genomic selection (GS) provide two potential avenues for predicting the performance of new genotypes, potentially increasing the selection gain per unit time. To test the effectiveness of these two approaches, we performed a genome-wide association study (GWAS) and GS on three related populations of cacao in Ecuador genotyped with a 15K single nucleotide polymorphism (SNP) microarray for three measures of WBD infection (vegetative broom, cushion broom, and chirimoya pod), one of FPRD (monilia pod) and two productivity traits (total fresh weight of pods and % healthy pods produced). GWAS yielded several SNPs associated with disease resistance in each population, but none were significantly correlated with the same trait in other populations. Genomic selection, using one population as a training set to estimate the phenotypes of the remaining two (composed of different families), varied among traits, from a mean prediction accuracy of 0.46 (vegetative broom) to 0.15 (monilia pod), and varied between training populations. Simulations demonstrated that selecting seedlings using GWAS markers alone generates no improvement over selecting at random, but that GS improves the selection process significantly. Our results suggest that the GWAS markers discovered here are not sufficiently predictive across diverse germplasm to be useful for MAS, but that using all markers in a GS framework holds
Directory of Open Access Journals (Sweden)
Michel S. McElroy
2018-03-01
Full Text Available Cacao (Theobroma cacao is a globally important crop, and its yield is severely restricted by disease. Two of the most damaging diseases, witches’ broom disease (WBD and frosty pod rot disease (FPRD, are caused by a pair of related fungi: Moniliophthora perniciosa and Moniliophthora roreri, respectively. Resistant cultivars are the most effective long-term strategy to address Moniliophthora diseases, but efficiently generating resistant and productive new cultivars will require robust methods for screening germplasm before field testing. Marker-assisted selection (MAS and genomic selection (GS provide two potential avenues for predicting the performance of new genotypes, potentially increasing the selection gain per unit time. To test the effectiveness of these two approaches, we performed a genome-wide association study (GWAS and GS on three related populations of cacao in Ecuador genotyped with a 15K single nucleotide polymorphism (SNP microarray for three measures of WBD infection (vegetative broom, cushion broom, and chirimoya pod, one of FPRD (monilia pod and two productivity traits (total fresh weight of pods and % healthy pods produced. GWAS yielded several SNPs associated with disease resistance in each population, but none were significantly correlated with the same trait in other populations. Genomic selection, using one population as a training set to estimate the phenotypes of the remaining two (composed of different families, varied among traits, from a mean prediction accuracy of 0.46 (vegetative broom to 0.15 (monilia pod, and varied between training populations. Simulations demonstrated that selecting seedlings using GWAS markers alone generates no improvement over selecting at random, but that GS improves the selection process significantly. Our results suggest that the GWAS markers discovered here are not sufficiently predictive across diverse germplasm to be useful for MAS, but that using all markers in a GS framework holds
Directory of Open Access Journals (Sweden)
Célia Regina Tremacoldi
2010-02-01
Full Text Available
Plantios de paricá, avaliados no Município de Dom Eliseu, Estado do Pará, apresentaram sintomas de cancro. Várias espécies de fungos foram associadas ao cancro observado no campo, mais notavelmente Lasiodiplodia theobromae e Pestalotiopsis sp. Culturas isoladas destes fungos, frequentemente associados a outros (incluindo Fusarium oxysporum, Alternaria e basidiomicetes, foram testadas quanto à patogenicidade em plantas jovens de paricá, com aproximadamente um metro de altura. Apenas L. theobromae produziu cancro sob as condições testadas, quando discos de cultura foram aplicados usando técnicas de inoculação por ferimento e alta umidade, reproduzindo perfeitamente os sintomas do campo. Pestalotiopsis sp. causou danos muito menores quando comparado a L. theobromae. A confirmação de L. theobromae como agente causal do cancro em paricá ocorreu após o reisolamento do fungo a partir dos tecidos sintomáticos das plantas inoculadas em casa-de-vegetação, concluindo a verificação dos Postulados de Koch. Este é o primeiro relato deste patógeno em paricá.
Doi: 10.4336/2009.pfb.59.69
Canker have been found in field plantings of parica examined in Dom Eliseu county, Para State,Ayenor, G.K.; Huis, van A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.
2007-01-01
Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma
Fungal species associated with Vigna unguiculata (L.) Walp (Cowpea)
African Journals Online (AJOL)
Aspergillus niger Van Tieghem, Botryodiplodia theobromae (Pat) Novel, Fusarium oxysporum Schlecht and Rhizopus stolonifer Ehrenb ex Link were isolated from both blotter and agar methods. Botryodiplodia theobromae had the highest mean occurrence (42.37%) followed by Fusarium oxysporum (30.02%), Aspergillus ...
Directory of Open Access Journals (Sweden)
Biano Alves de Melo Neto
2013-06-01
Full Text Available Four formulations of mixed açaí (Euterpe oleracea (A and cocoa´s honey (Theobroma cacao (CH jellies were prepared according to the following proportions: T1 (40% A:60% CH, T2 (50% A:50% CH, T3 (60% A: 40% CH and T4 (100% A - control. All formulations were prepared using a rate 60:40 (w/w of sucrose and pulp, plus 0.5% pectin and the products reached to average of 65% soluble solids content. The jellies were analyzed by chemical and physicochemical (titratable acidity, pH, soluble solid content, dry matter, total protein, lipids, vitamin C and calories and sensory characteristics; also were evaluated levels of P, K, Ca, Mg, Fe, Zn, Cu and Mn. It was used a hedonic scale of 7 points to evaluate the attributes: overall impression, spreadability, brightness, flavor, texture and color, and also was verified the purchase intention score. The titratable acidity and pH ranged from 0.46 to 0.64% and 3.35 to 3.64, respectively, that are within the range found at most fruit jellies. The soluble solids content ranged between 65.2 and 65.5 ºBrix. The sensory acceptance results showed that all treatments (T1, T2, T3 and T4 presented means of sensory attributes above 4, demonstrating good acceptance of the product, but the treatment T1 presented the higher scores for the evaluated attributes. Cocoa´s honey added a positive influence on the attributes of color, texture and spreadability.
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
... leaf extract on membrane-bound ATPases in streptozotocin-induced diabetic rats ... Experimental wound healing aspects of Jasminum grandiflorumLinn: a ... from soccer player's shoes and knowledge and applications about foot hygiene of ...
Samuels, Gary J; Ismaiel, Adnan; Rosmana, Ade; Junaid, Muhammad; Guest, David; McMahon, Peter; Keane, Philip; Purwantara, Agus; Lambert, Smilja; Rodriguez-Carres, Marianela; Cubeta, Marc A
2012-01-01
Vascular Streak Dieback (VSD) disease of cacao (Theobroma cacao) in Southeast Asia and Melanesia is caused by a basidiomycete (Ceratobasidiales) fungus Oncobasidium theobromae (syn. =Thanatephorus theobromae). The most characteristic symptoms of the disease are green-spotted leaf chlorosis or, commonly since about 2004, necrotic blotches, followed by senescence of leaves beginning on the second or third flush behind the shoot apex, and blackening of infected xylem in the vascular traces at the leaf scars resulting from the abscission of infected leaves. Eventually the shoot apex is killed and infected branches die. In susceptible cacao the fungus may grow through the xylem down into the main stem and kill a mature cacao tree. Infections in the stem of young plants prior to the formation of the first 3-4 lateral branches usually kill the plant. Basidiospores released from corticioid basidiomata developed on leaf scars or along cracks in the main vein of infected leaves infect young leaves. The pathogen commonly infects cacao but there are rare reports from avocado. As both crops are introduced to the region, the pathogen is suspected to occur asymptomatically in native vegetation. The pathogen is readily isolated but cultures cannot be maintained. In this study, DNA was extracted from pure cultures of O. theobromae obtained from infected cacao plants sampled from Indonesia. The internal transcribed spacer region (ITS), consisting of ITS1, 5.8S ribosomal RNA and ITS2, and a portion of nuclear large subunit (LSU) were sequenced. Phylogenetic analysis of ITS sequences placed O. theobromae sister to Ceratobasidium anastomosis groups AG-A, AG-Bo, and AG-K with high posterior probability. Therefore the new combination Ceratobasidium theobromae is proposed. A PCR-based protocol was developed to detect and identify C. theobromae in plant tissue of cacao enabling early detection of the pathogen in plants. A second species of Ceratobasidium, Ceratobasidium ramicola
Directory of Open Access Journals (Sweden)
A.M. Kosoko
2017-07-01
Full Text Available 80 rats, randomly selected, were divided into 3 treatment groups: pre-, co- and post-treatment; consisting of 6 sub-groups each (5 rats per sub-group: baseline, normal saline (2 mL, α-lipoic acid (20 mg/kg body weight, 200 mg/kg, 400 mg/kg or 800 mg/kg body weight Theobroma cacao stem bark aqueous extract (TCAE. All rats except for baseline group were intoxicated with 20 mg/kg body weight doxorubicin (DOX intraperitoneally. The animals in pre- or post-treatment group received a single dose of DOX (20 mg/kg body weight intraperitoneally 24 h before or after 7 days’ oral administration with TCAE respectively while those in co-treatment group were co-administered 2.86 mg/kg body weight of DOX with either normal saline, α- lipoic acid or TCAE orally for 7 days. Animals were sacrificed (pre- and post- treatment groups were sacrificed on the ninth day while the co-treatment group sacrificed on the 8th day. Brain and heart tissue samples were harvested for enzyme markers of toxicity, oxidative stress and histopathological examinations. DOX intoxication caused significant decrease in activities of LDH and ACP, and increase in γGT and ALP activities in brain tissues while causing a significant increase in LDH, ACP, γGT activities and decrease in ALP activity in the cardiac tissues. DOX intoxication caused a significant increase in concentrations of H2O2 generated, MDA and PC, XO, MPx and NOX activities with concomitant decrease in CAT, SOD, GPx and GST activities, and in concentrations of GSH, AsA and α-Toc in brain and cardiac tissues. Pre-, co- and post-treatment with TCAE at either 200 mg/kg, 400 mg/kg or 800 mg/kg body weight significantly reversed the oxidative damage to the organs induced by DOX-intoxication. The result affirmed that T. cacao stem bark aqueous extract protected against DOX induced oxidative damage in brain and cardiac tissues of experimental rats.
Indian Academy of Sciences (India)
Admin
Clausena anisata (Willd.) Hook.f. ex Benth. (Syn. C.dentata (Willd.) Roemer) – Black Currant. Grape Lime of the family Rutaceae is a small aromatic evergreen tree. Leaves are odd-pinnate with elliptic-ovate and oblique leaflets. Inflorescence is a raceme and flowers are greenish-white, and. 4-merous. Fruit is an ovoid small ...
Cyrielle Genard-Zielinski, Anne; Boissard, Christophe; Ormeño, Elena; Lathière, Juliette; Guenet, Bertrand; Gauquelin, Thierry; Fernandez, Catherine
2015-04-01
Biogenic Volatile Organic Compounds (BVOCs) released by plants mostly originate from their secondary metabolism. Their emissions are modulated, in terms of intensity and molecule diversity, by environmental conditions. Among BVOCs, isoprene has been especially studied due to its high emission fluxes and its contribution to tropospheric photochemistry, both in the gaseous and particulate phases. However, the way isoprene emissions are impacted by some abiotic factors, especially water stress, is still under debate. In a world facing climatic changes, global climate models expect air temperature and drought intensity to strengthen in the Mediterranean area by 2100. Our work focuses on the impact of water stress on isoprene emissions (ERiso) from Quercus pubescens Willd. This species covers large areas of the Mediterranean area where it appears to be the main isoprene emitter. An in situ experimentation was performed at the O3HP (Oak Observatory at OHP, southern France) in a pubescent oak forest with trees adapted to long lasting stress periods. We investigated during a whole seasonal cycle (from June 2012 to June 2013) the course of ERiso under both natural water stress (control treatment: C) and intensified water stress (stress treatment: S) by artificially reducing rain by 30% using a specific rain exclusion device. Restricted rain did not modify either the net CO2 assimilation or ERiso during the whole season. However, isoprene emission factors (Is) for trees under S were significantly higher (a factor of ˜ 2) than for trees growing under C in August (137.8 compared to 75.3 μgC.gDM-1.h-1 respectively) and September (75.3 compared to 40.2 μgC.gDM-1.h-1 respectively). Based on our experimental emission database, an appropriate isoprene emission algorithm (GZ2014) was developed using a statistic approach (an artificial neural network). Using ambient and edaphic environmental parameters integrated over up to 3 weeks, GZ2014 was found to represent more than 80% of
Directory of Open Access Journals (Sweden)
Ney Freitas Marinho
2004-03-01
Full Text Available A resposta de Acacia mangium Willd (mangium e Sclerolobium paniculatum Vogel (tachi à inoculação de fungos micorrízicos arbusculares (FMA, oriundos de áreas em recuperação após a extração de bauxita, foi avaliada em experimento com delineamento inteiramente casualizado, com 14 tratamentos (duas espécies leguminosas e sete tipos de solo e três repetições. Avaliou-se o número de esporos no solo, a colonização micorrízica, a matéria seca total, o P acumulado, a dependência micorrízica das mudas, e a abundância e a freqüência de espécies. O número de propágulos infectivos (NPI foi estudado em delineamento em blocos casualizados, com oito diluições de solo inóculo, cinco repetições e uma planta isca (Brachiaria decumbens Stapf. Utilizou-se substrato da mistura de um Planossolo mais areia lavada e fosfato de rocha araxá (0,60 g/kg. O número de esporos aumentou em função do tempo de cobertura das leguminosas. A colonização micorrízica foi mais intensa no tachi. Os valores de matéria seca dessa espécie foram inferiores aos de mangium, que por sua vez extraiu em torno de seis vezes mais P do substrato. Em geral, mangium, ao contrário do tachi, foi facultativa à presença dos FMA, sugerindo sua utilização na recuperação de áreas degradadas sem inoculação prévia. Dentre as 39 espécies de FMA identificadas, Glomus macrocarpum Tul. & Tul. apresentou maior índice de abundância e freqüência (IAF e maior NPI, destacando-se entre as espécies pioneiras, ao passo que outras apareceram apenas em estádios sucessionais mais avançados das áreas em recuperação.The responses of Acacia mangium Willd (mangium and Sclerolobium paniculatum Vogel (tachi to arbuscular mycorrhizal fungi (AMF inoculation collected from areas under reclamation after bauxite mining, was evaluated in an completely randomized design distributed in 14 treatments (two legume, species and seven soil types, with three replicates. Evaluated
Release Properties of Paracetamol Granulationa Formulated with ...
African Journals Online (AJOL)
Theobroma cacao gum, TCG was derived as a dry powder from fresh fruits of Theobroma cacao. Various granulations of paracetamol were prepared with TCG at the concentrations of 0.5 – 4% w/w. Similar formulations were prepared using sodium carboxymethyl cellulose, SCMC and acacia gums as standards. In each ...
Sugimoto, Naotoshi; Miwa, Shinji; Hitomi, Yoshiaki; Nakamura, Hiroyuki; Tsuchiya, Hiroyuki; Yachie, Akihiro
2014-01-01
Theobromine, a caffeine derivative, is the primary methylxanthine produced by Theobroma cacao. We previously showed that methylxanthines, including caffeine and theophylline, have antitumor and antiinflammatory effects, which are in part mediated by their inhibition of phosphodiesterase (PDE). A member of the PDE family, PDE4, is widely expressed in and promotes the growth of glioblastoma, the most common type of brain tumor. The purpose of this study was to determine whether theobromine could exert growth inhibitory effects on U87-MG, a cell line derived from human malignant glioma. We show that theobromine treatment elevates intracellular cAMP levels and increases the activity of p38 mitogen-activated protein kinase and c-Jun N-terminal kinase, whereas it attenuates p44/42 extracellular signal-regulated kinase activity and the Akt/mammalian target of rapamycin kinase and nuclear factor-kappa B signal pathways. It also inhibits cell proliferation. These results suggest that foods and beverages containing cocoa bean extracts, including theobromine, might be extremely effective in preventing human glioblastoma.
Directory of Open Access Journals (Sweden)
Katherine Pérez Ramos
2017-01-01
Full Text Available La presente investigación tuvo como objetivo la elaboración de un bocadito extruido de elevado tenor proteico, a partir de quinua ( Chenopodium quinoa Willd., tarwi ( Lupinus mutabilis Sweet y fécula de camote ( Ipomoea batatas L.. Para su formulación se aplicó el método de diseño de mezclas usando la herramienta computacional - estadíst ica Design Expert® versión 7.0, siendo las variables independientes las harinas de quinua, tarwi y fécula de camote; y las variables dependientes el contenido de proteína, índice de expansión, densidad aparente y dureza de los extruidos. La formulación ópt ima se determinó aplicando la prueba de deseabilidad basada en los modelos de regresión ajustado, dicha formulación se obtuvo maximizando el contenido de proteína e índice de expansión; y minimizando la dureza y densidad aparente de los extruidos. La formu lación óptima tuvo un porcentaje de quinua, tarwi y fécula de camote de 57%, 26% y 17 % respectivamente. El análisis fisicoquímico de la fórmula óptima dio como resultado 20,16% de proteína, 2,19 de índice de expansión, 0,220 g/cm 3 densidad aparente y 9,31 N de dureza. La calidad proteica de la formulación óptima fue determinada mediante los ensayos de digestibilidad verdadera y valor biológico verdadero en ratas, obteniéndose 83,5% y 62,9% respectivamente.
Directory of Open Access Journals (Sweden)
FERREIRA MARIA DAS GRAÇAS RODRIGUES
2001-01-01
Full Text Available Objetivou-se estudar o efeito da concentração de auxina e do meio líquido sobre o desenvolvimento de calos de cupuaçuzeiro. Segmentos de eixos embrionários e cotilédones, obtidos de frutos de cupuaçu dos tipos Mamorana e Redondo, foram cultivados em 4 meios de cultura diferentes: 1 meio MS (50%, suplementado com 2,4-D (1; 2; 4; 8 mg/L; 2 sais N6 (SIGMA (4 g/L, acrescidos de 2,4-D (0; 2; 4 mg/L e ANA (0; 3; 5 mg/L; 3 igual ao anterior, suplementado apenas com ANA (3 mg/L; e 4 meio MS, acrescido com ANA (1 mM. Calos com aspecto branco e brilhante foram observados em segmentos de eixos embrionários e cotilédones, cultivados nas menores concentrações de meio 1 (1 e 2 mg/L, enquanto nas maiores concentrações (4 e 8 mg/L se observou a formação de calos e massa calosa branco-opaca, em eixos embrionários e em segmentos cotiledonares, estas estruturas tornaram-se escuras dentro de oito semanas. Usando o meio 2, um grande número de raízes foram formadas, enquanto o mesmo meio suplementado apenas com ANA (3; 5 mg/L originou uma massa calosa. A combinação de ANA e 2,4-D, 3 e 2 mg/L, respectivamente, promoveu a formação de calos brancos e raízes. A transferência das culturas para meio líquido, sem regulador de crescimento, promoveu aumento de tamanho dos explantes e escurecimento dos mesmos. O cultivo desses explantes no meio 3 resultou no aparecimento de calos amarelos, com aspecto friável, que permaneceram com a mesma aparência no meio 4.
Franco, M R; Shibamoto, T
2000-04-01
Twenty-one volatile compounds were identified for the first time by GC-MS in umbu-caja and in camu-camu, plus 30 volatile compounds were identified in araça-boi samples. Terpenic compounds predominated among the volatile compounds in these fruit samples, with the major compounds being identified as cis-beta-ocimene and caryophyllene in the northeastern fruit; alpha-pinene and d-limonene were the most abundant volatile compounds in the headspace of the Amazonian fruit camu-camu. Sesquiterpenes were the most abundant compounds in the araça-boi sample, with germacrene D presenting a higher relative percentage. The chemical class of esters predominated in the cupuaçu sample. Ethyl butyrate and hexanoate were the major compounds in the headspace of this Amazonian fruit.
Rosmana, Ade; Nasaruddin, Nasaruddin; Hendarto, Hendarto; Hakkar, Andi Akbar; Agriansyah, Nursalim
2016-09-01
Trichoderma species are able to persist on living sapwood and leaves of cacao ( Theobroma cacao ) in an endophytic relationship. In this research, we evaluated the ability of Trichodema asperellum introduced at the incision site in the bark for side grafting with the concentration of 4 g/10 mL, 4 g/100 mL, and 4 g/1,000 mL (suspended in water) in suppressing vascular streak dieback (VSD) incidence and promoting growth of side grafts in the field. The incidence of VSD in two local clones of cacao, MCC1 and M04, without application of T. asperellum was 71.2% and 70.1% at 21 wk after grafting, respectively. However, when the two clones were treated with a concentration of 4 g/10 mL T. asperellum , the incidence was 20.6% and 21.7%, respectively, compared to 29.1% and 20.9% at 4 g/100 mL and 18.2% and 15.6% at 4 g/1,000 mL. By comparing to the control, the treatment with the same concentrations of T. asperellum listed above, the total number of stomata in MCC1 decreased by 41.9%, 30.2%, and 14.0% and in M04 by 30.5%, 21.9%, and -2.5% (exception), respectively. Otherwise, the total area of stomata opening increased by 91.4%, 99.7%, and 28.6% in MCC1 and by 203.8%, 253.5%, and 35.9% in M04, respectively. Furthermore, the number of buds and branches treated with a mixture concentration on the the two clones increased by 90.7% and 21.7%, respectively. These data showed that the application of T. asperellum to cacao scions while grafting can decrease VSD incidence in side grafts and increase growth of grafts in addition to decreasing total number of stomata, increasing total area of opened stomata, and increasing number of buds and branches.
Liu, Yi; Shi, Zi; Maximova, Siela N; Payne, Mark J; Guiltinan, Mark J
2015-06-25
The flavan-3-ols catechin and epicatechin, and their polymerized oligomers, the proanthocyanidins (PAs, also called condensed tannins), accumulate to levels of up to 15 % of the total weight of dry seeds of Theobroma cacao L. These compounds have been associated with several health benefits in humans. They also play important roles in pest and disease defense throughout the plant. In Arabidopsis, the R2R3 type MYB transcription factor TT2 regulates the major genes leading to the synthesis of PA. To explore the transcriptional regulation of the PA synthesis pathway in cacao, we isolated and characterized an R2R3 type MYB transcription factor MYBPA from cacao. We examined the spatial and temporal gene expression patterns of the Tc-MYBPA gene and found it to be developmentally expressed in a manner consistent with its involvement in PAs and anthocyanin synthesis. Functional complementation of an Arabidopsis tt2 mutant with Tc-MYBPA suggested that it can functionally substitute the Arabidopsis TT2 gene. Interestingly, in addition to PA accumulation in seeds of the Tc-MYBPA expressing plants, we also observed an obvious increase of anthocyanidin accumulation in hypocotyls. We observed that overexpression of the Tc-MYBPA gene resulted in increased expression of several key genes encoding the major structural enzymes of the PA and anthocyanidin pathway, including DFR (dihydroflavanol reductase), LDOX (leucoanthocyanidin dioxygenase) and BAN (ANR, anthocyanidin reductase). We conclude that the Tc-MYBPA gene that encodes an R2R3 type MYB transcription factor is an Arabidopsis TT2 like transcription factor, and may be involved in the regulation of both anthocyanin and PA synthesis in cacao. This research may provide molecular tools for breeding of cacao varieties with improved disease resistance and enhanced flavonoid profiles for nutritional and pharmaceutical applications.
Ali, Shahin S; Melnick, Rachel L; Crozier, Jayne; Phillips-Mora, Wilberth; Strem, Mary D; Shao, Jonathan; Zhang, Dapeng; Sicher, Richard; Meinhardt, Lyndel; Bailey, Bryan A
2014-09-01
An understanding of the tolerance mechanisms of Theobroma cacao used against Moniliophthora roreri, the causal agent of frosty pod rot, is important for the generation of stable disease-tolerant clones. A comparative view was obtained of transcript populations of infected pods from two susceptible and two tolerant clones using RNA sequence (RNA-Seq) analysis. A total of 3009 transcripts showed differential expression among clones. KEGG (Kyoto Encyclopedia of Genes and Genomes) pathway analysis of differentially expressed genes indicated shifts in 152 different metabolic pathways between the tolerant and susceptible clones. Real-time quantitative reverse transcription polymerase chain reaction (real-time qRT-PCR) analyses of 36 genes verified the differential expression. Regression analysis validated a uniform progression in gene expression in association with infection levels and fungal loads in the susceptible clones. Expression patterns observed in the susceptible clones diverged in tolerant clones, with many genes showing higher expression at a low level of infection and fungal load. Principal coordinate analyses of real-time qRT-PCR data separated the gene expression patterns between susceptible and tolerant clones for pods showing malformation. Although some genes were constitutively differentially expressed between clones, most results suggested that defence responses were induced at low fungal load in the tolerant clones. Several elicitor-responsive genes were highly expressed in tolerant clones, suggesting rapid recognition of the pathogen and induction of defence genes. Expression patterns suggested that the jasmonic acid-ethylene- and/or salicylic acid-mediated defence pathways were activated in the tolerant clones, being enhanced by reduced brassinosteroid (BR) biosynthesis and catabolic inactivation of both BR and abscisic acids. Finally, several genes associated with hypersensitive response-like cell death were also induced in tolerant clones. © 2014
Cancro em mogno africano no estado do Pará
Directory of Open Access Journals (Sweden)
Célia Regina Tremacoldi
2013-06-01
Full Text Available Sintomas de cancro foram observados em plantios de mogno africano, no município de Dom Eliseu, Pará. Os fungos associados aos tecidos sintomáticos foram identificados como Lasiodiplodia theobromae e Fusarium subglutinans. Culturas puras desses fungos foram testadas quanto à patogenicidade em mudas de mogno africano sadias. Apenas L. theobromae produziu cancro, por meio de inoculação por ferimento e alta umidade. A confirmação de L. theobromae como agente causal do cancro ocorreu após o reisolamento do fungo a partir das plantas inoculadas em casa de vegetação, concluindo a primeira verificação do postulado de Koch para esse patossistema.
Directory of Open Access Journals (Sweden)
Johana Andrea Guzmán Duque
2014-12-01
Full Text Available El departamento de Bolívar (Colombia presenta condiciones aptas tanto agrícolas como culturales para el desarrollo productivo de cacao de fino aroma. Esta actividad ofrece una oportunidad conveniente para su desarrollo sostenible, económico y de proyección social. La presente investigación evaluó las características sensoriales del cacao Theobroma cacao L. en seis municipios del sur de Bolívar para determinar atributos propios y diferencias significativas entre estas regiones; para esto se realizó un muestreo de granos secos y mazorcas de cacao, de los clones más representativos de cada municipio. El proceso se llevó a cabo con 18 jueces capacitados para detectar, describir y discriminar propiedades sensoriales en el cacao, quienes evaluaron las muestras a través de cuatro pruebas sensoriales específicas diseñadas para realizar la caracterización organoléptica del cacao de Bolívar, seleccionando para este fin las pruebas descriptivas de perfil de sabor y análisis cuantitativo y las pruebas discriminativas de ordenamiento y escalar de control. El análisis físico y sensorial del grano reveló la correlación entre las condiciones agroecológicas y tecnológicas (especialmente aquellos que tienen que ver con las operaciones de fermentación y/o beneficio con las cualidades sensoriales que éste posee en sus atributos de sabor y aroma.
Laus, Maura N; Gagliardi, Anna; Soccio, Mario; Flagella, Zina; Pastore, Donato
2012-11-01
Antioxidant activity (AA) of quinoa (Chenopodium quinoa Willd.) seeds, as well as of durum wheat (Triticum turgidum L. ssp. durum Desf.) and of emmer (T. turgidum L. ssp. dicoccum Schübler) grains, was evaluated by studying hydrophilic (H), lipophilic (L), free-soluble (FSP) and insoluble-bound (IBP) phenolic extracts using the new lipoxygenase/4-nitroso-N,N-dimethylaniline (LOX/RNO) method, able to simultaneously detect different antioxidant mechanisms, as well as using the Oxygen Radical Absorbance Capacity (ORAC) and the Trolox Equivalent Antioxidant Capacity (TEAC) assays, which measure the scavenging activity against peroxyl and ABTS [2,2'-azino-bis-(3-ethylbenzothiazoline-6-sulfonate)] radicals, respectively. The species under study were compared with respect to the sum of AA values of H, L and FSP extracts (AA(H+L+FSP)), containing freely solvent-soluble antioxidants, and AA values of IBP extracts (AA(IBP)), representing the phenolic fraction ester-linked to insoluble cell wall polymers. The LOX/RNO and ORAC methods measured in quinoa flour a remarkable AA(H+L+FSP) higher than durum wheat, although lower than emmer; according to the same assays, the IBP component of quinoa resulted less active than the durum wheat and emmer ones. The TEAC protocol also revealed a high AA(H+L+FSP) for quinoa. Interestingly, the ratio AA(H+L+FSP)/AA(H+L+FSP+IBP), as evaluated by the LOX/RNO and ORAC assays, resulted in quinoa higher than that of both durum wheat and emmer, and much higher than durum wheat, according to the TEAC protocol. This may suggest that antioxidants from quinoa seeds may be more readily accessible with respect to that of both the examined wheat species. Quinoa seeds may represent an excellent source of natural antioxidant compounds and, in particular, of the free-soluble antioxidant fraction. These compounds may improve nutritive and health-beneficial properties of quinoa-based gluten-free products, thus expanding interest for quinoa utilization from
Sesquiterpene lactones. XXX. Cynaropicrin in species of the subtribe Centaureanae Dumort.
Directory of Open Access Journals (Sweden)
Gerard Nowak
2014-01-01
Full Text Available The presence of cynaropicrin was determined in 13 species of the subtribe Centaureinae Dumort.: Centaurea declinata M. B.- C. leucophylla M. B.. C. dealbata Willd.. C. zangezuri (Sosn. Sosn., C. carthalinica (Sosn. Sosn., C. thracica (Janka Hayek, C. exarata Boiss. ex Cosson, C. phaeopappoides Bordz., Chartolepis intermedia Bioss., Ch. glastifolia (L. Cass., Rhaponticum carthamoides (Willd. Iljin, Rh. serratuloides (Georgi Bobr., Leuzea rhapontica (L. Holub.
Rahayu, Budi; Baktiyani, Siti Candra Windu; Nurdiana, Nurdiana
2016-01-01
This study aims to investigate whether an ethanolic extract of Theobroma cacao bean is able to increase cell viability and decrease IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Endothelial cells were obtained from human umbilical vascular endothelial cells. At confluency, endothelial cells were divided into six groups, which included control (untreated), endothelial cells exposed to plasma from normal pregnancy, endothelial cells exposed to 2% plasma from preeclamptic patients (PP), endothelial cells exposed to PP in the presence of ethanolic extract of T. cacao (PP+TC) at the following three doses: 25, 50, and 100 ppm. The analysis was performed in silico using the Hex 8.0, LigPlus and LigandScout 3.1 software. Analysis on IL-6 and sVCAM-1 levels were done by enzyme linked immunosorbent assay (ELISA). We found that seven of them could bind to the protein NFκB (catechin, leucoanthocyanidin, niacin, phenylethylamine, theobromine, theophylline, and thiamin). This increase in IL-6 was significantly (Pcacao extract. Plasma from PP significantly increased sVCAM-1 levels compared to untreated cells. This increase in sVCAM-1 was significantly attenuated by all doses of the extract. In conclusion, T. cacao extract prohibits the increase in IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Therefore this may provide a herbal therapy for attenuating the endothelial dysfunction found in preeclampsia. Copyright © 2016 International Society for the Study of Hypertension in Pregnancy. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Percy Arapa Carcasi
2014-12-01
Full Text Available Las propiedades físicas de las semillas influencian parámetros de trabajo en los equipos y son esenciales para el diseño de estos y de instalaciones para la recolección, cosecha, transporte, separación, secado, aireación, almacenamiento y procesamiento. En la determinación de propiedades físicas algunas dependen o se originan de las dimensiones ortogonales. Los granos o semillas de quinua (Chenopodium quinoa Willd. se caracterizan por su pequeño tamaño. El propósito de este trabajo fue determinar características físicas en semillas de quinua mediante procesamiento digital de imágenes. Se usaron computadoras, cámaras digitales y un escáner. Se utilizaron dos muestras de quinua procesada. Con la primera muestra se ensayaron los programas PHOTO-PAINT, Photoshop, Paint, SmartGrain y GrainScan para comparación. Con Photoshop se determinó el color en porción de granos y de harina. Con la segunda muestra se midieron dimensiones con PHOTO-PAINT, que no ofreció diferencias con Photoshop y Paint, para la determinación de las características físicas. Hubo diferencias estadísticas significativas (p 0,05 entre los programas (PHOTO-PAINT, SmartGrain y GrainScan. Los valores de las coordenadas colorimétricas en la muestra de semillas de quinua fueron L* 70, a* 8 y b* 44 y en la harina L* 71, a* 3 y b* 34. La segunda muestra presentó valores promedios de largo 2,3638; ancho 2,0129 y espesor 1,0605 mm.
Rosa, Mariana; Hilal, Mirna; González, Juan A; Prado, Fernando E
2009-04-01
The effect of low temperature on growth, sucrose-starch partitioning and related enzymes in salt-stressed and salt-acclimated cotyledons of quinoa (Chenopodium quinoa Willd.) was studied. The growth of cotyledons and growing axes in seedlings grown at 25/20 degrees C (light/dark) and shifted to 5/5 degrees C was lower than in those only growing at 25/20 degrees C (unstressed). However, there were no significant differences between low-temperature control and salt-treated seedlings. The higher activities of sucrose phosphate synthase (SPS, EC 2.4.1.14) and soluble acid invertase (acid INV, EC 3.2.1.25) were observed in salt-stressed cotyledons; however, the highest acid INV activity was observed in unstressed cotyledons. ADP-glucose pyrophosphorylase (ADP-GPPase, EC 2.7.7.27) was higher in unstressed cotyledons than in stressed ones. However, between 0 and 4days the highest value was observed in salt-stressed cotyledons. The lowest value of ADP-GPPase was observed in salt-acclimated cotyledons. Low temperature also affected sucrose synthase (SuSy, EC 2.4.1.13) activity in salt-treated cotyledons. Sucrose and glucose were higher in salt-stressed cotyledons, but fructose was essentially higher in low-temperature control. Starch was higher in low-temperature control; however, the highest content was observed at 0day in salt-acclimated cotyledons. Results demonstrated that low temperature induces different responses on sucrose-starch partitioning in salt-stressed and salt-acclimated cotyledons. Data also suggest that in salt-treated cotyledons source-sink relations (SSR) are changed in order to supply soluble sugars and proline for the osmotic adjustment. Relationships between starch formation and SuSy activity are also discussed.
Directory of Open Access Journals (Sweden)
Rosma Hasibuan
2014-08-01
Full Text Available Impact of Permethrin-Insecticide Application on Mirid Pest of Cocoa Helopeltis spp. (Hemiptera: Miridae and on Non-target Arthropods in Cocoa Plantations (Theobroma cacao L.. Cocoa mirid bugs, Helopeltis spp., (Hemiptera: Miridae are the most important pest of cocoa in Indonesia. A field study was conducted to investigate the effect of permethrin on cocoa mirids and non-target arthropods at a cocoa plantation in specific place. A randomized complete block design was used in which each of four blocks consisted of 5 treatments (4 concentrations of permethrin; 50; 100; 200; and 250 ppm and control. The results indicated that the application of permethrin significantly increased the cocoa mirids mortaliiy throughout all sprayed cocoa trees (up to 100% 72 h after application. Even at 1 h after application, the percentage of Cocoa mirids mortality 29.2% - 53.9% on cocoa trees sprayed with permethrin at concentrations of 50 - 250 ppm was significantly higher than that on control plant (3.6%. At 72 h after treatments, application of permethrin at concentrations of 200 and 250 ppm caused a complete kill (mortalty of 100% in the test mirids. Meanwhile, ground cloths caught at least 22 fanilies of abore-ground arthropods that were found killed by permethrin applications. Moreover, the number of non-target arthropods killed by permethrin at concentrations of 100 - 250 ppm (27.3 - 85.3 individuals/ground cloth were signifcantly higher than that on control trees. These results demonstrated that despite high efficacy of permethrin in controlling of cocoa mirids (Hetopeltis spp., its application also had adverse effects on non-target arthropods incocoa plantations.
Laconi, Erika B; Jayanegara, Anuraga
2015-03-01
Cocoa pod is among the by-products of cocoa (Theobroma cacao) plantations. The aim of this study was to apply a number of treatments in order to improve nutritional quality of cocoa pod for feeding of ruminants. Cocoa pod was subjected to different treatments, i.e. C (cocoa pod without any treatment or control), CAm (cocoa pod+1.5% urea), CMo (cocoa pod+3% molasses), CRu (cocoa pod+3% rumen content) and CPh (cocoa pod+3% molasses+Phanerochaete chrysosporium inoculum). Analysis of proximate and Van Soest's fiber fraction were performed on the respective treatments. The pods were then subjected to an in vitro digestibility evaluation by incubation in rumen fluid-buffer medium, employing a randomized complete block design (n = 3 replicates). Further, an in vivo evaluation of the pods (35% inclusion level in total mixed ration) was conducted by feeding to young Holstein steers (average body weight of 145±3.6 kg) with a 5×5 latin square design arrangement (n = 5 replicates). Each experimental period lasted for 30 d; the first 20 d was for feed adaptation, the next 3 d was for sampling of rumen liquid, and the last 7 d was for measurements of digestibility and N balance. Results revealed that lignin content was reduced significantly when cocoa pod was treated with urea, molasses, rumen content or P. chrysosporium (pCAm>CRu>CMo. Among all treatments, CAm and CPh treatments significantly improved the in vitro dry matter and organic matter digestibility (pcocoa pod. Average daily gain of steers receiving CAm or CPh treatment was significantly higher than that of control (pcocoa pod.
Hipólito-Romero, E; Carcaño-Montiel, M G; Ramos-Prado, J M; Vázquez-Cabañas, E A; López-Reyes, L; Ricaño-Rodríguez, J
Cocoa plant (Theobroma cacao L.) is native from South America and it represents one of the most significant "bio-cultural" resources of Mesoamerica, since it is a region where it was domesticated and had a relevance as ritual drink and as currency in many pre-hispanic cultures until the arrival of the Spaniards who spread its use worldwide, and became it one of the most consumed commodity goods. Through this research, an alternative is proposed to address the problem of cultivars through the introduction of a wide variety of cocoa plants in traditional agroforestry systems, in synergy with the inoculation of nitrogen-fixing and insoluble phosphor solubilizing edaphic bacterial consortia. Four cultivars of improved grafted cocoa plants were introduced in a traditional agroforestry plot and three fertilization treatments were applied: application of biofertilizer, application of chemical fertilizer and control. Measurements of height, stem diameter, number of leaves and branches were recorded at 2 and 12 months after planting and rhizosphere microbial populations were characterized. Growth results showed good potential for all studied cultivars and it was observed that biofertilization foresees significant effects in some of the growth indicators of cocoa plant. Thereby, plant associations in an agroforestry system could be favorable to promote fruit development and resistance to pests and diseases. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Directory of Open Access Journals (Sweden)
Mariluze P Cruz
Full Text Available The bark of Mimosa tenuiflora (Willd. Poiret (Leguminosae family, popularly known as "jurema preta" in Brazil, is used by the population of Contendas of Sincorá (Bahia State, Brazil for the treatment of coughs and wound healing. Thus, the aim of this study was to evaluate the antinociceptive and anti-inflammatory activities of the bark ethanol extract (EEMT and solvent soluble fractions (hexane-H, DCM-D, EtOAc-E and BuOH-B of the extract in vivo. Additionally, we synthesized 5,7-dihidroxy-4'-methoxyflavanone (isosakuranetin and isolated the compound sakuranetin, and both compounds were also tested. The anti-inflammatory and antinociceptive assays performed were: writhing test; nociception induced by intraplantar formalin injection; leukocyte recruitment to the peritoneal cavity; evaluation of vascular permeability (Evans blue test; and evaluation of mechanical hypernociception (von Frey test. Production of TNF-α, IL-10, myeloperoxidase and the expression of ICAM-1 were also evaluated. Statistical analysis was performed by one-way ANOVA followed by the Bonferroni post-test (n = 8, with P < 0.05. The EEMT showed antinociceptive activities in writhing test (100-200 mg/kg, in the second phase of the formalin test (50-200 mg/kg, and in mechanical hypernociception (100 mg/kg. EEMT showed an anti-inflammatory effect by reducing neutrophil migration to the peritoneal cavity and in the plantar tissue detected by the reduction of myeloperoxidase activity (100 mg/kg, reduction of IL-10 levels and expression of ICAM-1 in the peritoneal exudate and the mesentery (100 mg/kg, respectively. The four soluble EEMT fractions showed good results in tests for antinociceptive (H, D, E, B and anti-inflammation (H, D, E. Only sakuranetin showed reduction of the writhing and neutrophil migration (200 mg/kg. Thus, the EEMT and soluble fractions of M. tenuiflora bark demonstrated great antinociceptive and anti-inflammatory activities, as also sakuranetin. More studies
Maliro, Moses F A; Guwela, Veronica F; Nyaika, Jacinta; Murphy, Kevin M
2017-01-01
The goal of sustainable intensification of agriculture in Malawi has led to the evaluation of innovative, regionally novel or under-utilized crop species. Quinoa ( Chenopodium quinoa Willd.) has the potential to provide a drought tolerant, nutritious alternative to maize. We evaluated 11 diverse varieties of quinoa for their yield and agronomic performance at two locations, Bunda and Bembeke, in Malawi. The varieties originated from Ecuador, Chile and Bolivia in South America; the United States and Canada in North America; and, Denmark in Europe, and were chosen based on their variation in morphological and agronomic traits, and their potential for adaptation to the climate of Malawi. Plant height, panicle length, days to maturity, harvest index, and seed yield were recorded for each variety under irrigation at Bunda and Bembeke, and under rainfed conditions at Bunda. Plant height was significantly influenced by both genotype and environment. There were also significant differences between the two locations for panicle length whereas genotype and genotype × environment (G × E) interaction were not significantly different. Differences were found for genotype and G × E interaction for harvest index. Notably, differences for genotype, environment and G × E were found for grain yield. Seed yield was higher at Bunda (237-3019 kg/ha) than Bembeke (62-692 kg/ha) under irrigated conditions. The highest yielding genotype at Bunda was Titicaca (3019 kg/ha) whereas Multi-Hued was the highest (692 kg/ha) at Bembeke. Strong positive correlations between seed yield and (1) plant height ( r = 0.74), (2) days to maturity ( r = 0.76), and (3) biomass ( r = 0.87) were found under irrigated conditions. The rainfed evaluations at Bunda revealed significant differences in seed yield, plant biomass, and seed size among the genotypes. The highest yielding genotype was Black Seeded (2050 kg/ha) followed by Multi-Hued (1603 kg/ha) and Bio-Bio (1446 kg/ha). Ecuadorian (257 kg/ha) was
Directory of Open Access Journals (Sweden)
M.G. Dias
2014-06-01
Full Text Available As plantas com potencial medicinal têm sido muito utilizadas para o tratamento de doenças no Brasil. O objetivo deste estudo foi avaliar o efeito genotóxico e antiproliferativo de infusões de Mikania cordifolia (L.F. Willd. sobre o ciclo celular de Allium cepa L. Foram coletadas duas populações no município de Santa Maria, Rio Grande do Sul, e, para cada uma, foram preparados dois tratamentos em duas concentrações: 4g/500mL e 16g/500mL, além de um controle positivo composto por 10% de glifosato em 90% água, um herbicida amplamente utilizado com conhecido potencial genotóxico, e de um controle negativo composto por água destilada. Após período de 24 horas, as radículas foram coletadas das infusões, fixadas em etanol-ácido acético (3:1 por 24 horas e estocadas em etanol 70%. Foram analisadas células em todas as fases do ciclo celular de A. cepa, totalizando 2500, para cada grupo de bulbos. Os índices mitóticos (IM foram calculados e submetidos à análise estatística pelo teste χ² a 5%. Os resultados mostraram que, em ambas as populações de M. cordifolia, houve redução do IM de todos os tratamentos em relação ao controle negativo. Em ambas as populações, obteve-se aumento nos valores dos índices mitóticos em função do aumento da concentração da infusão. Ocorreram aberrações cromossômicas em ambas as populações estudadas. Concluiu-se que as infusões de M. cordifolia, nas concentrações estudadas, possuem efeito antiproliferativo e mutagênico sobre o ciclo celular de A. cepa.
Energy Technology Data Exchange (ETDEWEB)
Chang, So Young; Park, Ji Hoon [Respiratory Viruses Research Laboratory, Discovery Biology Department, Institut Pasteur Korea, 16, Daewangpangyo-ro 712 Beon-gil, Bundang-gu, Seongnam-si, Gyeonggi-do, 463-400 (Korea, Republic of); Kim, Young Ho; Kang, Jong Seong [College of Pharmacy, Chungnam National University, Daejeon, 305-764 (Korea, Republic of); Min, Ji-Young, E-mail: jiyoung.min@ip-korea.org [Respiratory Viruses Research Laboratory, Discovery Biology Department, Institut Pasteur Korea, 16, Daewangpangyo-ro 712 Beon-gil, Bundang-gu, Seongnam-si, Gyeonggi-do, 463-400 (Korea, Republic of)
2016-03-04
The need to develop anti-influenza drugs with novel antiviral mechanisms is urgent because of the rapid rate of antigenic mutation and the emergence of drug-resistant viruses. We identified a novel anti-influenza molecule by screening 861 plant-derived natural components using a high-throughput image-based assay that measures inhibition of the influenza virus infection. 1,3,4,6-tetra-O-galloyl-β-D-glucopyranoside (TGBG) from Euphorbia humifusa Willd showed broad-spectrum anti-influenza activity against two seasonal influenza A strains, A/California/07/2009 (H1N1) and A/Perth/16/2009 (H3N2), and seasonal influenza B strain B/Florida/04/2006. We investigated the mode of action of TGBG using neuraminidase activity inhibition and time-of-addition assays, which evaluate the viral release and entry steps, respectively. We found that TGBG exhibits a novel antiviral mechanism that differs from the FDA-approved anti-influenza drugs oseltamivir which inhibits viral release, and amantadine which inhibits viral entry. Immunofluorescence assay demonstrated that TGBG significantly inhibits nuclear export of influenza nucleoproteins (NP) during the early stages of infection causing NP to accumulate in the nucleus. In addition, influenza-induced activation of the Akt signaling pathway was suppressed by TGBG in a dose-dependent manner. These data suggest that a putative mode of action of TGBG involves inhibition of viral ribonucleoprotein (vRNP) export from the nucleus to the cytoplasm consequently disrupting the assembly of progeny virions. In summary, TGBG has potential as novel anti-influenza therapeutic with a novel mechanism of action. - Highlights: • The plant-derived natural product TGBG has broad-spectrum antiviral activity against seasonal influenza A and B viruses. • TGBG has a novel anti-viral mechanism of action that from differs from the currently available anti-influenza drugs. • TGBG hinders nuclear export of the influenza virus ribonucleoprotein (v
International Nuclear Information System (INIS)
Chang, So Young; Park, Ji Hoon; Kim, Young Ho; Kang, Jong Seong; Min, Ji-Young
2016-01-01
The need to develop anti-influenza drugs with novel antiviral mechanisms is urgent because of the rapid rate of antigenic mutation and the emergence of drug-resistant viruses. We identified a novel anti-influenza molecule by screening 861 plant-derived natural components using a high-throughput image-based assay that measures inhibition of the influenza virus infection. 1,3,4,6-tetra-O-galloyl-β-D-glucopyranoside (TGBG) from Euphorbia humifusa Willd showed broad-spectrum anti-influenza activity against two seasonal influenza A strains, A/California/07/2009 (H1N1) and A/Perth/16/2009 (H3N2), and seasonal influenza B strain B/Florida/04/2006. We investigated the mode of action of TGBG using neuraminidase activity inhibition and time-of-addition assays, which evaluate the viral release and entry steps, respectively. We found that TGBG exhibits a novel antiviral mechanism that differs from the FDA-approved anti-influenza drugs oseltamivir which inhibits viral release, and amantadine which inhibits viral entry. Immunofluorescence assay demonstrated that TGBG significantly inhibits nuclear export of influenza nucleoproteins (NP) during the early stages of infection causing NP to accumulate in the nucleus. In addition, influenza-induced activation of the Akt signaling pathway was suppressed by TGBG in a dose-dependent manner. These data suggest that a putative mode of action of TGBG involves inhibition of viral ribonucleoprotein (vRNP) export from the nucleus to the cytoplasm consequently disrupting the assembly of progeny virions. In summary, TGBG has potential as novel anti-influenza therapeutic with a novel mechanism of action. - Highlights: • The plant-derived natural product TGBG has broad-spectrum antiviral activity against seasonal influenza A and B viruses. • TGBG has a novel anti-viral mechanism of action that from differs from the currently available anti-influenza drugs. • TGBG hinders nuclear export of the influenza virus ribonucleoprotein (v
Bendas, Ehab Rasmy; Basalious, Emad B
2016-01-01
Our objective was to develop novel vagina retentive cream suppositories (VRCS) of progesterone having rapid disintegration and good vaginal retention. VRCS of progesterone were prepared using oil in water (o/w) emulsion of mineral oil or theobroma oil in hard fat and compared with conventional vaginal suppositories (CVS) prepared by hard fat. VRCS formulations were tested for content uniformity, disintegration, melting range, in vitro release and stability studies. The most stable formulation (VRCS I) was subjected to scaling-up manufacturing and patients' satisfaction test. The rapid disintegration, good retentive properties are applicable through the inclusion of emulsified theobroma oil rather than hydrophilic surfactant into the hard fat bases. The release profile of progesterone from VRCS I showed a biphasic pattern due to the formation of progesterone reservoir in the emulsified theobroma oil. All volunteers involved in patients' satisfaction test showed high satisfactory response to the tested formulation (VRCS). The in vivo pharmacokinetic study suggests that VRCS of progesterone provided higher rate and extent of absorption compared to hard fat based suppositories. Our results proposed that emulsified theobroma oil could be promising to solve the problems of poor patients' satisfaction and variability of drug absorption associated with hard fat suppositories.
Signals can trump rewards in attracting seed-dispersing ants.
Directory of Open Access Journals (Sweden)
Kyle M Turner
Full Text Available Both rewards and signals are important in mutualisms. In myrmecochory, or seed dispersal by ants, the benefits to plants are relatively well studied, but less is known about why ants pick up and move seeds. We examined seed dispersal by the ant Aphaenogaster rudis of four co-occurring species of plants, and tested whether morphology, chemical signaling, or the nutritional quality of fatty seed appendages called elaiosomes influenced dispersal rates. In removal trials, ants quickly collected diaspores (seeds plus elaiosomes of Asarum canadense, Trillium grandiflorum, and Sanguinaria canadensis, but largely neglected those of T. erectum. This discrepancy was not explained by differences in the bulk cost-benefit ratio, as assessed by the ratio of seed to elaiosome mass. We also provisioned colonies with diaspores from one of these four plant species or no diaspores as a control. Colonies performed best when fed S. canadensis diaspores, worst when fed T. grandiflorum, and intermediately when fed A. canadense, T. erectum, or no diaspores. Thus, the nutritional rewards in elaiosomes affected colony performance, but did not completely predict seed removal. Instead, high levels of oleic acid in T. grandiflorum elaiosomes may explain why ants disperse these diaspores even though they reduce ant colony performance. We show for the first time that different elaiosome-bearing plants provide rewards of different quality to ant colonies, but also that ants appear unable to accurately assess reward quality when encountering seeds. Instead, we suggest that signals can trump rewards as attractants of ants to seeds.
Functional anatomy of the water transport system in cut chrysanthemum
Nijsse, J.
2001-01-01
Cut flowers show a wide variance of keepability. The market demands more and more a guaranteed quality. Therefore, methods must be developed to predict vase life of cut flowers. Chrysanthemum ( Dendranthema x grandiflorum Tzvelev) and some other cut flowers suffer from
Directory of Open Access Journals (Sweden)
Omar Miguel Tarqui Freire
2017-07-01
Full Text Available El Programa de Mejoramiento del Cacao y el Café en el INIAP EET-Pichilingue ha estado estudiando, durante varios años, los genotipos de cacao más altos (Theobroma cacao L. caracterizados por la resistencia genética a las principales enfermedades, especialmente la escoba de brujas (Moniliophthora perniciosa Factor limitante para su cultivo en varios países de América Central y del Sur. El objetivo de la investigación fue identificar y seleccionar los clones de cacao con una baja incidencia de la enfermedad de la escoba de brujas. Se probaron 21 genotipos (14 resultantes de Amazonas x Amazonas y (4 de Amazonas x Cruces Nacionales. Entre la población derivada de cruces nacionales vs. nacionales, no se encontraron genotipos mostrando resistencia a la enfermedad. Además, se seleccionó INIAPT 074 del cruce entre CCN 51 x B 60 y TIP 1 y TAP 6 como clones de control. Se evaluaron las siguientes características: Número de mazorcas sanas (MS, Peso fresco (PF, Número de mazorcas enfermas (ME, Número de escobas vegetativas (EBveg, Número de escobas portadoras (EBcojin y Número de chirimoyas. Un análisis de componentes principales y un análisis de conglomerados se realizaron utilizando el método de Ward y se construyó un dendrograma para determinar la similitud entre las características productivas y sanitarias. Se determinó que los genotipos resultantes del cruce amazónico x amazónico: INIAPT 527, INIAPT 560 e INIAPT 526 presentaron menor incidencia de escobas y se identificaron como fuentes de resistencia genética a Moniliophthora perniciosa.
Ruiz-Carrasco, Karina; Antognoni, Fabiana; Coulibaly, Amadou Konotie; Lizardi, Susana; Covarrubias, Adriana; Martínez, Enrique A; Molina-Montenegro, Marco A; Biondi, Stefania; Zurita-Silva, Andrés
2011-11-01
Chenopodium quinoa (Willd.) is an Andean plant showing a remarkable tolerance to abiotic stresses. In Chile, quinoa populations display a high degree of genetic distancing, and variable tolerance to salinity. To investigate which tolerance mechanisms might account for these differences, four genotypes from coastal central and southern regions were compared for their growth, physiological, and molecular responses to NaCl at seedling stage. Seeds were sown on agar plates supplemented with 0, 150 or 300mM NaCl. Germination was significantly reduced by NaCl only in accession BO78. Shoot length was reduced by 150mM NaCl in three out of four genotypes, and by over 60% at 300mM (except BO78 which remained more similar to controls). Root length was hardly affected or even enhanced at 150mM in all four genotypes, but inhibited, especially in BO78, by 300mM NaCl. Thus, the root/shoot ratio was differentially affected by salt, with the highest values in PRJ, and the lowest in BO78. Biomass was also less affected in PRJ than in the other accessions, the genotype with the highest increment in proline concentration upon salt treatment. Free putrescine declined dramatically in all genotypes under 300mM NaCl; however (spermidine+spermine)/putrescine ratios were higher in PRJ than BO78. Quantitative RT-PCR analyses of two sodium transporter genes, CqSOS1 and CqNHX, revealed that their expression was differentially induced at the shoot and root level, and between genotypes, by 300mM NaCl. Expression data are discussed in relation to the degree of salt tolerance in the different accessions. Copyright © 2011 Elsevier Masson SAS. All rights reserved.
Gómez-Caravaca, Ana María; Segura-Carretero, Antonio; Fernández-Gutiérrez, Alberto; Caboni, Maria Fiorenza
2011-10-26
A new liquid chromatography methodology coupled to a diode array detector and a time-of-flight mass spectrometer has been developed for the simultaneous determination of phenolic compounds and saponins in quinoa (Chenopodium quinoa Willd). This method has allowed the simultaneous determination of these two families of compounds with the same analytical method for the first time. A fused-core column C18 has been used, and the analysis has been performed in less than 27 min. Both chromatographic and electrospray ionization time-of-flight mass spectrometry parameters have been optimized to improve the sensitivity and to maximize the number of compounds detected. A validation of the method has also been carried out, and free and bound polar fractions of quinoa have been studied. Twenty-five compounds have been tentatively identified and quantified in the free polar fraction, while five compounds have been tentatively identified and quantified in the bound polar fraction. It is important to highlight that 1-O-galloyl-β-D-glucoside, acacetin, protocatechuic acid 4-O-glucoside, penstebioside, ethyl-m-digallate, (epi)-gallocatechin, and canthoside have been tentatively identified for the first time in quinoa. Free phenolic compounds have been found to be in the range of 2.746-3.803 g/kg of quinoa, while bound phenolic compounds were present in a concentration that varies from 0.139 and 0.164 g/kg. Indeed, saponins have been found to be in a concentration that ranged from 5.6 to 7.5% of the total composition of whole quinoa flour.
Directory of Open Access Journals (Sweden)
Blackmon Barbara P
2011-07-01
Full Text Available Abstract Background BAC-based physical maps provide for sequencing across an entire genome or a selected sub-genomic region of biological interest. Such a region can be approached with next-generation whole-genome sequencing and assembly as if it were an independent small genome. Using the minimum tiling path as a guide, specific BAC clones representing the prioritized genomic interval are selected, pooled, and used to prepare a sequencing library. Results This pooled BAC approach was taken to sequence and assemble a QTL-rich region, of ~3 Mbp and represented by twenty-seven BACs, on linkage group 5 of the Theobroma cacao cv. Matina 1-6 genome. Using various mixtures of read coverages from paired-end and linear 454 libraries, multiple assemblies of varied quality were generated. Quality was assessed by comparing the assembly of 454 reads with a subset of ten BACs individually sequenced and assembled using Sanger reads. A mixture of reads optimal for assembly was identified. We found, furthermore, that a quality assembly suitable for serving as a reference genome template could be obtained even with a reduced depth of sequencing coverage. Annotation of the resulting assembly revealed several genes potentially responsible for three T. cacao traits: black pod disease resistance, bean shape index, and pod weight. Conclusions Our results, as with other pooled BAC sequencing reports, suggest that pooling portions of a minimum tiling path derived from a BAC-based physical map is an effective method to target sub-genomic regions for sequencing. While we focused on a single QTL region, other QTL regions of importance could be similarly sequenced allowing for biological discovery to take place before a high quality whole-genome assembly is completed.
Thomas, Evert; van Zonneveld, Maarten; Loo, Judy; Hodgkin, Toby; Galluzzi, Gea; van Etten, Jacob
2012-01-01
Cacao (Theobroma cacao L.) is indigenous to the Amazon basin, but is generally believed to have been domesticated in Mesoamerica for the production of chocolate beverage. However, cacao's distribution of genetic diversity in South America is also likely to reflect pre-Columbian human influences that were superimposed on natural processes of genetic differentiation. Here we present the results of a spatial analysis of the intra-specific diversity of cacao in Latin America, drawing on a dataset of 939 cacao trees genotypically characterized by means of 96 SSR markers. To assess continental diversity patterns we performed grid-based calculations of allelic richness, Shannon diversity and Nei gene diversity, and distinguished different spatially coherent genetic groups by means of cluster analysis. The highest levels of genetic diversity were observed in the Upper Amazon areas from southern Peru to the Ecuadorian Amazon and the border areas between Colombia, Peru and Brazil. On the assumption that the last glaciation (22,000-13,000 BP) had the greatest pre-human impact on the current distribution and diversity of cacao, we modeled the species' Pleistocene niche suitability and overlaid this with present-day diversity maps. The results suggest that cacao was already widely distributed in the Western Amazon before the onset of glaciation. During glaciations, cacao populations were likely to have been restricted to several refugia where they probably underwent genetic differentiation, resulting in a number of genetic clusters which are representative for, or closest related to, the original wild cacao populations. The analyses also suggested that genetic differentiation and geographical distribution of a number of other clusters seem to have been significantly affected by processes of human management and accompanying genetic bottlenecks. We discuss the implications of these results for future germplasm collection and in situ, on farm and ex situ conservation of cacao.
Zhang, Yufan; Clemens, Adam; Maximova, Siela N; Guiltinan, Mark J
2014-04-24
The Arabidopsis thaliana LEC2 gene encodes a B3 domain transcription factor, which plays critical roles during both zygotic and somatic embryogenesis. LEC2 exerts significant impacts on determining embryogenic potential and various metabolic processes through a complicated genetic regulatory network. An ortholog of the Arabidopsis Leafy Cotyledon 2 gene (AtLEC2) was characterized in Theobroma cacao (TcLEC2). TcLEC2 encodes a B3 domain transcription factor preferentially expressed during early and late zygotic embryo development. The expression of TcLEC2 was higher in dedifferentiated cells competent for somatic embryogenesis (embryogenic calli), compared to non-embryogenic calli. Transient overexpression of TcLEC2 in immature zygotic embryos resulted in changes in gene expression profiles and fatty acid composition. Ectopic expression of TcLEC2 in cacao leaves changed the expression levels of several seed related genes. The overexpression of TcLEC2 in cacao explants greatly increased the frequency of regeneration of stably transformed somatic embryos. TcLEC2 overexpressing cotyledon explants exhibited a very high level of embryogenic competency and when cultured on hormone free medium, exhibited an iterative embryogenic chain-reaction. Our study revealed essential roles of TcLEC2 during both zygotic and somatic embryo development. Collectively, our evidence supports the conclusion that TcLEC2 is a functional ortholog of AtLEC2 and that it is involved in similar genetic regulatory networks during cacao somatic embryogenesis. To our knowledge, this is the first detailed report of the functional analysis of a LEC2 ortholog in a species other then Arabidopsis. TcLEC2 could potentially be used as a biomarker for the improvement of the SE process and screen for elite varieties in cacao germplasm.
Zhang, Dapeng; Arevalo-Gardini, Enrique; Mischke, Sue; Zúñiga-Cernades, Luis; Barreto-Chavez, Alejandro; Del Aguila, Jorge Adriazola
2006-09-01
Cocoa (Theobroma cacao) is indigenous to the Amazon region of South America, and it is well known that the Peruvian Amazon harbours a large number of diverse cocoa populations. A small fraction of the diversity has been collected and maintained as an ex-situ germplasm repository in Peru. However, incorrect labelling of accessions and lack of information on genetic diversity have hindered efficient conservation and use of this germplasm. This study targeted assessment of genetic diversity and population structure in a managed and a semi-natural population. Using a capillary electrophoresis genotyping system, 105 cocoa accessions collected from the Huallaga and Ucayali valleys of Peru were fingerprinted. Based on 15 loci SSR profiles, genetic identity was examined for each accession and duplicates identified, population structure assessed and genetic diversity analysed in these two populations. Ten synonymous mislabelled groups were identified among the 105 accessions. The germplasm group in the Huallaga valley was clearly separated from the group in Ucayali valley by the Bayesian assignment test. The Huallaga group has lower genetic diversity, both in terms of allelic richness and of gene diversity, than the Ucayali group. Analysis of molecular variance suggested genetic substructure in the Ucayali group. Significant spatial correlation between genetic distance and geographical distances was detected in the Ucayali group by Mantel tests. These results substantiate the hypothesis that the Peruvian Amazon hosts a high level of cocoa genetic diversity, and the diversity has a spatial structure. The introduction of exotic seed populations into the Peruvian Amazon is changing the cocoa germplasm spectrum in this region. The spatial structure of cocoa diversity recorded here highlights the need for additional collecting and conservation measures for natural and semi-natural cocoa populations.
Directory of Open Access Journals (Sweden)
Kelly Alexsandra Souza Menezes
Full Text Available ABSTRACT Legume-rhizobia symbiosis is a cross-kingdom association that results in large amounts of nitrogen incorporated in food webs. For the Brazilian semi-arid region, data on genetic variability and symbiotic efficiency of Papilionoidae rhizobial communities are very scarce. The aim of this study was to evaluate the genetic variability and the symbiotic efficiency of eight rhizobial isolates obtained from “mulungu” (Erythrina velutina Willd. nodules. For 16S rRNA gene sequencing, the genomic DNA was extracted using a commercial kit, amplified with universal primers, and subjected to sequencing reactions. For the isolate ESA 71, PCR amplifications for nodC and nodA genes were attempted. Rhizobial efficiency was assessed by two greenhouse experiments. The first assay was carried out under gnotobiotic conditions, with sterile sand as a substrate; the second experiment was conducted in a non-sterile soil. For both experiments, the inoculation treatments consisted of a single inoculation of each isolate, in addition to a treatment with Bradyrhizobium elkanii BR 5609 as a reference strain. Furthermore, two non-inoculated control treatments, supplied and not supplied with mineral N, were also evaluated. Bacterial identification indicated that both α and β-rhizobia could be found in “mulungu” root nodules. Three isolates where classified within the Rhizobium genus, four bacteria belonged to Bradyrhizobium and one isolate clustered with Burkholderia. Positive amplification of an intragenic fragment of the nodA gene using a primer set to β-rhizobia could be found for ESA 71 (Burkholderia. All bacterial isolates were effective in colonizing “mulungu” roots. In the first experiment, all inoculated treatments and N fertilization increased the N concentration in “mulungu” shoot tissues. For total N in the shoots, the isolates ESA 70, ESA 72, and ESA 75 stood out. In the non-sterile substrate experiment, the isolates ESA 70, ESA 71, ESA
Directory of Open Access Journals (Sweden)
Yuspihana Fitrial
2013-03-01
Full Text Available The Potency of Waterlily’s Seed (Nymphaea pubescens Willd and Its Extract as DiarrheaPreventative in Rats that Intervented with Enterophatogenic Escherichia coli Yuspihana Fitrial, Made Astawan, Soewarno T.Soekarto,Komang G.Wiryawan, Tutik Wresdiyati ABSTRAK Penelitian ini bertujuan untuk mengetahui komponen Þ tokimia yang terdapat pada biji teratai dan ekstrak etil asetat bijiteratai dan mengetahui aktivitas antibakterinya terhadap E.coli penyebab diare (E.coli Enteropatogenik K1.1, EPECK1.1 pada tikus percobaan. Perlakuan diberikan pada tikus jantan jenis Sprague Dawley (berat 140 ±5 g selama28 hari. Tikus percobaan dibagi menjadi 4 grup yaitu, grup 1, kontrol (mendapatkan ransum standar, grup 2 yangmendapat ransum yang disubstitusi tepung biji teratai (18,7 g/100 g, grup 3 yang mendapat ransum yang disubstitusiFOS (fruktooligosakarida, 6 g/100 g, dan grup 4 yang mendapat ransum standar dan ekstrak etil asetat biji teratai(17,8 mg/ml. Setelah 2 minggu perlakuan ransum, tikus percobaan diintervensi secara oral dengan 0,3 ml dari 106CFU/ml EPEC K1.1 selama 1 minggu sehingga diare. Aktivitas biologis ransum perlakuan diamati dengan mengamatibobot badan, konsumsi ransum per hari, eÞ siensi ransum, total mikroba, total E.coli dan total bakteri asam laktatdari isi sekum tikus percobaan. Hasil penelitian menunjukkan bahwa biji teratai mengandung alkaloid, ß avonoid,steroid, glikosida, tanin, saponin, dan triterpenoid, sedangkan ekstrak etil asetat biji teratai mengandung alkaloid,ß avonoid, tanin, glikosida, saponin dan triterpenoid. Substitusi biji teratai pada ransum mampu menurunkan totalE.coli isi sekum, baik setelah intervensi maupun setelah intervensi EPEC dihentikan. Sementara pemberian ekstrakbiji teratai mampu menurunkan total E.coli isi sekum setelah intervensi dihentikan. EÞ siensi ransum pada grup yangdisubstitusi biji teratai lebih tinggi dibandingkan kontrol dan ekstrak biji teratai (P<0.05. Perlakuan substitusi bijiteratai, dan
Seng, John; Herrera, Geovanny; Vaughan, Christopher S; McCoy, Michael B
2014-09-01
Cacao (Theobroma cacao) is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthllora roreri, known commonly as "monilia", has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Thichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia) at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma). Each treatment was applied to four trees of each clone. We monitored the incidence of monilia infection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p ≤ 0.05) in only 35d, as compared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1,500 kg dried beans/ha by 198 kg/ha up to 1,698 kg/ha or by a total increase over the whole 110 ha plantation by 21,780 kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days) would decrease infection incidence even more. Application of this fungal control
Gas Chromatographic-Mass Spectrometric Analysis of Essential Oil ...
African Journals Online (AJOL)
hepatitis, dysmenorrhea, stomatitis, duodenitis and depression in south China [1]. There are few reports about its chemical constituents and pharmacological properties, such as the hydroalcoholic extract from the buds of. Jasminum grandiflorum showing preferable antiviral efficacy against HBV replication in. HepG2 2.2.15 ...
Detection and Management of Mango Dieback Disease in the United Arab Emirates
Saeed, Esam Eldin; Sham, Arjun; A. Al Shurafa, Khawla; S. Al Naqbi, Tahra; Iratni, Rabah; El-Tarabily, Khaled; F. AbuQamar, Synan
2017-01-01
Mango is affected by different decline disorders causing significant losses to mango growers. In the United Arab Emirates (UAE), the pathogen was isolated from all tissues sampled from diseased trees affected by Lasiodiplodia theobromae. Symptoms at early stages of the disease included general wilting appearance of mango trees, and dieback of twigs. In advanced stages, the disease symptoms were also characterized by the curling and drying of leaves, leading to complete defoliation of the tree and discolouration of vascular regions of the stems and branches. To substantially reduce the devastating impact of dieback disease on mango, the fungus was first identified based on its morphological and cultural characteristics. Target regions of 5.8S rRNA (ITS) and elongation factor 1-α (EF1-α) genes of the pathogen were amplified and sequenced. We also found that the systemic chemical fungicides, Score®, Cidely® Top, and Penthiopyrad®, significantly inhibited the mycelial growth of L. theobromae both in vitro and in the greenhouse. Cidely® Top proved to be a highly effective fungicide against L. theobromae dieback disease also under field conditions. Altogether, the morphology of the fruiting structures, molecular identification and pathogenicity tests confirm that the causal agent of the mango dieback disease in the UAE is L. theobromae. PMID:29053600
Directory of Open Access Journals (Sweden)
Fazzatul Rahmi
2017-04-01
Full Text Available Abstrak. Fermentasi merupakan kegiatan untuk melepaskan zat lendir dari permukaan kulit biji dan menghasilkan biji mutu dan aroma yang baik. Selain itu fermentasi juga dilakukan untuk menghindari tumbuhnya jamur selama masa penyimpanan. Selama fermentasi berlangsung akan terjadinya perpindahan panas/ suhu di dalam kotak fermentasi. Tujuan yang ingin dicapai dalam penelitian yaitu untuk melihat perubahan suhu selama proses fermentasi, mengetahui pengaruh bahan kotak (kayu dan styrofoam terhadap perpindahan panas di dalam kotak fermentasi dan perpindahan panas dari dalam kotak fermentasi terhadap lingkungan luar. Hasil penelitian yang diperoleh bahwa suhu ideal fermentasi pada kotak kayu dihasilkan pada hari ke-5, sedangkan kotak styrofoam suhu ideal dihasilkan pada hari ke-3. Perpindahan panas pada bahan kayu suhunya lebih tinggi dibandingkan dengan bahan styrofoam. Hal ini disebabkan karena panas pada kotak kayu keluar lebih cepat, sehingga suhu pada proses fermentasi bisa lebih rendah dibandingkan menggunakan kotak styrofoam. Hasil fermentasi biji kakao dengan menggunakan kotak kayu didapatkan biji kakao yang bagus yaitu pada hari ke-5 fermentasi dan kotak styrofoam pada hari ke-5 fermentasi didapatkan biji kakao yang berjamur. Analysis Of Transfer Heat Room Of Cocoa Seed Fermentation (Theobroma cacao L. Using Wood Box and Styrofoam Abstract. Fermentation is an activity to remove mucous substances from the skin surface to produce quality of seed and good aroma. In addition, fermentation also done to avoid the growth of mold during storage period. During fermentation, the heat transfer / temperature will be happen inside the fermentation box. The aim of this study is to observe the changes of temperature during the fermentation process, knowing the effect of packaging materials (wood and styrofoam to heat transfer in the fermentation box and heat transfer from inside of fermentation box to the environment in the outside. The results showed
Ayenor, G.K.; Huis, van, A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.
2007-01-01
Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma (Distant) (both Hemiptera: Miridae). Annual crop loss caused by capsids is estimated at 25¿30%. To control capsids, formal research recommends application of synthetic insecticides four times between Augu...
Gynostemma (Cucurbitaceae) in Thailand and Malesia
Wilde, de W.J.J.O.; Duyfjes, B.E.E.
2007-01-01
The genus Gynostemma is represented in Thailand and Malesia by four species of which the extremely variable G. pentaphyllum is widespread covering the whole area. Seven forms are recognized in G. pentaphyllum, of which three are new: forma fasciculare W.J. de Wilde & Duyfjes, forma grandiflorum W.J.
First report of Moroccan pepper virus on Lisianthus in Iran and Worldwide
Belkzadeh, N.; Peters, D.; Hassani-Mehraban, A.
2011-01-01
During the last decade, lisianthus (Eustoma grandiflorum) has been introduced in Iran in the horticultural cut-flower industry. This crop is currently produced in more than 800 small greenhouses on a surface of an estimated 0.8 km2 in the Pakdasht region (southeast of Teheran Province). Plants
Gas Chromatographic-Mass Spectrometric Analysis of Essential Oil ...
African Journals Online (AJOL)
Purpose: To analyze the essential oil composition of the flower of Jasminum officinale L. var. grandifloroum L. (Jasminum grandiflorum) by gas chromatography-mass spectrometry (GC-MS). Methods: The optimum GC-MS conditions used for the analysis were 250 oC inlet temperature, 150 oC MSD detector temperature, ...
Directory of Open Access Journals (Sweden)
Amang, J.
2005-01-01
Full Text Available Feeding Preferences of Sahlbergella singularis Hagl. (Hemiptera: Miridae to some Cocoa (Theobroma cacao L. Clones. The selection of cocoa clones, resistant to Sahlbergella singularis Hagl. was done in the laboratory according to the standardized method of indoor microtests based on the study of mirid feeding preferences. Fourteen cocoa clones were involved. The Sca6 clone was the control. An index (i which expresses the ratio of the number of stings on the clone to that obtained on the control was calculated for each cultivar. Which has enabled to quantify the levels of attractiveness of cocoa clones to S. singularis and to classify these clones in three groups: less attractive clones (i< 1, non different (i= 1 and more attractive (i> 1. The results obtained showed that the mean numbers of feeding stings on the control (tr ranged from 5.49 to 5.62 (5.49≤ tr≤ 5.62 and that obtained on the other clones (tc from 5.29 to 6.18 (5.29≤ tc ≤ 6.18. The Na33 clone had the highest stings mean number (6.18 and IFC 100 the lowest one (5.29. The High Amazonian clone Na33 was the most attractive and the clones ICS100, IFC100, (exotic trinitario, Sca12 (catongo and Na32 (High Amazonian were less attractive. On the other hand the clones IFC1363, IFC1362, IFC1374 (catongo, UPA337, T60/887, ICS1 and IMC60 (High Amazonians and ICS95 (exotic trinitario were non different. The reactivity seemed not depending on the origin of the clone. Save the High Amazonian clone Na33 which was the most attractive there were among non different and less attractive clones as well exotic trinitario, catongo as High Amazonians.
Directory of Open Access Journals (Sweden)
Jaime A. Osorio-Guarín
2017-11-01
Full Text Available Beans of the species Theobroma cacao L., also known as cacao, are the raw material to produce chocolate. Colombian cacao has been classified as a fine flavor cacao that represents the 5% of cacao world’s production. Colombian genetic resources from this species are conserved in ex situ and in-field germplasm banks, since T. cacao has recalcitrant seeds to desication and long-term storage. Currently, the collection of T. cacao of the Colombian Corporation of Agricultural Research (CORPOICA has approximately 700 germplasm accessions. We conducted a molecular analysis of Corpoica’s cacao collection and a morphological characterization of some accessions with the goal to study its genetic diversity and population structure and, to select interesting accessions for the cacao’s breeding program. Phenotypic evaluation was performed based on 18 morphological traits and 4 biochemical traits. PCA analysis of morphological traits explained 60.6% of the total variation in seven components and 100% of the total variation of biochemical traits in four components, grouping the collection in 4 clusters for both variables. We explored 565 accessions from Corpoica’s germplasm and 252 accessions from reference populations using 96 single nucleotide polymorphism (SNP molecular markers. Molecular patterns of cacao Corpoica’s collection were obtained amplifying specific alleles in a Fluidigm platform that used integrated circuits of fluids. Corpoica’s collection showed highest genetic diversity [Expected Heterozygosity (HE = 0.314, Observed Heterozygosity (HO = 0.353] that is reduced when reference populations were included in the dataset (HE = 0.294, HO = 0.261. The collection was divided into four clusters based on population structure analysis. Cacao accessions from distinct groups showed some taxonomic concordance and reflected their geographic origins. For instance, accessions classified as Criollo were clearly differentiated in one group and we
Directory of Open Access Journals (Sweden)
Danilo Scordia
2015-12-01
Full Text Available Great effort has been placed to identify the most suited bioenergy crop under different environments and management practices, however, there is still need to find new genetic resources for constrained areas. For instance, South Mediterranean area is strongly affected by prolonged drought, high vapour pressure deficit (VPD and extremely high temperatures during summertime. In the present work we investigated the soil water effect on crop growth and leaf gas exchange of Saccharum spontaneum L. ssp. aegyptiacum (Willd. Hackel, a perennial, rhizomatous, herbaceous grass. Furthermore, the net increase of biomass production per unit light intercepted [radiation use efficiency (RUE] and per unit water transpired [water use efficiency (WUE] was also studied. To this end a field trial was carried out imposing three levels of soil water availability (I100, I50 and I0, corresponding to 100%, 50% and 0% of ETm restutition under a semi-arid Mediterranean environment. Leaf area index (LAI, stem height, biomass dry matter yield, CO2 assimilation rate, and transpiration rate resulted significantly affected by measurement time and irrigation treatment, with the highest values in I100 and the lowest in I0. RUE was the highest in I100 followed by I50 and I0; on the other hand, WUE was higher in I0 than I50 and I100. At LAI values greater than 2.0, 85% photosynthetically active radiation was intercepted by the Saccharum stand, irrespective of the irrigation treatment. Saccharum spontaneum spp. aegyptiacum is a potential species for biomass production in environment characterized by drought stress, high temperatures and high VPD, as those of Southern Europe and similar semi-arid areas.
Urumarudappa, Santhosh Kumar Jayanthinagar; Gogna, Navdeep; Newmaster, Steven G; Venkatarangaiah, Krishna; Subramanyam, Ragupathy; Saroja, Seethapathy Gopalakrishnan; Gudasalamani, Ravikanth; Dorai, Kavita; Ramanan, Uma Shaanker
2016-11-01
Saraca asoca (Roxb.) Willd, commonly known as "Asoka" or "Ashoka," is one of the most important medicinal plants used in raw herbal trade in India. The bark extracts of the tree are used in the treatment of leucorrhea and other uterine disorders besides also having anti-inflammatory, anti-bacterial, anti-pyretic, anti-helminthic, and analgesic activity. The indiscriminate and rampant extraction of the wood to meet the ever-increasing market demand has led to a sharp decline in naturally occurring populations of the species in the country. Consequently, the species has recently been classified as "vulnerable" by the International Union for Conservation of Nature (IUCN). Increasing deforestation and increasing demand for this medicinal plant have resulted in a limited supply and suspected widespread adulteration of the species in the raw herbal trade market. Adulteration is a serious concern due to: (i) reduction in the efficacy of this traditional medicine, (ii) considerable health risk to consumers, and (iii) fraudulent product substitution that impacts the economy for the Natural Health Product (NHP) Industry and consumers. In this paper, we provide the first attempt to assess the extent of adulteration in the raw herbal trade of S. asoca using DNA barcoding validated by NMR spectroscopic techniques. Analyzing market samples drawn from 25 shops, mostly from peninsular India, we show that more than 80 % of the samples were spurious, representing plant material from at least 7 different families. This is the first comprehensive and large-scale study to demonstrate the widespread adulteration of market samples of S. asoca in India. These results pose grave implications for the use of raw herbal drugs, such as that of S. asoca, on consumer health and safety. Based on these findings, we argue for a strong and robust regulatory framework to be put in place, which would ensure the quality of raw herbal trade products and reassure consumer confidence in indigenous
Directory of Open Access Journals (Sweden)
John Seng
2014-09-01
Full Text Available Cacao (Theobroma cacao is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthora roreri, known commonly as “monilia”, has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. Fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Trichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma. Each treatment was applied to four trees of each clone. We monitored the incidence of moniliainfection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p<0.05 in only 35d, ascompared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1 500kg dried beans/ha by 198kg/ha up to 1 698kg/ha or by a total increase over the whole 110ha plantation by 21 780kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days would decrease infection incidence even more. Application of this fungal
Directory of Open Access Journals (Sweden)
Gheorghe FLORENTA
2018-03-01
Full Text Available A fost determinată activitatea sumară a oxidazelor, catalazelor şi a substanţelor reducătoare a extractelor din mugurii stejarului pufos prelevaţi primăvara de la arborii care cresc în diferite condiţii staţionale din sudul Republicii Moldova. În extracte se manifesta clar tendinţa de sporire a capacităţii sumare de utilizare a oxigenului datorită potenţialului reductiv al substanţelor fenolice şi activităţii oxidazelor la arborii care cresc mai la sud, ceea ce corespunde gradientului de sporire a temperaturii primăvara în direcţia nord-sud. Această tendinţă s-a manifestat şi pentru activitatea catalazelor, dar mai puţin pronunţat. Primăvara, în celulele mugurilor apicali schimbările componentelor care determină potenţialul oxidoreductiv se manifestă mai timpuriu, în comparaţie cu cele din mugurii laterali. Această accelerare poate fi o cauză a eliminării mai timpurii a dormitării mugurilor apicali în comparaţie cu cei laterali.THE ANTIOXIDANT ACTIVITY OF PUBESCENT OAK TREE BUDS (QUERCUS PUBESCENS WILLD. WHICH GROW UNDER DIFFERENT STATIONARY CONDITIONSIt was determined the summary activity of oxidases, catalases and reducing substances of extracts from pubescent oak shoots taken in spring from trees growing in different stationary conditions in the southern part of the Republic of Moldova. In the extracts, the tendency to increase the overall capacity of oxygen use due to the reductive potential of the phenolic substances and the activity of the oxidases in trees growing southwards is clearly manifested, which corresponds to the gradient of increasing the spring temperature in the north-south direction. This trend also manifested itself in the catalase activity, but less pronounced. In apical buds, in spring, the changes in the components that determine the oxidoreductive potential are manifested earlier, compared to those in lateral buds. This acceleration may be a reason of the early removal of
Indian Academy of Sciences (India)
Although, several paralogous genes encoding different isozymes of Sus have been identified and characterized in multiple plant genomes, to date detailed information about the Sus genes is lacking for cacao. This study reports the identification of six novel Sus genes from economically important cacao tree. Analyses of the ...
African Journals Online (AJOL)
Mimi
Protein, reducing sugars, non-reducing sugars and total sugars decreased significantly .... The principal factors .... Statgraphics software version 3.0 (STSC, Inc., Rockville, MD, USA) was used to ..... Cervantes E and ME Jaramillo-Flores Dynamics of volatile and non-volatile ... processes using principal components analysis.
African Journals Online (AJOL)
SAM
2014-07-16
Jul 16, 2014 ... 1Laboratory of Plant Physiology, Department of Biological Sciences, Higher Teacher's Training College. P. O. Box 47. Yaounde .... ground material was centrifuged at 6000 g for 20 min. The ..... Coffee, cocoa, tea. 20:97-115.
Directory of Open Access Journals (Sweden)
Wilmer Figueroa Medina
2013-07-01
Full Text Available El pasador del fruto, Carmenta foraseminis Eichlin, es un insecto que ha acentuado su ataque en cultivos de cacao (Theobroma cacao L. en los últimos años en Norte de Santander (Colombia. El objetivo de este estudio fue evaluar la patogenicidad de las cepas nativas Giav-3 Paecilomyces sp. y Giav-4 Lecanicillium sp. sobre larvas de C. foraseminis. Para el efecto, se realizaron aislamientos a partir de muestras de suelo recolectadas en el municipio de Tibú, Norte de Santander. Después de obtenidos los cultivos puros se procedió a la caracterización macroscópica y microscópica para la identificación del género de los aislados mediante claves taxonómicas. La infección fue realizada mediante inmersión de larvas en las suspensiones de los aislados en concentraciones de 0, 10(6, 10(7 y 10(8 conidios/ml. En ambos aislados se observó una tendencia lineal respecto a la mortalidad, la cual fue directamente proporcional a las concentraciones del inóculo. La CL50 y CL90 para Giav-3 fue de 10(6.95 y 10(8.70 conidios/ml y para Giav-4 de 10(6.6 y 10(8.04 conidios/ml, respectivamente. Lo cual indica que esta última requirió la menor concentración de inóculo para eliminar el 50% y 90% de la población tratada, lo que supone una mayor efectividad contra las larvas.
Oboh, Ganiyu; Ademosun, Ayokunle O; Ademiluyi, Adedayo O; Omojokun, Olasunkanmi S; Nwanna, Esther E; Longe, Kuburat O
2014-01-01
Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao) bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH), 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), hydroxyl (OH), and nitric oxide (NO)] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL), α-glucosidase (1.84 ± 0.17 mg/mL), and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart]) activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL), NO (6.98 ± 0.886 mg/mL), OH (3.72 ± 0.26 mg/mL), and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension.
Directory of Open Access Journals (Sweden)
Ganiyu Oboh
2014-01-01
Full Text Available Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH, 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid (ABTS, hydroxyl (OH, and nitric oxide (NO] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL, α-glucosidase (1.84 ± 0.17 mg/mL, and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart] activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL, NO (6.98 ± 0.886 mg/mL, OH (3.72 ± 0.26 mg/mL, and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension.
Ademosun, Ayokunle O.; Ademiluyi, Adedayo O.; Omojokun, Olasunkanmi S.; Nwanna, Esther E.; Longe, Kuburat O.
2014-01-01
Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao) bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH), 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), hydroxyl (OH), and nitric oxide (NO)] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL), α-glucosidase (1.84 ± 0.17 mg/mL), and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart]) activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL), NO (6.98 ± 0.886 mg/mL), OH (3.72 ± 0.26 mg/mL), and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension. PMID:25295218
African Journals Online (AJOL)
RAGHAVENDRA
world's population rely on traditional medicine for prim health care needs. The dependence of people on her medicine is cost effectiveness, health benef acceptability and most importantly the accessibility. Pla are extensively used in various systems of medicine su as Ayurveda, Sidda and Unani. The therapeutic poten.
Directory of Open Access Journals (Sweden)
Olga Rosero
2013-01-01
Full Text Available Quinua (Chenopodium quinoa Willd. es una planta que ha sido cultivada en las regiones andinas de Bolivia, Perú, Ecuador y Colombia. Su importancia se debe al alto contenido de proteínas y de aminoácidos esenciales en su grano. El objetivo principal en la investigación fue encontrar la relación entre el ácido fítico y la actividad de la fítasa en las variedades de quinua Nariño procedente de Colombia (QC, quinua Anapquis (QBA y quinua -IICA 020 Oruro (QB procedentes de Bolivia, y quinua Huancavelica de Perú (QP. Se encontraron diferencias significativas en las proporciones de proteína, grasa, fibra y ceniza entre las cuatro variedades. El análisis de los aminoácidos esenciales mostró que las variedades de quinua tienen altas concentraciones de arginina, leucina, fenilalanina y lisina, y tirosina como aminoácidos semi-esenciales. La fracción de grasa presentó concentraciones altas de ácido oleico, linoleico, a-linolénico y ácido palmítico. Las variedades presentaron altos contenidos de P y Ca. El ácido fítico en QC (19.64% fue significativamente más bajo que en las otras variedades. En la variedad QC (1052 FTU/kg se encontraron altas proporciones de actividad de la fítasa. Se encontró relación significativa y negativa (r = -0.89 entre la actividad de la fítasa y el ácido fítico en todas las variedades.
Marseglia, Angela
2015-01-01
Il cacao (Theobroma cacao L.) e il cioccolato sono fra i prodotti alimentari più apprezzati nel mondo. Il nome 'Theobroma' significa 'cibo degli dei', sottolineando le quasi divine qualità nutritive del cacao e del cioccolato. I prodotti a base di cacao sono ottenuti a partire dalle fave di cacao, che rappresentano i semi della pianta del cacao, la quale cresce in una zona geografica limitata, di circa 20 gradi a nord e a sud dell'equatore. I prodotti a base di cioccolato sono ottenuti con un...
Ogunmefun, O. T.; Fasola, T. R.; Saba, A. B.; Akinyemi, A. J.
2015-01-01
Evidence in both experimental and clinical studies has shown the participation of oxidative stress in the development and progression of diabetes mellitus. This study therefore, sought to investigate the inhibitory effect of methanolic extract of Phragmanthera incana leaves, a mistletoe species harvested from Cocoa (Theobroma cacao) and Kolanut (Cola nitida) on FeSO4 induced lipid peroxidation in rat pancreas, liver, kidney, heart and brain in vitro. The methanolic extract was prepared with 90% methanol (v/v); subsequently, the antioxidant properties and inhibitory effect of the extract on Fe2+ induced lipid peroxidation in some rat tissues were determined in vitro. Incubation of the different rat tissues homogenate in the presence of Fe caused a significant increase in the malondialdehyde (MDA) contents of the tissues. However, the methanolic extracts of Phragmanthera incana leaves harvested from both Cocoa and Kolanut trees caused a significant decrease in the MDA contents of all the tissues tested in a dose-dependent manner. However, the extract of Phragmanthera incana leaves harvested from kolanut trees had a better inhibitory effect on Fe2+- induced lipid peroxidation in the rat tissues homogenates than that of Phragmanthera incana leaves harvested from cocoa trees. This higher inhibitory effect could be attributed to its significantly higher antioxidant properties as typified by their phenolic content, DPPH radical scavenging ability and reducing power. Therefore, oxidative stress associated with diabetes and its other complications could be potentially managed/prevented by harnessing Phragmanthera incana leaves as cheap nutraceuticals. However, Phragmanthera incana leaves harvested from kolanut trees exhibited better antioxidant properties.
Protein (Viridiplantae): 417622 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 09 ... 214909:3609 ... 3640:3609 ... 3641:3609 ... Uncharacterized protein TCM_008191 Theobroma cacao MEETSLGLSFTKDENFREWYSEIYFVAVNSEMIECNDISSYYILRSRAISIGRLTCTFPAAVCTPEIKASFNILLRVNDVQ
Directory of Open Access Journals (Sweden)
Barrera Jaime A.
1996-06-01
Full Text Available A partir de la metodología de evaluación financiera de proyectos de inversión, se analizó la rentabilidad y sensibilidad de un proyecto de agroindustrialización del arazá y del copoazú en la zona de colonizaciónde San José del Guaviare. Basados en su buen comportamiento agronómico y características de olor y sabor agradables, se plantea el montaje de una planta procesadora de frutas en la región, de tal modo, que los posibles productores y usuarios de un programa de fomento puedan asegurar la venta de sus productos a precios adecuados, tanto para productores como para procesadores. Mediante la simulación del proceso comercial de obtención y almacenamiento de pulpas, se estableció la calidad técnica y se estimaron los posibles resultados económicos que se podrían obtener en su producción. Los resultados muestran que los procesos de transformación generados para las especies garantizan un retorno económico adecuado y los rendimientos obtenidos en planta permiten la viabilidad económica del proyecto, lo cual garantiza al inversionista menores riesgos y favorables alternativas de inversión para la región. La sensibilidad del proyecto es alta, lo cual implica un estricto manejoy administración del proyecto para obtener los resultados esperados. Igualmente, se demuestra que la implementación de una planta procesadora de frutas garantiza para los agricultores un poder de compra estable, con lo cual se evitarían las trabas comunes que conlleva la comercialización agrícola en la región.
This study was carry out in arder to analize the feasibility of the araza and the copoazu transformation at the Guaviare department in the colombian amazonic region. These crops are very interesting for the agroindustry as a result of their great productitivity capacity in the poor amazonic soils, and their fruits organoleptics characteristics. The transfomation will lead either crop productors and agroindustrialmen to obtain profit from these fruits trees. It was simulated the agroindustrial pulp transformation procedure to get more information about commercial technics and economics results that would be receive from a transformation pulp plant at the region. The results demonstrated the project will have a great viability with adequate economic return to the investors. That will conduct to new investments alternatives for the region taking care of a good administration of the project to attain the expecting results. The plant at the region will guarantee power sales for the farmers to lower the commercial problems. Also it will supply permanently raw materials for the pulp plant.
International Nuclear Information System (INIS)
Maqsood, A.; Nafees, M.; Ashraf, I.; Qureshi, R.
2014-01-01
Stem end rot majorly contribute in post-harvest losses of mango during storage. Maximum disease incidence (70%) was recorded in Sindhari cultivar followed by Chaunsa (64%), Fajri (62.5%) and 50% in both Langra and Anwar ratol. In vitro studies were carried out to identifyfungal pathogens responsible for rotting and decaying mango fruits during storage along with isolation and testing their pathogencity on healthy fruits. Results revealed that all selected commercial mango varieties infected by stem end rot. Colletotrichum gloeosporioides, Lasidodiplodia theobromae, Alternaria alternate, Aspergillus niger, Dothiorella domonicana were identified from Sindhri mango fruits, in which of C. gloeosporioides was found the most prevalent. Phomopsis mangiferae, Botryodiplodia theobromae, Altrnaria spp. Aspergillus niger, A. flavis were found in Chaunsa and Phomopsis mangiferae was most prevalent, while Botryodiplodia theobromae caused infection to locally cosumed Fajri variety. Effect of abiotic factors like pH, temperature, light intensity and carbon sources were tested against these isolates. The most efficient carbon source was glucose, which supported the maximum growth of the P. mangiferae and L. Theobromae, while C. gloeosporioides had maximum growth on lactose. All fungi had maximum growth at pH range of 6-6.5 and temperature range of 25-30 degree C on PDA medium. Alternate cycles of 12hr light and 12 hr darkness resulted maximum mycelial growth as compared to the 24 hour continuous exposure to either dark or light. Susceptibility of fungi with cultivars and intensity of spread under specific abiotic conditions provides basic information in this paper to minimize stem end rot of mango in field and storage conditions. (author)
Directory of Open Access Journals (Sweden)
L. I. A. CASTRO
2008-11-01
Full Text Available
A quinoa (Chenopodium quinoa Willd é um pseudocereal isento de glúten, oriundo dos Andes, onde tem sido cultivado há milhares de anos. O objetivo deste trabalho foi desenvolver e avaliar sensorialmente algumas preparações contendo quinoa em grãos, flocos e farinha, destinadas ao paciente celÃaco, e determinar a digestibilidade in vitro de sua proteÃna, submetida ou não ao tratamento térmico. As amostras foram avaliadas sensorialmente através de um teste de aceitação utilizando a escala hedônica nominal de 9 pontos. O método utilizado na análise da digestibilidade protéica in vitro foi o da queda de pH após 10 minutos, com a adição das enzimas tripsina e pancreatina à s amostras de quinoa, tratadas e não tratadas termicamente. Das sete preparações testadas, seis foram bem aceitas, já que apresentaram um Ãndice de Aceitabilidade maior que 70%. Os flocos e grãos de quinoa, após serem testados termicamente, tiveram sua digestibilidade otimizada. Portanto, a quinoa e seus derivados podem ser considerados uma boa opção para a alimentação dos indivÃduos portadores da doença celÃaca.
Maximova, Siela N; Florez, Sergio; Shen, Xiangling; Niemenak, Nicolas; Zhang, Yufan; Curtis, Wayne; Guiltinan, Mark J
2014-07-16
Theobroma cacao L. is a tropical fruit tree, the seeds of which are used to create chocolate. In vitro somatic embryogenesis (SE) of cacao is a propagation system useful for rapid mass-multiplication to accelerate breeding programs and to provide plants directly to farmers. Two major limitations of cacao SE remain: the efficiency of embryo production is highly genotype dependent and the lack of full cotyledon development results in low embryo to plant conversion rates. With the goal to better understand SE development and to improve the efficiency of SE conversion we examined gene expression differences between zygotic and somatic embryos using a whole genome microarray. The expression of 28,752 genes was determined at 4 developmental time points during zygotic embryogenesis (ZE) and 2 time points during cacao somatic embryogenesis (SE). Within the ZE time course, 10,288 differentially expressed genes were enriched for functions related to responses to abiotic and biotic stimulus, metabolic and cellular processes. A comparison ZE and SE expression profiles identified 10,175 differentially expressed genes. Many TF genes, putatively involved in ethylene metabolism and response, were more strongly expressed in SEs as compared to ZEs. Expression levels of genes involved in fatty acid metabolism, flavonoid biosynthesis and seed storage protein genes were also differentially expressed in the two types of embryos. Large numbers of genes were differentially regulated during various stages of both ZE and SE development in cacao. The relatively higher expression of ethylene and flavonoid related genes during SE suggests that the developing tissues may be experiencing high levels of stress during SE maturation caused by the in vitro environment. The expression of genes involved in the synthesis of auxin, polyunsaturated fatty acids and secondary metabolites was higher in SEs relative to ZEs despite lack of lipid and metabolite accumulation. These differences in gene
Jin, Yue; Yang, Cheng-Min; Wei, Jian-He
2016-05-01
In order to evaluate seed viability of Platycodon grandiflorum, Schizonepeta tenuifolia, Andrographis paniculat, Codonopsis pilosula, Scutellaria baicalensis, Leonurus japonicus, Rabdosia rubescens, stored in the medium-term gene bank of the National Medicinal Plant Gene Bank for 4 years, we tested seed germination rate of 7 species of medicinal plant and analyzed the change of significance of levels of the germination rate in pre and post store. Seed germination rates of 7 species of medicinal plants were all decreased after 4 years, and the decrease of S. tenuifolia and S. baicalensis germination rates were much smaller than other species. The higher initial germination rate of P. grandiflorum, C. pilosula, R. rubescens seed has the smaller decline of germination rate, but the data of A. paniculata showed the opposite trend. The rate decline of the germination of S. tenuifolia and S. baicalensis was roughly the same in different germination rate interval. The results showed that low temperature storage could effectively prolong the seed longevity, and maintain the seed vigor. Moreover, it is necessary to study on the storage characteristics of the main medicinal plant seeds, and establish the monitoring plan and regeneration standard. Copyright© by the Chinese Pharmaceutical Association.
Characterization of reaction products of iron and iron salts and aqueous plant extracts
Energy Technology Data Exchange (ETDEWEB)
Jaen, J.A. [Universidad de Panama, Centro de Investigaciones con Tecnicas Nucleares/Depto. de Quimica (Panama); Garcia de Saldana, E.; Hernandez, C. [Universidad de Panama, Maestria en Ciencias Quimicas (Panama)
1999-11-15
The complexes formed in aqueous solution as a result of a reaction of iron and iron salts (Fe{sup 2+} and Fe{sup 3+}) and some plant extracts were analyzed using Moessbauer spectroscopy and Fourier transform infrared. The extracts were obtained from Opuntia elatior mill., Acanthocereus pentagonus (L.) Britton, Mimosa tenuiflora, Caesalpinia coriaria (Jacq.) Willd., Bumbacopsis quinata (Jacq.) Dugand and Acacia mangium Willd., plants growing wildly in different zones of the Isthmus of Panama. Results suggest the formation of mono- and bis-type complexes, and in some cases, the occurrence of a redox reaction. The feasibility of application of the studied extracts as atmospheric corrosion inhibitors is discussed.
Camillo, Luciana Rodrigues; Filadelfo, Ciro Ribeiro; Monzani, Paulo Sérgio; Corrêa, Ronan Xavier; Gramacho, Karina Peres; Micheli, Fabienne; Pirovani, Carlos Priminho
2013-12-01
The level of hydrogen peroxide (H2O2) in plants signalizes the induction of several genes, including that of ascorbate peroxidase (APX-EC 1.11.1.11). APX isoenzymes play a central role in the elimination of intracellular H2O2 and contribute to plant responses to diverse stresses. During the infection process in Theobroma cacao by Moniliophthora perniciosa oxidative stress is generated and the APX action recruited from the plant. The present work aimed to characterize the T. cacao APX involved in the molecular interaction of T. cacao-M. perniciosa. The peroxidase activity was analyzed in protein extracts from cocoa plants infected by M. perniciosa and showed the induction of peroxidases like APX in resistant cocoa plants. The cytosolic protein of T. cacao (GenBank: ABR68691.2) was phylogenetically analyzed in relation to other peroxidases from the cocoa genome and eight genes encoding APX proteins with conserved domains were also analyzed. The cDNA from cytosolic APX was cloned in pET28a and the recombinant protein expressed and purified (rTc-cAPX). The secondary structure of the protein was analyzed by Circular Dichroism (CD) displaying high proportion of α-helices when folded. The enzymatic assay shows stable activity using ascorbate and guaiacol as an electron donor for H2O2 reduction. The pH 7.5 is the optimum for enzyme activity. Chromatographic analysis suggests that rTc-cAPX is a homodimer in solution. Results indicate that the rTc-cAPX is correctly folded, stable and biochemically active. The purified rTc-cAPX presented biotechnological potential and is adequate for future structural and functional studies. Copyright © 2013 The Authors. Published by Elsevier Masson SAS.. All rights reserved.
Effects of Platycodon grandiflorum methanolic extract on ...
African Journals Online (AJOL)
OLE
2012-09-25
Sep 25, 2012 ... on testosterone-induced benign prostatic hyperplasia in Wistar rats ... The development and growth of the prostate gland. *Corresponding author. ..... smooth muscle cell contraction (Furuya et al., 1982), and inhibitors of type II ...
Rachmat, Devita; Johar Mawarani, Lizda; Dewi Risanti, Doty
2018-01-01
Cocoa pod husk (Theobroma cacao l.) is a waste from cocoa beans processing. In this research we employ cocoa pod husk as activated carbon to decrease the value of FFA (Free Fatty Acid) in waste cooking oil and as K2CO3 catalyst in biodiesel production process from waste cooking oil. Cocoa pod husk was crusched and grounded into powder that passed thorugh 60 mesh-screen. As activated carbon, cocoa pod husk was firstly carbonized at three variant temperatures i.e 250°C, 300°C and 350°C. The activation process was done using HCl 2M as activator. Based on the results of XRD and FTIR, the carbonization at all variant temperatures does not cause a significant changes in terms of crystallite structure and water content. The pore of activated carbon started to form in sample that was carbonized at 350°C resulting in pore diameter of 5.14644 nm. This result was supported by the fact that the ability of this activated carbon in reducing the FFA of waste cooking oil was the most pronounced one, i.e. up to 86.7% of FFA. It was found that the performance of cocoa pod husk’s activated carbon in reducing FFA is more effective than esterification using H2SO4 which can only decrease 80.8%. On the other hand, the utilization as K2CO3 catalyst was carried out by carbonization at temperature 650°C and extraction using aquadest solvent. The extraction of cocoa pod husk produced 7.067% K2CO3 catalyst. According to RD results the fraction of K2CO3 compound from the green catalysts is the same as the commercial (SAP, 99%) that is ≥ 60%. From the obtained results, the best yield percentage was obtained using K2CO3 catalyst from cacao pod husk extract, i.e. 73-85%. To cope with biodiesel conversion efficiency, a two-step process consisting pretreatment with activated carbon carbonized at 350°C and esterification with K2CO3 from cocoa pod husk catalyst was developed. This two-step process could reach a high conversion of 85%. From the results it was clear that the produced
Schroth, Götz; Ferreira da Silva, Luciana; Wolf, Marc-Andree; Geraldes Teixeira, Wenceslau; Zech, Wolfgang
1999-07-01
The partitioning of rain water into throughfall, stemflow and interception loss when passing through plant canopies depends on properties of the respective plant species, such as leaf area and branch angles. In heterogeneous vegetation, such as tropical forest or polycultural systems, the presence of different plant species may consequently result in a mosaic of situations with respect to quantity and quality of water inputs into the soil. As these processes influence not only the water availability for the plants, but also water infiltration and nutrient leaching, the understanding of plant effects on the repartitioning of rain water may help in the optimization of land use systems and management practices. We measured throughfall and stemflow in a perennial polyculture (multi-strata agroforestry), monocultures of peach palm (Bactris gasipaes) for fruit and for palmito, a monoculture of cupuaçu (Theobroma grandiflorum), spontaneous fallow and primary forest during one year in central Amazonia, Brazil. The effect on rain water partitioning was measured separately for four useful tree species in the polyculture and for two tree species in the primary forest. Throughfall at two stem distances, and stemflow, differed significantly between tree species, resulting in pronounced spatial patterns of water input into the soil in the polyculture system. For two tree species, peach palm for fruit (Bactris gasipaes) and Brazil nut trees (Bertholletia excelsa), the water input into the soil near the stem was significantly higher than the open-area rainfall. This could lead to increased nutrient leaching when fertilizer is applied close to the stem of these trees. In the primary forest, such spatial patterns could also be detected, with significantly higher water input near a palm (Oenocarpus bacaba) than near a dicotyledonous tree species (Eschweilera sp.). Interception losses were 6·4% in the polyculture, 13·9 and 12·3% in the peach palm monocultures for fruit and for
Rheological properties of cupuassu and cocoa fats
Directory of Open Access Journals (Sweden)
Gioielli, L. A.
2004-06-01
Full Text Available Cocoa butter is an important ingredient in chocolate formulation as it dictates the main properties (texture, sensation in the mouth, and gloss. In the food industry, the texture of fat-containing products strongly depends on the macroscopic properties of the fat network formed within the finished product. Cupuassu ( Theobroma grandiflorum , Sterculiaceae is an Amazonian native fruit and the seeds can be used to derive a cocoa butter like product. In general, these fats are similar to those of cocoa, although they are different in some physical properties. The objective of this study was to analyze several properties of the cupuassu fat and cocoa butter (crystal formation at 25 ° C, rheological properties, and fatty acid composition and mixtures between the two fats (rheological properties, in order to understand the behavior of these fats for their use in chocolate products. Fat flow was described using common rheological models ( Newton , Power Law, Casson and Bingham plastic.La manteca de cacao es un ingrediente muy importante en la formulación de chocolates y es responsable de la mayor parte de sus propiedades (textura, palatibilidad y brillo. En la industria de alimentos, la textura de productos que contienen grasa depende enormemente de las propiedades macroscópicas de la red cristalina de la grasa en el producto final. El cupuaçu es una fruta nativa de la región amazónica y sus semillas pueden ser usadas para obtener una grasa semejante a la manteca de cacao. En general, esta grasa es similar a la manteca de cacao, pero difiere en algunas de sus propiedades fisicas . El objetivo de este estudio fue analizar algunas propiedades de la grasa de cupuaçu y de la manteca de cacao (formación de cristales a 25 °C, propiedades reológicas y composición en ácidos grasos y de algunas mezclas entre las dos grasas (propiedades reológicas, a fin de conocer el comportamiento de estas grasas para ser usadas en productos de la industria
Directory of Open Access Journals (Sweden)
Karina Carrera-Sánchez
2014-07-01
Full Text Available Moniliophthora roreri is a pathogen of cocoa (Theobroma cacao L. that causes high economic losses in Ecuador. This paper is intended to present a protocol for the isolation of the pathogen from cocoa fruits cv. `National', showing signs and symptoms of disease. The fruits were collected on farms of Napo (Ecuador. By wet chamber, it was able to induce profusely, sporulation on the surface of selected lesions. The isolations were performed from conidia directly located on the surface of fruits with brown powdery appearance. Isolation procedures and suggested of possible applications are presented. Key words: amazonia, basidiomycetes, fungi, moniliasis, Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Hengjia Ni
2016-01-01
Full Text Available Medicinal extract has been chronicled extensively in traditional Chinese medicine. Isoquinoline alkaloids, extract of Macleaya cordata (Willd. R. Br., have been used as feed additive in both swine and poultry. Dietary supplementation with isoquinoline alkaloids increases feed intake and weight gain. In addition, recent researches have demonstrated that isoquinoline alkaloids can regulate metabolic processes, innate immune system, and digestive functioning in animals. This review summarizes the latest scientific researches on isoquinoline alkaloids which are extracted from Macleaya cordata (Willd. R. Br. This review specifically focuses on its role as a feed supplement and its associated impact on growth performance and innate immune system, as well as its capacity to act as a substitute for oral antibiotics.
González, Juan A; Rosa, Mariana; Parrado, María F; Hilal, Mirna; Prado, Fernando E
2009-08-03
Morphological and physiological responses of seedlings to different solar UV-B irradiances were evaluated in two varieties of quinoa (Chenopodium quinoa Willd.), a crop species from Andean region of South America. Cristalina and Chucapaca varieties were grown at 1965m a.s.l in a glasshouse under natural light conditions for 18 days, and then transferred to outdoors under near-ambient (+UV-B) and strongly reduced (-UV-B) solar UV-B radiation. Exposition to -UV-B increased cotyledon area and seedling height in Cristalina variety whereas leaf number decreased compared to +UV-B. By contrast Chucapaca variety was not affected by UV-B treatments. Seedling fresh weight (FW), root length and leaf thickness did not show significant differences between +UV-B and -UV-B treatments. Mesophyll tissue was slightly affected by solar UV-B reduction. Chlorophyll content was differentially affected by UV-B treatments. Under +UV-B the highest value was observed in Cristalina variety, while in Chucapaca it was observed under -UV-B treatment. Chlorophyll content was slightly higher in leaves than in cotyledons, but there was no difference in the distribution pattern. Chlorophyll a/b ratio and carotenoid content did not show significant differences between UV-B treatments. Leaf UVB-absorbing compounds showed significant differences between UV-B treatments in Chucapaca only, while there were no significant differences in Cristalina variety. UVB-absorbing compounds of cotyledons did not show significant differences between +UV-B and -UV-B treatments. Sucrose, glucose and fructose showed different distribution patterns in cotyledons and leaves of the two varieties under near-ambient and strongly reduced UV-B. Results demonstrated that varieties of quinoa exhibit different morphological and physiological responses to changes in solar UV-B irradiance, but these responses cannot be used to predict the sensitivity to solar UV-B during a short-term exposition. Also, this study can be useful to
Directory of Open Access Journals (Sweden)
Diana Maria Chito Trujillo
2017-07-01
Full Text Available El diseño de alimentos funcionales a partir de productos vegetales muy estudiados como la soja (Glycine max [L.] Merr. y la potencialización de productos ancestrales como la quinoa (Chenopodium quinoa Willd. son estrategias factibles para contrarrestar la desnutrición mundial. El objetivo de la presente revisión es describir las características agroecológicas, de composición, nutricionales y tecnológicas de estas dos especies vegetales diferentes (leguminosa y pseudocereal, basado en las publicaciones previas. Se realizó una revisión en bases de datos (Scopus, Web of Science, Scielo y se complementó con una búsqueda manual en Google Scholar y páginas web de instituciones acreditadas. Los estudios incluidos (n=117 en esta revisión muestran que la soja se adapta mejor a altitudes bajas (~1.000 m s. n. m., mientras que la quinoa lo hace en un rango de mayores altitudes (500-4.000 m s. n. m. con mayor tolerancia a heladas. Ambas son fuente de una alta calidad proteica por suplir los requerimientos de aminoácidos esenciales sugeridos para niños y adultos sin diferencias significativas (p>0,05, particularmente triptófano y lisina y por los altos porcentajes de digestibilidad (>70%. Sus concentraciones bajas de prolaminas y aceptables de Fe, Zn, Ca, daidzeína y genisteína los convierten en productos de interés para la industria alimentaria.
(Dipteryx odorata (Aubl.) Willd)
African Journals Online (AJOL)
Fisiologia Vegetal
2016-11-02
Nov 2, 2016 ... metabolism, is a phenomenon that occurs in large extensions of arable areas ..... Effect of salinity on antioxidant responses of chickpea seedlings. ... Osmoregulation and antioxidant metabolism in drought-stressed. Helianthus ...
International Nuclear Information System (INIS)
Ullah, S. F.; Hussain, Y.; Iram, S.
2017-01-01
Two widely cultivated mango fruit varieties White chounsa and Sindhri were collected from two major mango growing areas of Punjab and Sindh Provinces of Pakistan. This study was focused on pathological characterization of predominant postharvest diseases such as stem end rot of mango (Mangifera indica) caused by Lasiodiplodia theobromae, and evaluation of bio-control activity by different plant extracts. L. theobromae aggressiveness of isolates was tested by artificial inoculations under controlled conditions, all isolates proved pathogenic in varying degree of aggressiveness on (Sindhri and White chounsa) with reference to control. Calculated standard error mean varied in lesion area produced by pathogens 6-63cm/sup 2/ (Sindhri) and 60-170 cm/sup 2/ (White chounsa). Re-isolation of respective fungi verified the Koch's postulates. Plant extract of Datura stramonium, Aloe-vera, Eucalyptus camaldulensis, were used to control the radial growth of L. theobromae. Comparative analysis showed D. Stramonium and E. camaldulensis extracts most efficiently reduced the growth of Lasiodiplodia isolates, in comparison to Aloe-vera extract, restrict the 15-20% growth. All pathological results and treatments were significant at p<0.05 through ANOVA. This study emphasizes the behavior of pathogens which could be helpful in mango breeding to introduce resistance toward Lasiodiplodia and referred plants provide the best alternative of chemical fungicides. (author)
Hoopen, G Martijn ten; Rees, Robert; Aisa, Philo; Stirrup, Tim; Krauss, Ulrike
2003-05-01
Mycoparasites collected from aerial parts of the cocoa plant (Theobroma cacao) have shown great promise in the control of black pod, caused by Phytophthora palmivora, and moniliasis, caused by Moniliophthora roreri. However, the ecology of epiphytic mycoparasites is still poorly understood although it has a direct bearing on applied biocontrol practices, ranging from the identification and isolation of promising biocontrol candidates to formulation needs and required application frequency. One objective of this study was to determine the natural abundance of mycoparasites on cocoa flowers and pods in relation to crop development stage and cultivar. For this purpose, native mycoparasites were detected on cocoa flowers and pods using the precolonised plate baiting technique. Furthermore, the survival of an applied Clonostachys rosea isolate on cocoa pods on shaded and non-shaded trees was compared as well as the recolonisation patterns of surface-sterilised pods by native mycoparasites under these conditions. Clonostachys spp. were the most commonly isolated native mycoparasites, followed by Fusarium spp. No differences in the occurrence of native, epiphytic mycoparasites were observed between the three main cocoa cultivars, 'Criollo', 'Forastero' and 'Trinitario', nor between clones within these groups. Thus, a single biocontrol inoculum can be suitable for application to cultivar mixtures of cocoa commonly grown together in a field. Different susceptibility classes of segregating F1 populations of hybrids with resistance against M. roreri and P. palmivora supported similar population levels and taxonomic assemblages of mycoparasites. Therefore, we reject the hypothesis that these antagonists mediate resistance. Mycoparasite abundance and genetic disease resistance to black pod and moniliasis are independent phenomena and should lead to additive effects if employed simultaneously in an integrated disease management programme. The survival of applied C. rosea was not
Directory of Open Access Journals (Sweden)
Mirtha Navarro
2017-10-01
Full Text Available The phenolic composition of aerial parts from Petiveria alliaceae L., Phyllanthus niruri L. and Senna reticulata Willd., species commonly used in Costa Rica as traditional medicines, was studied using UPLC-ESI-TQ-MS on enriched-phenolic extracts. Comparatively, higher values of total phenolic content (TPC, as measured by the Folin-Ciocalteau method, were observed for P. niruri extracts (328.8 gallic acid equivalents/g than for S. reticulata (79.30 gallic acid equivalents/g whereas P. alliaceae extract showed the lowest value (13.45 gallic acid equivalents/g. A total of 20 phenolic acids and proanthocyanidins were identified in the extracts, including hydroxybenzoic acids (benzoic, 4-hydroxybenzoic, gallic, prochatechuic, salicylic, syringic and vanillic acids; hydroxycinnamic acids (caffeic, ferulic, and p-coumaric acids; and flavan-3-ols monomers [(+-catechin and (−-epicatechin]. Regarding proanthocyanidin oligomers, five procyanidin dimers (B1, B2, B3, B4, and B5 and one trimer (T2 are reported for the first time in P. niruri, as well as two propelargonidin dimers in S. reticulata. Additionally, P. niruri showed the highest antioxidant DPPH and ORAC values (IC50 of 6.4 μg/mL and 6.5 mmol TE/g respectively, followed by S. reticulata (IC50 of 72.9 μg/mL and 2.68 mmol TE/g respectively and P. alliaceae extract (IC50 >1000 μg/mL and 1.32 mmol TE/g respectively. Finally, cytotoxicity and selectivity on gastric AGS and colon SW20 adenocarcinoma cell lines were evaluated and the best values were also found for P. niruri (SI = 2.8, followed by S. reticulata (SI = 2.5. Therefore, these results suggest that extracts containing higher proanthocyanidin content also show higher bioactivities. Significant positive correlation was found between TPC and ORAC (R2 = 0.996 as well as between phenolic content as measured by UPLC-DAD and ORAC (R2 = 0.990. These findings show evidence for the first time of the diversity of phenolic acids in P. alliaceae and S
Navarro, Mirtha; Moreira, Ileana; Arnaez, Elizabeth; Quesada, Silvia; Azofeifa, Gabriela; Alvarado, Diego; Monagas, Maria J.
2017-01-01
The phenolic composition of aerial parts from Petiveria alliaceae L., Phyllanthus niruri L. and Senna reticulata Willd., species commonly used in Costa Rica as traditional medicines, was studied using UPLC-ESI-TQ-MS on enriched-phenolic extracts. Comparatively, higher values of total phenolic content (TPC), as measured by the Folin-Ciocalteau method, were observed for P. niruri extracts (328.8 gallic acid equivalents/g) than for S. reticulata (79.30 gallic acid equivalents/g) whereas P. alliaceae extract showed the lowest value (13.45 gallic acid equivalents/g). A total of 20 phenolic acids and proanthocyanidins were identified in the extracts, including hydroxybenzoic acids (benzoic, 4-hydroxybenzoic, gallic, prochatechuic, salicylic, syringic and vanillic acids); hydroxycinnamic acids (caffeic, ferulic, and p-coumaric acids); and flavan-3-ols monomers [(+)-catechin and (−)-epicatechin)]. Regarding proanthocyanidin oligomers, five procyanidin dimers (B1, B2, B3, B4, and B5) and one trimer (T2) are reported for the first time in P. niruri, as well as two propelargonidin dimers in S. reticulata. Additionally, P. niruri showed the highest antioxidant DPPH and ORAC values (IC50 of 6.4 μg/mL and 6.5 mmol TE/g respectively), followed by S. reticulata (IC50 of 72.9 μg/mL and 2.68 mmol TE/g respectively) and P. alliaceae extract (IC50 >1000 μg/mL and 1.32 mmol TE/g respectively). Finally, cytotoxicity and selectivity on gastric AGS and colon SW20 adenocarcinoma cell lines were evaluated and the best values were also found for P. niruri (SI = 2.8), followed by S. reticulata (SI = 2.5). Therefore, these results suggest that extracts containing higher proanthocyanidin content also show higher bioactivities. Significant positive correlation was found between TPC and ORAC (R2 = 0.996) as well as between phenolic content as measured by UPLC-DAD and ORAC (R2 = 0.990). These findings show evidence for the first time of the diversity of phenolic acids in P. alliaceae and S
Aziz, Aniqa; Akram, Nudrat Aisha; Ashraf, Muhammad
2018-02-01
Phytoextracts are being widely used these days as a source of bioactive compounds for mitigating the harmful effects of abiotic stresses including drought stress. In this study, it was assessed how far foliar applied pure synthetic ascorbic acid (AsA) or natural sweet orange juice (OJ) enriched with AsA could mitigate the drought stress induced adverse effects on growth and some key metabolic processes in quinoa (Chenopodium quinoa Willd.; cultivar V 9 ) plants. Two weeks old quinoa seedlings were subjected to varying irrigation regimes as control [100% field capacity (FC)] and drought stress (60% FC, 40% FC and 20% FC). After one month of water deficit treatments, various levels of ascorbic acid (150 mg L -1 AsA or 25% OJ) besides control [distilled water (DW) and no spray (NS)] were applied as a foliar spray. After 15 days of AsA application, different physio-biochemical attributes were measured. The results showed that water deficit markedly decreased plant growth, relative water content (RWC), photosynthetic rate, total carotenoids (CAR) and total flavonoids, while it increased relative membrane permeability (RMP), intrinsic AsA content, hydrogen peroxide (H 2 O 2 ), malondialdehyde (MDA), glycinebetaine (GB), total phenolics, total soluble proteins (TSP), total free amino acids, activities of key antioxidant enzymes [superoxide dismutase (SOD), peroxidase (POD)], total soluble sugars (TSS), reducing (RS) and non-reducing sugars (NRS). Most obvious results of most of these parameters were observed at 40% and 20% FC. Foliar-applied pure 150 mg L -1 AsA and 25% OJ were found to be very effective in improving plant growth, RMP, photosynthetic rate, CAR, proline, AsA, MDA, GB, TSP, free amino acids, SOD, POD, TSS, RS, NRS and total flavonoids. It was noticed that 25% OJ enriched with AsA and other essential nutrients and biomolecules was as efficient as 150 mg L -1 AsA in reducing the adverse effects of drought stress on quinoa plants. So, it was concluded
Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire
2008-10-30
Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species.Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories.A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database.To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection.A large collection of new genetic markers was provided by this ESTs collection. This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high density gene map of T. cacao
Directory of Open Access Journals (Sweden)
Ruiz Manuel
2008-10-01
Full Text Available Abstract Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow
Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire
2008-01-01
Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high
comparative in vitro antioxidant properties of water juice from ...
African Journals Online (AJOL)
JUICE FROM SELECTED AFRICAN FRUITS CONSUMED IN ... from African star apple (Chrysophyllumafricanum) and cocoa (Theobroma cacao) were significantly (p<0.05) higher .... the formula as given by Chinaka and colleagues, and.
Identification and phytochemical screening of Endophytic fungi from ...
African Journals Online (AJOL)
SARAH
2015-06-30
Jun 30, 2015 ... Penicillium (03), Trichoderma (01) and Fusarium (01). The phytochemical ... guajava, Citrus spp. and Theobroma cacao (Dibong et al., 2011). ... Fermentation and extraction of metabolites: Each isolated ... Penicillium sp.1.
Elevated level of polysaccharides in a high level UV-B tolerant cell ...
African Journals Online (AJOL)
Jane
2011-04-26
Apr 26, 2011 ... A cell line of Bupleurum scorzonerifolium Willd with high level ... mechanisms to repair UV-induced damages via repairing ... for treatment or prevention of solar radiation. ..... working as both UV-B absorbing compounds and.
Directory of Open Access Journals (Sweden)
Ivan José Antunes Ribeiro
1987-01-01
Full Text Available Ceratocystis fimbriata foi descrito pela primeira vez em 1984, causando murcha em plantas de Cassia renigera, em Campinas (SP. Foram realizadas inoculações cruzadas com dois isolados de C. fimbriata obtidos de Cassia renigera e mangueira (Mangifera indica em plantas de: acácia-negra (Acacia decurrens, cacaueiro (Theobroma cacao, crotalária (Crotalaria juncea, feijão-guandu (Cajanus cajan, figueira (Ficus carica, gamelina (Gmelina arborea, mangueira (Mangifera indica, seringueira (Hevea brasilienses, Cassia sp., C. carnaval, C. ferruginea, C. grandis, C. moschata, C. multijuga, C. nodosa, C. renigera, C. siamea e C. speciosa. Os dois isolados do fungo foram patogênicos a todas as plantas testadas, com exceção de cacaueiro, gamelina e C. grandis.Ceratocystis fimbriata Ell. & Halst. is described for the first time in 1984 on Cassia renigera, in Campinas, State of São Paulo, Brazil. In cross inoculation, the isolates of C. fimbriata obtained from Cassia renigera and from Mangifera indica showed pathogenicity to the following plants: Acacia decurrens, Theobroma cacao, Crotalaria juncea, Cajanus cajan, Ficus Carica, Gmelina arborea, Mangifera indica, Hevea brasiliensis, Cassia sp., C. carnaval, C. ferruginea, C. grandis, C. moschata, C. multijuga, C. nodosa, C. renigera, C. siamea and C. speciosa. The isolates of C. fimbriata were pathogenic to all tested plants, except for Theobroma cacao, Gmelina arborea and C. grandis.
Venkatesagowda, Balaji; Ponugupaty, Ebenezer; Barbosa, Aneli M; Dekker, Robert F H
2012-01-01
Commercial oil-yielding seeds (castor, coconut, neem, peanut, pongamia, rubber and sesame) were collected from different places in the state of Tamil Nadu (India) from which 1279 endophytic fungi were isolated. The oil-bearing seeds exhibited rich fungal diversity. High Shannon-Index H' was observed with pongamia seeds (2.847) while a low Index occurred for coconut kernel-associated mycoflora (1.018). Maximum Colonization Frequency (%) was observed for Lasiodiplodia theobromae (176). Dominance Index (expressed in terms of the Simpson's Index D) was high (0.581) for coconut kernel-associated fungi, and low for pongamia seed-borne fungi. Species Richness (Chao) of the fungal isolates was high (47.09) in the case of neem seeds, and low (16.6) for peanut seeds. All 1279 fungal isolates were screened for lipolytic activity employing a zymogram method using Tween-20 in agar. Forty isolates showed strong lipolytic activity, and were morphologically identified as belonging to 19 taxa (Alternaria, Aspergillus, Chalaropsis, Cladosporium, Colletotrichum, Curvularia, Drechslera, Fusarium, Lasiodiplodia, Mucor, Penicillium, Pestalotiopsis, Phoma, Phomopsis, Phyllosticta, Rhizopus, Sclerotinia, Stachybotrys and Trichoderma). These isolates also exhibited amylolytic, proteolytic and cellulolytic activities. Five fungal isolates (Aspergillus niger, Chalaropsis thielavioides, Colletotrichum gloeosporioides, Lasiodiplodia theobromae and Phoma glomerata) exhibited highest lipase activities, and the best producer was Lasiodiplodia theobromae (108 U/mL), which was characterized by genomic sequence analysis of the ITS region of 18S rDNA.
Hybridization and adaptation to introduced balloon vines in an Australian soapberry bug.
Andres, J A; Thampy, P R; Mathieson, M T; Loye, J; Zalucki, M P; Dingle, H; Carroll, S P
2013-12-01
Contemporary adaptation of plant feeding insects to introduced hosts provides clear cases of ecologically based population divergence. In most cases the mechanisms permitting rapid differentiation are not well known. Here we study morphological and genetic variation associated with recent shifts by the Australian soapberry bug Leptocoris tagalicus onto two naturalized Neotropical balloon vines, Cardiospermum halicacabum and C. grandiflorum that differ in time since introduction. Our results show that these vines have much larger fruits than the native hosts (Whitewood tree -Atalaya hemiglauca- and Woolly Rambutan -Alectryon tomentosus-) and that bugs living on them have evolved significantly longer beaks and new allometries. Genetic analyses of mitochondrial haplotypes and amplified fragment length polymorphic (AFLP) markers indicate that the lineage of bugs on the annual vine C. halicacabum, the older introduction, is intermediate between the two subspecies of L. tagalicus found on native hosts. Moreover, where the annual vine and Whitewood tree co-occur, the morphology and genomic composition of the bugs are similar to those occurring in allopatry. These results show that hybridization provided the genetic elements underlying the strongly differentiated 'Halicacabum bugs'. In contrast, the bugs feeding on the recently introduced perennial balloon vine (C. grandiflorum) showed no evidence of admixture, and are genetically indistinguishable from the nearby populations on a native host. © 2013 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
José Ignacio Ruiz-Sanz
2012-05-01
Full Text Available Diverse plants of ethnobotanic interest in Amazonia are commonly used in traditional medicine. We determined the antioxidant potential against lipid peroxidation, the antimicrobial activity, and the polyphenol composition of several Amazonian plants (Brownea rosademonte, Piper glandulosissimum, Piper krukoffii, Piper putumayoense, Solanum grandiflorum, and Vismia baccifera. Extracts from the plant leaf, bark, and stem were prepared as aqueous infusions, as used in folk medicine, and added to rat liver microsomes exposed to iron. The polyphenolic composition was detected by reverse-phase HPLC coupled to diode-array detector and MS/MS analysis. The antimicrobial activity was tested by the spot-on-a-lawn method against several indicator microorganisms. All the extracts inhibited lipid oxidation, except the P. glandulosissimum stem. The plant extracts exhibiting high antioxidant potential (V. baccifera and B. rosademonte contained high levels of flavanols (particularly, catechin and epicatechin. By contrast, S. grandiflorum leaf, which exhibited very low antioxidant activity, was rich in hydroxycinnamic acids. None of the extracts showed antimicrobial activity. This study demonstrates for the first time the presence of bioactive polyphenolic compounds in several Amazonian plants, and highlights the importance of flavanols as major phenolic contributors to antioxidant activity.
2007-IJBCS-Article-Pierre Effa Onomo
African Journals Online (AJOL)
hp
Phenolic content and heritability of resistance in four hybrid populations of. Theobroma .... ANOVA and Tukey test permitted to analyse and compare the susceptibility level of better progenies ..... behaviour. Hybrids selected for the estimation.
Influence of gamma irradiation on pollen viability, germination ability ...
African Journals Online (AJOL)
STORAGESEVER
2009-12-15
Dec 15, 2009 ... minor cross-incompatibilities and physiological studies of incompatibility ... campanula shape of the flowers attractive for insect. (bees are ..... irradiation of cacao (Theobroma cacao L.) pollen: Effect on pollen grain viability ...
Molecular Characterization of Cocoa, Mango, Banana and Yam ...
African Journals Online (AJOL)
Molecular Characterization of Cocoa, Mango, Banana and Yam Isolates of Botryodiplodia theobromae in Ghana. ... A total of 25 fungal isolates were sampled from cocoa, mango, banana and yam within four ... HOW TO USE AJOL.
Sant i Vilella, M. Dolors
1987-01-01
[spa] En plantas de geranio dedicadas a la producción de esquejes (Pelargonium x hortorum cv. Orange Ricard, P. grandiflorum cv. FJamingo y P. peltatum cv. Old Lady, cultivadas en contenedor, en substrato artificial, en un invernadero comercial) se realizaron series estacionales de medidas del intercambio gaseoso en laboratorio en respuesta a cambios de irradiancia, temperatura y humedad del aire, y se determinaron en el invernadero la respuesta en el ciclo diario de la fotosíntesis neta, tra...
Directory of Open Access Journals (Sweden)
Maria Emilene Correia de Oliveira
2008-03-01
Full Text Available Resumo. Entre os anos de 2005 e 2007, foram observados mensalmente os danos causados por lagartas sobre as plantas Erythrina velutina (Willd. no município de São Cristovão, Sergipe, Brasil. As mudas com os danos foram levadas ao laboratório, com o objetivo de caracterizar os danos e identificar a praga. Esta foi identificada como Agathodes designalis (Guenée, encontrada em 35% das plantas em 2005 e 49% em 2007, causando danos da base para o ápice. Este é o primeiro registro de A. designalis atacando E. velutina no Estado de Sergipe, Brasil.Registration of the Agathodes designalis (Guenée, 1854 (Lepidoptera: Pyralidae in Mulungu (Erythrina velutina (Willd. in the Nursery of Seedlings of Native Forest Species in São Cristovão’s District, Sergipe, BrazilAbstract. Among the years 2005 to 2007, it was observed monthly the damaged caused by caterpillars on the Erythrina velutina (Willd. plants in São Cristovão’s District, Sergipe, Brazil. The damaged seedlings were taken to the laboratory, with the objective to characterize the damage and identify the insect pest. It was identified as Agathodes designalis (Guenée, found in 35% of plants in 2005 and 49% in 2007, causing damage to the base for the higher. It was the first record of the A. designalis attacking on E. velutina in Sergipe State, Brazil.
Directory of Open Access Journals (Sweden)
Kazhila C. Chinsembu
2016-01-01
Full Text Available Faced with critical shortages of staff, long queues, and stigma at public health facilities in Livingstone, Zambia, persons who suffer from HIV/AIDS-related diseases use medicinal plants to manage skin infections, diarrhoea, sexually transmitted infections, tuberculosis, cough, malaria, and oral infections. In all, 94 medicinal plant species were used to manage HIV/AIDS-related diseases. Most remedies are prepared from plants of various families such as Combretaceae, Euphorbiaceae, Fabaceae, and Lamiaceae. More than two-thirds of the plants (mostly leaves and roots are utilized to treat two or more diseases related to HIV infection. Eighteen plants, namely, Achyranthes aspera L., Lannea discolor (Sond. Engl., Hyphaene petersiana Klotzsch ex Mart., Asparagus racemosus Willd., Capparis tomentosa Lam., Cleome hirta Oliv., Garcinia livingstonei T. Anderson, Euclea divinorum Hiern, Bridelia cathartica G. Bertol., Acacia nilotica Delile, Piliostigma thonningii (Schumach. Milne-Redh., Dichrostachys cinerea (L. Wight and Arn., Abrus precatorius L., Hoslundia opposita Vahl., Clerodendrum capitatum (Willd. Schumach., Ficus sycomorus L., Ximenia americana L., and Ziziphus mucronata Willd., were used to treat four or more disease conditions. About 31% of the plants in this study were administered as monotherapies. Multiuse medicinal plants may contain broad-spectrum antimicrobial agents. However, since widely used plants easily succumb to the threats of overharvesting, they need special protocols and guidelines for their genetic conservation. There is still need to confirm the antimicrobial efficacies, pharmacological parameters, cytotoxicity, and active chemical ingredients of the discovered plants.
Chinsembu, Kazhila C
2016-01-01
Faced with critical shortages of staff, long queues, and stigma at public health facilities in Livingstone, Zambia, persons who suffer from HIV/AIDS-related diseases use medicinal plants to manage skin infections, diarrhoea, sexually transmitted infections, tuberculosis, cough, malaria, and oral infections. In all, 94 medicinal plant species were used to manage HIV/AIDS-related diseases. Most remedies are prepared from plants of various families such as Combretaceae, Euphorbiaceae, Fabaceae, and Lamiaceae. More than two-thirds of the plants (mostly leaves and roots) are utilized to treat two or more diseases related to HIV infection. Eighteen plants, namely, Achyranthes aspera L., Lannea discolor (Sond.) Engl., Hyphaene petersiana Klotzsch ex Mart., Asparagus racemosus Willd., Capparis tomentosa Lam., Cleome hirta Oliv., Garcinia livingstonei T. Anderson, Euclea divinorum Hiern, Bridelia cathartica G. Bertol., Acacia nilotica Delile, Piliostigma thonningii (Schumach.) Milne-Redh., Dichrostachys cinerea (L.) Wight and Arn., Abrus precatorius L., Hoslundia opposita Vahl., Clerodendrum capitatum (Willd.) Schumach., Ficus sycomorus L., Ximenia americana L., and Ziziphus mucronata Willd., were used to treat four or more disease conditions. About 31% of the plants in this study were administered as monotherapies. Multiuse medicinal plants may contain broad-spectrum antimicrobial agents. However, since widely used plants easily succumb to the threats of overharvesting, they need special protocols and guidelines for their genetic conservation. There is still need to confirm the antimicrobial efficacies, pharmacological parameters, cytotoxicity, and active chemical ingredients of the discovered plants.
Comparisons of stomatal parameters between normal and abnormal ...
African Journals Online (AJOL)
ED), guard cell length (GCL) and guard cell width (GCW) of normal and abnormal leaf of Bougainvillea spectabilis Willd were studied. This can be useful for further research of physical mechanism of abnormal leaf. Epidermal cells were ...
Foliar epidermal characters of some Sterculiaceae species in Nigeria
African Journals Online (AJOL)
DR. AWORINDE D.O
curve and slightly curved. All the species except Cola nitida (Vent) Schott, Malachanta alnifolia (Bak) Pierre, Mansonia altissima (A.Chev) R.Capuron, Theobroma cacao Linn and Waltheria indica Linn are amphistomatic. Stomata types included ...
In-vitro evaluation of plant extracts against Lasiodiplodia ...
African Journals Online (AJOL)
USER
2015-04-01
Apr 1, 2015 ... aidan (Tetrapleura tetraptera), and neem (Azadirachta indica) were ... was recorded in extract of A. hispida at 40% concentration. ... controlling L. theobromae with the ultimate goal of eliminating pesticide residues in the ...