WorldWideScience

Sample records for th-233u based msr

  1. Cost-based optimizations of power density and target-blanket modularity for 232Th/233U-based ADEP

    International Nuclear Information System (INIS)

    Krakowski, R.A.

    1995-01-01

    A cost-based parametric systems model is developed for an Accelerator-Driven Energy Production (ADEP) system based on a 232 Th/ 233 U fuel cycle and a molten-salt (LiF/BeF 2 /ThF 3 ) fluid-fuel primary system. Simplified neutron-balance, accelerator, reactor-core, chemical-processing, and balance-of-plant models are combined parametrically with a simplified costing model. The main focus of this model is to examine trade offs related to fission power density, reactor-core modularity, 233 U breeding rate, and fission product transmutation capacity

  2. Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu

    International Nuclear Information System (INIS)

    Smith, A.B.; Guenther, P.T.

    1982-01-01

    Differential-neutron-emission cross sections of 232 Th, 233 U, 235 U, 238 U, 239 Pu and 240 Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232 Th, 233 U, 235 U and 238 U inelastic-scattering values, poor agreement is observed for 240 Pu, and a serious discrepancy exists in the case of 239 Pu

  3. Development of automation and remotisation systems for fabrication of (Th-233U)O2 MOX fuel for AHWR

    International Nuclear Information System (INIS)

    Saraswat, Anupam; Danny, K.M.; Chakraborty, S.; Somayajulu, P.S.; Kumar, Arun; Mittal, R.; Prasad, R.S.; Mahule, K.N.; Panda, S.; Jayarajan, K.

    2011-01-01

    To meet the ever increasing power requirement of India, country is planning to utilize its large thorium reserves for the third stage of nuclear power program based on Thorium-Uranium 233 fuel in A.H.W.R. Although there are many advantages of (Th- 233 U)O 2 fuel cycle, presence of radiological hazards due to the presence of 1000-2000 ppm level of 232 U in the 233 U fuel and inertness of ThO 2 makes handling and fabrication of fuel difficult. The associated high alpha and gamma activity demands high level of automation and remote handling in alpha tight hot cells. To demonstrate automation and remotisation in (Th- 233 U)O 2 fuel fabrication, a mock up facility is being set up at BARC. This facility shall develop automation systems required for remote fuel fabrication in a simulated hot cell environment. There are many innovative schemes and systems being developed like integrated powder pellet system, remote viewing system for hot cell application etc. Low visibility inside the hot cell has always been a problem for the operator. To overcome this problem a remote viewing system has been developed by which entire hot cell area can be scanned with the use of a joystick and the display can be seen on a LCD monitor. The viewing system is made up of radiation resistant optics which can work even in high gamma fields. It consists of objective end assembly which is used to scan the hot cell area with the help of prism doublets and drive mechanism for capturing full 360 deg solid angle view. There is a Galilean telescope and focusing system used for focusing images of distant objects. Drive mechanism can be controlled by the joystick available to the operator. System has a high resolution CCD display and camera which gives a clear display of objects lying inside the hot cell area. Integrated powder pellet system is being developed for fabrication of MOX pellets from feed powder. This will be automated system which will take input in the form of MOX powder and convert it

  4. MSR Founders Narrative and Content Analysis of Scholarly Papers

    DEFF Research Database (Denmark)

    Tackney, Charles T.; Chappell, Stacie F.; Sato, Toyoko

    2017-01-01

    This is a founders’ narrative and research paper content analysis of the first 15 years of the Management Spirituality and Religion Interest Group (MSR) of the Academy of Management. Based on archival data and founder interviews, our inquiry recounts how the early collaborators established......: a corpus epitomizing MSR research and practice. The combined study is a benchmark of founding and institutionalization for current and potential MSR members. By tracing the research trends MSR has taken in light of the founding aspirations, we illuminate the distinctive values, tensions, and meanings...

  5. Within the framework of the new fuel cycle 232Th/233U, determination of the 233Pa(n.γ) radiative capture cross section for neutron energies ranging between 0 and 1 MeV

    International Nuclear Information System (INIS)

    Boyer, S.

    2004-10-01

    The Thorium cycle Th 232 /U 233 may face brilliant perspectives through advanced concepts like molten salt reactors or accelerator driven systems but it lacks accurate nuclear data concerning some nuclei. Pa 233 is one of these nuclei, its high activity makes the direct measurement of its radiative neutron capture cross-section almost impossible. This difficulty has been evaded by considering the transfer reaction Th 232 (He 3 ,p)Pa 234 * in which the Pa 234 nucleus is produced in various excited states according to the amount of energy available in the reaction. The first chapter deals with the thorium cycle and its assets to contribute to the quenching of the fast growing world energy demand. The second chapter gives a detailed description of the experimental setting. A scintillation detector based on deuterated benzene (C 6 D 6 ) has been used to counter gamma ray cascades. The third chapter is dedicated to data analysis. In the last chapter we compare our experimental results with ENDF and JENDL data and with computed values from 2 statistical models in the 0-1 MeV neutron energy range. Our results disagree clearly with evaluated data: our values are always above ENDF and JENDL data but tend to near computed values. We have also perform the measurement of the radiative neutron cross-section of Pa 231 for a 110 keV neutron: σ(n,γ) 2.00 ± 0.14 barn. (A.C.)

  6. MSR implementation and progress

    Energy Technology Data Exchange (ETDEWEB)

    McKensey, B.; Ellicott, C.; Webb, N. [NSW Department of Mineral Resources, Sydney, NSW (Australia). Coal Mining Inspectorate and Engineering

    1998-12-31

    In November 1996 the NSW Minister for Mineral Resources, commissioned a review of safety within the New South Wales mining industry, as a response to a disturbing number of fatalities during the Minister`s term of office together with a number of alarming near misses. ACiL were given the following terms of reference for the Mine Safety Review (MSR): identify key issues which need to be addressed before a significant and measurable improvement in mine safety performance can be expected; explore options for addressing these key issues, through consultation; consider how the findings of the Warden`s Court Inquiry into the 1994 Moura Mine disaster should be applied in New South Wales; evaluate the role, activities, structure, employment conditions, and resourcing of the State`s Mines Inspectorates; evaluate existing legislative provisions in the light of the identified key issues; and provide Government with recommendations on how mine safety in New South Wales could be enhanced, with particular regard to the Inspectorates. The ACiL report titled `Review of Mine Safety in NSW` was tabled in Parliament by the Ministry in April 1997. The review considered industry safety performance and its measurement through considering available statistics, drawing on submissions and, predominantly seeking the views of a broad cross section of industry and Government personnel. This included mine managers, inspectors, union officials and the workforce. In its report, the MSR makes numerous observations concerning issues of safety and the mining industry. Arising from those observations the review made 44 recommendations for either consideration or action to address the issues identified. 2 refs., 1 fig.

  7. Modular Stellarator Fusion Reactor (MSR) concept

    International Nuclear Information System (INIS)

    Miller, R.L.; Krakowski, R.A.

    1981-01-01

    A preliminary conceptual study has been made of the Modulator Stellarator Reactor (MSR) as a stedy-state, ignited, DT-fueled, magnetic fusion reactor. The MSR concept combines the physics of classic stellarator confinement with an innovative, modular-coil design. Parametric tradeoff calculations are described, leading to the selection of an interim design point for a 4.8-GWt plant based on Alcator transport scaling and an average beta value of 0.04 in an l = 2 system with a plasma aspect ratio of 11. Neither an economic analysis nor a detailed conceptual engineering design is presented here, as the primary intent of this scoping study is the elucidation of key physics tradeoffs, constraints, and uncertainties for the ultimate power-reactor embodiment

  8. Radionuclides release possibility analysis of MSR at various accident conditions

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Choong Wie; Kim, Hee Reyoung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-10-15

    There are some accidents which go beyond our expectation such as Fukushima Daiichi nuclear disaster and amounts of radionuclides release to environment, so more effort and research are conducted to prevent it. MSR (Molten Salt Reactor) is one of GEN-IV reactor types, and its coolant and fuel are mixtures of molten salt. MSR has a schematic like figure 1 and it has different features with the solid fuel reactor, but most important and interesting feature of MSR is its many safety systems. For example, MSR has a large negative void coefficient. Even though power increases, the reactor slows down soon. Radionuclides release possibility of MSR was analyzed at various accident conditions including Chernobyl and Fukushima ones. The MSR was understood to prevent the severe accident by the negative reactivity coefficient and the absence of explosive material such as water at the Chernobyl disaster condition. It was expected to contain fuel salts in the reactor building and not to release radionuclides into environment even if the primary system could be ruptured or broken and fuel salts would be leaked at the Fukushima Daiichi nuclear disaster condition of earthquake and tsunami. The MSR, which would not lead to the severe accident and therefore prevents the fuel release to the environment at many expected scenarios, was thought to have priority in the aspect of accidents. A quantitative analysis and a further research are needed to evaluate the possibility of radionuclide release to the environment at the various accident conditions based on the simple comparison of the safety feature between MSR and solid fuel reactor.

  9. The molten salt reactors (MSR) pyro chemistry and fuel cycle for innovative nuclear systems

    International Nuclear Information System (INIS)

    Brossard, Ph.; Garzenne, C.; Mouney, H.

    2002-01-01

    In the frame of the studies on next generation nuclear systems, and especially for the molten salt reactors and for the integrated fuel cycle (as IFR), the fuel cycle constraints must be taken into account in the preliminary studies of the system to improve the cycle and reactor optimisation. Among the purposes for next generation nuclear systems, sustainability and waste (radio-toxicity and mass) management are important goals. These goals imply reprocessing and recycling strategies. The objectives of this workshop are to present and to share the different strategies and scenarios, the needs based on these scenarios, the experimental facilities available today or in the future and their capabilities, the needs for demonstration. It aims at: identifying the needs for fuel cycle based on solid fuel or liquid fuel, and especially, the on-line reprocessing or clean up for the molten salt reactors; assessing the state-of-the-art on the pyro-chemistry applied to solid fuel and to present the research activities; assessing the state-of-the-art on liquid fuels (or others), and to present the research activities; expressing the R and D programs for pyro-chemistry, molten salt, and also to propose innovative processes; and proposing some joint activities in the frame of GEDEON and PRACTIS programs. This document brings together the transparencies of 18 contributions dealing with: scenario studies with AMSTER concept (Scenarios, MSR, breeders (Th) and burners); fuel cycle for innovative systems; current reprocessing of spent nuclear fuel (SNF) in molten salts (review of pyro-chemistry processes (non nuclear and nuclear)); high temperature NMR spectroscopies in molten salts; reductive extraction of An from molten fluorides (salt - liquid metal extraction); electrochemistry characterisation; characterisation with physical methods - extraction coefficient and kinetics; electrolytic extraction; dissolution-precipitation of plutonium in the eutectic LiCl-KCl (dissolution and

  10. Data Analysis with the Morse-Smale Complex: The msr Package for R

    KAUST Repository

    Gerber, Samuel

    2012-01-01

    In many areas, scientists deal with increasingly high-dimensional data sets. An important aspect for these scientists is to gain a qualitative understanding of the process or system from which the data is gathered. Often, both input variables and an outcome are observed and the data can be characterized as a sample from a high-dimensional scalar function. This work presents the R package msr for exploratory data analysis of multivariate scalar functions based on the Morse-Smale complex. The Morse-Smale complex provides a topologically meaningful decomposition of the domain. The msr package implements a discrete approximation of the Morse-Smale complex for data sets. In previous work this approximation has been exploited for visualization and partition-based regression, which are both supported in the msr package. The visualization combines the Morse-Smale complex with dimension-reduction techniques for a visual summary representation that serves as a guide for interactive exploration of the high-dimensional function. In a similar fashion, the regression employs a combination of linear models based on the Morse-Smale decomposition of the domain. This regression approach yields topologically accurate estimates and facilitates interpretation of general trends and statistical comparisons between partitions. In this manner, the msr package supports high-dimensional data understanding and exploration through the Morse-Smale complex.

  11. [download] (941Data Analysis with the Morse-Smale Complex: The msr Package for R

    Directory of Open Access Journals (Sweden)

    Samuel Gerber

    2012-07-01

    Full Text Available In many areas, scientists deal with increasingly high-dimensional data sets. An important aspect for these scientists is to gain a qualitative understanding of the process or system from which the data is gathered. Often, both input variables and an outcome are observed and the data can be characterized as a sample from a high-dimensional scalar function. This work presents the R package msr for exploratory data analysis of multivariate scalar functions based on the Morse-Smale complex. The Morse-Smale complex provides a topologically meaningful decomposition of the domain. The msr package implements a discrete approximation of the Morse-Smale complex for data sets. In previous work this approximation has been exploited for visualization and partition-based regression, which are both supported in the msr package. The visualization combines the Morse-Smale complex with dimension-reduction techniques for a visual summary representation that serves as a guide for interactive exploration of the high-dimensional function. In a similar fashion, the regression employs a combination of linear models based on the Morse-Smale decomposition of the domain. This regression approach yields topologically accurate estimates and facilitates interpretation of general trends and statistical comparisons between partitions. In this manner, the msr package supports high-dimensional data understanding and exploration through the Morse-Smale complex.

  12. Reactor physical program in the frame of the MSR-SPHINX transmuter concept development

    International Nuclear Information System (INIS)

    Hron, M.; Mikisek, M.

    2008-01-01

    In the frame of the R and D program for the Molten Salt Reactor (MSR) - SPHINX (Spent Hot fuel Incinerator by Neutron flux) concept, which has been under development in the Czech Republic as an actinide burner in resonance neutron spectrum and a radionuclide transmuter in a well-thermalized neutron spectrum, and namely its reactor physical part, the relatively broad experimental activities have been involved in the program, recently, which will serve for a validation of computer codes and verification of design inputs for designing of a demonstration unit of the MSR-type. The experimental program, which has been focused, in its first stage, on a short-term irradiation of small size samples of molten-salt systems as well as structural materials proposed for the MSR blanket in the field of high neutron flux of research reactors, will be in the proposed next stage of the program focused on a large-scale experimental verification of design inputs by use of MSR-type inserted zones into the existing light water moderated experimental reactor LR-0, which may allow to modify it to experimental zero power salt reactor SR-0. There has been a preparatory stage of the project called EROS started in the year 2006 and new experiments with MSR-type zones irradiated by cyclotron based neutron source are planned at the end of 2007 and should go on in the year 2008. There will be a brief description of the so far prepared and performed experimental programs introduced in the paper. (authors)

  13. Management, Spirituality, and Religion (MSR) Ways and Means

    DEFF Research Database (Denmark)

    Tackney, Charles Thomas; Chappell, Stacie F.; Harris, Dan

    2017-01-01

    Despite 15 years of functioning as an interest group, our domain of inquiry is relatively young and there are limited theoretical boundaries to support, shape, and assist our efforts. This metaphorical “blank canvas” is both empowering, in that so many inquiries are open for exploration, and yet...... also limiting. In this document we highlight three critical elements to emphasize their importance in MSR research: (a) delineating and operationalizing the key terms of religion, spirituality, and workplace spirituality; (b) acknowledging the work to date in the MSR corpus around definitions...

  14. MSR (Pu converters) and MSBRs in commercial nuclear power stations

    International Nuclear Information System (INIS)

    Reichle, L.F.C.

    1977-01-01

    Molten Salt Reactors are likely to be the best way to achieve lowest-cost, safe, reliable and environmentally compatible commercial nuclear power in the early 1990's. This conclusion is based on work performed by the industrial members of the U.S. Molten Salt Group and by the Oak Ridge National Laboratory - both of whom are in general agreement on the status and prospects of Molten Salt Reactor technology. The MSBR Development Program is a 14-year program comprised of a 250 MWe MSTR (Molten Salt Test Reactor), a 1,000 MWe MSBR (Molten Salt Breeder Reactor) Demonstration Plant, and related development work. Plutonium from LWRs will fuel MSR (Pu Converters) which, in turn, will produce U-233 to fuel MSBRs. Because of the low inventory of fissile material in MSRs, a given amount of Pu will start-up many more MSRs than LMFBRs or GCFRs. MSRs can be expected to produce energy at a cost that will be competitive with LWRs before LMFBRs or GCFRs. They will use less uranium and require less enrichment. They will have a much lower development cost. They have the potential of producing high-temperature process heat. MSRs use a fluid fuel, and therefore eliminate the high cost of fuel fabrication. They have on-stream refueling and high thermal efficiency. They will have construction costs comparable to LWRs. MSRs have relative safety and environmental advantages, such as no possibility of a LOCA, low inventory of fissile material, continuous removal of fission products and on-site storage of spent fuel wastes

  15. Preliminary Study for Radioactivity Evaluation of MSR compared with LWR

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Geun Hyeong; Kim, Hee Reyoung [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2014-05-15

    LWR uses fuel as {sup 235}U and fissile material as solid (enriched uranium). Those cannot control its component artificially and hard to change fuel frequently. Therefore this fuel remains as much as possible. That makes risk of high radiation leakage because of long neutron irradiation time. On the other hand, MSR (Molten Salt Reactor) uses fuel as thorium-uranium; fissile {sup 233}U when {sup 232}Th absorbs one neutron, and fissile material as liquid (molten salt). It has plenty of benefits respect to radioactive safety. It leads nuclear fuel dump when accident happens, diminishes basic fission substances' radiation and even the cost (Th exist 3∼4 times more on the earth compared with natural uranium). Source term is much lower than conventional LWR in order to processing time. Radiation exposure from volatile fission products in severe accidents is thought to be negligible due to the continuous removal mechanism. The generation of high level radioactive wastes from MSR is estimated to be much smaller than that of conventional LWR because of its less converting probability of thorium to minor actinides. It was thought the fundamental approach to MSR would make it possible to realize the safety of reactor when considering the severe accidents affecting on nuclear power plants due to natural disaster.

  16. Preliminary Study for Radioactivity Evaluation of MSR compared with LWR

    International Nuclear Information System (INIS)

    Lee, Geun Hyeong; Kim, Hee Reyoung

    2014-01-01

    LWR uses fuel as 235 U and fissile material as solid (enriched uranium). Those cannot control its component artificially and hard to change fuel frequently. Therefore this fuel remains as much as possible. That makes risk of high radiation leakage because of long neutron irradiation time. On the other hand, MSR (Molten Salt Reactor) uses fuel as thorium-uranium; fissile 233 U when 232 Th absorbs one neutron, and fissile material as liquid (molten salt). It has plenty of benefits respect to radioactive safety. It leads nuclear fuel dump when accident happens, diminishes basic fission substances' radiation and even the cost (Th exist 3∼4 times more on the earth compared with natural uranium). Source term is much lower than conventional LWR in order to processing time. Radiation exposure from volatile fission products in severe accidents is thought to be negligible due to the continuous removal mechanism. The generation of high level radioactive wastes from MSR is estimated to be much smaller than that of conventional LWR because of its less converting probability of thorium to minor actinides. It was thought the fundamental approach to MSR would make it possible to realize the safety of reactor when considering the severe accidents affecting on nuclear power plants due to natural disaster

  17. Three dimensional neutronic/thermal-hydraulic coupled simulation of MSR in transient state condition

    International Nuclear Information System (INIS)

    Zhou, Jianjun; Zhang, Daling; Qiu, Suizheng; Su, Guanghui; Tian, Wenxi; Wu, Yingwei

    2015-01-01

    Highlights: • Developed a three dimensional neutronic/thermal-hydraulic coupled transient analysis code for MSR. • Investigated the neutron distribution and thermal-hydraulic characters of the core under transient condition. • Analyzed three different transient conditions of inlet temperature drop, reactivity jump and pump coastdown. - Abstract: MSR (molten salt reactor) use liquid molten salt as coolant and fuel solvent, which was the only one liquid reactor of six Generation IV reactor types. As a liquid reactor the physical property of reactor was significantly influenced by fuel salt flow and the conventional analysis methods applied in solid fuel reactors are not applicable for this type of reactors. The present work developed a three dimensional neutronic/thermal-hydraulic coupled code investigated the neutronics and thermo-hydraulics characteristics of the core in transient condition based on neutron diffusion theory and numerical heat transfer. The code consists of two group neutron diffusion equations for fast and thermal neutron fluxes and six group balance equations for delayed neutron precursors. The code was separately validated by neutron benchmark and flow and heat transfer benchmark. Three different transient conditions was analyzed with inlet temperature drop, reactivity jump and pump coastdown. The results provide some valuable information in design and research this kind of reactor

  18. Three dimensional neutronic/thermal-hydraulic coupled simulation of MSR in transient state condition

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Jianjun [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xianning Road, 28, Xi’an 710049, Shaanxi (China); College of Mechanical and Power Engineering, China Three Gorges University, No 8, Daxue road, Yichang, Hubei 443002 (China); Zhang, Daling, E-mail: dlzhang@mail.xjtu.edu.cn [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xianning Road, 28, Xi’an 710049, Shaanxi (China); Qiu, Suizheng; Su, Guanghui; Tian, Wenxi; Wu, Yingwei [School of Nuclear Science and Technology, Xi’an Jiaotong University, Xianning Road, 28, Xi’an 710049, Shaanxi (China)

    2015-02-15

    Highlights: • Developed a three dimensional neutronic/thermal-hydraulic coupled transient analysis code for MSR. • Investigated the neutron distribution and thermal-hydraulic characters of the core under transient condition. • Analyzed three different transient conditions of inlet temperature drop, reactivity jump and pump coastdown. - Abstract: MSR (molten salt reactor) use liquid molten salt as coolant and fuel solvent, which was the only one liquid reactor of six Generation IV reactor types. As a liquid reactor the physical property of reactor was significantly influenced by fuel salt flow and the conventional analysis methods applied in solid fuel reactors are not applicable for this type of reactors. The present work developed a three dimensional neutronic/thermal-hydraulic coupled code investigated the neutronics and thermo-hydraulics characteristics of the core in transient condition based on neutron diffusion theory and numerical heat transfer. The code consists of two group neutron diffusion equations for fast and thermal neutron fluxes and six group balance equations for delayed neutron precursors. The code was separately validated by neutron benchmark and flow and heat transfer benchmark. Three different transient conditions was analyzed with inlet temperature drop, reactivity jump and pump coastdown. The results provide some valuable information in design and research this kind of reactor.

  19. Parametric systems analysis of the Modular Stellarator Reactor (MSR)

    International Nuclear Information System (INIS)

    Miller, R.L.; Krakowski, R.A.; Bathke, C.G.

    1982-05-01

    The close coupling in the stellarator/torsatron/heliotron (S/T/H) between coil design (peak field, current density, forces), magnetics topology (transform, shear, well depth), and plasma performance (equilibrium, stability, transport, beta) complicates the reactor assessment more so than for most magnetic confinement systems. In order to provide an additional degree of resolution of this problem for the Modular Stellarator Reactor (MSR), a parametric systems model has been developed and applied. This model reduces key issues associted ith plasma performance, first-wall/blanket/shield (FW/B/S), and coil design to a simple relationship between beta, system geometry, and a number of indicators of overall plant performance. The results of this analysis can then be used to guide more detailed, multidimensional plasma, magnetics, and coil design efforts towards technically and economically viable operating regimes. In general, it is shown that beta values > 0.08 may be needed if the MSR approach is to be substantially competitive with other approaches to magnetic fusion in terms of system power density, mass utilization, and cost for total power output around 4.0 GWt; lower powers will require even higher betas

  20. High-resolution wave number spectrum using multi-point measurements in space – the Multi-point Signal Resonator (MSR technique

    Directory of Open Access Journals (Sweden)

    Y. Narita

    2011-02-01

    Full Text Available A new analysis method is presented that provides a high-resolution power spectrum in a broad wave number domain based on multi-point measurements. The analysis technique is referred to as the Multi-point Signal Resonator (MSR and it benefits from Capon's minimum variance method for obtaining the proper power spectral density of the signal as well as the MUSIC algorithm (Multiple Signal Classification for considerably reducing the noise part in the spectrum. The mathematical foundation of the analysis method is presented and it is applied to synthetic data as well as Cluster observations of the interplanetary magnetic field. Using the MSR technique for Cluster data we find a wave in the solar wind propagating parallel to the mean magnetic field with relatively small amplitude, which is not identified by the Capon spectrum. The Cluster data analysis shows the potential of the MSR technique for studying waves and turbulence using multi-point measurements.

  1. Application of spectrometer cropscan MSR 16R and Landsat imagery for identification the spectral characteristics of land cover

    Science.gov (United States)

    Tampubolon, Togi; Abdullah, Khiruddin bin; San, Lim Hwee

    2013-09-01

    The spectral characteristics of land cover are basic references in classifying satellite image for geophysics analysis. It can be obtained from the measurements using spectrometer and satellite image processing. The aims of this study to investigate the spectral characteristics of land cover based on the results of measurement using Spectrometer Cropscan MSR 16R and Landsat satellite imagery. The area of study in this research is in Medan, (Deli Serdang, North Sumatera) Indonesia. The scope of this study is the basic survey from the measurements of spectral land cover which is covered several type of land such as a cultivated and managed terrestrial areas, natural and semi-natural, cultivated aquatic or regularly flooded areas, natural and semi-natural aquatic, artificial surfaces and associated areas, bare areas, artificial waterbodies and natural waterbodies. The measurement and verification were conducted using a spectrometer provided their spectral characteristics and Landsat imagery, respectively. The results of the spectral characteristics of land cover shows that each type of land cover have a unique characteristic. The correlation of spectral land cover based on spectrometer Cropscan MSR 16R and Landsat satellite image are above 90 %. However, the land cover of artificial waterbodiese have a correlation under 40 %. That is because the measurement of spectrometer Cropscan MSR 16R and acquisition of Landsat satellite imagery has a time different.

  2. Assessment of rigid multi-modality image registration consistency using the multiple sub-volume registration (MSR) method

    International Nuclear Information System (INIS)

    Ceylan, C; Heide, U A van der; Bol, G H; Lagendijk, J J W; Kotte, A N T J

    2005-01-01

    Registration of different imaging modalities such as CT, MRI, functional MRI (fMRI), positron (PET) and single photon (SPECT) emission tomography is used in many clinical applications. Determining the quality of any automatic registration procedure has been a challenging part because no gold standard is available to evaluate the registration. In this note we present a method, called the 'multiple sub-volume registration' (MSR) method, for assessing the consistency of a rigid registration. This is done by registering sub-images of one data set on the other data set, performing a crude non-rigid registration. By analysing the deviations (local deformations) of the sub-volume registrations from the full registration we get a measure of the consistency of the rigid registration. Registration of 15 data sets which include CT, MR and PET images for brain, head and neck, cervix, prostate and lung was performed utilizing a rigid body registration with normalized mutual information as the similarity measure. The resulting registrations were classified as good or bad by visual inspection. The resulting registrations were also classified using our MSR method. The results of our MSR method agree with the classification obtained from visual inspection for all cases (p < 0.02 based on ANOVA of the good and bad groups). The proposed method is independent of the registration algorithm and similarity measure. It can be used for multi-modality image data sets and different anatomic sites of the patient. (note)

  3. Ecdysone Induction of MsrA Protects Against Oxidative Stress in Drosophila

    Energy Technology Data Exchange (ETDEWEB)

    Roesijadi, Guri; Rezvankhah, Saeid; Binninger, David M.; Weissbach, Herbert

    2007-03-09

    The methionine sulfoxide reductases MsrA and MsrB reduce Met(O) to Met in epimer-specific fashion. In Drosophila, the major ecdysone induced protein is MsrA, which is regulated by the EcR-USP complex. We tested Kc cells for induction of MsrA, MsrB, EcR. and CAT by ecdysone and found that MsrA and the EcR were induced by ecdysone, but MsrB and CAT were not. When we tested for resistance to 20 mM H2O2 toxicity, viability of Kc cells was reduced threefold. After pretreatment with 0.2 μM ecdysone for 48 h, then exposed to H2O2, viability of Kc cells increased to 77% of controls. The EcR-deficient L57-3-11 knockout line was not responsive to ecdysone, and H2O2 resistance of both control and ecdysone-treated L57-3-11 cells was similar to that of the ecdysone-untreated Kc cells. These results show that hormonal regulation of MsrA is implicated in conferring protection against oxidative stress in the Drosophila model.

  4. Mechanism study of freeze-valve for molten salt reactor (MSR)

    International Nuclear Information System (INIS)

    Qinhua, Zhang

    2014-01-01

    Molten salt reactor (MSR) is one of the fourth generation nuclear reactor, ordinary nuclear grade valve is unsuitable for MSR due to its special coolant and extraordinary working temperature. Freeze-valve is proposed as the most appropriate valve for MSR, but the technology issue about freeze-valve has not been report in recent decades. Its significance to test the comprehensive property of freeze-valve for the application in MSR. A high temperature molten salt test loop was built which the physics property of salt is similar to the coolant of MSR. The results indicate that freeze-valve has a good performance use in the molten salt circumstances of high temperature (max 700 deg. C) and strong corrosion (authors)

  5. A unified form of exact-MSR codes via product-matrix frameworks

    KAUST Repository

    Lin, Sian Jheng

    2015-02-01

    Regenerating codes represent a class of block codes applicable for distributed storage systems. The [n, k, d] regenerating code has data recovery capability while possessing arbitrary k out of n code fragments, and supports the capability for code fragment regeneration through the use of other arbitrary d fragments, for k ≤ d ≤ n - 1. Minimum storage regenerating (MSR) codes are a subset of regenerating codes containing the minimal size of each code fragment. The first explicit construction of MSR codes that can perform exact regeneration (named exact-MSR codes) for d ≥ 2k - 2 has been presented via a product-matrix framework. This paper addresses some of the practical issues on the construction of exact-MSR codes. The major contributions of this paper include as follows. A new product-matrix framework is proposed to directly include all feasible exact-MSR codes for d ≥ 2k - 2. The mechanism for a systematic version of exact-MSR code is proposed to minimize the computational complexities for the process of message-symbol remapping. Two practical forms of encoding matrices are presented to reduce the size of the finite field.

  6. A unified form of exact-MSR codes via product-matrix frameworks

    KAUST Repository

    Lin, Sian Jheng; Chung, Weiho; Han, Yunghsiangsam; Al-Naffouri, Tareq Y.

    2015-01-01

    Regenerating codes represent a class of block codes applicable for distributed storage systems. The [n, k, d] regenerating code has data recovery capability while possessing arbitrary k out of n code fragments, and supports the capability for code fragment regeneration through the use of other arbitrary d fragments, for k ≤ d ≤ n - 1. Minimum storage regenerating (MSR) codes are a subset of regenerating codes containing the minimal size of each code fragment. The first explicit construction of MSR codes that can perform exact regeneration (named exact-MSR codes) for d ≥ 2k - 2 has been presented via a product-matrix framework. This paper addresses some of the practical issues on the construction of exact-MSR codes. The major contributions of this paper include as follows. A new product-matrix framework is proposed to directly include all feasible exact-MSR codes for d ≥ 2k - 2. The mechanism for a systematic version of exact-MSR code is proposed to minimize the computational complexities for the process of message-symbol remapping. Two practical forms of encoding matrices are presented to reduce the size of the finite field.

  7. Metasurface Reflector (MSR Loading for High Performance Small Microstrip Antenna Design.

    Directory of Open Access Journals (Sweden)

    Md Rezwanul Ahsan

    Full Text Available A meander stripline feed multiband microstrip antenna loaded with metasurface reflector (MSR structure has been designed, analyzed and constructed that offers the wireless communication services for UHF/microwave RFID and WLAN/WiMAX applications. The proposed MSR assimilated antenna comprises planar straight forward design of circular shaped radiator with horizontal slots on it and 2D metasurface formed by the periodic square metallic element that resembles the behavior of metamaterials. A custom made high dielectric bio-plastic substrate (εr = 15 is used for fabricating the prototype of the MSR embedded planar monopole antenna. The details of the design progress through numerical simulations and experimental results are presented and discussed accordingly. The measured impedance bandwidth, radiation patterns and gain of the proposed MSR integrated antenna are compared with the obtained results from numerical simulation, and a good compliance can be observed between them. The investigation shows that utilization of MSR structure has significantly broadened the -10 dB impedance bandwidth than the conventional patch antenna: from 540 to 632 MHz (17%, 467 to 606 MHz (29% and 758 MHz to 1062 MHz (40% for three distinct operating bands centered at 0.9, 3.5 and 5.5 GHz. Additionally, due to the assimilation of MSR, the overall realized gains have been upgraded to a higher value of 3.62 dBi, 6.09 dBi and 8.6 dBi for lower, middle and upper frequency band respectively. The measured radiation patterns, impedance bandwidths (S11<-10 dB and gains from the MSR loaded antenna prototype exhibit reasonable characteristics that can satisfy the requirements of UHF/microwave (5.8 GHz RFID, WiMAX (3.5/5.5 GHz and WLAN (5.2/5.8 GHz applications.

  8. System design description of forced-convection molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4

    International Nuclear Information System (INIS)

    Huntley, W.R.; Silverman, M.D.

    1976-11-01

    Molten-salt corrosion loops MSR-FCL-3 and MSR-FCL-4 are high-temperature test facilities designed to evaluate corrosion and mass transfer of modified Hastelloy N alloys for future use in Molten-Salt Breeder Reactors. Salt is circulated by a centrifugal sump pump to evaluate material compatibility with LiF-BeF 2 -ThF 4 -UF 4 fuel salt at velocities up to 6 m/s (20 fps) and at salt temperatures from 566 to 705 0 C (1050 to 1300 0 F). The report presents the design description of the various components and systems that make up each corrosion facility, such as the salt pump, corrosion specimens, salt piping, main heaters, salt coolers, salt sampling equipment, and helium cover-gas system, etc. The electrical systems and instrumentation and controls are described, and operational procedures, system limitations, and maintenance philosophy are discussed

  9. Metasurface Reflector (MSR) Loading for High Performance Small Microstrip Antenna Design.

    Science.gov (United States)

    Ahsan, Md Rezwanul; Islam, Mohammad Tariqul; Ullah, Mohammad Habib; Singh, Mandeep Jit; Ali, Mohd Tarmizi

    2015-01-01

    A meander stripline feed multiband microstrip antenna loaded with metasurface reflector (MSR) structure has been designed, analyzed and constructed that offers the wireless communication services for UHF/microwave RFID and WLAN/WiMAX applications. The proposed MSR assimilated antenna comprises planar straight forward design of circular shaped radiator with horizontal slots on it and 2D metasurface formed by the periodic square metallic element that resembles the behavior of metamaterials. A custom made high dielectric bio-plastic substrate (εr = 15) is used for fabricating the prototype of the MSR embedded planar monopole antenna. The details of the design progress through numerical simulations and experimental results are presented and discussed accordingly. The measured impedance bandwidth, radiation patterns and gain of the proposed MSR integrated antenna are compared with the obtained results from numerical simulation, and a good compliance can be observed between them. The investigation shows that utilization of MSR structure has significantly broadened the -10 dB impedance bandwidth than the conventional patch antenna: from 540 to 632 MHz (17%), 467 to 606 MHz (29%) and 758 MHz to 1062 MHz (40%) for three distinct operating bands centered at 0.9, 3.5 and 5.5 GHz. Additionally, due to the assimilation of MSR, the overall realized gains have been upgraded to a higher value of 3.62 dBi, 6.09 dBi and 8.6 dBi for lower, middle and upper frequency band respectively. The measured radiation patterns, impedance bandwidths (S11WLAN (5.2/5.8 GHz) applications.

  10. Evaluation of the root cause for MSR high level trip in Maanshan

    International Nuclear Information System (INIS)

    Liao, L.-Y.; Ferng, Y.-M.; Jange, S.J.; Ko, C.M.

    2004-01-01

    Reactor trip due to Moisture Separator Reheater (MSR) high water level has been a long time issue for Maanshan nuclear power plant. The operating experience shows that there are five reactor trips due to MSR high water level. Four out of the five reactor trips are generated when Combined Intermediate valve (CIV) no. 1 is closed during CIV closure test. The fifth reactor trip occurs when the reactor power is increasing from 99% to 100%. An extensive root cause analysis has been performed by Taipower Company. It is concluded that the water accumulated in the cross under leg between the exhaust of high pressure turbine and the inlet of MSR was the water source contributing to the MSR high level trip. Although, Maanshan does not have similar trip after the root cause analysis, it is interested to evaluate the proposed root cause from thermal hydraulic point of view. It is also hoped that some useful guidelines can be established. This paper includes a description of the scenario of reactor trips, a summary of the root cause analysis done by Taipower Company, an examination of possible mechanisms, an identification of key parameters and a presentation of major findings. In addition, the applicability of RELAP5/MOD3 under this condition is discussed. (author)

  11. MSR Founding Narratives and Content Analysis of Best/Dexter Award Nominee Papers (2001-2015)

    DEFF Research Database (Denmark)

    Tackney, Charles T.; Chappell, Stacie; Sato, Toyoko

    data and founder interviews. The individuals interviewed were identified through preliminary inquiry and from archival data. As a complement of and extension to this inclusive founding narrative, we conducted a content and discourse analysis of the 15 years of MSR Best Papers and Carolyn Dexter Best...

  12. The molten salt reactors (MSR) pyro chemistry and fuel cycle for innovative nuclear systems; Congres sur les reacteurs a sels fondus (RSF) pyrochimie et cycles des combustibles nucleaires du futur

    Energy Technology Data Exchange (ETDEWEB)

    Brossard, Ph. [GEDEON, Groupement de Recherche CEA CNRS EDF FRAMATOME (France); Garzenne, C.; Mouney, H. [and others

    2002-07-01

    In the frame of the studies on next generation nuclear systems, and especially for the molten salt reactors and for the integrated fuel cycle (as IFR), the fuel cycle constraints must be taken into account in the preliminary studies of the system to improve the cycle and reactor optimisation. Among the purposes for next generation nuclear systems, sustainability and waste (radio-toxicity and mass) management are important goals. These goals imply reprocessing and recycling strategies. The objectives of this workshop are to present and to share the different strategies and scenarios, the needs based on these scenarios, the experimental facilities available today or in the future and their capabilities, the needs for demonstration. It aims at: identifying the needs for fuel cycle based on solid fuel or liquid fuel, and especially, the on-line reprocessing or clean up for the molten salt reactors; assessing the state-of-the-art on the pyro-chemistry applied to solid fuel and to present the research activities; assessing the state-of-the-art on liquid fuels (or others), and to present the research activities; expressing the R and D programs for pyro-chemistry, molten salt, and also to propose innovative processes; and proposing some joint activities in the frame of GEDEON and PRACTIS programs. This document brings together the transparencies of 18 contributions dealing with: scenario studies with AMSTER concept (Scenarios, MSR, breeders (Th) and burners); fuel cycle for innovative systems; current reprocessing of spent nuclear fuel (SNF) in molten salts (review of pyro-chemistry processes (non nuclear and nuclear)); high temperature NMR spectroscopies in molten salts; reductive extraction of An from molten fluorides (salt - liquid metal extraction); electrochemistry characterisation; characterisation with physical methods - extraction coefficient and kinetics; electrolytic extraction; dissolution-precipitation of plutonium in the eutectic LiCl-KCl (dissolution and

  13. MsrA Overexpression Targeted to the Mitochondria, but Not Cytosol, Preserves Insulin Sensitivity in Diet-Induced Obese Mice.

    Directory of Open Access Journals (Sweden)

    JennaLynn Hunnicut

    Full Text Available There is growing evidence that oxidative stress plays an integral role in the processes by which obesity causes type 2 diabetes. We previously identified that mice lacking the protein oxidation repair enzyme methionine sulfoxide reductase A (MsrA are particularly prone to obesity-induced insulin resistance suggesting an unrecognized role for this protein in metabolic regulation. The goals of this study were to test whether increasing the expression of MsrA in mice can protect against obesity-induced metabolic dysfunction and to elucidate the potential underlying mechanisms. Mice with increased levels of MsrA in the mitochondria (TgMito MsrA or in the cytosol (TgCyto MsrA were fed a high fat/high sugar diet and parameters of glucose homeostasis were monitored. Mitochondrial content, markers of mitochondrial proteostasis and mitochondrial energy utilization were assessed. TgMito MsrA, but not TgCyto MsrA, mice remain insulin sensitive after high fat feeding, though these mice are not protected from obesity. This metabolically healthy obese phenotype of TgMito MsrA mice is not associated with changes in mitochondrial number or biogenesis or with a reduction of proteostatic stress in the mitochondria. However, our data suggest that increased mitochondrial MsrA can alter metabolic homeostasis under diet-induced obesity by activating AMPK signaling, thereby defining a potential mechanism by which this genetic alteration can prevent insulin resistance without affecting obesity. Our data suggest that identification of targets that maintain and regulate the integrity of the mitochondrial proteome, particular against oxidative damage, may play essential roles in the protection against metabolic disease.

  14. Study on domestic material purchasing in MSR manufacture of conventional island

    International Nuclear Information System (INIS)

    Xie Zhengmao

    2010-01-01

    Combining the real case of Dongfang Electric (Guangzhou) Heavy Machinery Co., Ltd. trying to purchase the domestic sealing gasket as needed in the MSR of the conventional island, this paper describes the trends and relevant experience about nuclear power equipment manufacturers purchasing materials in the domestic market, and provides a reference to broadening the procurement channels of the purchasing departments of nuclear equipment manufacturers. (author)

  15. Peptide methionine sulfoxide reductase A (MsrA): direct electrochemical oxidation on carbon electrodes.

    Science.gov (United States)

    Enache, T A; Oliveira-Brett, A M

    2013-02-01

    The direct electrochemical behaviour of peptide methionine sulfoxide reductase A (MsrA) adsorbed on glassy carbon and boron doped diamond electrodes surface, was studied over a wide pH range by cyclic and differential pulse voltammetry. MsrA oxidation mechanism occurs in three consecutive, pH dependent steps, corresponding to the oxidation of tyrosine, tryptophan and histidine amino acid residues. At the glassy carbon electrode, the first step corresponds to the oxidation of tyrosine and tryptophan residues and occurs for the same potential. The advantage of boron doped diamond electrode was to enable the separation of tyrosine and tryptophan oxidation peaks. On the second step occurs the histidine oxidation, and on the third, at higher potentials, the second tryptophan oxidation. MsrA adsorbs on the hydrophobic carbon electrode surface preferentially through the three hydrophobic domains, C1, C2 and C3, which contain the tyrosine, tryptophan and histidine residues, and tryptophan exists only in these regions, and undergo electrochemical oxidation. Copyright © 2012 Elsevier B.V. All rights reserved.

  16. Characterization of the Metabolically Modified Heavy Metal-Resistant Cupriavidus metallidurans Strain MSR33 Generated for Mercury Bioremediation

    Science.gov (United States)

    Rojas, Luis A.; Yáñez, Carolina; González, Myriam; Lobos, Soledad; Smalla, Kornelia; Seeger, Michael

    2011-01-01

    Background Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. Methodology/Principal Findings To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg2+. The minimum inhibitory concentrations (mM) for strain MSR33 were: Hg2+, 0.12 and CH3Hg+, 0.08. The addition of Hg2+ (0.04 mM) at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg2+ (0.10 and 0.15 mM) was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM) after 2 h. Conclusions/Significance A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel and stable bacterial strain

  17. Characterization of the metabolically modified heavy metal-resistant Cupriavidus metallidurans strain MSR33 generated for mercury bioremediation.

    Directory of Open Access Journals (Sweden)

    Luis A Rojas

    Full Text Available BACKGROUND: Mercury-polluted environments are often contaminated with other heavy metals. Therefore, bacteria with resistance to several heavy metals may be useful for bioremediation. Cupriavidus metallidurans CH34 is a model heavy metal-resistant bacterium, but possesses a low resistance to mercury compounds. METHODOLOGY/PRINCIPAL FINDINGS: To improve inorganic and organic mercury resistance of strain CH34, the IncP-1β plasmid pTP6 that provides novel merB, merG genes and additional other mer genes was introduced into the bacterium by biparental mating. The transconjugant Cupriavidus metallidurans strain MSR33 was genetically and biochemically characterized. Strain MSR33 maintained stably the plasmid pTP6 over 70 generations under non-selective conditions. The organomercurial lyase protein MerB and the mercuric reductase MerA of strain MSR33 were synthesized in presence of Hg(2+. The minimum inhibitory concentrations (mM for strain MSR33 were: Hg(2+, 0.12 and CH(3Hg(+, 0.08. The addition of Hg(2+ (0.04 mM at exponential phase had not an effect on the growth rate of strain MSR33. In contrast, after Hg(2+ addition at exponential phase the parental strain CH34 showed an immediate cessation of cell growth. During exposure to Hg(2+ no effects in the morphology of MSR33 cells were observed, whereas CH34 cells exposed to Hg(2+ showed a fuzzy outer membrane. Bioremediation with strain MSR33 of two mercury-contaminated aqueous solutions was evaluated. Hg(2+ (0.10 and 0.15 mM was completely volatilized by strain MSR33 from the polluted waters in presence of thioglycolate (5 mM after 2 h. CONCLUSIONS/SIGNIFICANCE: A broad-spectrum mercury-resistant strain MSR33 was generated by incorporation of plasmid pTP6 that was directly isolated from the environment into C. metallidurans CH34. Strain MSR33 is capable to remove mercury from polluted waters. This is the first study to use an IncP-1β plasmid directly isolated from the environment, to generate a novel

  18. D-MSR: A Distributed Network Management Scheme for Real-Time Monitoring and Process Control Applications in Wireless Industrial Automation

    Science.gov (United States)

    Zand, Pouria; Dilo, Arta; Havinga, Paul

    2013-01-01

    Current wireless technologies for industrial applications, such as WirelessHART and ISA100.11a, use a centralized management approach where a central network manager handles the requirements of the static network. However, such a centralized approach has several drawbacks. For example, it cannot cope with dynamicity/disturbance in large-scale networks in a real-time manner and it incurs a high communication overhead and latency for exchanging management traffic. In this paper, we therefore propose a distributed network management scheme, D-MSR. It enables the network devices to join the network, schedule their communications, establish end-to-end connections by reserving the communication resources for addressing real-time requirements, and cope with network dynamicity (e.g., node/edge failures) in a distributed manner. According to our knowledge, this is the first distributed management scheme based on IEEE 802.15.4e standard, which guides the nodes in different phases from joining until publishing their sensor data in the network. We demonstrate via simulation that D-MSR can address real-time and reliable communication as well as the high throughput requirements of industrial automation wireless networks, while also achieving higher efficiency in network management than WirelessHART, in terms of delay and overhead. PMID:23807687

  19. D-MSR: a distributed network management scheme for real-time monitoring and process control applications in wireless industrial automation.

    Science.gov (United States)

    Zand, Pouria; Dilo, Arta; Havinga, Paul

    2013-06-27

    Current wireless technologies for industrial applications, such as WirelessHART and ISA100.11a, use a centralized management approach where a central network manager handles the requirements of the static network. However, such a centralized approach has several drawbacks. For example, it cannot cope with dynamicity/disturbance in large-scale networks in a real-time manner and it incurs a high communication overhead and latency for exchanging management traffic. In this paper, we therefore propose a distributed network management scheme, D-MSR. It enables the network devices to join the network, schedule their communications, establish end-to-end connections by reserving the communication resources for addressing real-time requirements, and cope with network dynamicity (e.g., node/edge failures) in a distributed manner. According to our knowledge, this is the first distributed management scheme based on IEEE 802.15.4e standard, which guides the nodes in different phases from joining until publishing their sensor data in the network. We demonstrate via simulation that D-MSR can address real-time and reliable communication as well as the high throughput requirements of industrial automation wireless networks, while also achieving higher efficiency in network management than WirelessHART, in terms of delay and overhead.

  20. Luminescent properties of UV excitable blue emitting phosphors MSr4(BO3)3:Ce3+ (M = Li and Na)

    International Nuclear Information System (INIS)

    Guo Chongfeng; Ding Xu; Seo, Hyo Jin; Ren Zhaoyu; Bai Jintao

    2011-01-01

    Research highlights: → Novel blue emitting phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were prepared first. → Luminescent properties of phosphors borate MSr 4 (BO 3 ) 3 (M = Li or Na) were investigated extensively as candidates of blue emitting phosphor used for UV excited LED. → The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined as 0.05 for Li and x = 0.09 for Na excited by UV light respectively. - Abstract: A series of Ce 3+ doped novel borate phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) were successfully synthesized by traditional solid-state reaction. The crystal structures and the phase purities of samples were characterized by powder X-ray diffraction. The optimal concentrations of dopant Ce 3+ ions in compound MSr 4 (BO 3 ) 3 (M = Li or Na) were determined through the measurements of photoluminescence spectra of phosphors. Ce 3+ doped phosphors MSr 4 (BO 3 ) 3 (M = Li or Na) show strong broad band absorption in UV spectral region and bright blue emission under the excitation of 345 nm light. In addition, the temperature dependences of emission spectra of M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors with optimal composition x = 0.05 for Li and x = 0.09 for Na excited under 355 nm pulse laser were also investigated. The experimental results indicate that the M 1+x Sr 4-2x Ce x (BO 3 ) 3 (M = Li or Na) phosphors are promising blue emitting phosphors pumped by UV light.

  1. Effects of transgenic methionine sulfoxide reductase A (MsrA expression on lifespan and age-dependent changes in metabolic function in mice

    Directory of Open Access Journals (Sweden)

    Adam B. Salmon

    2016-12-01

    Full Text Available Mechanisms that preserve and maintain the cellular proteome are associated with long life and healthy aging. Oxidative damage is a significant contributor to perturbation of proteostasis and is dealt with by the cell through regulation of antioxidants, protein degradation, and repair of oxidized amino acids. Methionine sulfoxide reductase A (MsrA repairs oxidation of free- and protein-bound methionine residues through enzymatic reduction and is found in both the cytosol and the mitochondria. Previous studies in Drosophila have shown that increasing expression of MsrA can extend longevity. Here we test the effects of increasing MsrA on longevity and healthy aging in two transgenic mouse models. We show that elevated expression of MsrA targeted specifically to the cytosol reduces the rate of age-related death in female mice when assessed by Gompertz analysis. However, neither cytosolic nor mitochondrial MsrA overexpression extends lifespan when measured by log-rank analysis. In mice with MsrA overexpression targeted to the mitochondria, we see evidence for improved insulin sensitivity in aged female mice. With these and our previous data, we conclude that the increasing MsrA expression in mice has differential effects on aging and healthy aging that are dependent on the target of its subcellular localization.

  2. Mining Tasks from the Web Anchor Text Graph: MSR Notebook Paper for the TREC 2015 Tasks Track

    Science.gov (United States)

    2015-11-20

    Mining Tasks from the Web Anchor Text Graph: MSR Notebook Paper for the TREC 2015 Tasks Track Paul N. Bennett Microsoft Research Redmond, USA pauben...anchor text graph has proven useful in the general realm of query reformulation [2], we sought to quantify the value of extracting key phrases from...anchor text in the broader setting of the task understanding track. Given a query, our approach considers a simple method for identifying a relevant

  3. MSR redesign and reconstruction at Indiana Michigan Power Company's Donald C. Cook Nuclear Power Plant, Unit 1

    International Nuclear Information System (INIS)

    Yarden, A.L.; Tam, C.W.; Benes, J.D.; Arnold, W.E.

    1993-01-01

    When Indiana Michigan Power Company's (I and M) 1089- MWe, PWR, Donald C. Cook Nuclear Plant, Unit 1, (Cook 1) in Bridgeman, Michigan went into commercial operation in late 1975, its turbine generator included two Moisture Separator Reheater (MSR) vessels. Each of these original MSRs contained, in addition to the moisture separation section, a single stage 2-pass reheater consisting of 5/8 inch O.D., finned CuNi tubes with main heating steam as an energy source. The enormous size of the tube bank, with a vertical orientation of its tubes' U-bends, led the designer to choose two separate headers for the inlet side and outlet side of the tube bank. Over the years, these 2-pass reheaters had deteriorated mechanically such that maintenance costs had increased considerably. Also, the MSR performance in terms of MWe gain, had fallen off as a result of a gradual reduction of both superheat and moisture separation efficiency. In 1990, these MSRs were totally reconstructed with inherently different 4-pass reheaters and upgraded moisture separation systems. The performance and other direct parameters of these newly retrofitted and improved MSRs have exceeded original design specifications, and their operational stability has improved markedly. This MSR reconstruction at Cook 1 is the first of its kind to include a 4-pass reheater in association with a nuclear turbine generator of this design. This paper highlights the problems and solutions associated respectively with the original reheaters in the Cook 1 MSRs and their recent redesign, reconstruction, and performance

  4. Transgenic Brassica juncea plants expressing MsrA1, a synthetic cationic antimicrobial peptide, exhibit resistance to fungal phytopathogens.

    Science.gov (United States)

    Rustagi, Anjana; Kumar, Deepak; Shekhar, Shashi; Yusuf, Mohd Aslam; Misra, Santosh; Sarin, Neera Bhalla

    2014-06-01

    Cationic antimicrobial peptides (CAPs) have shown potential against broad spectrum of phytopathogens. Synthetic versions with desirable properties have been modeled on these natural peptides. MsrA1 is a synthetic chimera of cecropin A and melittin CAPs with antimicrobial properties. We generated transgenic Brassica juncea plants expressing the msrA1 gene aimed at conferring fungal resistance. Five independent transgenic lines were evaluated for resistance to Alternaria brassicae and Sclerotinia sclerotiorum, two of the most devastating pathogens of B. juncea crops. In vitro assays showed inhibition by MsrA1 of Alternaria hyphae growth by 44-62 %. As assessed by the number and size of lesions and time taken for complete leaf necrosis, the Alternaria infection was delayed and restricted in the transgenic plants with the protection varying from 69 to 85 % in different transgenic lines. In case of S. sclerotiorum infection, the lesions were more severe and spread profusely in untransformed control compared with transgenic plants. The sclerotia formed in the stem of untransformed control plants were significantly more in number and larger in size than those present in the transgenic plants where disease protection of 56-71.5 % was obtained. We discuss the potential of engineering broad spectrum biotic stress tolerance by transgenic expression of CAPs in crop plants.

  5. Preserving Samples and Their Scientific Integrity — Insights into MSR from the Astromaterials Acquisition and Curation Office at NASA Johnson Space Center

    Science.gov (United States)

    Calaway, M. J.; Regberg, A. B.; Mitchell, J. L.; Fries, M. D.; Zeigler, R. A.; McCubbin, F. M.; Harrington, A. D.

    2018-04-01

    Rigorous collection of samples for contamination knowledge, the information gained from the characterization of reference materials and witness plates in concurrence with sample return, is essential for MSR mission success.

  6. Positron annihilation study of La2-xMxCuO4 (M=Sr, Ba) system

    International Nuclear Information System (INIS)

    Lu Qingfeng; Du Baoli; Li Xigui

    2004-01-01

    The positron lifetime spectra of La 2-x M x CuO 4 (LMCO, M=Sr, Ba, x=0.05, 0.10, 0.125, 0.15, 0.2) were measured at room temperature for studying the long-standing mystery of '1/8 abnormal' in doped lanthanum cuprate. Electron density n e and void concentration (number density) C V were calculated as a function of substitution content x. The appearance of peak (n e ) and valley (C V ) at x=0.125 and the correlation with superconductivity were discussed. (authors)

  7. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.

    1986-12-01

    The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  8. A general overview of generation IV molten salt reactor (MSR) and the use of thorium as fuel

    Energy Technology Data Exchange (ETDEWEB)

    Yamaguchi, Carlos H.; Stefani, Giovanni L.; Santos, Thiago A., E-mail: carlos.yamaguchi@usp.br, E-mail: giovanni.stefani@ipen.br, E-mail: thiago.santos@ufabc.edu.br [Universidade de Sao Paulo (USP), SP (Brazil). Instituto de Fisica; Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Universidade Federal do ABC (CECS/UFABC), Santo Andre, SP (Brazil). Centro de Engenharia, Modelagem e Ciencias Sociais Aplicadas

    2017-07-01

    The molten salt reactors (MSRs) make use of fluoride salt as primary cooler, at low pressure. Although considered a generation IV reactor, your concept isn't new, since in the 1960 years the Oak Ridge National Laboratory created a little prototype of 8MWt. Over the 20{sup th} century, other countries, like UK, Japan, Russia, China and France also did research in the area, especially with the use of thorium as fuel. This goes with the fact that Brazil possess the biggest reserve of thorium in the world. In the center of nuclear engineering at IPEN is being created a study group connected to thorium reactors, which purpose is to investigate reactors using thorium to produce {sup 233}U and tailing burn, thus making the MSR using thorium as fuel, an object of study. This present work searches to do a general summary about the researches of MSR's, having as focus the utilization of thorium with the goal being to show it's efficiency and utilization is doable. (author)

  9. MSR - SPHINX concept program Eros (Experimental zero power Salt reactor SR-0) - The proposed experimental program as a basis for validation of reactor physics methods

    Energy Technology Data Exchange (ETDEWEB)

    Hron, M.; Juricek, V.; Kyncl, J.; Mikisek, M.; Rypar, V. [Nuclear Research Institute Rez plc, Rez (Czech Republic)

    2007-07-01

    The Molten Salt Reactor (MSR) - SPHINX (SPent Hot fuel Incinerator by Neutron fluX) concept solves this principal problem of spent fuel treatment by means of so-called nuclear incineration. It means the burning of fissionable part of its inventory and transmutation of other problematic radionuclides by use of nuclear reactions with neutrons in a MSR-SPHINX system. This reactor system is an actinide burner (most in resonance neutron spectrum) and a radionuclide transmuter in a well-thermalized neutron spectrum. In the frame of the physical part, there are computational analyses and experimental activities. The experimental program has been focused, in its first stage, on a short-term irradiation of small size samples of molten-salt systems as well as structural materials proposed for the MSR blanket in the field of high neutron flux of research reactors. The proposed next stage of the program will focus on a large-scale experimental verification of design inputs by use of MSR-type inserting zones into the existing light water moderated experimental reactor LR-0, which may allow us to modify it into the experimental zero power salt reactor SR-0. There will be a detail description of the proposed program given in the paper together with the so far performed experiments and their first results. These realized experiments help us also to verify computational codes used, and to recognize some anomalies related to molten fluorides utilization. (authors)

  10. The Anti-Oxidant Defense System of the Marine Polar Ciliate Euplotes nobilii: Characterization of the MsrB Gene Family

    Directory of Open Access Journals (Sweden)

    Francesca Ricci

    2017-01-01

    Full Text Available Organisms living in polar waters must cope with an extremely stressful environment dominated by freezing temperatures, high oxygen concentrations and UV radiation. To shed light on the genetic mechanisms on which the polar marine ciliate, Euplotes nobilii, relies to effectively cope with the oxidative stress, attention was focused on methionine sulfoxide reductases which repair proteins with oxidized methionines. A family of four structurally distinct MsrB genes, encoding enzymes specific for the reduction of the methionine-sulfoxide R-forms, were identified from a draft of the E. nobilii transcriptionally active (macronuclear genome. The En-MsrB genes are constitutively expressed to synthesize proteins markedly different in amino acid sequence, number of CXXC motifs for zinc-ion binding, and presence/absence of a cysteine residue specific for the mechanism of enzyme regeneration. The En-MsrB proteins take different localizations in the nucleus, mitochondria, cytosol and endoplasmic reticulum, ensuring a pervasive protection of all the major subcellular compartments from the oxidative damage. These observations have suggested to regard the En-MsrB gene activity as playing a central role in the genetic mechanism that enables E. nobilii and ciliates in general to live in the polar environment.

  11. Genetic modification of potato against microbial diseases: in vitro and in planta activity of a dermaseptin B1 derivative, MsrA2.

    Science.gov (United States)

    Osusky, Milan; Osuska, Lubica; Kay, William; Misra, Santosh

    2005-08-01

    Dermaseptin B1 is a potent cationic antimicrobial peptide found in skin secretions of the arboreal frog Phyllomedusa bicolor. A synthetic derivative of dermaseptin B1, MsrA2 (N-Met-dermaseptin B1), elicited strong antimicrobial activities against various phytopathogenic fungi and bacteria in vitro. To assess its potential for plant protection, MsrA2 was expressed at low levels (1-5 microg/g of fresh tissue) in the transgenic potato (Solanum tuberosum L.) cv. Desiree. Stringent challenges of these transgenic potato plants with a variety of highly virulent fungal phytopathogens--Alternaria, Cercospora, Fusarium, Phytophthora, Pythium, Rhizoctonia and Verticillium species--and with the bacterial pathogen Erwinia carotovora demonstrated that the plants had an unusually broad-spectrum and powerful resistance to infection. MsrA2 profoundly protected both plants and tubers from diseases such as late blight, dry rot and pink rot and markedly extended the storage life of tubers. Due to these properties in planta, MsrA2 is proposed as an ideal antimicrobial peptide candidate to significantly increase resistance to phytopathogens and improve quality in a variety of crops worldwide with the potential to obviate fungicides and facilitate storage under difficult conditions.

  12. Transcriptional attenuation controls macrolide inducible efflux and resistance in Streptococcus pneumoniae and in other Gram-positive bacteria containing mef/mel(msr(D)) elements.

    Science.gov (United States)

    Chancey, Scott T; Bai, Xianhe; Kumar, Nikhil; Drabek, Elliott F; Daugherty, Sean C; Colon, Thomas; Ott, Sandra; Sengamalay, Naomi; Sadzewicz, Lisa; Tallon, Luke J; Fraser, Claire M; Tettelin, Hervé; Stephens, David S

    2015-01-01

    Macrolide resistance, emerging in Streptococcus pneumoniae and other Gram-positive bacteria, is increasingly due to efflux pumps encoded by mef/mel(msr) operons found on discrete mobile genetic elements. The regulation of mef/mel(msr) in these elements is not well understood. We identified the mef(E)/mel transcriptional start, localized the mef(E)/mel promoter, and demonstrated attenuation of transcription as a mechanism of regulation of macrolide-inducible mef-mediated macrolide resistance in S. pneumoniae. The mef(E)/mel transcriptional start site was a guanine 327 bp upstream of mef(E). Consensus pneumococcal promoter -10 (5'-TATACT-3') and -35 (5'-TTGAAC-3') boxes separated by 17 bp were identified 7 bp upstream of the start site. Analysis of the predicted secondary structure of the 327 5' region identified four pairs of inverted repeats R1-R8 predicted to fold into stem-loops, a small leader peptide [MTASMRLR, (Mef(E)L)] required for macrolide induction and a Rho-independent transcription terminator. RNA-seq analyses provided confirmation of transcriptional attenuation. In addition, expression of mef(E)L was also influenced by mef(E)L-dependent mRNA stability. The regulatory region 5' of mef(E) was highly conserved in other mef/mel(msr)-containing elements including Tn1207.1 and the 5612IQ complex in pneumococci and Tn1207.3 in Group A streptococci, indicating a regulatory mechanism common to a wide variety of Gram-positive bacteria containing mef/mel(msr) elements.

  13. Th and U fuel photofission study by NTD for AD-MSR subcritical assembly

    Energy Technology Data Exchange (ETDEWEB)

    Sajo-Bohus, Laszlo; Greaves, Eduardo D.; Barros, Haydn; Pino, Felix; Barrera, Maria T.; Farina, Fulvio [Universidad Simón Bolívar, Nuclear Physics Laboratory, Apdo 89000, Caracas 1080A (Venezuela, Bolivarian Republic of); Davila, Jesus [Física Médica C. A. and Universidad Central de Venezuela, Caracas (Venezuela, Bolivarian Republic of)

    2015-07-23

    During the last decade a considerable effort has been devoted for developing energy generating systems based on advanced nuclear technology within the design concepts of GEN-IV. Thorium base fuel systems such as accelerator driven nuclear reactors are one of the often mentioned attractive and affordable options. Several radiotherapy linear accelerators are on the market and due to their reliability, they could be employed as drivers for subcritical liquid fuel assemblies. Bremsstrahlung photons with energies above 5.5MeV, induce (γ,n) and (e,e’n) reactions in the W-target. Resulting gamma radiation and photo or fission neutrons may be absorbed in target materials such as thorium and uranium isotopes to induce sustained fission or nuclear transmutation in waste radioactive materials. Relevant photo driven and photo-fission reaction cross sections are important for actinides {sup 232}Th, {sup 238}U and {sup 237}Np in the radiotherapy machines energy range of 10-20 MV. In this study we employ passive nuclear track detectors (NTD) to determine fission rates and neutron production rates with the aim to establish the feasibility for gamma and photo-neutron driven subcritical assemblies. To cope with these objectives a 20 MV radiotherapy machine has been employed with a mixed fuel target. Results will support further development for a subcritical assembly employing a thorium containing liquid fuel. It is expected that acquired technological knowledge will contribute to the Venezuelan nuclear energy program.

  14. Th and U fuel photofission study by NTD for AD-MSR subcritical assembly

    Science.gov (United States)

    Sajo-Bohus, Laszlo; Greaves, Eduardo D.; Davila, Jesus; Barros, Haydn; Pino, Felix; Barrera, Maria T.; Farina, Fulvio

    2015-07-01

    During the last decade a considerable effort has been devoted for developing energy generating systems based on advanced nuclear technology within the design concepts of GEN-IV. Thorium base fuel systems such as accelerator driven nuclear reactors are one of the often mentioned attractive and affordable options. Several radiotherapy linear accelerators are on the market and due to their reliability, they could be employed as drivers for subcritical liquid fuel assemblies. Bremsstrahlung photons with energies above 5.5MeV, induce (γ,n) and (e,e'n) reactions in the W-target. Resulting gamma radiation and photo or fission neutrons may be absorbed in target materials such as thorium and uranium isotopes to induce sustained fission or nuclear transmutation in waste radioactive materials. Relevant photo driven and photo-fission reaction cross sections are important for actinides 232Th, 238U and 237Np in the radiotherapy machines energy range of 10-20 MV. In this study we employ passive nuclear track detectors (NTD) to determine fission rates and neutron production rates with the aim to establish the feasibility for gamma and photo-neutron driven subcritical assemblies. To cope with these objectives a 20 MV radiotherapy machine has been employed with a mixed fuel target. Results will support further development for a subcritical assembly employing a thorium containing liquid fuel. It is expected that acquired technological knowledge will contribute to the Venezuelan nuclear energy program.

  15. Plutonium and minor actinides utilization in Thorium molten salt reactor

    International Nuclear Information System (INIS)

    Waris, Abdul; Aji, Indarta K.; Novitrian,; Kurniadi, Rizal; Su'ud, Zaki

    2012-01-01

    FUJI-12 reactor is one of MSR systems that proposed by Japan. The original FUJI-12 design considers Th/ 233 U or Th/Pu as main fuel. In accordance with the currently suggestion to stay away from the separation of Pu and minor actinides (MA), in this study we evaluated the utilization of Pu and MA in FUJI-12. The reactor grade Pu was employed in the present study as a small effort of supporting THORIMS-NES scenario. The result shows that the reactor can achieve its criticality with the Pu and MA composition in the fuel of 5.96% or more.

  16. Matrix-based system reliability method and applications to bridge networks

    International Nuclear Information System (INIS)

    Kang, W.-H.; Song Junho; Gardoni, Paolo

    2008-01-01

    Using a matrix-based system reliability (MSR) method, one can estimate the probabilities of complex system events by simple matrix calculations. Unlike existing system reliability methods whose complexity depends highly on that of the system event, the MSR method describes any general system event in a simple matrix form and therefore provides a more convenient way of handling the system event and estimating its probability. Even in the case where one has incomplete information on the component probabilities and/or the statistical dependence thereof, the matrix-based framework enables us to estimate the narrowest bounds on the system failure probability by linear programming. This paper presents the MSR method and applies it to a transportation network consisting of bridge structures. The seismic failure probabilities of bridges are estimated by use of the predictive fragility curves developed by a Bayesian methodology based on experimental data and existing deterministic models of the seismic capacity and demand. Using the MSR method, the probability of disconnection between each city/county and a critical facility is estimated. The probability mass function of the number of failed bridges is computed as well. In order to quantify the relative importance of bridges, the MSR method is used to compute the conditional probabilities of bridge failures given that there is at least one city disconnected from the critical facility. The bounds on the probability of disconnection are also obtained for cases with incomplete information

  17. Unravelling Local Atomic Order of the Anionic Sublattice in M(Al1-x Gax )4 with M=Sr and Ba by Using NMR Spectroscopy and Quantum Mechanical Modelling.

    Science.gov (United States)

    Pecher, Oliver; Mausolf, Bernhard; Peters, Volker; Lamberts, Kevin; Korthaus, Alexander; Haarmann, Frank

    2016-12-05

    The quasibinary section of the intermetallic phases MAl 4 and MGa 4 with M=Sr and Ba have been characterised by means of X-ray diffraction (XRD) studies and differential thermal analysis. The binary phases show complete miscibility and form solid solutions M(Al 1-x Ga x ) 4 with M=Sr and Ba. These structures crystallise in the BaAl 4 structure type with four- and five-bonded Al and/or Ga atoms (denoted as Al(4b), Al(5b), Ga(4b), and Ga(5b), respectively) that form a polyanionic Al/Ga sublattice. Solid state 27 Al NMR spectroscopic analysis and quantum mechanical (QM) calculations were applied to study the bonding of the Al centres and the influence of Al/Ga substitution, especially in the regimes with low degrees of substitution. M(Al 1-x Ga x ) 4 with M=Sr and Ba and 0.925≤x≤0.975 can be described as a matrix of the binary majority compound in which a low amount of the Ga atoms has been substituted by Al atoms. In good agreement with the QM calculations, 27 Al NMR investigations and single crystal XRD studies prove a preferred occupancy of Al(4b) for these substitution regimes. Furthermore, two different local Al environments were found, namely isolated Al(4b1) atoms and Al(4b2), due to the formation of Al(4b)-Al(4b) pairs besides isolated Al(4b) atoms within the polyanionic sublattice. QM calculations of the electric field gradient (EFG) using superlattice structures under periodic boundary conditions are in good agreement with the NMR spectroscopic results. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. ZZ-FSXLIB-JD99, MCNP nuclear data library based on JENDL Dosimetry File 99

    International Nuclear Information System (INIS)

    Shibata, Keiichi

    2007-01-01

    Description: JENDL Dosimetry File 99 processed into ACE for Monte Carlo calculations. JENDL/D-99 based MCNP library. Format: ACE. Number of groups: Continuous energy cross section library. Nuclides: 47 Nuclides and 67 reactions: Li-6 (n, triton) alpha; Li-6 alpha-production; Li-7 triton- production; B-10 (n, alpha) Li-7; B-10 alpha-production; F-19 (n, 2n) F-18; Na-23 (n, 2n) Na-22; Na-23 (n, gamma) Na-24; Mg-24 (n, p) Na-24; Al-27 (n, p) Mg-27; Al-27 (n, alpha) Na-24; P-31 (n, p) Si-31; S-32 (n, p) P-32; Sc-45 (n, gamma) Sc-46; Ti-nat (n, x) Sc-46; Ti-nat (n, x) Sc-47; Ti-nat (n, x) Sc-48; Ti-46 (n, 2n) Ti-45; Ti-46 (n, p) Sc-46; Ti-47 (n, np) Sc-46; Ti-47 (n, p) Sc-47; Ti-48 (n, np) Sc-47; Ti-48 (n, p) Sc-48; Ti-49 (n, np) Sc-48; Cr-50 (n, gamma) Cr-51; Cr-52 (n, 2n) Cr-51; Mn-55 (n, 2n) Mn-54; Mn-55 (n, gamma) Mn-56; Fe-54 (n, p) Mn-54; Fe-56 (n, p) Mn-56; Fe-57 (n, np) Mn-56; Fe-58 (n, gamma) Fe-59; Co-59 (n, 2n) Co-58; Co-59 (n, gamma) Co-60; Co-59 (n, alpha) Mn-56; Ni-58 (n, 2n) Ni-57; Ni-58 (n, p) Co-58; Ni-60 (n, p) Co-60; Cu-63 (n, 2n) Cu-62; Cu-63 (n, gamma) Cu-64; Cu-63 (n, alpha) Co-60; Cu-65 (n, 2n) Cu-64; Zn-64 (n, p) Cu-64; Y-89 (n, 2n) Y-88; Zr-90 (n, 2n) Zr-89; Nb-93 (n, n') Nb-93m; Nb-93 (n, 2n) Nb-92m; Rh-103 (n, n') Rh-103m; Ag-109 (n, gamma) Ag-110m; In-115 (n, n') In-115m; In-115 (n, gamma) In-116m; I-127 (n,2n) I-126; Eu-151 (n, gamma) Eu-152; Tm-169 (n,2n) Tm-168; Ta-181 (n, gamma) Ta-182; W-186 (n, gamma) W-187; Au-197 (n, 2n) Au-196; Au-197 (n, gamma) Au-198; Hg-199 (n, n') Hg-199m; Th-232 - fission; Th-232 (n, gamma) Th-233; U-235 - fission; U-238 - fission; U-238 (n, gamma) U-239; Np-237 - fission; Pu-239 - fission; Am-241 - fission. The data were produced on the 31 of March, 2006

  19. Wykorzystanie informacji prospektywnychw sprawozdawczości finansowej zorientowanejna wartość na przykładzie MSR 36„Utrata wartości aktywów”

    Directory of Open Access Journals (Sweden)

    Irena Sobańska

    2009-12-01

    Full Text Available Autorzy artykułu wskazują na istotę i rosnące znaczenie informacji prospektywnych we współczesnych systemach sprawozdawczości finansowej opartej na MSSF. Ewolucja dokonująca się w sprawozdawczości finansowej, pod wpływem harmonizacji zasad rachunkowości wskutek ciągle zmieniających się MSSF, została przedstawiona na tle zmian dokonujących się w otoczeniu, w celach i w systemach zarządzania (orientacja strategiczna, wartość przedsiębiorstwa, jak również w systemach strategicznej rachunkowości zarządczej. Na podstawie szerokiego kontekstu analizy autorzy stawiają wniosek, że koncepcja wartości (przedsiębiorstwa stanowi istotny element systemu pomiaru i wyceny w systemie sprawozdawczości finansowej. Tworzy ona także spójną podstawę dla integracji rachunkowości zarządczej i rachunkowości finansowej w jeden system zapewniający użyteczne informacje zarówno dla użytkowników zewnętrznych, jak i wewnętrznych, których łączy wspólny cel – maksymalizacja wartości. Uwarunkowania tworzenia systemu sprawozdawczości opartego na informacjach prospektywnych, zorientowanego na wartość, jak również stopień dostosowania przedsiębiorstw do jego wdrożenia pokazano na przykładzie praktycznej realizacji postanowień MSR 36.

  20. Review of ORNL's MSR technology and status

    International Nuclear Information System (INIS)

    Toth, L.M.; Gat, U.; Del Cul, G.D.; Dai, S.; Williams, D.F.

    1996-01-01

    The current status of molten salt reactor development is discussed with reference to the experience from the Oak Ridge Molten Salt Reactor Experiment. Assessment of the future for this reactor system is reviewed with consideration of both advantages and disadvantages. Application of this concept to ADTT (accelerator driven transmutation technology) needs appears to be feasible by drawing on the MSRE experience. Key chemical considerations remain as: solubility, redox behavior, and chemical activity and their importance to ADTT planning is briefly explained. Priorities in the future development of molten salts for these applications are listed, with the foremost being the acceptance of the 2LiF-BeF 2 solvent system. 8 refs, 2 figs

  1. Fissility of actinide nuclei induced by 60-130 MeV photons

    International Nuclear Information System (INIS)

    Morcelle, Viviane; Tavares, Odilon A.P.

    2004-06-01

    Nuclear fissilities obtained from recent photofission reaction cross section measurements carried out at Saskatchewan Accelerator Laboratory (Saskatoon, Canada) in the energy range 60-130 MeV for 232 Th, 233 U, 235 U, 238 U, and 237 Np nuclei have been analysed in a systematic way. To this aim, a semiempirical approach has been developed based on the quasi-deuteron nuclear photoabsorption model followed by the process of competition between neutron evaporation and fission for the excited nucleus. The study reproduces satisfactorily well the increasing trend of nuclear fissility with parameter Z 2 =A. (author)

  2. Fission-energy release for 16 fissioning nuclides. Final report

    International Nuclear Information System (INIS)

    Sher, R.

    1981-03-01

    Results are presented of a least-squares evaluation of the components of energy release per fission in 232 Th, 233 U, 235 U, 238 U, 239 Pu, and 241 Pu. For completeness, older (1978) results based on systematics are presented for these and ten other isotopes of interest. There have been recent indications that the delayed energy components may be somewhat higher than those used previously, but the LSQ results do not seem to change significantly when modest (approx. 1 MeV) increases in the total delayed energy are included in the inputs. Additional measurements of most of the energy components are still needed to resolve remaining discrepancies

  3. Depth-based human activity recognition: A comparative perspective study on feature extraction

    Directory of Open Access Journals (Sweden)

    Heba Hamdy Ali

    2018-06-01

    Full Text Available Depth Maps-based Human Activity Recognition is the process of categorizing depth sequences with a particular activity. In this problem, some applications represent robust solutions in domains such as surveillance system, computer vision applications, and video retrieval systems. The task is challenging due to variations inside one class and distinguishes between activities of various classes and video recording settings. In this study, we introduce a detailed study of current advances in the depth maps-based image representations and feature extraction process. Moreover, we discuss the state of art datasets and subsequent classification procedure. Also, a comparative study of some of the more popular depth-map approaches has provided in greater detail. The proposed methods are evaluated on three depth-based datasets “MSR Action 3D”, “MSR Hand Gesture”, and “MSR Daily Activity 3D”. Experimental results achieved 100%, 95.83%, and 96.55% respectively. While combining depth and color features on “RGBD-HuDaAct” Dataset, achieved 89.1%. Keywords: Activity recognition, Depth, Feature extraction, Video, Human body detection, Hand gesture

  4. Improving Night Time Driving Safety Using Vision-Based Classification Techniques.

    Science.gov (United States)

    Chien, Jong-Chih; Chen, Yong-Sheng; Lee, Jiann-Der

    2017-09-24

    The risks involved in nighttime driving include drowsy drivers and dangerous vehicles. Prominent among the more dangerous vehicles around at night are the larger vehicles which are usually moving faster at night on a highway. In addition, the risk level of driving around larger vehicles rises significantly when the driver's attention becomes distracted, even for a short period of time. For the purpose of alerting the driver and elevating his or her safety, in this paper we propose two components for any modern vision-based Advanced Drivers Assistance System (ADAS). These two components work separately for the single purpose of alerting the driver in dangerous situations. The purpose of the first component is to ascertain that the driver would be in a sufficiently wakeful state to receive and process warnings; this is the driver drowsiness detection component. The driver drowsiness detection component uses infrared images of the driver to analyze his eyes' movements using a MSR plus a simple heuristic. This component issues alerts to the driver when the driver's eyes show distraction and are closed for a longer than usual duration. Experimental results show that this component can detect closed eyes with an accuracy of 94.26% on average, which is comparable to previous results using more sophisticated methods. The purpose of the second component is to alert the driver when the driver's vehicle is moving around larger vehicles at dusk or night time. The large vehicle detection component accepts images from a regular video driving recorder as input. A bi-level system of classifiers, which included a novel MSR-enhanced KAZE-base Bag-of-Features classifier, is proposed to avoid false negatives. In both components, we propose an improved version of the Multi-Scale Retinex (MSR) algorithm to augment the contrast of the input. Several experiments were performed to test the effects of the MSR and each classifier, and the results are presented in experimental results section

  5. Hydrogen production by methanol steam reforming carried out in membrane reactor on Cu/Zn/Mg-based catalyst

    NARCIS (Netherlands)

    Basile, A.; Parmaliana, A.; Tosti, S.; Iulianelli, A.; Gallucci, F.; Espro, C.; Spooren, J.

    2008-01-01

    The methanol steam reforming (MSR) reaction was studied by using both a dense Pd-Ag membrane reactor (MR) and a fixed bed reactor (FBR). Both the FBR and the MR were packed with a new catalyst based on CuOAl2O3ZnOMgO, having an upper temperature limit of around 350 °C. A constant sweep gas flow rate

  6. Feasibility of Thorium Fuel Cycles in a Very High Temperature Pebble-Bed Hybrid System

    Directory of Open Access Journals (Sweden)

    L.P. Rodriguez

    2015-08-01

    Full Text Available Nuclear energy presents key challenges to be successful as a sustainable energy source. Currently, the viability of the use thorium-based fuel cycles in an innovative nuclear energy generation system is being investigated in order to solve these key challenges. In this work, the feasibility of three thorium-based fuel cycles (232Th-233U, 232Th-239Pu, and 232Th-U in a hybrid system formed by a Very High Temperature Pebble-Bed Reactor (VHTR and two Pebble-Bed Accelerator Driven Systems (ADSs was evaluated using parameters related to the neutronic behavior such as nuclear fuel breeding, minor actinide stockpile, the energetic contribution of each fissile isotope, and the radiotoxicity of the long lived wastes. These parameters were used to compare the fuel cycles using the well-known MCNPX ver. 2.6e computational code. The results obtained confirm that the 232Th-233U fuel cycle is the best cycle for minimizing the production of plutonium isotopes and minor actinides. Moreover, the inclusion of the second stage in the ADSs demonstrated the possibility of extending the burnup cycle duration and reducing the radiotoxicity of the discharged fuel from the VHTR.

  7. MSR Fetch Rover Capability Development at the Canadian Space Agency

    Science.gov (United States)

    Picard, M.; Hipkin, V.; Gingras, D.; Allard, P.; Lamarche, T.; Rocheleau, S. G.; Gemme, S.

    2018-04-01

    Describes Fetch Rover technology testing during CSA's 2016 Mars Sample Return Analogue Deployment which demonstrated autonomous navigation to 'cache depots' of M-2020-like sample tubes, acquisition of six such tubes, and transfer to a MAV mock up.

  8. Mixed Sequence Reader: A Program for Analyzing DNA Sequences with Heterozygous Base Calling

    Science.gov (United States)

    Chang, Chun-Tien; Tsai, Chi-Neu; Tang, Chuan Yi; Chen, Chun-Houh; Lian, Jang-Hau; Hu, Chi-Yu; Tsai, Chia-Lung; Chao, Angel; Lai, Chyong-Huey; Wang, Tzu-Hao; Lee, Yun-Shien

    2012-01-01

    The direct sequencing of PCR products generates heterozygous base-calling fluorescence chromatograms that are useful for identifying single-nucleotide polymorphisms (SNPs), insertion-deletions (indels), short tandem repeats (STRs), and paralogous genes. Indels and STRs can be easily detected using the currently available Indelligent or ShiftDetector programs, which do not search reference sequences. However, the detection of other genomic variants remains a challenge due to the lack of appropriate tools for heterozygous base-calling fluorescence chromatogram data analysis. In this study, we developed a free web-based program, Mixed Sequence Reader (MSR), which can directly analyze heterozygous base-calling fluorescence chromatogram data in .abi file format using comparisons with reference sequences. The heterozygous sequences are identified as two distinct sequences and aligned with reference sequences. Our results showed that MSR may be used to (i) physically locate indel and STR sequences and determine STR copy number by searching NCBI reference sequences; (ii) predict combinations of microsatellite patterns using the Federal Bureau of Investigation Combined DNA Index System (CODIS); (iii) determine human papilloma virus (HPV) genotypes by searching current viral databases in cases of double infections; (iv) estimate the copy number of paralogous genes, such as β-defensin 4 (DEFB4) and its paralog HSPDP3. PMID:22778697

  9. Road-map design for thorium-uranium breeding recycle in PWR - 031

    International Nuclear Information System (INIS)

    Shengyi, Si

    2010-01-01

    The paper was focused on designing a road-map to finally approach sustainable Thorium-Uranium ( 232 Th- 233 U) Breeding Recycle in current PWR, without any other change to the fuel lattice and the core internals, but substituting the UOX pellet with Thorium-based pellet. At first, the paper presented some insights to the inherence of Thorium-Uranium fuel conversion or breeding in PWR based on the neutronics theory and revealed the prerequisites for Thorium-Uranium fuel in PWR to achieve sustainable Breeding Recycle; And then, various Thorium-based fuels were designed and examined, and the calculation results further validated the above theoretical deductions; Based on the above theoretical analysis and calculation results, a road-map for sustainable Thorium-Uranium breeding recycle in PWR was outlined finally. (authors)

  10. Actinide integral measurements in the CFRMF and integral tests for ENDF/B-V

    International Nuclear Information System (INIS)

    Anderl, R.A.

    1982-01-01

    Integral capture and/or fission rates have been reported earlier for several actinides irradiated in the fast neutron field of the Coupled Fast Reactivity Measurements Facility (CFRMF). These nuclides include 232 Th, 233 U, 235 U, 238 U, 237 Np, 239 Pu, 240 Pu, 242 Pu, 241 Am and 243 Am. This paper forucses on the utilization of these integral data for testing the respective cross sections on ENDF/B-V. Integral cross sections derived from the measured reaction rates are tabulated. Results are presented for cross-section data testing which includes integral testing based on a comparison of calculated and measured integral cross sections and testing based on least-squares-adjustment analyses

  11. Vehicle Position Estimation Based on Magnetic Markers: Enhanced Accuracy by Compensation of Time Delays

    Directory of Open Access Journals (Sweden)

    Yeun-Sub Byun

    2015-11-01

    Full Text Available The real-time recognition of absolute (or relative position and orientation on a network of roads is a core technology for fully automated or driving-assisted vehicles. This paper presents an empirical investigation of the design, implementation, and evaluation of a self-positioning system based on a magnetic marker reference sensing method for an autonomous vehicle. Specifically, the estimation accuracy of the magnetic sensing ruler (MSR in the up-to-date estimation of the actual position was successfully enhanced by compensating for time delays in signal processing when detecting the vertical magnetic field (VMF in an array of signals. In this study, the signal processing scheme was developed to minimize the effects of the distortion of measured signals when estimating the relative positional information based on magnetic signals obtained using the MSR. In other words, the center point in a 2D magnetic field contour plot corresponding to the actual position of magnetic markers was estimated by tracking the errors between pre-defined reference models and measured magnetic signals. The algorithm proposed in this study was validated by experimental measurements using a test vehicle on a pilot network of roads. From the results, the positioning error was found to be less than 0.04 m on average in an operational test.

  12. An Out-of-Core GPU based dimensionality reduction algorithm for Big Mass Spectrometry Data and its application in bottom-up Proteomics.

    Science.gov (United States)

    Awan, Muaaz Gul; Saeed, Fahad

    2017-08-01

    Modern high resolution Mass Spectrometry instruments can generate millions of spectra in a single systems biology experiment. Each spectrum consists of thousands of peaks but only a small number of peaks actively contribute to deduction of peptides. Therefore, pre-processing of MS data to detect noisy and non-useful peaks are an active area of research. Most of the sequential noise reducing algorithms are impractical to use as a pre-processing step due to high time-complexity. In this paper, we present a GPU based dimensionality-reduction algorithm, called G-MSR, for MS2 spectra. Our proposed algorithm uses novel data structures which optimize the memory and computational operations inside GPU. These novel data structures include Binary Spectra and Quantized Indexed Spectra (QIS) . The former helps in communicating essential information between CPU and GPU using minimum amount of data while latter enables us to store and process complex 3-D data structure into a 1-D array structure while maintaining the integrity of MS data. Our proposed algorithm also takes into account the limited memory of GPUs and switches between in-core and out-of-core modes based upon the size of input data. G-MSR achieves a peak speed-up of 386x over its sequential counterpart and is shown to process over a million spectra in just 32 seconds. The code for this algorithm is available as a GPL open-source at GitHub at the following link: https://github.com/pcdslab/G-MSR.

  13. Angular distributions in the neutron-induced fission of actinides

    CERN Multimedia

    In 2003 the n_TOF Collaboration performed the fission cross section measurement of several actinides ($^{232}$Th, $^{233}$U, $^{234}$U, $^{237}$Np) at the n_TOF facility using an experImental setup made of Parallel Plate Avalanche Counters (PPAC). The method based on the detection of the 2 fragments in coincidence allowed to clearly disentangle the fission reactions among other types of reactions occurring in the spallation domain. We have been therefore able to cover the very broad neutron energy range 1eV-1GeV, taking full benefit of the unique characteristics of the n_TOF facility. Figure 1 shows an example obtained in the case of $^{237}$Np where the n_ TOF measurement showed that the cross section was underestimated by a large factor in the resonance region.

  14. Method of measurement of cross sections of heavy nuclei fission induced by intermediate energy protons

    International Nuclear Information System (INIS)

    Kotov, Alexander; Chtchetkovski, Alexander; Fedorov, Oleg; Gavrikov, Yuri; Chestnov, Yuri; Poliakov, Vladimir; Vaishnene, Larissa; Vovchenko, Vil; Fukahori, Tokio

    2003-01-01

    The purpose of this work is experimental studies of the energy dependence of the fission cross sections of heavy nuclei, nat Pb, 209 Bi, 232 Th, 233 U, 235 U, 238 U, 237 Np and 239 Pu, by protons at the energies from 200 to 1000 MeV. At present experiment the method based on use of the gas parallel plate avalanche counters (PPACs) for registration of complementary fission fragments in coincidence and the telescope of scintillation counters for direct counting of the incident protons on the target has been used. First preliminary results of the energy dependences of proton induced fission cross sections for nat Pb, 209 Bi, 235 U and 238 U are reported. (author)

  15. The thorium fuel cycle

    International Nuclear Information System (INIS)

    Merz, E.R.

    1977-01-01

    The utilization of the thorium fuel cycle has long since been considered attractive due to the excellent neutronic characteristics of 233 U, and the widespread and cheap thorium resources. Although the uranium ore as well as the separative work requirements are usually lower for any thorium-based fuel cycle in comparison to present uranium-plutonium fuel cycles of thermal water reactors, interest by nuclear industry has hitherto been marginal. Fast increasing uranium prices, public reluctance against widespread Pu-recycling and expected retardations for the market penetration of fast breeders have led to a reconsideration of the thorium fuel cycle merits. In addition, it could be learned in the meantime that problems associated with reprocessing and waste handling, but particularly with a remote refabrication of 233 U are certainly not appreciably more difficult than for Pu-recycling. This may not only be due to psychological constraints but be based upon technological as well as economical facts, which have been mostly neglected up till now. In order to diversify from uranium as a nuclear energy source it seems to be worthwhile to greatly intensify efforts in the future for closing the Th/ 233 U fuel cycle. HTGR's are particularly promising for economic application. However, further R and D activites should not be solely focussed on this reactor type alone. Light and heavy-water moderated reactors, as well as even fast breeders later on, may just as well take advantage of a demonstrated thorium fuel cycle. A summary is presented of the state-of-the-art of Th/ 233 U-recycling technology and the efforts still necessary to demonstrate this technology all the way through to its industrial application

  16. Fast Thorium Molten Salt Reactors Started with Plutonium

    International Nuclear Information System (INIS)

    Merle-Lucotte, E.; Heuer, D.; Le Brun, C.; Brissot, R.; Liatard, E.; Meplan, O.; Nuttin, A.; Mathieu, L.

    2006-01-01

    One of the pending questions concerning Molten Salt Reactors based on the 232 Th/ 233 U fuel cycle is the supply of the fissile matter, and as a consequence the deployment possibilities of a fleet of Molten Salt Reactors, since 233 U does not exist on earth and is not yet produced in the current operating reactors. A solution may consist in producing 233 U in special devices containing Thorium, in Pressurized Water or Fast Neutrons Reactors. Two alternatives to produce 233 U are examined here: directly in standard Molten Salt Reactors started with Plutonium as fissile matter and then operated in the Th/ 233 U cycle; or in dedicated Molten Salt Reactors started and fed with Plutonium as fissile matter and Thorium as fertile matter. The idea is to design a critical reactor able to burn the Plutonium and the minor actinides presently produced in PWRs, and consequently to convert this Plutonium into 233 U. A particular reactor configuration is used, called 'unique channel' configuration in which there is no moderator in the core, leading to a quasi fast neutron spectrum, allowing Plutonium to be used as fissile matter. The conversion capacities of such Molten Salt Reactors are excellent. For Molten Salt Reactors only started with Plutonium, the assets of the Thorium fuel cycle turn out to be quickly recovered and the reactor's characteristics turn out to be equivalent to Molten Salt Reactors operated with 233 U only. Using a combination of Molten Salt Reactors started or operated with Plutonium and of Molten Salt Reactors started with 233 U, the deployment capabilities of these reactors fully satisfy the condition of sustainability. (authors)

  17. Mesocarbon microbead based graphite for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Yajuan, E-mail: yajuan.zhong@gmail.com [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); CAS Key Laboratory of Carbon Materials, Institute of Coal Chemistry, Chinese Academy of Sciences, Taiyuan 030001 (China); Zhang, Junpeng [CAS Key Laboratory of Carbon Materials, Institute of Coal Chemistry, Chinese Academy of Sciences, Taiyuan 030001 (China); Lin, Jun, E-mail: linjun@sinap.ac.cn [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Xu, Liujun [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhang, Feng; Xu, Hongxia; Chen, Yu; Jiang, Haitao; Li, Ziwei; Zhu, Zhiyong [Center for Thorium Molten Salt Reactor System, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Guo, Quangui [CAS Key Laboratory of Carbon Materials, Institute of Coal Chemistry, Chinese Academy of Sciences, Taiyuan 030001 (China)

    2017-07-15

    Mesocarbon microbeads (MCMB) and quasi-isostatic pressing method were used to prepare MCMB based graphite (MG) for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor (MSR). Characteristics of mercury infiltration and molten salt infiltration in MG were investigated and compared with A3-3 (graphite for spherical fuel element in high temperature gas cooled reactor) to identify the infiltration behaviors. The results indicated that MG had a low porosity about 14%, and an average pore diameter of 96 nm. Fluoride salt occupation of A3-3 (average pore diameter was 760 nm) was 10 wt% under 6.5 atm, whereas salt gain did not infiltrate in MG even up to 6.5 atm. It demonstrated that MG could inhibit the infiltration of liquid fluoride salt effectively. Coefficient of thermal expansion (CTE) of MG lies in 6.01 × 10{sup −6} K{sup −1} (α{sub ∥}) and 6.15 × 10{sup −6} K{sup −1} (α{sub ⊥}) at the temperature range of 25–700 °C. The anisotropy factor of MG calculated by CTE maintained below 1.02, which could meet the requirement of the spherical fuel element (below 1.30). The constant isotropic property of MG is beneficial for the integrity and safety of the graphite used in the spherical fuel element for a MSR.

  18. Mesocarbon microbead based graphite for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor

    International Nuclear Information System (INIS)

    Zhong, Yajuan; Zhang, Junpeng; Lin, Jun; Xu, Liujun; Zhang, Feng; Xu, Hongxia; Chen, Yu; Jiang, Haitao; Li, Ziwei; Zhu, Zhiyong; Guo, Quangui

    2017-01-01

    Mesocarbon microbeads (MCMB) and quasi-isostatic pressing method were used to prepare MCMB based graphite (MG) for spherical fuel element to inhibit the infiltration of liquid fluoride salt in molten salt reactor (MSR). Characteristics of mercury infiltration and molten salt infiltration in MG were investigated and compared with A3-3 (graphite for spherical fuel element in high temperature gas cooled reactor) to identify the infiltration behaviors. The results indicated that MG had a low porosity about 14%, and an average pore diameter of 96 nm. Fluoride salt occupation of A3-3 (average pore diameter was 760 nm) was 10 wt% under 6.5 atm, whereas salt gain did not infiltrate in MG even up to 6.5 atm. It demonstrated that MG could inhibit the infiltration of liquid fluoride salt effectively. Coefficient of thermal expansion (CTE) of MG lies in 6.01 × 10 −6 K −1 (α ∥ ) and 6.15 × 10 −6 K −1 (α ⊥ ) at the temperature range of 25–700 °C. The anisotropy factor of MG calculated by CTE maintained below 1.02, which could meet the requirement of the spherical fuel element (below 1.30). The constant isotropic property of MG is beneficial for the integrity and safety of the graphite used in the spherical fuel element for a MSR.

  19. Landslide mapping with multi-scale object-based image analysis – a case study in the Baichi watershed, Taiwan

    Directory of Open Access Journals (Sweden)

    T. Lahousse

    2011-10-01

    Full Text Available We developed a multi-scale OBIA (object-based image analysis landslide detection technique to map shallow landslides in the Baichi watershed, Taiwan, after the 2004 Typhoon Aere event. Our semi-automated detection method selected multiple scales through landslide size statistics analysis for successive classification rounds. The detection performance achieved a modified success rate (MSR of 86.5% with the training dataset and 86% with the validation dataset. This performance level was due to the multi-scale aspect of our methodology, as the MSR for single scale classification was substantially lower, even after spectral difference segmentation, with a maximum of 74%. Our multi-scale technique was capable of detecting landslides of varying sizes, including very small landslides, up to 95 m2. The method presented certain limitations: the thresholds we established for classification were specific to the study area, to the landslide type in the study area, and to the spectral characteristics of the satellite image. Because updating site-specific and image-specific classification thresholds is easy with OBIA software, our multi-scale technique is expected to be useful for mapping shallow landslides at watershed level.

  20. Integration of Methane Steam Reforming and Water Gas Shift Reaction in a Pd/Au/Pd-Based Catalytic Membrane Reactor for Process Intensification.

    Science.gov (United States)

    Castro-Dominguez, Bernardo; Mardilovich, Ivan P; Ma, Liang-Chih; Ma, Rui; Dixon, Anthony G; Kazantzis, Nikolaos K; Ma, Yi Hua

    2016-09-19

    Palladium-based catalytic membrane reactors (CMRs) effectively remove H₂ to induce higher conversions in methane steam reforming (MSR) and water-gas-shift reactions (WGS). Within such a context, this work evaluates the technical performance of a novel CMR, which utilizes two catalysts in series, rather than one. In the process system under consideration, the first catalyst, confined within the shell side of the reactor, reforms methane with water yielding H₂, CO and CO₂. After reforming is completed, a second catalyst, positioned in series, reacts with CO and water through the WGS reaction yielding pure H₂O, CO₂ and H₂. A tubular composite asymmetric Pd/Au/Pd membrane is situated throughout the reactor to continuously remove the produced H₂ and induce higher methane and CO conversions while yielding ultrapure H₂ and compressed CO₂ ready for dehydration. Experimental results involving (i) a conventional packed bed reactor packed (PBR) for MSR, (ii) a PBR with five layers of two catalysts in series and (iii) a CMR with two layers of two catalysts in series are comparatively assessed and thoroughly characterized. Furthermore, a comprehensive 2D computational fluid dynamics (CFD) model was developed to explore further the features of the proposed configuration. The reaction was studied at different process intensification-relevant conditions, such as space velocities, temperatures, pressures and initial feed gas composition. Finally, it is demonstrated that the above CMR module, which was operated for 600 h, displays quite high H₂ permeance and purity, high CH₄ conversion levels and reduced CO yields.

  1. Otimização de propriedades mecânicas de misturas ternárias de polipropileno (PP/borracha de etileno-propileno-dieno (EPDM/pó de pneus (SRT sob tração e impacto usando a metodologia da superfície de resposta (MSR Optimization of mechanical properties of polypropylene (PP/ethylene-propylene-diene monomer rubber (EPDM/scrap rubber tire (SRT ternary mixtures under tensile and impact using the response surface methodology (RSM

    Directory of Open Access Journals (Sweden)

    Helson M. da Costa

    2012-01-01

    Full Text Available A metodologia da superfície de resposta (MSR é uma coleção de técnicas estatísticas e matemáticas para desenvolver, melhorar e otimizar processos. Neste estudo, a técnica MSR foi aplicada na investigação do comportamento mecânico de diferentes misturas ternárias de PP/EPDM/SRT. Após a mistura apropriada em uma extrusora de dupla rosca co-rotante e a moldagem por injeção, as propriedades mecânicas (resistência à tração e a resistência ao impacto foram determinadas e usadas como variáveis de resposta. A microscopia eletrônica de varredura (MEV foi usada para investigar a morfologia das diferentes misturas e interpretar os resultados. Com ferramentas estatísticas específicas, um número mínimo de experimentos permitiu o desenvolvimento de um modelo de superfície de resposta e a otimização das concentrações dos componentes de acordo com o desempenho mecânico. Valores elevados de resistência ao impacto são alcançados (>80 J.m-1 quando, de acordo com as condições experimentais estudadas, a mistura física de PP/EPDM/SRT mantém as proporções de EPDM e SRT em torno de 25%.The response surface methodology (RSM is a collection of statistical and mathematical techniques for developing, improving and optimizing processes. In this study, RSM technique was applied to the investigation of the mechanical behavior of different PP/EPDM/SRT ternary mixtures. After appropriate processing in a co-rotating twin extruder and injection molding, the mechanical properties, such as tensile strength and impact strength, were determined and used as response variables. Scanning electron microscopy (SEM was used for investigating the morphology of the different blends and to interpret the results. With specific statistical tools, a minimum number of experiments allowed the response surface model to be developed and the concentrations of the components to be optimized according to the mechanical performance. High values of impact

  2. Potentialities of the molten salt reactor concept for a sustainable nuclear power production based on thorium cycle in epithermal spectrum

    International Nuclear Information System (INIS)

    Nuttin, Alexis

    2002-01-01

    In the case of a significant nuclear contribution to world energy needs, the problem of present nuclear waste management pose the sustainability of the PWR fuel cycle back into question. Studies on storage and incineration of these wastes should therefore go hand in hand with studies on innovative systems dedicated to a durable nuclear energy production, as reliable, clean and safe as possible. We are here interested in the concept of molten salt reactor, whose fuel is liquid. This particularity allows an online pyrochemical reprocessing which gives the possibility to overcome some neutronic limits. In the late sixties, the MSBR (Molten Salt Breeder Reactor) project of a graphite-moderated fluoride molten salt reactor proved thus that breeding is attainable with thorium in a thermal spectrum, provided that the online reprocessing is appropriate. By means of simulation tools developed around the Monte Carlo code MCNP, we first re-evaluate the performance of a reference system, which is inspired by the MSBR project. The complete study of the pre-equilibrium transient of this 2,500 MWth reactor, started with 232 Th/ 233 U fuel, allows us to validate our reference choices. The obtained equilibrium shows an important reduction of inventories and induced radio-toxicities in comparison with the other possible fuel cycles. The online reprocessing is efficient enough to make the system breed, with a doubling time of about thirty years at equilibrium. From the reference system, we then test different options in terms of neutron economy, transmutation and control of reactivity. We find that the online reprocessing brings most of its flexibility to this system, which is particularly well adapted to power generation with thorium. The study of transition scenarios to this fuel cycle quantifies the limits of a possible deployment from the present French power stock, and finally shows that a rational management of the available plutonium would be necessary in any case. (author)

  3. Multi-year evaluation of stocking rate and animal genotype on milk production per hectare within intensive pasture-based production systems.

    Science.gov (United States)

    Coffey, E L; Delaby, L; Fleming, C; Pierce, K M; Horan, B

    2018-03-01

    The objective of this experiment was to evaluate the effect of stocking rate (SR) and animal genotype (BR) on milk production, body weight (BW), and body condition score (BCS) within intensive pasture-based systems. A total of 533 lactation records, from 246 elite genetic merit dairy cows were available for analysis; 68 Holstein-Friesian (HF) and 71 Jersey × Holstein-Friesian (JxHF) crossbred cows in each of 4 consecutive years (2013-2016, inclusive). Cows from each BR were randomly allocated to 1 of 3 whole-farm comparative SR treatments, low (LSR; 1,200 kg of BW/ha), medium (MSR; 1,400 kg of BW/ha), and high (HSR; 1,600 kg of BW/ha), and remained in the same SR treatments for the duration of the experiment. The effects of SR, BR, and their interaction on milk production/cow and per hectare, BW, BCS, and grazing characteristics were analyzed. Total pasture utilization per hectare consumed in the form of grazed pasture increased linearly as SR increased: least in LSR (10,237 kg of dry matter/ha), intermediate in MSR (11,016 kg of dry matter/ha), and greatest in HSR (11,809 kg of dry matter/ha). Milk and milk solids (MS) yield per hectare was greatest for HSR (15,942 and 1,354 kg, respectively), intermediate for MSR (14,191 and 1,220 kg, respectively), and least for LSR (13,186 and 1,139 kg, respectively) with similar trends evident for fat, protein, and lactose yield/ha. At higher SR (MSR and HSR), MS yield per kg of BW per ha was reduced (0.85 and 0.82 kg of MS/kg of BW, respectively) compared with LSR (0.93 kg of MS/kg of BW/ha). Holstein-Friesian cows achieved fewer grazing days per hectare (-37 d), and produced more milk (+561 kg/ha) but less fat plus protein (-57 kg/ha) compared with JxHF cows; the JxHF cows were lighter. At similar BW per hectare, JxHF cows produced more fat plus protein/ha during the grazing season at low (1,164 vs. 1,113 kg), medium (1,254 vs. 1,185 kg), and high (1,327 vs. 1,380 kg) SR. In addition, JxHF cows produced more fat plus

  4. Base

    DEFF Research Database (Denmark)

    Hjulmand, Lise-Lotte; Johansson, Christer

    2004-01-01

    BASE - Engelsk basisgrammatik er resultatet af Lise-Lotte Hjulmands grundige bearbejdning og omfattende revidering af Christer Johanssons Engelska basgrammatik. Grammatikken adskiller sig fra det svenske forlæg på en lang række punkter. Den er bl.a. tilpasset til et dansk publikum og det danske...

  5. Integration of Methane Steam Reforming and Water Gas Shift Reaction in a Pd/Au/Pd-Based Catalytic Membrane Reactor for Process Intensification

    Directory of Open Access Journals (Sweden)

    Bernardo Castro-Dominguez

    2016-09-01

    Full Text Available Palladium-based catalytic membrane reactors (CMRs effectively remove H2 to induce higher conversions in methane steam reforming (MSR and water-gas-shift reactions (WGS. Within such a context, this work evaluates the technical performance of a novel CMR, which utilizes two catalysts in series, rather than one. In the process system under consideration, the first catalyst, confined within the shell side of the reactor, reforms methane with water yielding H2, CO and CO2. After reforming is completed, a second catalyst, positioned in series, reacts with CO and water through the WGS reaction yielding pure H2O, CO2 and H2. A tubular composite asymmetric Pd/Au/Pd membrane is situated throughout the reactor to continuously remove the produced H2 and induce higher methane and CO conversions while yielding ultrapure H2 and compressed CO2 ready for dehydration. Experimental results involving (i a conventional packed bed reactor packed (PBR for MSR, (ii a PBR with five layers of two catalysts in series and (iii a CMR with two layers of two catalysts in series are comparatively assessed and thoroughly characterized. Furthermore, a comprehensive 2D computational fluid dynamics (CFD model was developed to explore further the features of the proposed configuration. The reaction was studied at different process intensification-relevant conditions, such as space velocities, temperatures, pressures and initial feed gas composition. Finally, it is demonstrated that the above CMR module, which was operated for 600 h, displays quite high H2 permeance and purity, high CH4 conversion levels and reduced CO yields.

  6. Chain and independent fission product yields adjusted to conform with physical conservation laws. Part 2

    International Nuclear Information System (INIS)

    Crouch, E.A.C.

    1976-01-01

    Previously reported adjustments to the chain yields and independent yields for the thermal neutron induced fission of 233 U, 235 U, 239 Pu and 241 Pu, the fast neutron induced fission of 232 Th, 233 U, 235 U, 238 U, 239 Pu, 240 Pu and 241 Pu, and the 14 MeV neutron induced fission of 232 Th, 233 U, 235 U and 238 U, have been recalculated using the principle of least squares. The adjustments to the chain yields so found are much smaller than those previously reported. (author)

  7. [Various report forms and letters regarding MSR Abril 5B-1

    Energy Technology Data Exchange (ETDEWEB)

    Various

    2007-08-16

    The documents described here and the following may be found at the Website of the State of California Department of Conservation, Division of Oil, Gas & Geothermal Resources, http://www.consrv.ca.gov/DOG/geothermal/unit_15/Unit15.htm. GEO Operator Corporation (formerly Thermogenics, Inc. and Geothermal Resources International Operator Corporation) drilled steam production and injection wells in the northwestern portion of The Geysers geothermal field from 1967 to 1985. These wells produced steam that was sold to PG&E's power plant 15. In 1989, the plant stopped operating so the wells stopped producing and GEO Operator Corporation went bankrupt. In 1997-1998, the U.S. Environmental Protection Agency and the Division of Oil, Gas, and Geothermal Resources, with funding from the California Energy Commission, plugged and abandoned most of these idle wells because of severe wellhead corrosion. Technical data and well cuttings were salvaged from an abandoned warehouse on the GEO Operator Corporation lease. These data have recently been scanned and added to the Division's existing scanned well records. The data are unique because GEO Operator Corporation performed an unusually high number of studies, well tests, and analyses. A total of over 10,300 pages and over 340 logs are included in the scans. The reservoir engineering section alone contains over 3,300 pages of reservoir characterization, well testing, and related studies. These data will be useful to the operators at The Geysers Geothermal field, as well as the public and researchers worldwide.

  8. Data Analysis with the Morse-Smale Complex: The msr Package for R

    KAUST Repository

    Gerber, Samuel; Potter, Kristin

    2012-01-01

    In many areas, scientists deal with increasingly high-dimensional data sets. An important aspect for these scientists is to gain a qualitative understanding of the process or system from which the data is gathered. Often, both input variables

  9. Molten Salt Demonstration Transmuter (comparison of new technical problems with old US MSR plans)

    International Nuclear Information System (INIS)

    Lelek, V.

    2001-01-01

    A Molten Salt Demonstration Transmuter (MSDT) is required to show the operation and design performance for closing the nuclear spent fuel (NSF) cycle for PWR or WWER reactors operated in the once-through cycle (OTC) mode. The remnant waste (fission products only) would be either permanently stored or held for secondary use. The purpose of this proposal is to establish the design basis for the MSDT and compare contemporary knowledge and demands with that from US plans for MS reactors from 1974, because both technologies are very near (Authors)

  10. The design and optimization of disk structures for MAMMOS/MSR magneto-optic recording

    International Nuclear Information System (INIS)

    Hendren, W R; Atkinson, R; Pollard, R J; Salter, I W; Wright, C D; Clegg, W W; Jenkins, D F L

    2005-01-01

    Existing quadrilayer and trilayer techniques for optimizing the magneto-optical effects from magnetic materials have been applied to new generation recording media to investigate the possibility of maximizing the signal-to-noise readout performance. Various methods are reviewed and the designs they produce are compared with each other and with the working media found in the literature. In order to address a number of inadequacies, a new numerical approach to the optimization of a quadrilayer structure is used to find further solutions that are considered more suitable for the practical recording media. The effects on design and performance of medium of incidence, type of storage layer and wavelength are all considered

  11. Optimized Application of MSR and Steam Turbine Retrofits in Nuclear Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Crossland, Robert; McCoach, John [ALSTOM Power, Willans Works, Newbold Road, Rugby, Warwickshire CV21 2NH (United Kingdom); Gagelin, Jean-Philippe [ALSTOM Power Heat Exchange, 19-21 avenue Morane-Saulnier, BP 65, 78143 Velizy Cedex (France)

    2004-07-01

    The benefit to a nuclear power plant from a steam turbine retrofit has often been clearly demonstrated in recent years but, for light water nuclear plants, the Moisture Separator Reheaters (MSRs) are also of prime importance. This paper describes how refurbishment of these crucial components can only provide full potential performance benefit when made in conjunction with a steam turbine retrofit (although in practice these activities are frequently separated). Examples are given to show how combined application is best handled within a single organization to ensure optimized integration into the thermal cycle. (authors)

  12. Optimized Application of MSR and Steam Turbine Retrofits in Nuclear Power Plants

    International Nuclear Information System (INIS)

    Crossland, Robert; McCoach, John; Gagelin, Jean-Philippe

    2004-01-01

    The benefit to a nuclear power plant from a steam turbine retrofit has often been clearly demonstrated in recent years but, for light water nuclear plants, the Moisture Separator Reheaters (MSRs) are also of prime importance. This paper describes how refurbishment of these crucial components can only provide full potential performance benefit when made in conjunction with a steam turbine retrofit (although in practice these activities are frequently separated). Examples are given to show how combined application is best handled within a single organization to ensure optimized integration into the thermal cycle. (authors)

  13. The design and optimization of disk structures for MAMMOS/MSR magneto-optic recording

    Energy Technology Data Exchange (ETDEWEB)

    Hendren, W R [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Atkinson, R [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Pollard, R J [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Salter, I W [School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Wright, C D [School of Engineering and Computer Science, University of Exeter, Exeter EX4 4QF (United Kingdom); Clegg, W W [Centre for Research in Information Storage Technology, University of Plymouth, Plymouth PL4 8AA (United Kingdom); Jenkins, D F L [Centre for Research in Information Storage Technology, University of Plymouth, Plymouth PL4 8AA (United Kingdom)

    2005-07-21

    Existing quadrilayer and trilayer techniques for optimizing the magneto-optical effects from magnetic materials have been applied to new generation recording media to investigate the possibility of maximizing the signal-to-noise readout performance. Various methods are reviewed and the designs they produce are compared with each other and with the working media found in the literature. In order to address a number of inadequacies, a new numerical approach to the optimization of a quadrilayer structure is used to find further solutions that are considered more suitable for the practical recording media. The effects on design and performance of medium of incidence, type of storage layer and wavelength are all considered.

  14. Molten salt reactor related research in Switzerland

    International Nuclear Information System (INIS)

    Krepel, Jiri; Hombourger, Boris; Fiorina, Carlo

    2015-01-01

    Switzerland represented by the Paul Scherrer Institute (PSI) is a member of the Generation IV International Forum (GIF). In the past, the research at PSI focused mainly on HTR, SFR, and GFR. Currently, a research program was established also for Molten Salt Reactors (MSR). Safety is the key point and main interest of the MSR research at the Nuclear Energy and Safety (NES) department of PSI. However, it cannot be evaluated without knowing the system design, fuel chemistry, salt thermal-hydraulics features, safety and fuel cycle approach, and the relevant material and chemical limits. Accordingly, sufficient knowledge should be acquired in the other individual fields before the safety can be evaluated. The MSR research at NES may be divided into four working packages (WP): WP1: MSR core design and fuel cycle, WP2: MSR fuel behavior at nominal and accidental conditions, WP3: MSR thermal-hydraulics and decay heat removal system, WP4: MSR safety, fuel stream, and relevant limits. The WPs are proposed so that there are research topics which can be independently studied within each of them. The work plan of the four WPs is based on several ongoing or past national and international projects relevant to MSR, where NES/PSI participates. At the current stage, the program focuses on several specific and design independent studies. The safety is the key point and main long-term interest of the MSR research at NES. (author)

  15. Calculating the mass distribution of heavy nucleus fission product by neutrons

    International Nuclear Information System (INIS)

    Gudkov, A.N.; Koldobskij, A.B.; Kolobashkin, V.M.; Semenova, E.V.

    1981-01-01

    The technique of calculating the fission product mass yields by neutrons which are necessary for performing nucleus physical calculations in designing nuclear reactor cores is considered. The technique is based on the approximation of fission product mass distribution over the whole mass range by five Gauss functions. New analytical expressions for determining energy weights of used gaussians are proposed. The results of comparison of experimental data with calculated values for fission product mass obtained for reference processes in the capacity of which the fission reactions are chosen: 233 U, 235 U fission by thermal neutrons, 232 Th, 233 U, 235 U, 238 U by fission spectrum neutrons and 14 MeV neutrons and for 232 Th fission reactions by 11 MeV neutrons and 238 U by 7.7 MeV neutrons. On the basis of the analysis of results obtained the conclusion is drawn on a good agreement of fission product mass yield calculation values obtained using recommended values of mass distribution parameters with experimental data [ru

  16. High Flux Microchannel Receiver Development with Adap-tive Flow Control

    Energy Technology Data Exchange (ETDEWEB)

    Drost, Kevin [Oregon State Univ., Corvallis, OR (United States)

    2015-08-15

    This project is focused on the demonstration of a microchannel-based solar receiver (MSR). The MSR concept consists of using a modular arrangement of arrayed microchannels to heat a working fluid in a concentrating solar receiver, allowing a much higher solar flux on the receiver and consequently a significant reduction in thermal losses, size, and cost.

  17. Preparation and Tribological Properties of Dual-Coated TiO2 Nanoparticles as Water-Based Lubricant Additives

    Directory of Open Access Journals (Sweden)

    Yue Gu

    2014-01-01

    Full Text Available Titanium dioxide nanoparticles (TiO2 were synthesized and then dual-coated with silane coupling agent (KH-570 and OP-10 in sequence in order to be dispersed stably in water as lubricant additives. The tribological properties and the application performance in Q235 steel machining of the nanoparticles as water-based lubricant additives were investigated on an MSR-10D four-ball tribotester and on a bench drilling machine, respectively. Scanning electron microscope (SEM and atomic force microscope (AFM were used to analyze the worn surface. The results show that the surface-modified TiO2 nanoparticles can remarkably improve the load-carrying capacity, the friction reducing, and anti wear abilities of pure water. The wear scar diameter and the coefficient of friction of the water-based lubricating fluids with TiO2 nanoparticles decreased, and the thick deep furrows on the surface of wear scar also decreased obviously with the increase of TiO2 concentration. The power consumption in drilling process was lower and the cutting surface was smoother using the water-based lubricating fluids added TiO2 nanoparticles compared to the fluid without addition. The reason for nanoparticles improving tribological properties of water based lubricating fluid might be the formation of a dynamic deposition film during rubbing process according to analysis of the worn surface.

  18. Molten Salt Breeder Reactor Analysis Based on Unit Cell Model

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Yongjin; Choi, Sooyoung; Lee, Deokjung [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2014-05-15

    Contemporary computer codes like the MCNP6 or SCALE are only good for solving a fixed solid fuel reactor. However, due to the molten-salt fuel, MSR analysis needs some functions such as online reprocessing and refueling, and circulating fuel. J. J. Power of Oak Ridge National Laboratory (ORNL) suggested in 2013 a method for simulating the Molten Salt Breeder Reactor (MSBR) with SCALE, which does not support continuous material processing. In order to simulate MSR characteristics, the method proposes dividing a depletion time into short time intervals and batchwise reprocessing and refueling at each step. We are applying this method by using the MCNP6 and PYTHON and NEWT-TRITON-PYTHON and PYTHON code systems to MSBR. This paper contains various parameters to analyze the MSBR unit cell model such as the multiplication factor, breeding ratio, change of amount of fuel, amount of fuel feeding, and neutron flux distribution. The result of MCNP6 and NEWT module in SCALE show some difference in depletion analysis, but it still seems that they can be used to analyze MSBR. Using these two computer code system, it is possible to analyze various parameters for the MSBR unit cells such as the multiplication factor, breeding ratio, amount of material, total feeding, and neutron flux distribution. Furthermore, the two code systems will be able to be used for analyzing other MSR model or whole core models of MSR.

  19. Molten Salt Breeder Reactor Analysis Based on Unit Cell Model

    International Nuclear Information System (INIS)

    Jeong, Yongjin; Choi, Sooyoung; Lee, Deokjung

    2014-01-01

    Contemporary computer codes like the MCNP6 or SCALE are only good for solving a fixed solid fuel reactor. However, due to the molten-salt fuel, MSR analysis needs some functions such as online reprocessing and refueling, and circulating fuel. J. J. Power of Oak Ridge National Laboratory (ORNL) suggested in 2013 a method for simulating the Molten Salt Breeder Reactor (MSBR) with SCALE, which does not support continuous material processing. In order to simulate MSR characteristics, the method proposes dividing a depletion time into short time intervals and batchwise reprocessing and refueling at each step. We are applying this method by using the MCNP6 and PYTHON and NEWT-TRITON-PYTHON and PYTHON code systems to MSBR. This paper contains various parameters to analyze the MSBR unit cell model such as the multiplication factor, breeding ratio, change of amount of fuel, amount of fuel feeding, and neutron flux distribution. The result of MCNP6 and NEWT module in SCALE show some difference in depletion analysis, but it still seems that they can be used to analyze MSBR. Using these two computer code system, it is possible to analyze various parameters for the MSBR unit cells such as the multiplication factor, breeding ratio, amount of material, total feeding, and neutron flux distribution. Furthermore, the two code systems will be able to be used for analyzing other MSR model or whole core models of MSR

  20. APXS Data from Mars and MSR Samples: How Can They Be Combined and Benefit from Each Other?

    Science.gov (United States)

    Gellert, R.

    2018-04-01

    The APXS has returned the chemical composition of more than 1000 samples on four rover missions along the combined traverse of >70km. Combining Mars data with terrestrial lab results of martian samples will be important, but it has to be done right.

  1. Effects of Dissolved Oxygen Concentration and Iron Addition on Immediate-early Gene Expression of Magnetospirillum gryphiswaldense MSR-1

    DEFF Research Database (Denmark)

    Zhuang, Shiwen; Anyaogu, Diana Chinyere; Kasama, Takeshi

    2017-01-01

    in cultures at 0.5% O2 compared to those at higher oxygen tensions. Moreover, expression of katG (catalase-peroxidase gene) and feoB2 (ferrous transport protein B2 gene) was reduced markedly by iron addition, regardless of oxygen conditions. The data provides a greater understanding of molecular response...

  2. Proposed Guidance for Preparing and Reviewing Molten Salt Nonpower Reactor Licence Applications (NUREG-1537)

    Energy Technology Data Exchange (ETDEWEB)

    Belles, Randy [ORNL; Flanagan, George F. [ORNL; Voth, Marcus [Boston Government Services, LLC

    2018-05-01

    Development of non-power molten salt reactor (MSR) test facilities is under consideration to support the analyses needed for development of a full-scale MSR. These non-power MSR test facilities will require review by the US Nuclear Regulatory Commission (NRC) staff. This report proposes chapter adaptations for NUREG-1537 in the form of interim staff guidance to address preparation and review of molten salt non-power reactor license applications. The proposed adaptations are based on a previous regulatory gap analysis of select chapters from NUREG-1537 for their applicability to non-power MSRs operating with a homogeneous fuel salt mixture.

  3. Simulation of Molten Salt Reactor dynamics

    International Nuclear Information System (INIS)

    Krepel, J.; Rohde, U.; Grundmann, U.

    2005-01-01

    Dynamics of the Molten Salt Reactor - one of the 'Generation IV' concepts - was studied in this paper. The graphite-moderated channel type MSR was selected for the numerical simulation of the reactor with liquid fuel. The MSR dynamics is very specific because of two physical peculiarities of the liquid fueled reactor: the delayed neutrons precursors are drifted by the fuel flow and the fission energy is immediately released directly into the coolant. Presently, there are not many accessible numerical codes appropriate for the MSR simulation, therefore the DYN3D-MSR code was developed based on the FZR in-house code DYN3D. It allows calculating of full 3D transient neutronics in combination with parallel channel type thermal-hydraulics. By means of DYN3D-MSR, several transients typical for the liquid fuel system were analyzed. Those transients were initiated by reactivity insertion, by overcooling of fuel at the core inlet, by the fuel pump start-up or coast-down, or by the blockage of selected fuel channels. In these considered transients, the response of the MSR is characterized by the immediate change of the fuel temperature with changing power and fast negative temperature feedback to the power. The response through the graphite temperature is slower. Furthermore, for big MSR cores fueled with U233 the graphite feedback coefficient can be positive. In this case the addition of erbium to the graphite can ensure the inherent safety features. The DYN3D-MSR code has been shown to be an effective tool for MSR dynamics studies. (author)

  4. Field studies on the terrestrial behavior of actinide elements in East Tennessee

    International Nuclear Information System (INIS)

    Garten, C.T. Jr.; Bondietti, E.A.; Trabalka, J.R.; Walker, R.L.; Scott, T.G.

    1984-01-01

    Field studies on the comparative uptake of various actinide elements ( 232 Th, 233 U, 238 U, 239 Pu, 241 Am, and 244 Cm) by plants and animals inhabiting historically contaminated environments on the Oak Ridge National Laboratory (ORNL) reservation in East Tennessee are summarized. The present-day pattern of actinide element bioaccumulation from a flood plain site contaminated with Pu in 1944 is U > Th approx. Pu. Thus the environmentally dispersed 239 Pu exhibits a transfer from floodplain soil to biota comparable to that of indigenous 232 Th and less than that of the indigenous 238 U. This ranking agrees with the chemical extractability of U, Th, and Pu from soil, using either weak acids or strongly basic reagents. The pattern of actinide element uptake from the shoreline of a historically contaminated pond is Pu 238 U = 233 U. This ranking also agrees with the chemical extractability of Pu, Am, Cm, and U from shoreline sediment, using weak acids. Results from field studies at ORNL agree with what has been generally inferred about the relative food chain transfer of the actinides, based on laboratory studies and field studies at other sites in the United States. Because they share the same valence state, there are apparent strong similarities in soil sorption, plant uptake, and animal uptake between trivalent Am and Cm and between tetravalent Pu and Th. Available evidence suggests that knowledge of the behavior of naturally occurring 232 Th in the terrestrial food chain can be useful for predicting the long-term fate of environmentally dispersed 239 Pu, while data on 238 U might be used to place an upper limit on the expected long-term food chain transfer of all transuranic elements except Np. 33 references, 5 figures, 1 table

  5. Comparison of square and hexagonal fuel lattices for high conversion PWRs

    International Nuclear Information System (INIS)

    Kotlyar, D.; Shwageraus, E.

    2011-01-01

    This paper reports on an investigation into fuel design choices of a PWR operating in a self sustainable Th- 233 U fuel cycle. Achieving such self-sustainable with respect to fissile material fuel cycle would practically eliminate concerns over nuclear fuel supply hundreds of years into the future. Moreover, utilization of light water reactor technology and its associated vast experience would allow faster deployment of such fuel cycle without immediate need for development of fast reactor technology, which tends to be more complex and costly. In order to evaluate feasibility of this concept, two types of fuel assembly lattices were considered: square and hexagonal. The hexagonal lattice may offer some advantages over the square one. For example, the fertile blanket fuel can be packed more tightly reducing the blanket volume fraction in the core and potentially allowing to achieve higher core average power density. Furthermore, hexagonal lattice may allow more uniform leakage of neutrons from fissile to fertile regions and therefore more uniform neutron captures in thorium blanket. The calculations were carried out with Monte-Carlo based BGCore system, which includes neutronic, fuel depletion and thermo-hydraulic modules. The results were compared to those obtained from Serpent Monte-Carlo code and deterministic fuel assembly transport code BOXER. One of the major design challenges associated with the square seed-blanket concept is high power peaking due to the high concentration of fissile material in the seed region. In order to explore feasibility of the studied designs, the calculations were extended to include 3D fuel assembly analysis with thermal-hydraulic feedback. The coupled neutronic - thermal-hydraulic calculations were performed with BGCore code system. The analysis showed that both hexagonal and square seed-blanket fuel assembly designs have a potential of achieving net breeding. While no major neutronic advantages were observed for either fuel

  6. Separation of silicon carbide-coated fertile and fissile particles by gas classification

    International Nuclear Information System (INIS)

    Vaughen, V.C.A.

    1976-07-01

    The separation of 235 U and 233 U in the reprocessing of HTGR fuels is a key feature of the feed-breed fuel cycle concept. This is attained in the Fort St. Vrain (FSV) reactor by coating the fissile (Th- 235 U) particles and the fertile (Th- 233 U) particles separately with silicon carbide (SiC) layers to contain the fission products and to protect the kernels from burning in the head-end reprocessing steps. Pneumatic (gas) classification based on size and density differences is the reference process for separating the SiC-coated particles into fissile and fertile streams for subsequent handling. Terminal velocities have been calculated for the +- 2 sigma ranges of particle sizes and densities for ''Fissile B''--''Fertile A'' particles used in the FSV reactor. Because of overlapping particle fractions, a continuous pneumatic separator appears infeasible; however, a batch separation process can be envisioned. Changing the gas from air to CO 2 and/or the temperature to 300 0 C results in less than 10 percent change in calculated terminal velocities. Recently reported work in gas classification is discussed in light of the theoretical calculations. The pneumatic separation of fissile and fertile particles needs more study, specifically with regard to (1) measuring the recoveries and separation efficiencies of actual fissile and fertile fractions in the tests of the pneumatic classifiers; and (2) improving the contactor design or flowsheet to avoid apparent flow separation or flooding problems at the feed point when using the feed rates required for the pilot plant

  7. Mirror reactor studies

    International Nuclear Information System (INIS)

    Moir, R.W.; Barr, W.L.; Bender, D.J.

    1977-01-01

    Design studies of a fusion mirror reactor, a fusion-fission mirror reactor, and two small mirror reactors are summarized. The fusion reactor uses 150-keV neutral-beam injectors based on the acceleration of negative ions. The injectors provide over 1 GW of continuous power at an efficiency greater than 80%. The fusion reactor has three-stage, modularized, Venetian blind, plasma direct converter with a predicted efficiency of 59% and a new concept for removal of the lune-shaped blanket: a crane is brought between the two halves of the Yin-Yang magnet, which are separated by a float. The design has desirable features such as steady-state operation, minimal impurity problems, and low first-wall thermal stress. The major disadvantage is low Q resulting in high re-circulating power and hence high cost of electrical power. However, the direct capital cost per unit of gross electrical power is reasonable [$1000/kW(e)]. By contrast, the fusion-fission reactor design is not penalized by re-circulating power and uses relatively near-term fusion technology being developed for the fusion power program. New results are presented on the Th- 233 U and the U- 239 Pu fuel cycles. The purpose of this hybrid is fuel production, with projected costs at $55/g of Pu or $127/g of 233 U. Blanket and cooling system designs, including an emergency cooling system, by General Atomic Company, lead us to the opinion that the reactor can meet expected safety standards for licensing. The smallest mirror reactor having only a shield between the plasma and the coil is the 4.2-m long fusion engineering research facility (FERF) designed for material irradiation. The smallest mirror reactor having both a blanket and shield is the 7.5-m long experimental power reactor (EPR), which has both a fusion and a fusion-fission version. (author)

  8. Predicting standard-dose PET image from low-dose PET and multimodal MR images using mapping-based sparse representation

    International Nuclear Information System (INIS)

    Wang, Yan; Zhou, Jiliu; Zhang, Pei; An, Le; Ma, Guangkai; Kang, Jiayin; Shi, Feng; Shen, Dinggang; Wu, Xi; Lalush, David S; Lin, Weili

    2016-01-01

    Positron emission tomography (PET) has been widely used in clinical diagnosis for diseases and disorders. To obtain high-quality PET images requires a standard-dose radionuclide (tracer) injection into the human body, which inevitably increases risk of radiation exposure. One possible solution to this problem is to predict the standard-dose PET image from its low-dose counterpart and its corresponding multimodal magnetic resonance (MR) images. Inspired by the success of patch-based sparse representation (SR) in super-resolution image reconstruction, we propose a mapping-based SR (m-SR) framework for standard-dose PET image prediction. Compared with the conventional patch-based SR, our method uses a mapping strategy to ensure that the sparse coefficients, estimated from the multimodal MR images and low-dose PET image, can be applied directly to the prediction of standard-dose PET image. As the mapping between multimodal MR images (or low-dose PET image) and standard-dose PET images can be particularly complex, one step of mapping is often insufficient. To this end, an incremental refinement framework is therefore proposed. Specifically, the predicted standard-dose PET image is further mapped to the target standard-dose PET image, and then the SR is performed again to predict a new standard-dose PET image. This procedure can be repeated for prediction refinement of the iterations. Also, a patch selection based dictionary construction method is further used to speed up the prediction process. The proposed method is validated on a human brain dataset. The experimental results show that our method can outperform benchmark methods in both qualitative and quantitative measures. (paper)

  9. Self-recognition, theory-of-mind, and self-awareness: what side are you on?

    Science.gov (United States)

    Morin, Alain

    2011-05-01

    A fashionable view in comparative psychology states that primates possess self-awareness because they exhibit mirror self-recognition (MSR), which in turn makes it possible to infer mental states in others ("theory-of-mind"; ToM). In cognitive neuroscience, an increasingly popular position holds that the right hemisphere represents the centre of self-awareness because MSR and ToM tasks presumably increase activity in that hemisphere. These two claims are critically assessed here as follows: (1) MSR should not be equated with full-blown self-awareness, as it most probably only requires kinaesthetic self-knowledge and does not involve access to one's mental events; (2) ToM and self-awareness are fairly independent and should also not be taken as equivalent notions; (3) MSR and ToM tasks engage medial and left brain areas; (4) other self-awareness tasks besides MSR and ToM tasks (e.g., self-description, autobiography) mostly recruit medial and left brain areas; (5) and recent neuropsychological evidence implies that inner speech (produced by the left hemisphere) plays a significant role in self-referential activity. The main conclusions reached based on this analysis are that (a) organisms that display MSR most probably do not possess introspective self-awareness, and (b) self-related processes most likely engage a distributed network of brain regions situated in both hemispheres.

  10. Integration of the Ovation Based Distributed Turbine Control System into the Existing Process Information System and Full Scope Simulator at NPP Krsko

    International Nuclear Information System (INIS)

    Cicvaric, D.

    2010-01-01

    Programmable Digital Electro Hydraulic System (PDEH) is Turbine Control System (TCS), built on Emerson OVATION Distributed Control System (DCS) platform and installed by the Westinghouse Electric Company at the Krsko Nuclear Power Plant as the replacement for the DEH Mod II turbine control system. Core of the PDEH system consist of three pairs of redundant controllers (ETS, OA/OPC and ATC/MSR) configured for the Turbine Generator (TG) set protection, control and monitoring functions. Existing serial data link between replaced DEH Mod II and Process Information System (PIS) was removed and replaced with redundant bi-directional Ethernet TCP/IP data link via two Data Link servers in client-server architecture configuration. All hardwired signals and some of the important calculated signals are being transferred from PDEH to PIS. Main purpose of PIS data link is trending utilization at the existing PIS workstations with pre-configured trend groups and centralized data archiving. Most of the PDEH display screens (mimics) were also replicated on the PIS platform, so that TG set monitoring and operation overview can be performed over the PIS network as well as over the Process Computer Network (PCN) with PMSNT-view utility. The simulator is implemented using a stimulated Windows based Ovation platform and a SGI IRIX based Plant Model Computer (PMC) using the L-3 MAPPS simulation software platform. Two PDEH stimulated systems are installed at the Krsko Full Scope Simulator (KFSS), one for foreground and another for background simulation. Stimulated PDEH hardware is essentially identical to that installed in the plant with the exception of hardware redundancy, isolation features and interface with physical plant I/O. The Ovation control logic sheets are executed with virtual controllers hosted on a simulator specific Virtual Controller Host (VCH) Workstation. The data interface between the simulator Ovation system and the PMC is accomplished through the Ethernet

  11. Design of the Natural Circulation Loop and Implementation of DOWTHERM A Properties into MARS-LMR Code

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Yukyung; Park, Seong Dae; Kang, Sarah; Bang, In Cheol [Ulsan National Institute of Science and Technology, Ulsan (Korea, Republic of)

    2015-05-15

    Molten Salt Reactor (MSR), which is one of the generation IV reactors, has an advantage in these requirements. MSR uses a molten salt mixture as the primary coolant, or the fuel itself and it operates on high temperature, so it doesn't need pressurizing. Also, liquid state fuel has an advantage for pyro-processing with easy separation of fission products. These fission products also have relatively short half-lives compared to those of the existing reactors. With these characteristics, MSR can have inherent safety in both direct and indirect sides. Also, MSR can operate at high temperature range, so that it can have the high efficiency to produce electricity. Therefore, research of MSR is meaningful for developing advanced nuclear reactors. FLiBe which is a mixture of lithium fluoride (LiF) and beryllium fluoride (BeF{sub 2}) is used as a primary coolant in MSR and LMR (Liquid Metal cooled Reactor). It has superiority over conventional liquid metal coolant like sodium, because it doesn't react with air or water. thermos-physical properties of DOWTHERM A for MARS-LMR code were made by modifying stg file of existing one. It was based on the process of Moore using 6 output parameters such as specific volume, internal energy, thermal expansion coefficient, isothermal compressibility, specific heat and entropy. With generated stg file (stgdowa.f90) and input file, tpf file (tpfdowa) which includes fluid property tables for MARS-LMR simulation was obtained. For the verification, this tpf file with execution file will be applied to the input deck of our natural circulation design. This work will contribute to researching and developing of MSR and LMR.

  12. ClpP-Independent Function of ClpX Interferes with Telithromycin Resistance Conferred by Msr(A) in Staphylococcus aureus

    Czech Academy of Sciences Publication Activity Database

    Vimberg, Vladimír; Lenart, Jakub; Janata, Jiří; Balíková Novotná, Gabriela

    2015-01-01

    Roč. 59, č. 6 (2015), s. 3611-3614 ISSN 0066-4804 R&D Projects: GA MŠk(CZ) EE2.3.20.0055; GA ČR GPP302/12/P632; GA MŠk(CZ) EE2.3.30.0003; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : COAGULASE-NEGATIVE STAPHYLOCOCCI * ZINC-BINDING DOMAIN * STRESS TOLERANCE Subject RIV: EE - Microbiology, Virology Impact factor: 4.415, year: 2015

  13. Classification of agricultural assets on the international accounting standard 41 Agriculture Klasyfikacja aktywów pochodzenia rolniczego według MSR 41 Rolnictwo

    Directory of Open Access Journals (Sweden)

    Dorota Czerwińska-Kayzer

    2011-12-01

    Full Text Available Agricultural activity is characterised by dissimilarity and complexity of economic events. Therefore, the assets related to agricultural activity, should be properly classified, as it affects the method of valuation and the company assessment. In the article the classification of agricultural assets has been presented in respect of IAS/IFRS 41 Agriculture.

  14. D-MSR: A Distributed Network Management Scheme for Real-Time Monitoring and Process Control Applications in Wireless Industrial Automation

    NARCIS (Netherlands)

    Zand, P.; Dilo, Arta; Havinga, Paul J.M.

    2013-01-01

    Current wireless technologies for industrial applications, such as WirelessHART and ISA100.11a, use a centralized management approach where a central network manager handles the requirements of the static network. However, such a centralized approach has several drawbacks. For example, it cannot

  15. APPLICATION OF MEMBRANE SORPTION REACTOR TECHNOLOGY FOR LRW MANAGEMENT

    International Nuclear Information System (INIS)

    Glagolenko, Yuri; Dzekun, Evgeny; Myasoedovg, Boris; Gelis, Vladimir; Kozlitin, Evgeny; Milyutin, Vitaly; Trusov, Lev; Rengel, Mike; Mackay, Stewart M.; Johnson, Michael E.

    2003-01-01

    A new membrane-sorption technology has been recently developed and industrially implemented in Russia for the treatment of the Liquid (Low-Level) Radioactive Waste (LRW). The first step of the technology is a precipitation of the radionuclides and/or their adsorption onto sorbents of small particle size. The second step is filtration of the precipitate/sorbent through the metal-ceramic membrane, Trumem.. The unique feature of the technology is a Membrane-Sorption Reactor (MSR), in which the precipitation / sorption and the filtration of the radionuclides occur simultaneously, in one stage. This results in high efficiency, high productivity and compactness of the equipment, which are the obvious advantages of the developed technology. Two types of MSR based on Flat Membranes device and Centrifugal Membrane device were developed. The advantages and disadvantages of application of each type of the reactors are discussed. The MSR technology has been extensively tested and efficiently implemented at ''Mayak '' nuclear facility near Chelyabinsk, Russia as well as at other Russian sites. The results of this and other applications of the MSR technology at the different Russian nuclear facilities are discussed. The results of the first industrial applications of the MSR technology for radioactive waste treatment in Russia and analysis of the available information about LRW accumulated in other countries imply that this technology can be successfully used for the Low Level Radioactive Waste treatment in the USA and in other nuclear countries

  16. Potential use of thorium through fusion breeders in the Indian context

    International Nuclear Information System (INIS)

    Srinivasan, M.; Basu, T.K.; Subba Rao, K.

    1991-01-01

    The Indian Nuclear Programme is based on a three stage strategy: the first stage of about 10 GWe comprises of natural uranium fuelled Pressurised Heavy Water Reactors (PHWRs); the second stage would consist of Liquid Metal Cooled Fast Breeder Reactors (LMFBRs) to be fuelled with plutonium generated in the first stage PHWRs and the third stage is envisaged to be based on advanced converters/breeders operating on the Th/U-233 cycle. It has generally been assumed that the initial inventory of U-233 for the third stage reactors would be generated in the blankets of LMFBRs containing thorium. But the success of this strategy depends crucially on the attainment of LMFBR doubling times as short as 14 years. The progress registered in recent years in the magnetic confinement of fusion plasmas has opened up the prospects of developing Fusion Breeders for the direct conversion of fertile 232 Th into fissile 233 U using the 14 MeV neutron released in the (D-T) fusion reaction. A detailed study of the dependence of the 233 U production characteristics as well as energy cost of fissile fuel production of such systems on parameters such as plasma energy gain Q, blanket neutron multiplication has been carried out. The growth rate dynamics of the symbiotic combination of 233 U generating fusion breeders with PHWRs operating on the Th/U-233 cycle in the so called near-breeder regime has been examined. 95% of the energy generated by PHWRs operating with Th/ 233 U fuel would arise from thorium consumption rather than fission of the initially loaded 233 U. A few sub-engineering breakeven fusion breeders producing U-233 at an energy cost well under 200 MeV per atom are adequate to give the requisite nuclear capacity growth rates in conjunction with such near breeder PHWRs. This corresponds to only a 5% diversion of the grid electrical power for the operation of such fusion breeders. In summary the symbiotic combination of a few fusion breeders with a number of PHWRs gives fresh hopes

  17. Analysis of a sustainable gas cooled fast breeder reactor concept

    International Nuclear Information System (INIS)

    Kumar, Akansha; Chirayath, Sunil S.; Tsvetkov, Pavel V.

    2014-01-01

    Highlights: • A Thorium-GFBR breeder for actinide recycling ability, and thorium fuel feasibility. • A mixture of 232 Th and 233 U is used as fuel and LWR used fuel is used. • Detailed neutronics, fuel cycle, and thermal-hydraulics analysis has been presented. • Run this TGFBR for 20 years with breeding of 239 Pu and 233 U. • Neutronics analysis using MCNP and Brayton cycle for energy conversion are used. - Abstract: Analysis of a thorium fuelled gas cooled fast breeder reactor (TGFBR) concept has been done to demonstrate the self-sustainability, breeding capability, actinide recycling ability, and thorium fuel feasibility. Simultaneous use of 232 Th and used fuel from light water reactor in the core has been considered. Results obtained confirm the core neutron spectrum dominates in an intermediate energy range (peak at 100 keV) similar to that seen in a fast breeder reactor. The conceptual design achieves a breeding ratio of 1.034 and an average fuel burnup of 74.5 (GWd)/(MTHM) . TGFBR concept is to address the eventual shortage of 235 U and nuclear waste management issues. A mixture of thorium and uranium ( 232 Th + 233 U) is used as fuel and light water reactor used fuel is utilized as blanket, for the breeding of 239 Pu. Initial feed of 233 U has to be obtained from thorium based reactors; even though there are no thorium breeders to breed 233 U a theoretical evaluation has been used to derive the data for the source of 233 U. Reactor calculations have been performed with Monte Carlo radiation transport code, MCNP/MCNPX. It is determined that this reactor has to be fuelled once every 5 years assuming the design thermal power output as 445 MW. Detailed analysis of control rod worth has been performed and different reactivity coefficients have been evaluated as part of the safety analysis. The TGFBR concept demonstrates the sustainability of thorium, viability of 233 U as an alternate to 235 U and an alternate use for light water reactor used fuel as a

  18. SMART: A Propositional Logic-Based Trade Analysis and Risk Assessment Tool for a Complex Mission

    Science.gov (United States)

    Ono, Masahiro; Nicholas, Austin; Alibay, Farah; Parrish, Joseph

    2015-01-01

    This paper introduces a new trade analysis software called the Space Mission Architecture and Risk Analysis Tool (SMART). This tool supports a high-level system trade study on a complex mission, such as a potential Mars Sample Return (MSR) mission, in an intuitive and quantitative manner. In a complex mission, a common approach to increase the probability of success is to have redundancy and prepare backups. Quantitatively evaluating the utility of adding redundancy to a system is important but not straightforward, particularly when the failure of parallel subsystems are correlated.

  19. Tendances Carbone no. 106. Free allocation in the EU ETS by 2030: paving the way for decarbonization of industry

    International Nuclear Information System (INIS)

    Jalard, Matthieu; Alberola, Emilie; Dahan, Lara

    2015-10-01

    Among the publications of I4CE, 'Tendances Carbone' bulletin specifically studies the developments of the European market for CO 2 allowances. Beside some statistical figures about energy production/consumption and carbon markets, this issue specifically addresses the following points: - EU ETS - MSR: On September 18, EU Environment Ministers adopted the Market Stability Reserve (MSR) for a start date in 2018. - EU ETS - MSR: On September, the timeline for the revision of the Directive for Phase IV of the EU ETS was detailed. A vote in plenary is expected in November 2016. - Energy Union: On September 28, a European Council meeting on Energy published draft conclusions on the governance system of the Energy Union, based on National Energy and Climate Plans to be drawn up in 2018

  20. Modular Stellarator Fusion Reactor concept

    International Nuclear Information System (INIS)

    Miller, R.L.; Krakowski, R.A.

    1981-08-01

    A preliminary conceptual study is made of the Modular Stellarator Reactor (MSR). A steady-state ignited, DT-fueled, magnetic fusion reactor is proposed for use as a central electric-power station. The MSR concept combines the physics of the classic stellarator confinement topology with an innovative, modular-coil design. Parametric tradeoff calculations are described, leading to the selection of an interim design point for a 4-GWt plant based on Alcator transport scaling and an average beta value of 0.04 in an l = 2 system with a plasma aspect ratio of 11. The physics basis of the design point is described together with supporting magnetics, coil-force, and stress computations. The approach and results presented herein will be modified in the course of ongoing work to form a firmer basis for a detailed conceptual design of the MSR

  1. The introduction of the safety of molten salt reactor

    International Nuclear Information System (INIS)

    Zuo Jiaxu; Zhang Chunming

    2011-01-01

    This paper introduces the generation TV Nuclear Energy Systems and molten salt reactor which is the only fluid fuel reactor in the Gen-TV. Safety features and attributes of MSR are described. The supply of fuel and the minimum of waste are described. The clean molten salt in the secondary heat transport system transfers the heat from the primary heat exchanger to a high-temperature Brayton cycle that converts the heat to electricity. With the Brayton cycle, the thermal efficiency of the system will be improved. Base on the MSR, the thorium-uranium fuel cycle is also introduced. (authors)

  2. Thorium Molten Salt Nuclear Energy Synergetic System (THORIMS-NES)

    International Nuclear Information System (INIS)

    Yoshioka, Ritsuo; Mitachi, Koshi

    2013-01-01

    The authors have been promoting nuclear energy technology based on thorium molten salt as Thorium Molten Salt Nuclear Energy Synergetic System (THORIMS-NES). This system is a combination of fission power reactor of Molten Salt Reactor (MSR), and Accelerator Molten Salt Breeder (AMSB) for production of fissile 233 U with connecting chemical processing facility. In this paper, concept of THORIMS-NES, advantages of thorium and molten salt recent MSR design results such as FUJI-U3 using 233 U fuel, FUJI-Pu, large sized super-FUJI, pilot plant miniFUJI, AMSB, and chemical processing facility are described. (author)

  3. Intergranular tellurium cracking of nickel-based alloys in molten Li, Be, Th, U/F salt mixture

    Science.gov (United States)

    Ignatiev, Victor; Surenkov, Alexander; Gnidoy, Ivan; Kulakov, Alexander; Uglov, Vadim; Vasiliev, Alexander; Presniakov, Mikhail

    2013-09-01

    In Russia, R&D on Molten Salt Reactor (MSR) are concentrated now on fast/intermediate spectrum concepts which were recognized as long term alternative to solid fueled fast reactors due to their attractive features: strong negative feedback coefficients, easy in-service inspection, and simplified fuel cycle. For high-temperature MSR corrosion of the metallic container alloy in primary circuit is the primary concern. Key problem receiving current attention include surface fissures in Ni-based alloys probably arising from fission product tellurium attack. This paper summarizes results of corrosion tests conducted recently to study effect of oxidation state in selected fuel salt on tellurium attack and to develop means of controlling tellurium cracking in the special Ni-based alloys recently developed for molten salt actinide recycler and tranforming (MOSART) system. Tellurium corrosion of Ni-based alloys was tested at temperatures up to 750 °C in stressed and unloaded conditions in molten LiF-BeF2 salt mixture fueled by about 20 mol% of ThF4 and 2 mol% of UF4 at different [U(IV)]/[U(III)] ratios: 0.7, 4, 20, 100 and 500. Following Ni-based alloys (in mass%): HN80М-VI (Mo—12, Cr—7.6, Nb—1.5), HN80МТY (Mo—13, Cr—6.8, Al—1.1, Ti—0.9), HN80МТW (Mo—9.4, Cr—7.0, Ti—1.7, W—5.5) and ЕМ-721 (W—25.2, Cr—5.7, Ti—0.17) were used for the study in the corrosion facility. If the redox state the fuel salt is characterized by uranium ratio [U(IV)]/[U(III)] uranium intermetallic compounds and alloys with nickel and molybdenum. This leads to spontaneous behavior of alloy formation processes on the specimens' surface and further diffusion of uranium deep into the metallic phase. As consequence of this films of intermetallic compounds and alloys of nickel, molybdenum, tungsten with uranium are formed on the alloys specimens' surface, and intergranular corrosion does not take place. In the fuel salt with [U(IV)]/[U(III)] = 4-20 the potentials of uranium

  4. Nuclear data for actinide production and depletion calculations

    International Nuclear Information System (INIS)

    Benjamin, R.W.

    1978-01-01

    The status of nuclear cross section data required for actinide depletion calculations in thermal reactors is summarized, and recommendations are made for future work. The primary fertile and fissile nuclides ( 232 Th, 233 U, 235 U, 238 U, and 239 Pu) are not reviewed. Nuclear data for the transactinium mass region are, with few exceptions, reasonably complete and adequate for current thermal-reactor depletion calculations. There is a real need, however, for well-documented reactor production studies to use as benchmarks for data testing. 3 figures, 6 tables

  5. Thorium--uranium cycle ICF hybrid concept

    International Nuclear Information System (INIS)

    Frank, T.G.

    1978-01-01

    The results of preliminary studies of a laser-driven fusion-fission hybrid concept utilizing the 232 Th- 233 U breeding cycle are reported. Neutron multiplication in the breeding blanket is provided by a region containing 238 UO 2 and the equilibrium concentration of 239 PuO 2 . Established fission reactor technology is utilized to determine limits on operating conditions for high-temperature fuels and structures. The implications of nonproliferation policies for the operation of fusion-fission hybrid reactors are discussed

  6. Inhalation exposures at a thorium refinery

    International Nuclear Information System (INIS)

    Mausner, L.F.

    1982-01-01

    There is a current interest in the metabolism and health effects of thorium due to its potential use in the 232 Th - 233 U nuclear fuel cycle. The airborne concentrations of thorium, thoron daughters and rare earths in a plant which produced thorium and rare earth chemicals from 1932 to 1973 were calculated from past records of alpha counting and air filter samples. This analysis showed that high airborne concentrations of 232 Th, 220 Rn, 212 Pb, 212 Bi and rare earth elements were sometimes reached during plant operations. Limited measurements on autopsy samples of former employees of the plant showed increased tissue concentrations of thorium and rare earths. (U.K.)

  7. Sensory-Challenge Balance Exercises Improve Multisensory Reweighting in Fall-Prone Older Adults.

    Science.gov (United States)

    Allison, Leslie K; Kiemel, Tim; Jeka, John J

    2018-04-01

    Multisensory reweighting (MSR) deficits in older adults contribute to fall risk. Sensory-challenge balance exercises may have value for addressing the MSR deficits in fall-prone older adults. The purpose of this study was to examine the effect of sensory-challenge balance exercises on MSR and clinical balance measures in fall-prone older adults. We used a quasi-experimental, repeated-measures, within-subjects design. Older adults with a history of falls underwent an 8-week baseline (control) period. This was followed by an 8-week intervention period that included 16 sensory-challenge balance exercise sessions performed with computerized balance training equipment. Measurements, taken twice before and once after intervention, included laboratory measures of MSR (center of mass gain and phase, position, and velocity variability) and clinical tests (Activities-specific Balance Confidence Scale, Berg Balance Scale, Sensory Organization Test, Limits of Stability test, and lower extremity strength and range of motion). Twenty adults 70 years of age and older with a history of falls completed all 16 sessions. Significant improvements were observed in laboratory-based MSR measures of touch gain (P = 0.006) and phase (P = 0.05), Berg Balance Scale (P = 0.002), Sensory Organization Test (P = 0.002), Limits of Stability Test (P = 0.001), and lower extremity strength scores (P = 0.005). Mean values of vision gain increased more than those for touch gain, but did not reach significance. A balance exercise program specifically targeting multisensory integration mechanisms improved MSR, balance, and lower extremity strength in this mechanistic study. These valuable findings provide the scientific rationale for sensory-challenge balance exercise to improve perception of body position and motion in space and potential reduction in fall risk.

  8. Constraining neutrinoless double beta decay

    International Nuclear Information System (INIS)

    Dorame, L.; Meloni, D.; Morisi, S.; Peinado, E.; Valle, J.W.F.

    2012-01-01

    A class of discrete flavor-symmetry-based models predicts constrained neutrino mass matrix schemes that lead to specific neutrino mass sum-rules (MSR). We show how these theories may constrain the absolute scale of neutrino mass, leading in most of the cases to a lower bound on the neutrinoless double beta decay effective amplitude.

  9. System reliability analysis using dominant failure modes identified by selective searching technique

    International Nuclear Information System (INIS)

    Kim, Dong-Seok; Ok, Seung-Yong; Song, Junho; Koh, Hyun-Moo

    2013-01-01

    The failure of a redundant structural system is often described by innumerable system failure modes such as combinations or sequences of local failures. An efficient approach is proposed to identify dominant failure modes in the space of random variables, and then perform system reliability analysis to compute the system failure probability. To identify dominant failure modes in the decreasing order of their contributions to the system failure probability, a new simulation-based selective searching technique is developed using a genetic algorithm. The system failure probability is computed by a multi-scale matrix-based system reliability (MSR) method. Lower-scale MSR analyses evaluate the probabilities of the identified failure modes and their statistical dependence. A higher-scale MSR analysis evaluates the system failure probability based on the results of the lower-scale analyses. Three illustrative examples demonstrate the efficiency and accuracy of the approach through comparison with existing methods and Monte Carlo simulations. The results show that the proposed method skillfully identifies the dominant failure modes, including those neglected by existing approaches. The multi-scale MSR method accurately evaluates the system failure probability with statistical dependence fully considered. The decoupling between the failure mode identification and the system reliability evaluation allows for effective applications to larger structural systems

  10. Regulation of Expression of Oxacillin-Inducible Methionine Sulfoxide Reductases in Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Kyle R. Baum

    2015-01-01

    Full Text Available Cell wall-active antibiotics cause induction of a locus that leads to elevated synthesis of two methionine sulfoxide reductases (MsrA1 and MsrB in Staphylococcus aureus. To understand the regulation of this locus, reporter strains were constructed by integrating a DNA fragment consisting of the msrA1/msrB promoter in front of a promoterless lacZ gene in the chromosome of wild-type and MsrA1-, MsrB-, MsrA1/MsrB-, and SigB-deficient methicillin-sensitive S. aureus strain SH1000 and methicillin-resistant S. aureus strain COL. These reporter strains were cultured in TSB and the cellular levels of β-galactosidase activity in these cultures were assayed during different growth phases. β-galactosidase activity assays demonstrated that the lack of MsrA1, MsrB, and SigB upregulated the msrA1/msrB promoter in S. aureus strain SH1000. In S. aureus strain COL, the highest level of β-galactosidase activity was observed under the conditions when both MsrA1 and MsrB proteins were absent. The data suggest that the msrA1/msrB locus, in part, is negatively regulated by MsrA1, MsrB, and SigB in S. aureus.

  11. R and D of On-line Reprocessing Technology for Molten-Salt Reactor Systems

    International Nuclear Information System (INIS)

    Uhlir, Jan; Tulackova, Radka; Chuchvalcova Bimova, Karolina

    2006-01-01

    The Molten Salt Reactor (MSR) represents one of promising future nuclear reactor concept included in the Generation IV reactors family. The reactor can be operated as the thorium breeder or as the actinide transmuter. However, the future deployment of Molten-Salt Reactors will be significantly dependent on the successful mastering of advanced reprocessing technologies dedicated to their fuel cycle. Here the on-line reprocessing technology connected with the fuel circuit of MSR is of special importance because the reactor cannot be operated for a long run without the fuel salt clean-up. Generally, main MSR reprocessing technologies are pyrochemical, majority of them are fluoride technologies. The proposed flow-sheets of MSR on-line reprocessing are based on a combination of molten-salt / liquid metal extraction and electro-separation processes, which can be added to the gas extraction process already verified during the MSRE project in ORNL. The crucial separation method proposed for partitioning of actinides from fission products is based on successive Anodic dissolution and Cathodic deposition processes in molten fluoride media. (authors)

  12. Review on the current status of molten chloride reactor and its future prospect

    Energy Technology Data Exchange (ETDEWEB)

    Seo, Seok Bin; Shin, Yukyung; Bang, In Cheol [UNIST, Ulsan (Korea, Republic of)

    2016-10-15

    This paper has summarized and reviewed the current status of MCR as an online pyroprocessing reactor, and introduced the related works in UNIST. As the developments of the next generation nuclear energy systems require the fuel sustainability, passive operation safety, nuclear proliferation, and reduction of highly radioactive waste, only several types of nuclear reactor systems survive to the last. Among these, molten salt reactor (MSR) is one of the most promising concepts of next generation nuclear reactor system that deliver on these requirements. MSR have great advantages in the fuel cycle and reduction of nuclear waste, since MSR can serve the online reprocessing system for the reprocessing of spent fuel. Especially, MSR utilizing chloride-based fuel, called molten chloride reactor (MCR) has been recently highlighted in USA under the DOE’s Gateway for Accelerated Innovation in Nuclear (GAIN) program. Recently, the interests in the molten chloride salt have arisen. The use of chloride-based salt gives great advantages to the reactor operating in a fast spectrum. Then MCR can serve waste management functions or fuel cycle sustainability functions, which can solve the current issues in nuclear field. Thus, research plan was established in UNIST which includes the investigation of thermal-hydraulic characteristics of chloride salt and optimization of heat transport system of MCR, using both numerical method and experimental method.

  13. Optimization of temperature coefficient and breeding ratio for a graphite-moderated molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zou, C.Y.; Cai, X.Z.; Jiang, D.Z.; Yu, C.G.; Li, X.X.; Ma, Y.W.; Han, J.L. [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); CAS Center for Excellence in TMSR Energy System, Chinese Academy of Sciences, Shanghai 201800 (China); Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Chinese Academy of Sciences, Shanghai 201800 (China); Chen, J.G., E-mail: chenjg@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); CAS Center for Excellence in TMSR Energy System, Chinese Academy of Sciences, Shanghai 201800 (China); Key Laboratory of Nuclear Radiation and Nuclear Energy Technology, Chinese Academy of Sciences, Shanghai 201800 (China)

    2015-01-15

    Highlights: • The temperature feedback coefficient with different moderation ratios for TMSR in thermal neutron region is optimized. • The breeding ratio and doubling time of a thermal TMSR with three different reprocessing schemes are analyzed. • The smaller hexagon size and larger salt fraction with more negative feedback coefficient can better satisfy the safety demands. • A shorter reprocessing time can achieve a better breeding ratio in a thermal TMSR. • The graphite moderator lifespan is compared with other MSRs and discussed. - Abstract: Molten salt reactor (MSR) has fascinating features: inherent safety, no fuel fabrication, online fuel reprocessing, etc. However, the graphite moderated MSR may present positive feedback coefficient which has severe implications for the transient behavior during operation. In this paper, the feedback coefficient and the breeding ratio are optimized based on the fuel-to-graphite ratio variation for a thorium based MSR (TMSR). A certain thermal core with negative feedback coefficient and relative high initial breeding ratio is chosen for the reprocessing scheme analysis. The breeding performances for the TMSR under different online fuel reprocessing efficiencies and frequencies are evaluated and compared with other MSR concepts. The results indicate that the thermal TMSR can get a breeding ratio greater than 1.0 with appropriate reprocessing scheme. The low fissile inventory in thermal TMSR leads to a short doubling time and low transuranic (TRU) inventory. The lifetime of graphite used for the TMSR is also discussed.

  14. Parametric analyses of single-zone thorium-fueled molten salt reactor fuel cycle options

    International Nuclear Information System (INIS)

    Powers, J.J.; Worrall, A.; Gehin, J.C.; Harrison, T.J.; Sunny, E.E.

    2013-01-01

    Analyses of fuel cycle options based on thorium-fueled Molten Salt Reactors (MSRs) have been performed in support of fuel cycle screening and evaluation activities for the United States Department of Energy. The MSR options considered are based on thermal spectrum MSRs with 3 different separations levels: full recycling, limited recycling, and 'once-through' operation without active separations. A single-fluid, single-zone 2250 MWth (1000 MWe) MSR concept consisting of a fuel-bearing molten salt with graphite moderator and reflectors was used as the basis for this study. Radiation transport and isotopic depletion calculations were performed using SCALE 6.1 with ENDF/B-VII nuclear data. New methodology developed at Oak Ridge National Laboratory (ORNL) enables MSR analysis using SCALE, modeling material feed and removal by taking user-specified parameters and performing multiple SCALE/TRITON simulations to determine the resulting equilibrium operating conditions. Parametric analyses examined the sensitivity of the performance of a thorium MSR to variations in the separations efficiency for protactinium and fission products. Results indicate that self-sustained operation is possible with full or limited recycling but once-through operation would require an external neutron source. (authors)

  15. Review on the current status of molten chloride reactor and its future prospect

    International Nuclear Information System (INIS)

    Seo, Seok Bin; Shin, Yukyung; Bang, In Cheol

    2016-01-01

    This paper has summarized and reviewed the current status of MCR as an online pyroprocessing reactor, and introduced the related works in UNIST. As the developments of the next generation nuclear energy systems require the fuel sustainability, passive operation safety, nuclear proliferation, and reduction of highly radioactive waste, only several types of nuclear reactor systems survive to the last. Among these, molten salt reactor (MSR) is one of the most promising concepts of next generation nuclear reactor system that deliver on these requirements. MSR have great advantages in the fuel cycle and reduction of nuclear waste, since MSR can serve the online reprocessing system for the reprocessing of spent fuel. Especially, MSR utilizing chloride-based fuel, called molten chloride reactor (MCR) has been recently highlighted in USA under the DOE’s Gateway for Accelerated Innovation in Nuclear (GAIN) program. Recently, the interests in the molten chloride salt have arisen. The use of chloride-based salt gives great advantages to the reactor operating in a fast spectrum. Then MCR can serve waste management functions or fuel cycle sustainability functions, which can solve the current issues in nuclear field. Thus, research plan was established in UNIST which includes the investigation of thermal-hydraulic characteristics of chloride salt and optimization of heat transport system of MCR, using both numerical method and experimental method

  16. Reprocessing of AHWR spent-fuel: Challenges and strategies

    International Nuclear Information System (INIS)

    Kant, S.

    2005-01-01

    Reprocessing of advanced heavy water reactor (AHWR) spent-fuel involves separation of Th, 233 U and Pu, from the fission products and from one another. A proper combination of Purex and Thorex processes is required. The technology development for a reprocessing facility is extremely complex owing to high fissile content, high levels of irradiation, presence high of levels of 232 U, difficulty in thoria dissolution, presence of thorium as the major constituent, problems due to third phase formation with Th, etc. It demands for development of suitable dissolution, solvent extraction, criticality control, U-Pu partitioning, and other equipments and/or techniques. Process modelling, simulation and optimisation are crucial in predicting behaviour of equipments/cycles, and in arriving at safe and optimum flowsheet. A significant success in this field has been achieved. This paper describes the reprocessing aspects pertaining to AHWR spent-fuel, indicating the major technological challenges, strategies to be followed and development requirements. A schematic flowsheet is proposed for Th- 233 U-Pu separation. (author)

  17. Lotus Base

    DEFF Research Database (Denmark)

    Mun, Terry; Bachmann, Asger; Gupta, Vikas

    2016-01-01

    exploration of Lotus genomic and transcriptomic data. Equally important are user-friendly in-browser tools designed for data visualization and interpretation. Here, we present Lotus Base, which opens to the research community a large, established LORE1 insertion mutant population containing an excess of 120...... such data, allowing users to construct, visualize, and annotate co-expression gene networks. Lotus Base takes advantage of modern advances in browser technology to deliver powerful data interpretation for biologists. Its modular construction and publicly available application programming interface enable...... developers to tap into the wealth of integrated Lotus data. Lotus Base is freely accessible at: https://lotus.au.dk....

  18. Touch BASE

    CERN Multimedia

    Antonella Del Rosso

    2015-01-01

    In a recent Nature article (see here), the BASE collaboration reported the most precise comparison of the charge-to-mass ratio of the proton to its antimatter equivalent, the antiproton. This result is just the beginning and many more challenges lie ahead.   CERN's AD Hall, where the BASE experiment is set-up. The Baryon Antibaryon Symmetry Experiment (BASE) was approved in June 2013 and was ready to take data in August 2014. During these 14 months, the BASE collaboration worked hard to set up its four cryogenic Penning traps, which are the heart of the whole experiment. As their name indicates, these magnetic devices are used to trap antiparticles – antiprotons coming from the Antiproton Decelerator – and particles of matter – negative hydrogen ions produced in the system by interaction with a degrader that slows the antiprotons down, allowing scientists to perform their measurements. “We had very little time to set up the wh...

  19. On direct internal methane steam reforming kinetics in operating solid oxide fuel cells with nickel-ceria anodes

    Science.gov (United States)

    Thallam Thattai, A.; van Biert, L.; Aravind, P. V.

    2017-12-01

    Major operating challenges remain to safely operate methane fuelled solid oxide fuel cells due to undesirable temperature gradients across the porous anode and carbon deposition. This article presents an experimental study on methane steam reforming (MSR) global kinetics for single operating SOFCs with Ni-GDC (gadolinium doped ceria) anodes for low steam to carbon (S/C) ratios and moderate current densities. The study points out the hitherto insufficient research on MSR global and intrinsic kinetics for operating SOFCs with complete Ni-ceria anodes. Further, it emphasizes the need to develop readily applicable global kinetic models as a subsequent step from previously reported state-of-art and complex intrinsic models. Two rate expressions of the Power law (PL) and Langmuir-Hinshelwood (LH) type have been compared and based on the analysis, limitations of using previously proposed rate expressions for Ni catalytic beds to study MSR kinetics for complete cermet anodes have been identified. Firstly, it has been shown that methane reforming on metallic (Ni) current collectors may not be always negligible, contrary to literature reports. Both PL and LH kinetic models predict significantly different local MSR reaction rate and species partial pressure distributions along the normalized reactor length, indicating a strong need for further experimental verifications.

  20. Methionine sulfoxide reductase A deficiency exacerbates acute liver injury induced by acetaminophen

    International Nuclear Information System (INIS)

    Singh, Mahendra Pratap; Kim, Ki Young; Kim, Hwa-Young

    2017-01-01

    Acetaminophen (APAP) overdose induces acute liver injury via enhanced oxidative stress and glutathione (GSH) depletion. Methionine sulfoxide reductase A (MsrA) acts as a reactive oxygen species scavenger by catalyzing the cyclic reduction of methionine-S-sulfoxide. Herein, we investigated the protective role of MsrA against APAP-induced liver damage using MsrA gene-deleted mice (MsrA −/− ). We found that MsrA −/− mice were more susceptible to APAP-induced acute liver injury than wild-type mice (MsrA +/+ ). The central lobule area of the MsrA −/− liver was more impaired with necrotic lesions. Serum alanine transaminase, aspartate transaminase, and lactate dehydrogenase levels were significantly higher in MsrA −/− than in MsrA +/+ mice after APAP challenge. Deletion of MsrA enhanced APAP-induced hepatic GSH depletion and oxidative stress, leading to increased susceptibility to APAP-induced liver injury in MsrA-deficient mice. APAP challenge increased Nrf2 activation more profoundly in MsrA −/− than in MsrA +/+ livers. Expression and nuclear accumulation of Nrf2 and its target gene expression were significantly elevated in MsrA −/− than in MsrA +/+ livers after APAP challenge. Taken together, our results demonstrate that MsrA protects the liver from APAP-induced toxicity. The data provided herein constitute the first in vivo evidence of the involvement of MsrA in hepatic function under APAP challenge. - Highlights: • MsrA deficiency increases APAP-induced liver damage. • MsrA deletion enhances APAP-induced hepatic GSH depletion and oxidative stress. • MsrA deficiency induces more profound activation of Nrf2 in response to APAP. • MsrA protects the liver from APAP-induced toxicity.

  1. Fragmentation based

    Directory of Open Access Journals (Sweden)

    Shashank Srivastava

    2014-01-01

    Gaining the understanding of mobile agent architecture and the security concerns, in this paper, we proposed a security protocol which addresses security with mitigated computational cost. The protocol is a combination of self decryption, co-operation and obfuscation technique. To circumvent the risk of malicious code execution in attacking environment, we have proposed fragmentation based encryption technique. Our encryption technique suits the general mobile agent size and provides hard and thorny obfuscation increasing attacker’s challenge on the same plane providing better performance with respect to computational cost as compared to existing AES encryption.

  2. Deficiency of methionine sulfoxide reductase A causes cellular dysfunction and mitochondrial damage in cardiac myocytes under physical and oxidative stresses

    International Nuclear Information System (INIS)

    Nan, Changlong; Li, Yuejin; Jean-Charles, Pierre-Yves; Chen, Guozhen; Kreymerman, Alexander; Prentice, Howard; Weissbach, Herbert; Huang, Xupei

    2010-01-01

    Research highlights: → Deficiency of MsrA in the heart renders myocardial cells more sensitive to oxidative stress. → Mitochondrial damage happens in the heart lacking MsrA. → More protein oxidation in myocardial cells lacking MsrA. → MsrA protects the heart against oxidative stress. -- Abstract: Methionine sulfoxide reductase A (MsrA) is an enzyme that reverses oxidation of methionine in proteins. Using a MsrA gene knockout (MsrA -/- ) mouse model, we have investigated the role of MsrA in the heart. Our data indicate that cellular contractility and cardiac function are not significantly changed in MsrA -/- mice if the hearts are not stressed. However, the cellular contractility, when stressed using a higher stimulation frequency (2 Hz), is significantly reduced in MsrA -/- cardiac myocytes. MsrA -/- cardiac myocytes also show a significant decrease in contractility after oxidative stress using H 2 O 2 . Corresponding changes in Ca 2+ transients are observed in MsrA -/- cardiomyocytes treated with 2 Hz stimulation or with H 2 O 2 . Electron microscope analyses reveal a dramatic morphological change of mitochondria in MsrA -/- mouse hearts. Further biochemical measurements indicate that protein oxidation levels in MsrA -/- mouse hearts are significantly higher than those in wild type controls. Our study demonstrates that the lack of MsrA in cardiac myocytes reduces myocardial cell's capability against stress stimulations resulting in a cellular dysfunction in the heart.

  3. Fuzzy knowledge bases integration based on ontology

    OpenAIRE

    Ternovoy, Maksym; Shtogrina, Olena

    2012-01-01

    the paper describes the approach for fuzzy knowledge bases integration with the usage of ontology. This approach is based on metadata-base usage for integration of different knowledge bases with common ontology. The design process of metadata-base is described.

  4. Foundation: Transforming data bases into knowledge bases

    Science.gov (United States)

    Purves, R. B.; Carnes, James R.; Cutts, Dannie E.

    1987-01-01

    One approach to transforming information stored in relational data bases into knowledge based representations and back again is described. This system, called Foundation, allows knowledge bases to take advantage of vast amounts of pre-existing data. A benefit of this approach is inspection, and even population, of data bases through an intelligent knowledge-based front-end.

  5. Development and application of a system analysis code for liquid fueled molten salt reactors based on RELAP5 code

    International Nuclear Information System (INIS)

    Shi, Chengbin; Cheng, Maosong; Liu, Guimin

    2016-01-01

    Highlights: • New point kinetics and thermo-hydraulics models as well as a numerical method are added into RELAP5 code to be suitable for liquid fueled molten salt reactor. • The extended REALP5 code is verified by the experimental benchmarks of MSRE. • The different transient scenarios of the MSBR are simulated to evaluate performance during the transients. - Abstract: The molten salt reactor (MSR) is one of the six advanced reactor concepts declared by the Generation IV International Forum (GIF), which can be characterized by attractive attributes as inherent safety, economical efficiency, natural resource protection, sustainable development and nuclear non-proliferation. It is important to make system safety analysis for nuclear power plant of MSR. In this paper, in order to developing a system analysis code suitable for liquid fueled molten salt reactors, the point kinetics and thermo-hydraulic models as well as the numerical method in thermal–hydraulic transient code Reactor Excursion and Leak Analysis Program (RELAP5) developed at the Idaho National Engineering Laboratory (INEL) for the U.S. Nuclear Regulatory Commission (NRC) are extended and verified by Molten Salt Reactor Experiment (MSRE) experimental benchmarks. And then, four transient scenarios including the load demand change, the primary flow transient, the secondary flow transient and the reactivity transient of the Molten Salt Breeder Reactor (MSBR) are modeled and simulated so as to evaluate the performance of the reactor during the anticipated transient events using the extended RELAP5 code. The results indicate the extended RELAP5 code is effective and well suited to the liquid fueled molten salt reactor, and the MSBR has strong inherent safety characteristics because of its large negative reactivity coefficient. In the future, the extended RELAP5 code will be used to perform transient safety analysis for a liquid fueled thorium molten salt reactor named TMSR-LF developed by the Center

  6. Development and application of a system analysis code for liquid fueled molten salt reactors based on RELAP5 code

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Chengbin [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Cheng, Maosong, E-mail: mscheng@sinap.ac.cn [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China); Liu, Guimin [Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201800 (China)

    2016-08-15

    Highlights: • New point kinetics and thermo-hydraulics models as well as a numerical method are added into RELAP5 code to be suitable for liquid fueled molten salt reactor. • The extended REALP5 code is verified by the experimental benchmarks of MSRE. • The different transient scenarios of the MSBR are simulated to evaluate performance during the transients. - Abstract: The molten salt reactor (MSR) is one of the six advanced reactor concepts declared by the Generation IV International Forum (GIF), which can be characterized by attractive attributes as inherent safety, economical efficiency, natural resource protection, sustainable development and nuclear non-proliferation. It is important to make system safety analysis for nuclear power plant of MSR. In this paper, in order to developing a system analysis code suitable for liquid fueled molten salt reactors, the point kinetics and thermo-hydraulic models as well as the numerical method in thermal–hydraulic transient code Reactor Excursion and Leak Analysis Program (RELAP5) developed at the Idaho National Engineering Laboratory (INEL) for the U.S. Nuclear Regulatory Commission (NRC) are extended and verified by Molten Salt Reactor Experiment (MSRE) experimental benchmarks. And then, four transient scenarios including the load demand change, the primary flow transient, the secondary flow transient and the reactivity transient of the Molten Salt Breeder Reactor (MSBR) are modeled and simulated so as to evaluate the performance of the reactor during the anticipated transient events using the extended RELAP5 code. The results indicate the extended RELAP5 code is effective and well suited to the liquid fueled molten salt reactor, and the MSBR has strong inherent safety characteristics because of its large negative reactivity coefficient. In the future, the extended RELAP5 code will be used to perform transient safety analysis for a liquid fueled thorium molten salt reactor named TMSR-LF developed by the Center

  7. Paper based electronics platform

    KAUST Repository

    Nassar, Joanna Mohammad; Sevilla, Galo Andres Torres; Hussain, Muhammad Mustafa

    2017-01-01

    A flexible and non-functionalized low cost paper-based electronic system platform fabricated from common paper, such as paper based sensors, and methods of producing paper based sensors, and methods of sensing using the paper based sensors

  8. Analysis of a multi-frequency electromagnetic imaging functional for thin, crack-like electromagnetic inclusions

    OpenAIRE

    Park, Won-Kwang

    2012-01-01

    Recently, a non-iterative multi-frequency subspace migration imaging algorithm was developed based on an asymptotic expansion formula for thin, curve-like electromagnetic inclusions and the structure of singular vectors in the Multi-Static Response (MSR) matrix. The present study examines the structure of subspace migration imaging functional and proposes an improved imaging functional weighted by the frequency. We identify the relationship between the imaging functional and Bessel functions ...

  9. Development of the Flameless Ration Heater for the Meal, Ready-to-Eat

    Science.gov (United States)

    1993-04-01

    DRHD FB FED FTA FDTE FED-STD FPU FSC FY GRAS HDPE HHAR JSR JWG IDPE MANFRDTT MIL-H-44398 MILrR-44398 MORE MRE MRHD MSDS MSR...Bragg, NO Again, the CRH consisted of the ZT Energy Pad and an instruction card , with the MRE meal bag being used as the heating container...pack and assemble MRE menus with the following new items: FRH, pork chow mein, smokey links, sugar free beverage base, potato sticks, chew mein

  10. Multi sensor reanalysis of total ozone

    Directory of Open Access Journals (Sweden)

    R. J. van der A

    2010-11-01

    Full Text Available A single coherent total ozone dataset, called the Multi Sensor Reanalysis (MSR, has been created from all available ozone column data measured by polar orbiting satellites in the near-ultraviolet Huggins band in the last thirty years. Fourteen total ozone satellite retrieval datasets from the instruments TOMS (on the satellites Nimbus-7 and Earth Probe, SBUV (Nimbus-7, NOAA-9, NOAA-11 and NOAA-16, GOME (ERS-2, SCIAMACHY (Envisat, OMI (EOS-Aura, and GOME-2 (Metop-A have been used in the MSR. As first step a bias correction scheme is applied to all satellite observations, based on independent ground-based total ozone data from the World Ozone and Ultraviolet Data Center. The correction is a function of solar zenith angle, viewing angle, time (trend, and effective ozone temperature. As second step data assimilation was applied to create a global dataset of total ozone analyses. The data assimilation method is a sub-optimal implementation of the Kalman filter technique, and is based on a chemical transport model driven by ECMWF meteorological fields. The chemical transport model provides a detailed description of (stratospheric transport and uses parameterisations for gas-phase and ozone hole chemistry. The MSR dataset results from a 30-year data assimilation run with the 14 corrected satellite datasets as input, and is available on a grid of 1× 1 1/2° with a sample frequency of 6 h for the complete time period (1978–2008. The Observation-minus-Analysis (OmA statistics show that the bias of the MSR analyses is less than 1% with an RMS standard deviation of about 2% as compared to the corrected satellite observations used.

  11. Driven Factors Analysis of China’s Irrigation Water Use Efficiency by Stepwise Regression and Principal Component Analysis

    Directory of Open Access Journals (Sweden)

    Renfu Jia

    2016-01-01

    Full Text Available This paper introduces an integrated approach to find out the major factors influencing efficiency of irrigation water use in China. It combines multiple stepwise regression (MSR and principal component analysis (PCA to obtain more realistic results. In real world case studies, classical linear regression model often involves too many explanatory variables and the linear correlation issue among variables cannot be eliminated. Linearly correlated variables will cause the invalidity of the factor analysis results. To overcome this issue and reduce the number of the variables, PCA technique has been used combining with MSR. As such, the irrigation water use status in China was analyzed to find out the five major factors that have significant impacts on irrigation water use efficiency. To illustrate the performance of the proposed approach, the calculation based on real data was conducted and the results were shown in this paper.

  12. Optimal risky bidding strategy for a generating company by self-organising hierarchical particle swarm optimisation

    International Nuclear Information System (INIS)

    Boonchuay, Chanwit; Ongsakul, Weerakorn

    2011-01-01

    In this paper, an optimal risky bidding strategy for a generating company (GenCo) by self-organising hierarchical particle swarm optimisation with time-varying acceleration coefficients (SPSO-TVAC) is proposed. A significant risk index based on mean-standard deviation ratio (MSR) is maximised to provide the optimal bid prices and quantities. The Monte Carlo (MC) method is employed to simulate rivals' behaviour in competitive environment. Non-convex operating cost functions of thermal generating units and minimum up/down time constraints are taken into account. The proposed bidding strategy is implemented in a multi-hourly trading in a uniform price spot market and compared to other particle swarm optimisation (PSO). Test results indicate that the proposed SPSO-TVAC approach can provide a higher MSR than the other PSO methods. It is potentially applicable to risk management of profit variation of GenCo in spot market.

  13. Behavior study on Na heat pipe in passive heat removal system of new concept molten salt reactor

    International Nuclear Information System (INIS)

    Wang Chenglong; Tian Wenxi; Su Guanghui; Zhang Dalin; Wu Yingwei; Qiu Suizheng

    2013-01-01

    The high temperature Na heat pipe is an effective device for transporting heat, which is characterized by remarkable advantages in conductivity, isothermally and passively working. The application of Na heat pipe on passive heat removal system of new concept molten salt reactor (MSR) is significant. The transient performance of high temperature Na heat pipe was simulated by numerical method under the MSR accident. The model of the Na heat pipe was composed of three conjugate heat transfer zones, i.e. the vapor, wick and wall. Based on finite element method, the governing equations were solved by making use of FORTRAN to acquire the profiles of the temperature, velocity and pressure for the heat pipe transient operation. The results show that the high temperature Na heat pipe has a good performance on operating characteristics and high heat transfer efficiency from the frozen state. (authors)

  14. The thorium fuel cycle

    International Nuclear Information System (INIS)

    Merz, E.R.

    1977-01-01

    The utilization of the thorium fuel cycle has long since been considered attractive owing to the excellent neutronic characteristics of 233 U, and the widespread and cheap thorium resources. Rapidly increasing uranium prices, public reluctance for widespread Pu recycling and expected delays for the market penetration of fast breeders have led to a reconsideration of the thorium fuel cycle merits. In addition, problems associated with reprocessing and waste handling, particularly with re-fabrication by remote handling of 233 U, are certainly not appreciably more difficult than for Pu recycling. To divert from uranium as a nuclear energy source it seems worth while intensifying future efforts for closing the Th/ 233 U fuel cycle. HTGRs are particularly promising for economic application. However, further research and development activities should not concentrate on this reactor type alone. Light- and heavy-water-moderated reactors, and even future fast breeders, may just as well take advantage of a demonstrated thorium fuel cycle. (author)

  15. HTGR fuel and fuel cycle technology

    International Nuclear Information System (INIS)

    Lotts, A.L.; Coobs, J.H.

    1976-08-01

    The status of fuel and fuel cycle technology for high-temperature gas-cooled reactors (HTGRs) is reviewed. The all-ceramic core of the HTGRs permits high temperatures compared with other reactors. Core outlet temperatures of 740 0 C are now available for the steam cycle. For advanced HTGRs such as are required for direct-cycle power generation and for high-temperature process heat, coolant temperatures as high as 1000 0 C may be expected. The paper discusses the variations of HTGR fuel designs that meet the performance requirements and the requirements of the isotopes to be used in the fuel cycle. Also discussed are the fuel cycle possibilities, which include the low-enrichment cycle, the Th- 233 U cycle, and plutonium utilization in either cycle. The status of fuel and fuel cycle development is summarized

  16. Physics concept on the constellation type fissile fuels and its application to the prospective Th-232U Reactor

    International Nuclear Information System (INIS)

    Zhang, Jiahua

    1994-01-01

    In contrast with the conventional nuclear reactor which usually fuelled with on single fissile nuclide, a constellation type fissile fuels reactor consists of a parent nuclide such as 232 Th or 238 U and its whole family of neutron generated daughter nuclides. All of them are regarded as fissile fuels but of quite different fission ability. The concentration of each daughter nuclide is determined by its saturate concentration ratio with the parent nuclide. In such fuel system, the whole fuel consumed by neutron reaction almost completely results in fission products. In this article, some properties of such fuel system, determination of the saturate concentration of each daughter nuclide and applicability to Th- 233 U fueled reactor will be discussed. 3 refs., 1 tab., 2 figs

  17. Measuring of a few integral data in the ΣΣ neutron field

    International Nuclear Information System (INIS)

    Garlea, I.; Miron, C.; Lupu, M.; Ilie, P.; Thurzo, A.; Stanica, N.; Popa, F.

    1978-01-01

    Measurements of absolute reaction rates for the nonfissionable isotopes were obtained at the Institute for Nuclear Technology (ITN) Romania, using activation detector foils exposed at the centre of ΣΣ. The average microscopic integral cross sections sigma were obtained for the following reactions: 197 Au(n,γ), 115 In(n,γ), 115 In(n,n'), 27 Al(n,α), 46 Ti(n,p), 47 Ti(n,p), 48 Ti(n,p) and 58 Ni(n,p). The same data, the absolute reaction rates and the average microscopic integral cross sections, for the principal fissionable isotopes were performed in the ΣΣ-ITN facility by means of absolute fission chambers. These average fission cross sections for 235 U, 239 Pu, 238 U, 237 Np, 232 Th, 233 U, 241 Pu were determined. (author)

  18. The fission cross section ratios and error analysis for ten thorium, uranium, neptunium and plutonium isotopes at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    Meadows, J.W.

    1987-03-01

    The error information from the recent measurements of the fission cross section ratios of nine isotopes, 230 Th, 232 Th, 233 U, 234 U, 236 U, 238 U, 237 Np, 239 Pu, and 242 Pu, relative to 235 U at 14.74 MeV neutron energy was used to calculate their correlations. The remaining 36 non-trivial and non-reciprocal cross section ratios and their errors were determined and compared to evaluated (ENDF/B-V) values. There are serious differences but it was concluded that the reduction of three of the evaluated cross sections would remove most of them. The cross sections to be reduced are 230 Th - 13%, 237 Np - 9.6% and 239 Pu - 7.6%. 5 refs., 6 tabs

  19. Thermophysical properties of thorium and uranium systems for use in reactor safety analysis

    International Nuclear Information System (INIS)

    Fink, J.K.; Chasanov, M.G.; Leibowitz, L.

    1977-06-01

    The data compilation is intended to serve as a preliminary set of thermophysical property values for use in reactor safety analyses of the Th-- 233 U reactor concept. The properties covered include mp, bp, enthalpy, heats of vaporization and fusion, heat capacity, thermal conductivity, density, thermal expansion, emissivity, viscosity, etc. The systems covered are Th, Th 0 . 9 U 0 . 1 , U, ThO 2 , Th 0 . 9 U 0 . 1 O 2 , UO 2 , U 0 . 8 Pu 0 . 2 O 2 , ThC, Th 0 . 9 U 0 . 1 C, UC, U 0 . 8 Pu 0 . 2 C, ThC 2 , Th 0 . 9 U 0 . 1 C 2 , and UC 2 . 5 figures, 10 tables, 150 references

  20. Resonance Region Covariance Analysis Method and New Covariance Data for Th-232, U-233, U-235, U-238, and Pu-239

    International Nuclear Information System (INIS)

    Leal, Luiz C.; Arbanas, Goran; Derrien, Herve; Wiarda, Dorothea

    2008-01-01

    Resonance-parameter covariance matrix (RPCM) evaluations in the resolved resonance region were done for 232Th, 233U, 235U, 238U, and 239Pu using the computer code SAMMY. The retroactive approach of the code SAMMY was used to generate the RPCMs for 233U, 235U. RPCMs for 232Th, 238U and 239Pu were generated together with the resonance parameter evaluations. The RPCMs were then converted in the ENDF format using the FILE32 representation. Alternatively, for computer storage reasons, the FILE32 was converted in the FILE33 cross section covariance matrix (CSCM). Both representations were processed using the computer code PUFF-IV. This paper describes the procedures used to generate the RPCM with SAMMY.

  1. Comparison of potential radiological impacts of 233U and 239Pu fuel cycles

    International Nuclear Information System (INIS)

    Meyer, H.R.; Little, C.A.; Witherspoon, J.P.; Till, J.E.

    1979-01-01

    Nuclear fuel cycles utilizing 233 U are currently the subject of considerable interest in the United States. This paper focuses on the identification of significant differences between the off-site radiological hazards posed by 232 Th/ 233 U (Th/U) and 238 U/ 239 Pu (U/Pu) fuel cycles, and represents a portion of our involvement in the Nonproliferation Alternative Systems Assessment Program (NASAP), to be used in support of the International Fuel Cycle Evaluation (INFCE). The major contributors to radiological dose are likely to be uranium mining and milling (58.5% of total fuel cycle dose), reprocessing (33.9%), and light-water reactor power generation (7.3%). The remainder of the cycle, including enrichment processes, fuel fabrication, transportation, and waste management, contributes only 0.3% to total estimated fuel cycle dose

  2. Analysis of Dynamic Characteristics of the 21st Century Maritime Silk Road

    Science.gov (United States)

    Zhang, Xudong; Zhang, Jie; Fan, Chenqing; Meng, Junmin; Wang, Jing; Wan, Yong

    2018-06-01

    The 21st century Maritime Silk Road (MSR) proposed by China strongly promotes the maritime industry. In this paper, we use wind and ocean wave datasets from 1979 to 2014 to analyze the spatial and temporal distributions of the wind speed, significant wave height (SWH), mean wave direction (MWD), and mean wave period (MWP) in the MSR. The analysis results indicate that the Luzon Strait and Gulf of Aden have the most obvious seasonal variations and that the central Indian Ocean is relatively stable. We analyzed the distributions of the maximum wind speed and SWH in the MSR over this 36-year period. The results show that the distribution of the monthly average frequency for SWH exceeds 4 m (huge waves) and that of the corresponding wind speed exceeds 13.9 m s-1 (high wind speed). The occurrence frequencies of huge waves and high winds in regions east of the Gulf of Aden are as high as 56% and 80%, respectively. We also assessed the wave and wind energies in different seasons. Based on our analyses, we propose a risk factor (RF) for determining navigation safety levels, based on the wind speed and SWH. We determine the spatial and temporal RF distributions for different seasons and analyze the corresponding impact on four major sea routes. Finally, we determine the spatial distribution of tropical cyclones from 2000 to 2015 and analyze the corresponding impact on the four sea routes. The analysis of the dynamic characteristics of the MSR provides references for ship navigation as well as ocean engineering.

  3. A new approach for modeling and analysis of molten salt reactors using SCALE

    Energy Technology Data Exchange (ETDEWEB)

    Powers, J. J.; Harrison, T. J.; Gehin, J. C. [Oak Ridge National Laboratory, PO Box 2008, Oak Ridge, TN 37831-6172 (United States)

    2013-07-01

    The Office of Fuel Cycle Technologies (FCT) of the DOE Office of Nuclear Energy is performing an evaluation and screening of potential fuel cycle options to provide information that can support future research and development decisions based on the more promising fuel cycle options. [1] A comprehensive set of fuel cycle options are put into evaluation groups based on physics and fuel cycle characteristics. Representative options for each group are then evaluated to provide the quantitative information needed to support the valuation of criteria and metrics used for the study. Included in this set of representative options are Molten Salt Reactors (MSRs), the analysis of which requires several capabilities that are not adequately supported by the current version of SCALE or other neutronics depletion software packages (e.g., continuous online feed and removal of materials). A new analysis approach was developed for MSR analysis using SCALE by taking user-specified MSR parameters and performing a series of SCALE/TRITON calculations to determine the resulting equilibrium operating conditions. This paper provides a detailed description of the new analysis approach, including the modeling equations and radiation transport models used. Results for an MSR fuel cycle option of interest are also provided to demonstrate the application to a relevant problem. The current implementation is through a utility code that uses the two-dimensional (2D) TRITON depletion sequence in SCALE 6.1 but could be readily adapted to three-dimensional (3D) TRITON depletion sequences or other versions of SCALE. (authors)

  4. A new approach for modeling and analysis of molten salt reactors using SCALE

    International Nuclear Information System (INIS)

    Powers, J. J.; Harrison, T. J.; Gehin, J. C.

    2013-01-01

    The Office of Fuel Cycle Technologies (FCT) of the DOE Office of Nuclear Energy is performing an evaluation and screening of potential fuel cycle options to provide information that can support future research and development decisions based on the more promising fuel cycle options. [1] A comprehensive set of fuel cycle options are put into evaluation groups based on physics and fuel cycle characteristics. Representative options for each group are then evaluated to provide the quantitative information needed to support the valuation of criteria and metrics used for the study. Included in this set of representative options are Molten Salt Reactors (MSRs), the analysis of which requires several capabilities that are not adequately supported by the current version of SCALE or other neutronics depletion software packages (e.g., continuous online feed and removal of materials). A new analysis approach was developed for MSR analysis using SCALE by taking user-specified MSR parameters and performing a series of SCALE/TRITON calculations to determine the resulting equilibrium operating conditions. This paper provides a detailed description of the new analysis approach, including the modeling equations and radiation transport models used. Results for an MSR fuel cycle option of interest are also provided to demonstrate the application to a relevant problem. The current implementation is through a utility code that uses the two-dimensional (2D) TRITON depletion sequence in SCALE 6.1 but could be readily adapted to three-dimensional (3D) TRITON depletion sequences or other versions of SCALE. (authors)

  5. Feasibility study and economic analysis on thorium utilization in heavy water reactors

    International Nuclear Information System (INIS)

    1978-07-01

    Even though natural uranium is a more easily usable fuel in heavy water reactors, thorium fuel cycles have also been considered owing to certain attractive features of the thorium fuel cycle in heavy water reactors. The relatively higher fission neutron yield per thermal neutron absorption in 233 U combined with the very low neutron absorption cross section of heavy water make it possible to achieve breeding in a heavy water reactor operating on Th- 233 U fuel cycle. Even if the breeding ratio is very low, once a self-sustaining cycle is achieved, thereafter dependence on uranium can be completely eliminated. Thus, with a self-sustaining Th- 233 U fuel cycle in heavy water reactors, a given quantity of natural uranium will be capable of supporting a much larger installed generating capacity to significantly longer period of time. However, since thorium does not contain any fissile isotope, fissile material has to be added at the beginning. Concentrated fissile material is considerably more expensive than the 235 U contained in natural uranium. This makes the fuel cycle cost higher with thorium fuel cycle, at least during the initial stages. The situation is made worse by the fact that, because of its higher thermal neutron absorption cross section, thorium requires a higher concentration of fissile material than 238 U. Nevertheless, because of the superior nuclear characteristics of 233 U, once uranium becomes more expensive, thorium fuel cycle in heavy water reactors may become economically acceptable. Furthermore, the energy that can be made available from a given quantity of uranium is considerably increased with a self-sustaining thorium fuel cycle

  6. The physics data base

    International Nuclear Information System (INIS)

    Gault, F.D.

    1984-01-01

    The physics data base is introduced along with its associated data base management system. The emphasis is on data and their use and a classification of data and of data bases is developed to distinguish compilation organizations. The characteristics of these organizations are examined briefly and the long term consequences of the physics data base discussed. (orig.)

  7. Comparisons between different techniques for measuring mass segregation

    Science.gov (United States)

    Parker, Richard J.; Goodwin, Simon P.

    2015-06-01

    We examine the performance of four different methods which are used to measure mass segregation in star-forming regions: the radial variation of the mass function {M}_MF; the minimum spanning tree-based ΛMSR method; the local surface density ΣLDR method; and the ΩGSR technique, which isolates groups of stars and determines whether the most massive star in each group is more centrally concentrated than the average star. All four methods have been proposed in the literature as techniques for quantifying mass segregation, yet they routinely produce contradictory results as they do not all measure the same thing. We apply each method to synthetic star-forming regions to determine when and why they have shortcomings. When a star-forming region is smooth and centrally concentrated, all four methods correctly identify mass segregation when it is present. However, if the region is spatially substructured, the ΩGSR method fails because it arbitrarily defines groups in the hierarchical distribution, and usually discards positional information for many of the most massive stars in the region. We also show that the ΛMSR and ΣLDR methods can sometimes produce apparently contradictory results, because they use different definitions of mass segregation. We conclude that only ΛMSR measures mass segregation in the classical sense (without the need for defining the centre of the region), although ΣLDR does place limits on the amount of previous dynamical evolution in a star-forming region.

  8. Thorium and Molten Salt Reactors: Essential Questions for Classroom Discussions

    Science.gov (United States)

    DiLisi, Gregory A.; Hirsch, Allison; Murray, Meredith; Rarick, Richard

    2018-04-01

    A little-known type of nuclear reactor called the "molten salt reactor" (MSR), in which nuclear fuel is dissolved in a liquid carrier salt, was proposed in the 1940s and developed at the Oak Ridge National Laboratory in the 1960s. Recently, the MSR has generated renewed interest as a remedy for the drawbacks associated with conventional uranium-fueled light-water reactors (LWRs) in use today. Particular attention has been given to the "thorium molten salt reactor" (TMSR), an MSR engineered specifically to use thorium as its fuel. The purpose of this article is to encourage the TPT community to incorporate discussions of MSRs and the thorium fuel cycle into courses such as "Physics and Society" or "Frontiers of Physics." With this in mind, we piloted a pedagogical approach with 27 teachers in which we described the underlying physics of the TMSR and posed five essential questions for classroom discussions. We assumed teachers had some preexisting knowledge of nuclear reactions, but such prior knowledge was not necessary for inclusion in the classroom discussions. Overall, our material was perceived as a real-world example of physics, fit into a standards-based curriculum, and filled a need in the teaching community for providing unbiased references of alternative energy technologies.

  9. Reactor physical experimental program EROS in the frame of the molten salt applying reactor concepts development

    International Nuclear Information System (INIS)

    Hron, Miloslav; Kyncl, Jan; Mikisek, Miroslav

    2009-01-01

    After the relatively broad program of experimental activities, which have been involved in the complex R and D program for the Molten Salt Reactor (MSR) - SPHINX (SPent Hot fuel Incinerator by Neutron fluX) concept development in the Czech Republic, there has been a next stage (namely large-scale experimental verification of design inputs by use of MSR-type inserted zones into the existing light water moderated experimental reactor LR-0 called EROS project) started, which will be focused to the experimental verification of the rector physical or neutronic properties of other types of reactor concepts applying molten salts in the role of liquid fuel and/or coolant. This tendency is based on the recently accepted decision of the MSR SSC of GIF to consider for further period of its activity two baseline concepts- fast neutron molten salt reactor non-moderated (FMSR-NM) as a long-term alternative to solid fuelled fast neutron reactors and simultaneously, advanced high temperature reactor (AHTR) with pebble bed type solid fuel cooled by liquid salts. There will be a brief description of the prepared and performed experimental programs in these directions (as well as the preliminary results obtained so far) introduced in the paper. (author)

  10. Development of a three dimension multi-physics code for molten salt fast reactor

    International Nuclear Information System (INIS)

    Cheng Maosong; Dai Zhimin

    2014-01-01

    Molten Salt Reactor (MSR) was selected as one of the six innovative nuclear reactors by the Generation IV International Forum (GIF). The circulating-fuel in the can-type molten salt fast reactor makes the neutronics and thermo-hydraulics of the reactor strongly coupled and different from that of traditional solid-fuel reactors. In the present paper: a new coupling model is presented that physically describes the inherent relations between the neutron flux, the delayed neutron precursor, the heat transfer and the turbulent flow. Based on the model, integrating nuclear data processing, CAD modeling, structured and unstructured mesh technology, data analysis and visualization application, a three dimension steady state simulation code system (MSR3DS) for the can-type molten salt fast reactor is developed and validated. In order to demonstrate the ability of the code, the three dimension distributions of the velocity, the neutron flux, the delayed neutron precursor and the temperature were obtained for the simplified MOlten Salt Advanced Reactor Transmuter (MOSART) using this code. The results indicate that the MSR3DS code can provide a feasible description of multi-physical coupling phenomena in can-type molten salt fast reactor. Furthermore, the code can well predict the flow effect of fuel salt and the transport effect of the turbulent diffusion. (authors)

  11. Prospect on Desalination and Other Non-Electric Applications of Nuclear Energy In Indonesia

    Directory of Open Access Journals (Sweden)

    G.R. Sunaryo

    2007-01-01

    Full Text Available Molten-Salt Reactor (MSR is a design of an advanced reactor system from the GEN IV family working in thermal or epithermal neutron spectrum and using thorium or transuranium fuel in the form of molten fluorides. It is based on the experience with the development of the molten-salt reactor technology in the Oak-Ridge National Laboratory in the United States. The MSR fuel cycle with integrated reprocessing represents one of the potential ways both for significant decrease of total amount of radioactive wastes for final deposition and for utilization of nuclear energy for electricity and heat production as effectively as possible. There are two pyrochemical reprocessing techniques studied in NRI Rez plc which are considered to be applied both for reprocessing of already existing spent fuel and for preparation and „on-line“ reprocessing of MSR fuel: (i the Fluoride Volatility Method (FVM, which performs chemical conversion of spent thermal oxide fuel components into fluorides and their consequent separation by means of their different volatility, thermal stability and chemical affinity to various sorbents; and (ii electrochemical separation of the actinides (Ans and fission products (FP, represented mainly by lanthanides (Lns, from each other by electrolytic deposition method on solid cathode in molten fluoride media.

  12. Simulation tools and new developments of the molten salt fast reactor

    International Nuclear Information System (INIS)

    Merle-Lucotte, E.; Doligez, X.; Heuer, D.; Allibert, M.; Ghetta, V.

    2010-01-01

    Starting from the Molten Salt Breeder Reactor project of Oak-Ridge, we have performed parametric studies in terms of safety coefficients, reprocessing requirements and breeding capabilities. In the frame of this major re-evaluation of the molten salt reactor (MSR), we have developed a new concept called Molten Salt Fast Reactor or MSFR, based on the Thorium fuel cycle and a fast neutron spectrum. This concept has been selected for further studies by the MSR steering committee of the Generation IV International Forum in 2009. Our reactor's studies of the MSFR concept rely on numerical simulations making use of the MCNP neutron transport code coupled with a code for materials evolution which resolves the Bateman's equations giving the population of each nucleus inside each part of the reactor at each moment. Because of MSR's fundamental characteristics compared to classical solid-fuelled reactors, the classical Bateman equations have to be modified by adding two terms representing the reprocessing capacities and the fertile or fissile alimentation. We have thus coupled neutronic and reprocessing simulation codes in a numerical tool used to calculate the extraction efficiencies of fission products, their location in the whole system (reactor and reprocessing unit) and radioprotection issues. (authors)

  13. Solid Base Catalysis

    CERN Document Server

    Ono, Yoshio

    2011-01-01

    The importance of solid base catalysts has come to be recognized for their environmentally benign qualities, and much significant progress has been made over the past two decades in catalytic materials and solid base-catalyzed reactions. The book is focused on the solid base. Because of the advantages over liquid bases, the use of solid base catalysts in organic synthesis is expanding. Solid bases are easier to dispose than liquid bases, separation and recovery of products, catalysts and solvents are less difficult, and they are non-corrosive. Furthermore, base-catalyzed reactions can be performed without using solvents and even in the gas phase, opening up more possibilities for discovering novel reaction systems. Using numerous examples, the present volume describes the remarkable role solid base catalysis can play, given the ever increasing worldwide importance of "green" chemistry. The reader will obtain an overall view of solid base catalysis and gain insight into the versatility of the reactions to whic...

  14. Beyond Zero Based Budgeting.

    Science.gov (United States)

    Ogden, Daniel M., Jr.

    1978-01-01

    Suggests that the most practical budgeting system for most managers is a formalized combination of incremental and zero-based analysis because little can be learned about most programs from an annual zero-based budget. (Author/IRT)

  15. VectorBase

    Data.gov (United States)

    U.S. Department of Health & Human Services — VectorBase is a Bioinformatics Resource Center for invertebrate vectors. It is one of four Bioinformatics Resource Centers funded by NIAID to provide web-based...

  16. Mobile Inquiry Based Learning

    NARCIS (Netherlands)

    Specht, Marcus

    2012-01-01

    Specht, M. (2012, 8 November). Mobile Inquiry Based Learning. Presentation given at the Workshop "Mobile inquiry-based learning" at the Mobile Learning Day 2012 at the Fernuniversität Hagen, Hagen, Germany.

  17. Microbead agglutination based assays

    KAUST Repository

    Kodzius, Rimantas; Castro, David; Foulds, Ian G.; Parameswaran, Ash M.; Sumanpreet, K. Chhina

    2013-01-01

    We report a simple and rapid room temperature assay for point-of-care (POC) testing that is based on specific agglutination. Agglutination tests are based on aggregation of microbeads in the presence of a specific analyte thus enabling

  18. Carbon Based Nanotechnology: Review

    Science.gov (United States)

    Srivastava, Deepak; Saini, Subhash (Technical Monitor)

    1999-01-01

    This presentation reviews publicly available information related to carbon based nanotechnology. Topics covered include nanomechanics, carbon based electronics, nanodevice/materials applications, nanotube motors, nano-lithography and H2O storage in nanotubes.

  19. The ground based plan

    International Nuclear Information System (INIS)

    1989-01-01

    The paper presents a report of ''The Ground Based Plan'' of the United Kingdom Science and Engineering Research Council. The ground based plan is a plan for research in astronomy and planetary science by ground based techniques. The contents of the report contains a description of:- the scientific objectives and technical requirements (the basis for the Plan), the present organisation and funding for the ground based programme, the Plan, the main scientific features and the further objectives of the Plan. (U.K.)

  20. OHB's Exploration Capabilities Overview Relevant to Mars Sample Return Mission

    Science.gov (United States)

    Jaime, A.; Gerth, I.; Rohrbeck, M.; Scheper, M.

    2018-04-01

    The presentation will give an overview to all the OHB past and current projects that are relevant to the Mars Sample Return (MSR) mission, including some valuable lessons learned applicable to the upcoming MSR mission.

  1. Stolen Base Physics

    Science.gov (United States)

    Kagan, David

    2013-01-01

    Few plays in baseball are as consistently close and exciting as the stolen base. While there are several studies of sprinting, the art of base stealing is much more nuanced. This article describes the motion of the base-stealing runner using a very basic kinematic model. The model will be compared to some data from a Major League game. The…

  2. Convergent Filter Bases

    Directory of Open Access Journals (Sweden)

    Coghetto Roland

    2015-09-01

    Full Text Available We are inspired by the work of Henri Cartan [16], Bourbaki [10] (TG. I Filtres and Claude Wagschal [34]. We define the base of filter, image filter, convergent filter bases, limit filter and the filter base of tails (fr: filtre des sections.

  3. Cholinesterase-based biosensors.

    Science.gov (United States)

    Štěpánková, Šárka; Vorčáková, Katarína

    2016-01-01

    Recently, cholinesterase-based biosensors are widely used for assaying anticholinergic compounds. Primarily biosensors based on enzyme inhibition are useful analytical tools for fast screening of inhibitors, such as organophosphates and carbamates. The present review is aimed at compilation of the most important facts about cholinesterase based biosensors, types of physico-chemical transduction, immobilization strategies and practical applications.

  4. A simple urea-based route to ternary metal oxynitride nanoparticles

    International Nuclear Information System (INIS)

    Gomathi, A.; Reshma, S.; Rao, C.N.R.

    2009-01-01

    Ternary metal oxynitrides are generally prepared by heating the corresponding metal oxides with ammonia for long durations at high temperatures. In order to find a simple route that avoids use of gaseous ammonia, we have employed urea as the nitriding agent. In this method, ternary metal oxynitrides are obtained by heating the corresponding metal carbonates and transition metal oxides with excess urea. By this route, ternary metal oxynitrides of the formulae MTaO 2 N (M=Ca, Sr or Ba), MNbO 2 N (M=Sr or Ba), LaTiO 2 N and SrMoO 3-x N x have been prepared successfully. The oxynitrides so obtained were generally in the form of nanoparticles, and were characterized by various physical techniques. - Graphical abstract: Nanoparticles of ternary metal oxynitrides can be synthesized by means of urea route. Given is the TEM image of the nanoparticles of CaTaO 2 N so obtained and the insets show the SAED pattern and HREM image of the nanoparticles

  5. ARAC terrain data base

    International Nuclear Information System (INIS)

    Walker, H.

    1982-11-01

    A terrain data base covering the continental United States at 500-meter resolution has been generated. Its function is to provide terrain data for input to mesoscale atmospheric models that are used as part of the Atmospheric Release Advisory Capability at Lawrence Livermore Laboratory (LLNL). The structure of the data base as it exists on the LLNL computer system is described. The data base has been written to tapes for transfer to other systems and the format of these tapes is also described

  6. Base Station Performance Model

    OpenAIRE

    Walsh, Barbara; Farrell, Ronan

    2005-01-01

    At present the testing of power amplifiers within base station transmitters is limited to testing at component level as opposed to testing at the system level. While the detection of catastrophic failure is possible, that of performance degradation is not. This paper proposes a base station model with respect to transmitter output power with the aim of introducing system level monitoring of the power amplifier behaviour within the base station. Our model reflects the expe...

  7. Value-based pricing

    OpenAIRE

    Netseva-Porcheva Tatyana

    2010-01-01

    The main aim of the paper is to present the value-based pricing. Therefore, the comparison between two approaches of pricing is made - cost-based pricing and value-based pricing. The 'Price sensitively meter' is presented. The other topic of the paper is the perceived value - meaning of the perceived value, the components of perceived value, the determination of perceived value and the increasing of perceived value. In addition, the best company strategies in matrix 'value-cost' are outlined. .

  8. Network-Based Effectiveness

    National Research Council Canada - National Science Library

    Friman, Henrik

    2006-01-01

    ...) to increase competitive advantage, innovation, and mission effectiveness. Network-based effectiveness occurs due to the influence of various factors such as people, procedures, technology, and organizations...

  9. Case-based reasoning

    CERN Document Server

    Kolodner, Janet

    1993-01-01

    Case-based reasoning is one of the fastest growing areas in the field of knowledge-based systems and this book, authored by a leader in the field, is the first comprehensive text on the subject. Case-based reasoning systems are systems that store information about situations in their memory. As new problems arise, similar situations are searched out to help solve these problems. Problems are understood and inferences are made by finding the closest cases in memory, comparing and contrasting the problem with those cases, making inferences based on those comparisons, and asking questions whe

  10. Strengths-based Learning

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    -being. The Ph.D.-project in Strength-based learning took place in a Danish school with 750 pupils age 6-16 and a similar school was functioning as a control group. The presentation will focus on both the aware-explore-apply processes and the practical implications for the schools involved, and on measurable......Strength-based learning - Children͛s Character Strengths as Means to their Learning Potential͛ is a Ph.D.-project aiming to create a strength-based mindset in school settings and at the same time introducing strength-based interventions as specific tools to improve both learning and well...

  11. Monitoring Knowledge Base (MKB)

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Monitoring Knowledge Base (MKB) is a compilation of emissions measurement and monitoring techniques associated with air pollution control devices, industrial...

  12. Imagery Data Base Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Imagery Data Base Facility supports AFRL and other government organizations by providing imagery interpretation and analysis to users for data selection, imagery...

  13. Characters of neutron noise in full-size molten salt reactor

    International Nuclear Information System (INIS)

    Wang, Jiangmeng; Cao, Xinrong

    2015-01-01

    Highlights: • The larger system size makes full-size MSR deviate from point kinetic behavior. • The increasing velocity has non-monotonic effect on the effective delayed neutron fraction. • The amplitude of Green’s function at low frequencies is inversely proportional to the effective delayed neutron fraction. • The range of plateau region is smaller due to the more prominent point kinetic effect. - Abstract: In the present paper, the frequency-dependent and space-dependent behavior of the neutron noise in a full-size Molten Salt Reactor (MSR) is investigated. The theoretical models considering the fuel circulation are established based on one-group neutron diffusion theory. Green’s function of the neutron noise induced by a propagating perturbation is introduced with linear noise theory, due to the small perturbation. The equations are numerically calculated by developing a code, in which the eigenfunction expansion method is adopted. The static results show that the effective delayed neutron fraction changes non-monotonically with the increasing fuel velocity. In the dynamic case, the results are compared to those obtained in 1D MSR and a traditional reactor, in order to figure out the effects of both the fuel circulation and the system size. It is found that there is no difference in 1D and 3D MSR systems from the view of fuel circulation, i.e., the fuel circulation enhances the spatial neutronic coupling and leads to the stronger point kinetic effect. The more prominent space-dependent effect founded in 3D traditional reactors is also observed in the MSR, due to the looser neutronic coupling and the unique singularity of Green’s function in the location of the perturbation. Another interesting finding is that Green’s function for low frequencies changes non-monotonically with increasing velocity. The largest magnitude of Green’s function is observed at the velocity where the effective delayed neutron fraction reaches its minimum. Finally, the

  14. Game-Based Teaching

    DEFF Research Database (Denmark)

    Hanghøj, Thorkild

    2013-01-01

    This chapter outlines theoretical and empirical perspectives on how Game-Based Teaching can be integrated within the context of formal schooling. Initially, this is done by describing game scenarios as models for possible actions that need to be translated into curricular knowledge practices...... approaches to game-based teaching, which may or may not correspond with the pedagogical models of particular games....

  15. Secure base stations

    NARCIS (Netherlands)

    Bosch, Peter; Brusilovsky, Alec; McLellan, Rae; Mullender, Sape J.; Polakos, Paul

    2009-01-01

    With the introduction of the third generation (3G) Universal Mobile Telecommunications System (UMTS) base station router (BSR) and fourth generation (4G) base stations, such as the 3rd Generation Partnership Project (3GPP) Long Term Evolution (LTE) Evolved Node B (eNB), it has become important to

  16. Hydrogel based occlusion systems

    NARCIS (Netherlands)

    Stam, F.A.; Jackson, N.; Dubruel, P.; Adesanya, K.; Embrechts, A.; Mendes, E.; Neves, H.P.; Herijgers, P.; Verbrugghe, Y.; Shacham, Y.; Engel, L.; Krylov, V.

    2013-01-01

    A hydrogel based occlusion system, a method for occluding vessels, appendages or aneurysms, and a method for hydrogel synthesis are disclosed. The hydrogel based occlusion system includes a hydrogel having a shrunken and a swollen state and a delivery tool configured to deliver the hydrogel to a

  17. Diffusion Based Photon Mapping

    DEFF Research Database (Denmark)

    Schjøth, Lars; Fogh Olsen, Ole; Sporring, Jon

    2007-01-01

    . To address this problem we introduce a novel photon mapping algorithm based on nonlinear anisotropic diffusion. Our algorithm adapts according to the structure of the photon map such that smoothing occurs along edges and structures and not across. In this way we preserve the important illumination features......, while eliminating noise. We call our method diffusion based photon mapping....

  18. Diffusion Based Photon Mapping

    DEFF Research Database (Denmark)

    Schjøth, Lars; Olsen, Ole Fogh; Sporring, Jon

    2006-01-01

    . To address this problem we introduce a novel photon mapping algorithm based on nonlinear anisotropic diffusion. Our algorithm adapts according to the structure of the photon map such that smoothing occurs along edges and structures and not across. In this way we preserve the important illumination features......, while eliminating noise. We call our method diffusion based photon mapping....

  19. Zero-Based Budgeting.

    Science.gov (United States)

    Wichowski, Chester

    1979-01-01

    The zero-based budgeting approach is designed to achieve the greatest benefit with the fewest undesirable consequences. Seven basic steps make up the zero-based decision-making process: (1) identifying program goals, (2) classifying goals, (3) identifying resources, (4) reviewing consequences, (5) developing decision packages, (6) implementing a…

  20. Office-based anaesthesia

    African Journals Online (AJOL)

    infection, and consistency in nursing personnel. In the USA 17 -. 24% of all elective ambulatory surgery is ... knowledge base or personality to deal with the OBA environment. Compared with hospitals, office-based facilities currently ... disease or major cardiovascular risk factors). Intravenous access via a flexible cannula is.

  1. Knowledge base mechanisms

    Energy Technology Data Exchange (ETDEWEB)

    Suwa, M; Furukawa, K; Makinouchi, A; Mizoguchi, T; Mizoguchi, F; Yamasaki, H

    1982-01-01

    One of the principal goals of the Fifth Generation Computer System Project for the coming decade is to develop a methodology for building knowledge information processing systems which will provide people with intelligent agents. The key notion of the fifth generation computer system is knowledge used for problem solving. In this paper the authors describe the plan of Randd on knowledge base mechanisms. A knowledge representation system is to be designed to support knowledge acquisition for the knowledge information processing systems. The system will include a knowledge representation language, a knowledge base editor and a debugger. It is also expected to perform as a kind of meta-inference system. In order to develop the large scale knowledge base systems, a knowledge base mechanism based on the relational model is to be studied in the earlier stage of the project. Distributed problem solving is also one of the main issues of the project. 19 references.

  2. Skull base tumours

    Energy Technology Data Exchange (ETDEWEB)

    Borges, Alexandra [Instituto Portugues de Oncologia Francisco Gentil, Servico de Radiologia, Rua Professor Lima Basto, 1093 Lisboa Codex (Portugal)], E-mail: borgesalexandra@clix.pt

    2008-06-15

    With the advances of cross-sectional imaging radiologists gained an increasing responsibility in the management of patients with skull base pathology. As this anatomic area is hidden to clinical exam, surgeons and radiation oncologists have to rely on imaging studies to plan the most adequate treatment. To fulfil these endeavour radiologists need to be knowledgeable about skull base anatomy, about the main treatment options available, their indications and contra-indications and needs to be aware of the wide gamut of pathologies seen in this anatomic region. This article will provide a radiologists' friendly approach to the central skull base and will review the most common central skull base tumours and tumours intrinsic to the bony skull base.

  3. Evidence-based radiography

    International Nuclear Information System (INIS)

    Hafslund, Bjorg; Clare, Judith; Graverholt, Birgitte; Wammen Nortvedt, Monica

    2008-01-01

    Evidence-based practice (EBP) offers the integration of the best research evidence with clinical knowledge and expertise and patient values. EBP is a well known term in health care. This paper discusses the implementation of EBP into radiography and introduces the term evidence-based radiography. Evidence-based radiography is radiography informed and based on the combination of clinical expertise and the best available research-based evidence, patient preferences and resources available. In Norway, EBP in radiography is being debated and radiographers are discussing the challenges of implementing EBP in both academic and clinical practice. This discussion paper explains why EBP needs to be a basis for a radiography curriculum and a part of radiographers' practice. We argue that Norwegian radiographers must increase participation in research and developing practice within their specific radiographic domain

  4. Skull base tumours

    International Nuclear Information System (INIS)

    Borges, Alexandra

    2008-01-01

    With the advances of cross-sectional imaging radiologists gained an increasing responsibility in the management of patients with skull base pathology. As this anatomic area is hidden to clinical exam, surgeons and radiation oncologists have to rely on imaging studies to plan the most adequate treatment. To fulfil these endeavour radiologists need to be knowledgeable about skull base anatomy, about the main treatment options available, their indications and contra-indications and needs to be aware of the wide gamut of pathologies seen in this anatomic region. This article will provide a radiologists' friendly approach to the central skull base and will review the most common central skull base tumours and tumours intrinsic to the bony skull base

  5. Design-Based Research

    DEFF Research Database (Denmark)

    Gynther, Karsten; Christensen, Ove; Petersen, Trine Brun

    2012-01-01

    I denne artikel introduceres Design Based Research for første gang på dansk i et videnskabeligt tidsskrift. Artiklen præsenterer de grundlæggende antagelser, som ligger til grund for Design Based Research-traditionen, og artiklen diskuterer de principper, som ligger til grund for gennemførelse af...... et DBR-forskningsprojekt. Med udgangspunkt i forsknings- og udviklingsprojektet ELYK: E-læring, Yderområder og Klyngedannelse, præsenteres den innovationsmodel, som projektet har udviklet med udgangspunkt i Design Based Research traditionen. ELYKs DBR innovationsmodel har vist sig effektiv i forhold...

  6. Nature-based integration

    DEFF Research Database (Denmark)

    Pitkänen, Kati; Oratuomi, Joose; Hellgren, Daniela

    Increased attention to, and careful planning of the integration of migrants into Nordic societies is ever more important. Nature based integration is a new solution to respond to this need. This report presents the results of a Nordic survey and workshop and illustrates current practices of nature...... based integration by case study descriptions from Denmark, Sweden Norway and Finland. Across Nordic countries several practical projects and initiatives have been launched to promote the benefits of nature in integration and there is also growing academic interest in the topic. Nordic countries have...... the potential of becoming real forerunners in nature based integration even at the global scale....

  7. Data base management study

    Science.gov (United States)

    1976-01-01

    Data base management techniques and applicable equipment are described. Recommendations which will assist potential NASA data users in selecting and using appropriate data base management tools and techniques are presented. Classes of currently available data processing equipment ranging from basic terminals to large minicomputer systems were surveyed as they apply to the needs of potential SEASAT data users. Cost and capabilities projections for this equipment through 1985 were presented. A test of a typical data base management system was described, as well as the results of this test and recommendations to assist potential users in determining when such a system is appropriate for their needs. The representative system tested was UNIVAC's DMS 1100.

  8. Value-based pricing

    Directory of Open Access Journals (Sweden)

    Netseva-Porcheva Tatyana

    2010-01-01

    Full Text Available The main aim of the paper is to present the value-based pricing. Therefore, the comparison between two approaches of pricing is made - cost-based pricing and value-based pricing. The 'Price sensitively meter' is presented. The other topic of the paper is the perceived value - meaning of the perceived value, the components of perceived value, the determination of perceived value and the increasing of perceived value. In addition, the best company strategies in matrix 'value-cost' are outlined. .

  9. QuickBase

    CERN Document Server

    Conner, Nancy

    2007-01-01

    Ready to put Intuit's QuickBase to work? Our new Missing Manual shows you how to capture, modify, share, and manage data and documents with this web-based data-sharing program quickly and easily. No longer do you have to coordinate your team through a blizzard of emails or play frustrating games of "guess which document is the right one."QuickBase saves your organization time and money, letting you manage and share the information that makes your business tick: sales figures, project timelines, drafts of documents, purchase or work requests--whatever information you need to keep business flowi

  10. Cheboygan Vessel Base

    Data.gov (United States)

    Federal Laboratory Consortium — Cheboygan Vessel Base (CVB), located in Cheboygan, Michigan, is a field station of the USGS Great Lakes Science Center (GLSC). CVB was established by congressional...

  11. Hanscom Air Force Base

    Data.gov (United States)

    Federal Laboratory Consortium — MIT Lincoln Laboratory occupies 75 acres (20 acres of which are MIT property) on the eastern perimeter of Hanscom Air Force Base, which is at the nexus of Lexington,...

  12. Network-Based Effectiveness

    National Research Council Canada - National Science Library

    Friman, Henrik

    2006-01-01

    ... (extended from Leavitt, 1965). This text identifies aspects of network-based effectiveness that can benefit from a better understanding of leadership and management development of people, procedures, technology, and organizations...

  13. WormBase

    Data.gov (United States)

    U.S. Department of Health & Human Services — WormBase is an international consortium of biologists and computer scientists dedicated to providing the research community with accurate, current, accessible...

  14. Kelomehele preemia Baseli festivalil

    Index Scriptorium Estoniae

    2000-01-01

    Baselis festivalil "VIPER - International Festival for Film Video and New Media" tunnistati parimaks CD-ROMiks Gustav Deutschi/Anna Schimeki "Odysee today", netiprojektiks itaallaste "01.ORG", äramärkimispreemia - Raivo Kelomehe "Videoweaver"

  15. Risk based modelling

    International Nuclear Information System (INIS)

    Chapman, O.J.V.; Baker, A.E.

    1993-01-01

    Risk based analysis is a tool becoming available to both engineers and managers to aid decision making concerning plant matters such as In-Service Inspection (ISI). In order to develop a risk based method, some form of Structural Reliability Risk Assessment (SRRA) needs to be performed to provide a probability of failure ranking for all sites around the plant. A Probabilistic Risk Assessment (PRA) can then be carried out to combine these possible events with the capability of plant safety systems and procedures, to establish the consequences of failure for the sites. In this way the probability of failures are converted into a risk based ranking which can be used to assist the process of deciding which sites should be included in an ISI programme. This paper reviews the technique and typical results of a risk based ranking assessment carried out for nuclear power plant pipework. (author)

  16. Problem Based Learning

    DEFF Research Database (Denmark)

    de Graaff, Erik; Guerra, Aida

    , the key principles remain the same everywhere. Graaff & Kolmos (2003) identify the main PBL principles as follows: 1. Problem orientation 2. Project organization through teams or group work 3. Participant-directed 4. Experiental learning 5. Activity-based learning 6. Interdisciplinary learning and 7...... model and in general problem based and project based learning. We apply the principle of teach as you preach. The poster aims to outline the visitors’ workshop programme showing the results of some recent evaluations.......Problem-Based Learning (PBL) is an innovative method to organize the learning process in such a way that the students actively engage in finding answers by themselves. During the past 40 years PBL has evolved and diversified resulting in a multitude in variations in models and practices. However...

  17. Biomimetics: nature based innovation

    National Research Council Canada - National Science Library

    Bar-Cohen, Yoseph

    2012-01-01

    "Based on the concept that nature offers numerous sources of inspiration for inventions related to mechanisms, materials, processes, and algorithms, this book covers the topic of biomimetics and the inspired innovation...

  18. BaseMap

    Data.gov (United States)

    California Natural Resource Agency — The goal of this project is to provide a convenient base map that can be used as a starting point for CA projects. It's simple, but designed to work at a number of...

  19. PHENANTHROLINE TEMPLATED SCHIFF BASE

    African Journals Online (AJOL)

    DNA in intercalative mode and in the development of unique chemotherapeutics where they impact on the ... between base pairs of DNA. .... h, i, j, k belong to fragmentation products of impap. ..... Sm(III) complex and herring sperm DNA. Bull.

  20. Decreased immunostaining for macrophage scavenger receptor is associated with poor prognosis of prostate cancer.

    Science.gov (United States)

    Takayama, Hitoshi; Nonomura, Norio; Nishimura, Kazuo; Oka, Daizo; Shiba, Masahiro; Nakai, Yasutomo; Nakayama, Masashi; Tsujimura, Akira; Aozasa, Katsuyuki; Okuyama, Akihiko

    2009-02-01

    The aim of this study is to evaluate the expression of the macrophage scavenger receptor (MSR) in prostate needle biopsy specimens as a possible prognostic factor for prostate cancer. As MSR reportedly has a role in recognizing foreign pathogenic substances, MSR-positive inflammatory cells are often detected in solid tumours, and there is a correlation between the relative risk of prostate cancer and polymorphism of the MSR gene. MSR was evaluated by immunostaining in needle biopsies of the prostate from 135 patients who were confirmed to have prostate cancer. Among these men, 70 were treated by radical prostatectomy or by radiotherapy as definitive therapy; the other 65 were treated by hormonal therapy because of advanced disease or age. Needle-biopsy specimens were sectioned at 5 microm and immunostained with a monoclonal antibody against MSR. Six microscopic (x400) fields around the cancer foci were selected in each case for analysis. The median number of MSR-positive cells (MSR count) in each case was 24. There was an inverse correlation between the MSR count and Gleason score and clinical stage. The MSR count was lower in patients with biochemical (prostate-specific antigen, PSA) failure than that in those with no PSA failure (P or =24) than that in those with low MSR count (<24, P < 0.001). Moreover, for patients treated by definitive or hormonal therapy, the RFS rates in those with a higher MSR count were higher than in those with a lower MSR count (P < 0.001 and 0.014, respectively). Cox multivariate analysis showed that the MSR count was a prognostic factor for prostate cancer in addition to extraprostatic extension and Gleason score (P = 0.002, 0.038 and 0.011, respectively). The results of immunostaining of MSR in needle-biopsy specimens is a prognostic factor for prostate cancer.

  1. Lunar resource base

    Science.gov (United States)

    Pulley, John; Wise, Todd K.; Roy, Claude; Richter, Phil

    A lunar base that exploits local resources to enhance the productivity of a total SEI scenario is discussed. The goals were to emphasize lunar science and to land men on Mars in 2016 using significant amounts of lunar resources. It was assumed that propulsion was chemical and the surface power was non-nuclear. Three phases of the base build-up are outlined, the robotic emplacement of the first elements is detailed and a discussion of future options is included.

  2. Participatory design based research

    DEFF Research Database (Denmark)

    Dau, Susanne; Bach Jensen, Louise; Falk, Lars

    This poster reveal how participatory design based research by the use of a CoED inspired creative process can be used for designing solutions to problems regarding students study activities outside campus.......This poster reveal how participatory design based research by the use of a CoED inspired creative process can be used for designing solutions to problems regarding students study activities outside campus....

  3. Maintaining Relationship Based Procurement

    OpenAIRE

    Davis, Peter

    2012-01-01

    Alliance and relationship projects are increasingin number and represent a large pool of work. Tobe successful relationship style contracts dependon soft-dollar factors, particularly the participants'ability to work together within an agreedframework, generally they are not based on lowbid tendering. Participants should be prepared todo business in an open environment based ontrust and mutually agreed governance. Theresearch evaluates relationship maintenance inthe implementation phase of con...

  4. Game-based telerehabilitation.

    Science.gov (United States)

    Lange, B; Flynn, Sheryl M; Rizzo, A A

    2009-03-01

    This article summarizes the recent accomplishments and current challenges facing game-based virtual reality (VR) telerehabilitation. Specifically this article addresses accomplishments relative to realistic practice scenarios, part to whole practice, objective measurement of performance and progress, motivation, low cost, interaction devices and game design. Furthermore, a description of the current challenges facing game based telerehabilitation including the packaging, internet capabilities and access, data management, technical support, privacy protection, seizures, distance trials, scientific scrutiny and support from insurance companies.

  5. REST based mobile applications

    Science.gov (United States)

    Rambow, Mark; Preuss, Thomas; Berdux, Jörg; Conrad, Marc

    2008-02-01

    Simplicity is the major advantage of REST based webservices. Whereas SOAP is widespread in complex, security sensitive business-to-business aplications, REST is widely used for mashups and end-user centric applicatons. In that context we give an overview of REST and compare it to SOAP. Furthermore we apply the GeoDrawing application as an example for REST based mobile applications and emphasize on pros and cons for the use of REST in mobile application scenarios.

  6. Swarm-based medicine.

    Science.gov (United States)

    Putora, Paul Martin; Oldenburg, Jan

    2013-09-19

    Occasionally, medical decisions have to be taken in the absence of evidence-based guidelines. Other sources can be drawn upon to fill in the gaps, including experience and intuition. Authorities or experts, with their knowledge and experience, may provide further input--known as "eminence-based medicine". Due to the Internet and digital media, interactions among physicians now take place at a higher rate than ever before. With the rising number of interconnected individuals and their communication capabilities, the medical community is obtaining the properties of a swarm. The way individual physicians act depends on other physicians; medical societies act based on their members. Swarm behavior might facilitate the generation and distribution of knowledge as an unconscious process. As such, "swarm-based medicine" may add a further source of information to the classical approaches of evidence- and eminence-based medicine. How to integrate swarm-based medicine into practice is left to the individual physician, but even this decision will be influenced by the swarm.

  7. Evidence-Based Toxicology.

    Science.gov (United States)

    Hoffmann, Sebastian; Hartung, Thomas; Stephens, Martin

    Evidence-based toxicology (EBT) was introduced independently by two groups in 2005, in the context of toxicological risk assessment and causation as well as based on parallels between the evaluation of test methods in toxicology and evidence-based assessment of diagnostics tests in medicine. The role model of evidence-based medicine (EBM) motivated both proposals and guided the evolution of EBT, whereas especially systematic reviews and evidence quality assessment attract considerable attention in toxicology.Regarding test assessment, in the search of solutions for various problems related to validation, such as the imperfectness of the reference standard or the challenge to comprehensively evaluate tests, the field of Diagnostic Test Assessment (DTA) was identified as a potential resource. DTA being an EBM discipline, test method assessment/validation therefore became one of the main drivers spurring the development of EBT.In the context of pathway-based toxicology, EBT approaches, given their objectivity, transparency and consistency, have been proposed to be used for carrying out a (retrospective) mechanistic validation.In summary, implementation of more evidence-based approaches may provide the tools necessary to adapt the assessment/validation of toxicological test methods and testing strategies to face the challenges of toxicology in the twenty first century.

  8. LDEF materials data bases

    Science.gov (United States)

    Funk, Joan G.; Strickland, John W.; Davis, John M.

    1993-01-01

    The Long Duration Exposure Facility (LDEF) and the accompanying experiments were composed of and contained a wide variety of materials representing the largest collection of materials flown in low Earth orbit (LEO) and retrieved for ground based analysis to date. The results and implications of the mechanical, thermal, optical, and electrical data from these materials are the foundation on which future LEO space missions will be built. The LDEF Materials Special Investigation Group (MSIG) has been charged with establishing and developing data bases to document these materials and their performance to assure not only that the data are archived for future generations but also that the data are available to the spacecraft user community in an easily accessed, user-friendly form. This paper discusses the format and content of the three data bases developed or being developed to accomplish this task. The hardware and software requirements for each of these three data bases are discussed along with current availability of the data bases. This paper also serves as a user's guide to the MAPTIS LDEF Materials Data Base.

  9. Paper based electronics platform

    KAUST Repository

    Nassar, Joanna Mohammad

    2017-07-20

    A flexible and non-functionalized low cost paper-based electronic system platform fabricated from common paper, such as paper based sensors, and methods of producing paper based sensors, and methods of sensing using the paper based sensors are provided. A method of producing a paper based sensor can include the steps of: a) providing a conventional paper product to serve as a substrate for the sensor or as an active material for the sensor or both, the paper product not further treated or functionalized; and b) applying a sensing element to the paper substrate, the sensing element selected from the group consisting of a conductive material, the conductive material providing contacts and interconnects, sensitive material film that exhibits sensitivity to pH levels, a compressible and/or porous material disposed between a pair of opposed conductive elements, or a combination of two of more said sensing elements. The method of sensing can further include measuring, using the sensing element, a change in resistance, a change in voltage, a change in current, a change in capacitance, or a combination of any two or more thereof.

  10. Gossip-Based Dissemination

    Science.gov (United States)

    Friedman, Roy; Kermarrec, Anne-Marie; Miranda, Hugo; Rodrigues, Luís

    Gossip-based networking has emerged as a viable approach to disseminate information reliably and efficiently in large-scale systems. Initially introduced for database replication [222], the applicability of the approach extends much further now. For example, it has been applied for data aggregation [415], peer sampling [416] and publish/subscribe systems [845]. Gossip-based protocols rely on a periodic peer-wise exchange of information in wired systems. By changing the way each peer is selected for the gossip communication, and which data are exchanged and processed [451], gossip systems can be used to perform different distributed tasks, such as, among others: overlay maintenance, distributed computation, and information dissemination (a collection of papers on gossip can be found in [451]). In a wired setting, the peer sampling service, allowing for a random or specific peer selection, is often provided as an independent service, able to operate independently from other gossip-based services [416].

  11. Iron-based superconductivity

    CERN Document Server

    Johnson, Peter D; Yin, Wei-Guo

    2015-01-01

    This volume presents an in-depth review of experimental and theoretical studies on the newly discovered Fe-based superconductors.  Following the Introduction, which places iron-based superconductors in the context of other unconventional superconductors, the book is divided into three sections covering sample growth, experimental characterization, and theoretical understanding.  To understand the complex structure-property relationships of these materials, results from a wide range of experimental techniques and theoretical approaches are described that probe the electronic and magnetic proper

  12. Evidence-Based Development

    DEFF Research Database (Denmark)

    Hertzum, Morten; Simonsen, Jesper

    2004-01-01

    Systems development is replete with projects that represent substantial resource investments but result in systems that fail to meet users’ needs. Evidence-based development is an emerging idea intended to provide means for managing customer-vendor relationships and working systematically toward...... meeting customer needs. We are suggesting that the effects of the use of a system should play a prominent role in the contractual definition of IT projects and that contract fulfilment should be determined on the basis of evidence of these effects. Based on two ongoing studies of home-care management...

  13. Video-based rendering

    CERN Document Server

    Magnor, Marcus A

    2005-01-01

    Driven by consumer-market applications that enjoy steadily increasing economic importance, graphics hardware and rendering algorithms are a central focus of computer graphics research. Video-based rendering is an approach that aims to overcome the current bottleneck in the time-consuming modeling process and has applications in areas such as computer games, special effects, and interactive TV. This book offers an in-depth introduction to video-based rendering, a rapidly developing new interdisciplinary topic employing techniques from computer graphics, computer vision, and telecommunication en

  14. Process-based costing.

    Science.gov (United States)

    Lee, Robert H; Bott, Marjorie J; Forbes, Sarah; Redford, Linda; Swagerty, Daniel L; Taunton, Roma Lee

    2003-01-01

    Understanding how quality improvement affects costs is important. Unfortunately, low-cost, reliable ways of measuring direct costs are scarce. This article builds on the principles of process improvement to develop a costing strategy that meets both criteria. Process-based costing has 4 steps: developing a flowchart, estimating resource use, valuing resources, and calculating direct costs. To illustrate the technique, this article uses it to cost the care planning process in 3 long-term care facilities. We conclude that process-based costing is easy to implement; generates reliable, valid data; and allows nursing managers to assess the costs of new or modified processes.

  15. Inkjet-based micromanufacturing

    CERN Document Server

    Korvink, Jan G; Shin, Dong-Youn; Brand, Oliver; Fedder, Gary K; Hierold, Christofer; Tabata, Osamu

    2012-01-01

    Inkjet-based Micromanufacturing Inkjet technology goes way beyond putting ink on paper: it enables simpler, faster and more reliable manufacturing processes in the fields of micro- and nanotechnology. Modern inkjet heads are per se precision instruments that deposit droplets of fluids on a variety of surfaces in programmable, repeating patterns, allowing, after suitable modifications and adaptations, the manufacturing of devices such as thin-film transistors, polymer-based displays and photovoltaic elements. Moreover, inkjet technology facilitates the large-scale production of flexible RFID tr

  16. On multivariate Wilson bases

    DEFF Research Database (Denmark)

    Bownik, Marcin; Jakobsen, Mads Sielemann; Lemvig, Jakob

    2017-01-01

    A Wilson system is a collection of finite linear combinations of time frequency shifts of a square integrable function. In this paper we give an account of the construction of bimodular Wilson bases in higher dimensions from Gabor frames of redundancy two.......A Wilson system is a collection of finite linear combinations of time frequency shifts of a square integrable function. In this paper we give an account of the construction of bimodular Wilson bases in higher dimensions from Gabor frames of redundancy two....

  17. A calculational procedure for neutronic and depletion analysis of Molten-Salt reactors based on SCALE6/TRITON

    International Nuclear Information System (INIS)

    Sheu, R.J.; Chang, J.S.; Liu, Y.-W. H.

    2011-01-01

    Molten-Salt Reactors (MSRs) represent one of the selected categories in the GEN-IV program. This type of reactor is distinguished by the use of liquid fuel circulating in and out of the core, which makes it possible for online refueling and salt processing. However, this operation characteristic also complicates the modeling and simulation of reactor core behaviour using conventional neutronic codes. The TRITON sequence in the SCALE6 code system has been designed to provide the combined capabilities of problem-dependent cross-section processing, rigorous treatment of neutron transport, and coupled with the ORIGEN-S depletion calculations. In order to accommodate the simulation of dynamic refueling and processing scheme, an in-house program REFRESH together with a run script are developed for carrying out a series of stepwise TRITON calculations, that makes the work of analyzing the neutronic properties and performance of a MSR core design easier. As a demonstration and cross check, we have applied this method to reexamine the conceptual design of Molten Salt Actinide Recycler & Transmuter (MOSART). This paper summarizes the development of the method and preliminary results of its application on MOSART. (author)

  18. Supramolecular fluorene based materials

    NARCIS (Netherlands)

    Abbel, R.J.

    2008-01-01

    This thesis describes the use of noncovalent interactions in order to manipulate and control the self-assembly and morphology of electroactive fluorene-based materials. The supramolecular arrangement of p-conjugated polymers and oligomers can strongly influence their electronic and photophysical

  19. EPICS based DAQ system

    International Nuclear Information System (INIS)

    Cheng Weixing; Chen Yongzhong; Zhou Weimin; Ye Kairong; Liu Dekang

    2002-01-01

    EPICS is the most popular developing platform to build control system and beam diagnostic system in modern physics experiment facilities. An EPICS based data acquisition system was built in Redhat 6.2 operation system. The system is successfully used in the beam position monitor mapping, it improves the mapping process a lot

  20. Scenario-based strategizing

    DEFF Research Database (Denmark)

    Lehr, Thomas; Lorenz, Ullrich; Willert, Markus

    2017-01-01

    -based efficacy and robustness. To facilitate the colla- borative strategizing in teams, we propose a matrix with robustness and efficacy as the two axes, which we call the Parmenides Matrix. We assess the impact of the novel approach by applying it in two cases, at a govern- mental agency (German Environmental...

  1. Dictionary Based Image Segmentation

    DEFF Research Database (Denmark)

    Dahl, Anders Bjorholm; Dahl, Vedrana Andersen

    2015-01-01

    We propose a method for weakly supervised segmentation of natural images, which may contain both textured or non-textured regions. Our texture representation is based on a dictionary of image patches. To divide an image into separated regions with similar texture we use an implicit level sets...

  2. Web Based VRML Modelling

    NARCIS (Netherlands)

    Kiss, S.; Sarfraz, M.

    2004-01-01

    Presents a method to connect VRML (Virtual Reality Modeling Language) and Java components in a Web page using EAI (External Authoring Interface), which makes it possible to interactively generate and edit VRML meshes. The meshes used are based on regular grids, to provide an interaction and modeling

  3. Surfel Based Geometry Resonstruction

    DEFF Research Database (Denmark)

    Andersen, Vedrana; Aanæs, Henrik; Bærentzen, Jakob Andreas

    2010-01-01

    We propose a method for retrieving a piecewise smooth surface from noisy data. In data acquired by a scanning process sampled points are almost never on the discontinuities making reconstruction of surfaces with sharp features difficult. Our method is based on a Markov Random Field (MRF) formulat...

  4. Diffusion Based Photon Mapping

    DEFF Research Database (Denmark)

    Schjøth, Lars; Sporring, Jon; Fogh Olsen, Ole

    2008-01-01

    . To address this problem, we introduce a photon mapping algorithm based on nonlinear anisotropic diffusion. Our algorithm adapts according to the structure of the photon map such that smoothing occurs along edges and structures and not across. In this way, we preserve important illumination features, while...

  5. Evidence-based policy

    DEFF Research Database (Denmark)

    Vohnsen, Nina Holm

    2013-01-01

    -makers and the research community (e.g. Boden & Epstein 2006; House of Commons 2006; Cartwright et al 2009; Rod 2010; Vohnsen 2011). This article intends to draw out some general pitfalls in the curious meeting of science and politics by focusing on a particular attempt to make evidence-based legislation in Denmark (for...

  6. Project-Based Science

    Science.gov (United States)

    Krajcik, Joe

    2015-01-01

    Project-based science is an exciting way to teach science that aligns with the "Next Generation Science Standards" ("NGSS"). By focusing on core ideas along with practices and crosscutting concepts, classrooms become learning environments where teachers and students engage in science by designing and carrying out…

  7. Financing Competency Based Programs.

    Science.gov (United States)

    Daniel, Annette

    Literature on the background, causes, and current prevalence of competency based programs is synthesized in this report. According to one analysis of the actual and probable costs of minimum competency testing, estimated costs for test development, test administration, bureaucratic structures, and remedial programs for students who cannot pass the…

  8. Computer Based Expert Systems.

    Science.gov (United States)

    Parry, James D.; Ferrara, Joseph M.

    1985-01-01

    Claims knowledge-based expert computer systems can meet needs of rural schools for affordable expert advice and support and will play an important role in the future of rural education. Describes potential applications in prediction, interpretation, diagnosis, remediation, planning, monitoring, and instruction. (NEC)

  9. Community-Based Care

    Science.gov (United States)

    ... our e-newsletter! Aging & Health A to Z Community-Based Care Basic Facts & Information A variety of healthcare options ... day care centers are either in churches or community centers. Adult day care is commonly used to care for people who ...

  10. Polymer based tunneling sensor

    Science.gov (United States)

    Cui, Tianhong (Inventor); Wang, Jing (Inventor); Zhao, Yongjun (Inventor)

    2006-01-01

    A process for fabricating a polymer based circuit by the following steps. A mold of a design is formed through a lithography process. The design is transferred to a polymer substrate through a hot embossing process. A metal layer is then deposited over at least part of said design and at least one electrical lead is connected to said metal layer.

  11. Evidence-based guidelines

    DEFF Research Database (Denmark)

    Rovira, Àlex; Wattjes, Mike P; Tintoré, Mar

    2015-01-01

    diagnosis in patients with MS. The aim of this article is to provide guidelines for the implementation of MRI of the brain and spinal cord in the diagnosis of patients who are suspected of having MS. These guidelines are based on an extensive review of the recent literature, as well as on the personal...

  12. School Based Health Centers

    Science.gov (United States)

    Children's Aid Society, 2012

    2012-01-01

    School Based Health Centers (SBHC) are considered by experts as one of the most effective and efficient ways to provide preventive health care to children. Few programs are as successful in delivering health care to children at no cost to the patient, and where they are: in school. For many underserved children, The Children's Aid Society's…

  13. Internet based benchmarking

    DEFF Research Database (Denmark)

    Bogetoft, Peter; Nielsen, Kurt

    2005-01-01

    We discuss the design of interactive, internet based benchmarking using parametric (statistical) as well as nonparametric (DEA) models. The user receives benchmarks and improvement potentials. The user is also given the possibility to search different efficiency frontiers and hereby to explore...

  14. Problem-based learning

    NARCIS (Netherlands)

    Loyens, Sofie; Kirschner, Paul A.; Paas, Fred

    2010-01-01

    Loyens, S. M. M., Kirschner, P. A., & Paas, F. (2011). Problem-based learning. In S. Graham (Editor-in-Chief), A. Bus, S. Major, & L. Swanson (Associate Editors), APA educational psychology handbook: Vol. 3. Application to learning and teaching (pp. 403-425). Washington, DC: American Psychological

  15. Base tree property

    Czech Academy of Sciences Publication Activity Database

    Balcar, B.; Doucha, Michal; Hrušák, M.

    2015-01-01

    Roč. 32, č. 1 (2015), s. 69-81 ISSN 0167-8094 R&D Projects: GA AV ČR IAA100190902 Institutional support: RVO:67985840 Keywords : forcing * Boolean algebras * base tree Subject RIV: BA - General Mathematics Impact factor: 0.614, year: 2015 http://link.springer.com/article/10.1007/s11083-013-9316-2

  16. unsymmetrical Schiff base complexes

    Indian Academy of Sciences (India)

    the effect of the substitutional groups of the Schiff base on the oxidation and reduction potentials, we used ... Electrochemistry of these complexes showed that the presence of electron .... a solution of the ligand (1 mmol) in methanol (15 mL).

  17. Home-based care

    African Journals Online (AJOL)

    Mrs. Patience Edoho Samson-Akpan

    study was to ascertain the relationship between home-based care and quality of life of PLWHA in support groups in. Calabar South Local Government Area. A correlational design was utilized and a purposive sample of 74 PLWHA participated in the study. A self developed and well validated questionnaire was used for data ...

  18. Mutually unbiased bases

    Indian Academy of Sciences (India)

    Mutually unbiased bases play an important role in quantum cryptography [2] and in the optimal determination of the density operator of an ensemble [3,4]. A density operator ρ in N-dimensions depends on N2 1 real quantities. With the help of MUB's, any such density operator can be encoded, in an optimal way, in terms of ...

  19. Scenario-based strategizing

    DEFF Research Database (Denmark)

    Lehr, Thomas; Lorenz, Ullrich; Willert, Markus

    2017-01-01

    For over 40 years, scenarios have been promoted as a key technique for forming strategies in uncertain en- vironments. However, many challenges remain. In this article, we discuss a novel approach designed to increase the applicability of scenario-based strategizing in top management teams. Drawi...... Ministry) and a firm affected by disruptive change (Bosch, leading global supplier of technology and solutions)....

  20. 80537 based distance relay

    DEFF Research Database (Denmark)

    Pedersen, Knud Ole Helgesen

    1999-01-01

    A method for implementing a digital distance relay in the power system is described.Instructions are given on how to program this relay on a 80537 based microcomputer system.The problem is used as a practical case study in the course 53113: Micocomputer applications in the power system.The relay...

  1. Mojave Base Station Implementation

    Science.gov (United States)

    Koscielski, C. G.

    1984-01-01

    A 12.2 meter diameter X-Y mount antenna was reconditioned for use by the crustal dynamic project as a fixed base station. System capabilities and characteristics and key performance parameters for subsystems are presented. The implementation is completed.

  2. Model-based consensus

    NARCIS (Netherlands)

    Boumans, M.; Martini, C.; Boumans, M.

    2014-01-01

    The aim of the rational-consensus method is to produce "rational consensus", that is, "mathematical aggregation", by weighing the performance of each expert on the basis of his or her knowledge and ability to judge relevant uncertainties. The measurement of the performance of the experts is based on

  3. Model-based consensus

    NARCIS (Netherlands)

    Boumans, Marcel

    2014-01-01

    The aim of the rational-consensus method is to produce “rational consensus”, that is, “mathematical aggregation”, by weighing the performance of each expert on the basis of his or her knowledge and ability to judge relevant uncertainties. The measurement of the performance of the experts is based on

  4. Animation-based Sketching

    DEFF Research Database (Denmark)

    Vistisen, Peter

    This thesis is based on the results of a three-year long PhD-study at the Department of Communication and Psychology at Aalborg University. The thesis consist of five original papers, a book manuscript, as well as a linking text with the thesis’ research questions, research design, and summary...

  5. Refractive index based measurements

    DEFF Research Database (Denmark)

    2014-01-01

    In a method for performing a refractive index based measurement of a property of a fluid such as chemical composition or temperature, a chirp in the local spatial frequency of interference fringes of an interference pattern is reduced by mathematical manipulation of the recorded light intensity...

  6. Performance based fault diagnosis

    DEFF Research Database (Denmark)

    Niemann, Hans Henrik

    2002-01-01

    Different aspects of fault detection and fault isolation in closed-loop systems are considered. It is shown that using the standard setup known from feedback control, it is possible to formulate fault diagnosis problems based on a performance index in this general standard setup. It is also shown...

  7. Schiff base ligand

    Indian Academy of Sciences (India)

    Unknown

    Low-temperature stoichiometric Schiff base reaction in air in 3 : 1 mole ratio between benz- aldehyde and triethylenetetramine (trien) in methanol yields a novel tetraaza µ-bis(bidentate) acyclic ligand L. It was .... electrochemical work was performed as reported in ..... change in ligand shape through change in oxidation.

  8. ISFET based enzyme sensors

    NARCIS (Netherlands)

    van der Schoot, Bart H.; Bergveld, Piet

    1987-01-01

    This paper reviews the results that have been reported on ISFET based enzyme sensors. The most important improvement that results from the application of ISFETs instead of glass membrane electrodes is in the method of fabrication. Problems with regard to the pH dependence of the response and the

  9. Microcontroller base process emulator

    OpenAIRE

    Jovrea Titus Claudiu

    2009-01-01

    This paper describes the design of a microcontroller base emulator for a conventional industrial process. The emulator is made with microcontroller and is used for testing and evaluating the performances of the industrial regulators. The parameters of the emulated process are fully customizable online and downloadable thru a serial communication from a personal computer.

  10. REST based service composition

    DEFF Research Database (Denmark)

    Grönvall, Erik; Ingstrup, Mads; Pløger, Morten

    2011-01-01

    This paper presents an ongoing work developing and testing a Service Composition framework based upon the REST architecture named SECREST. A minimalistic approach have been favored instead of a creating a complete infrastructure. One focus has been on the system's interaction model. Indeed, an aim...

  11. Interpersonal Problems and Their Relationship to Depression, Self-Esteem, and Malignant Self-Regard.

    Science.gov (United States)

    Huprich, Steven K; Lengu, Ketrin; Evich, Carly

    2016-12-01

    DSM-5 Section III recommends that level of personality functioning be assessed. This requires an assessment of self and other representations. Malignant self-regard (MSR) is a way of assessing the level of functioning of those with a masochistic, self-defeating, depressive, or vulnerably narcissistic personality. In Study 1, 840 undergraduates were assessed for MSR, depressive symptoms, self-esteem, anaclitic and introjective depression, and interpersonal problems. MSR, self-esteem, depressive symptoms, and anaclitic and introjective depression were correlated with multiple dimensions of interpersonal problems, and MSR predicted the most variance in interpersonal scales measuring social inhibition, nonassertion, over-accommodation, and excessive self-sacrifice. MSR, anaclitic, and introjective depression predicted unique variance in six of the eight domains of interpersonal problems assessed. In Study 2, 68 undergraduates were provided positive or negative feedback. Consistent with theory, MSR predicted unique variance in state anxiety but not state anger. Results support the validity of the MSR construct.

  12. Convolution based profile fitting

    International Nuclear Information System (INIS)

    Kern, A.; Coelho, A.A.; Cheary, R.W.

    2002-01-01

    Full text: In convolution based profile fitting, profiles are generated by convoluting functions together to form the observed profile shape. For a convolution of 'n' functions this process can be written as, Y(2θ)=F 1 (2θ)x F 2 (2θ)x... x F i (2θ)x....xF n (2θ). In powder diffractometry the functions F i (2θ) can be interpreted as the aberration functions of the diffractometer, but in general any combination of appropriate functions for F i (2θ) may be used in this context. Most direct convolution fitting methods are restricted to combinations of F i (2θ) that can be convoluted analytically (e.g. GSAS) such as Lorentzians, Gaussians, the hat (impulse) function and the exponential function. However, software such as TOPAS is now available that can accurately convolute and refine a wide variety of profile shapes numerically, including user defined profiles, without the need to convolute analytically. Some of the most important advantages of modern convolution based profile fitting are: 1) virtually any peak shape and angle dependence can normally be described using minimal profile parameters in laboratory and synchrotron X-ray data as well as in CW and TOF neutron data. This is possible because numerical convolution and numerical differentiation is used within the refinement procedure so that a wide range of functions can easily be incorporated into the convolution equation; 2) it can use physically based diffractometer models by convoluting the instrument aberration functions. This can be done for most laboratory based X-ray powder diffractometer configurations including conventional divergent beam instruments, parallel beam instruments, and diffractometers used for asymmetric diffraction. It can also accommodate various optical elements (e.g. multilayers and monochromators) and detector systems (e.g. point and position sensitive detectors) and has already been applied to neutron powder diffraction systems (e.g. ANSTO) as well as synchrotron based

  13. Integrated Case Based and Rule Based Reasoning for Decision Support

    OpenAIRE

    Eshete, Azeb Bekele

    2009-01-01

    This project is a continuation of my specialization project which was focused on studying theoretical concepts related to case based reasoning method, rule based reasoning method and integration of them. The integration of rule-based and case-based reasoning methods has shown a substantial improvement with regards to performance over the individual methods. Verdande Technology As wants to try integrating the rule based reasoning method with an existing case based system. This project focu...

  14. Rock properties data base

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, R.; Gorski, B.; Gyenge, M.

    1991-03-01

    As mining companies proceed deeper and into areas whose stability is threatened by high and complex stress fields, the science of rock mechanics becomes invaluable in designing underground mine strata control programs. CANMET's Mining Research Laboratories division has compiled a summary of pre- and post-failure mechanical properties of rock types which were tested to provide design data. The 'Rock Properties Data Base' presents the results of these tests, and includes many rock types typical of Canadian mine environments. The data base also contains 'm' and 's' values determined using Hoek and Brown's failure criteria for both pre- and post-failure conditions. 7 refs., 3 tabs., 9 figs., 1 append.

  15. Sparse approximation with bases

    CERN Document Server

    2015-01-01

    This book systematically presents recent fundamental results on greedy approximation with respect to bases. Motivated by numerous applications, the last decade has seen great successes in studying nonlinear sparse approximation. Recent findings have established that greedy-type algorithms are suitable methods of nonlinear approximation in both sparse approximation with respect to bases and sparse approximation with respect to redundant systems. These insights, combined with some previous fundamental results, form the basis for constructing the theory of greedy approximation. Taking into account the theoretical and practical demand for this kind of theory, the book systematically elaborates a theoretical framework for greedy approximation and its applications.  The book addresses the needs of researchers working in numerical mathematics, harmonic analysis, and functional analysis. It quickly takes the reader from classical results to the latest frontier, but is written at the level of a graduate course and do...

  16. Problem Based Game Design

    DEFF Research Database (Denmark)

    Reng, Lars; Schoenau-Fog, Henrik

    2011-01-01

    At Aalborg University’s department of Medialogy, we are utilizing the Problem Based Learning method to encourage students to solve game design problems by pushing the boundaries and designing innovative games. This paper is concerned with describing this method, how students employ it in various ...... projects and how they learn to analyse, design, and develop for innovation by using it. We will present various cases to exemplify the approach and focus on how the method engages students and aspires for innovation in digital entertainment and games.......At Aalborg University’s department of Medialogy, we are utilizing the Problem Based Learning method to encourage students to solve game design problems by pushing the boundaries and designing innovative games. This paper is concerned with describing this method, how students employ it in various...

  17. Technology based Education System

    DEFF Research Database (Denmark)

    Kant Hiran, Kamal; Doshi, Ruchi; Henten, Anders

    2016-01-01

    Abstract - Education plays a very important role for the development of the country. Education has multiple dimensions from schooling to higher education and research. In all these domains, there is invariably a need for technology based teaching and learning tools are highly demanded in the acad......Abstract - Education plays a very important role for the development of the country. Education has multiple dimensions from schooling to higher education and research. In all these domains, there is invariably a need for technology based teaching and learning tools are highly demanded...... in the academic institutions. Thus, there is a need of comprehensive technology support system to cater the demands of all educational actors. Cloud Computing is one such comprehensive and user-friendly technology support environment that is the need of an hour. Cloud computing is the emerging technology that has...

  18. Knowledge based maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Sturm, A [Hamburgische Electacitaets-Werke AG Hamburg (Germany)

    1998-12-31

    The establishment of maintenance strategies is of crucial significance for the reliability of a plant and the economic efficiency of maintenance measures. Knowledge about the condition of components and plants from the technical and business management point of view therefore becomes one of the fundamental questions and the key to efficient management and maintenance. A new way to determine the maintenance strategy can be called: Knowledge Based Maintenance. A simple method for determining strategies while taking the technical condition of the components of the production process into account to the greatest possible degree which can be shown. A software with an algorithm for Knowledge Based Maintenance leads the user during complex work to the determination of maintenance strategies for this complex plant components. (orig.)

  19. Knowledge based maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Sturm, A. [Hamburgische Electacitaets-Werke AG Hamburg (Germany)

    1997-12-31

    The establishment of maintenance strategies is of crucial significance for the reliability of a plant and the economic efficiency of maintenance measures. Knowledge about the condition of components and plants from the technical and business management point of view therefore becomes one of the fundamental questions and the key to efficient management and maintenance. A new way to determine the maintenance strategy can be called: Knowledge Based Maintenance. A simple method for determining strategies while taking the technical condition of the components of the production process into account to the greatest possible degree which can be shown. A software with an algorithm for Knowledge Based Maintenance leads the user during complex work to the determination of maintenance strategies for this complex plant components. (orig.)

  20. Conducting Polymer Based Nanobiosensors

    Directory of Open Access Journals (Sweden)

    Chul Soon Park

    2016-06-01

    Full Text Available In recent years, conducting polymer (CP nanomaterials have been used in a variety of fields, such as in energy, environmental, and biomedical applications, owing to their outstanding chemical and physical properties compared to conventional metal materials. In particular, nanobiosensors based on CP nanomaterials exhibit excellent performance sensing target molecules. The performance of CP nanobiosensors varies based on their size, shape, conductivity, and morphology, among other characteristics. Therefore, in this review, we provide an overview of the techniques commonly used to fabricate novel CP nanomaterials and their biosensor applications, including aptasensors, field-effect transistor (FET biosensors, human sense mimicking biosensors, and immunoassays. We also discuss prospects for state-of-the-art nanobiosensors using CP nanomaterials by focusing on strategies to overcome the current limitations.

  1. Fusion safety data base

    International Nuclear Information System (INIS)

    Laats, E.T.; Hardy, H.A.

    1983-01-01

    The purpose of this Fusion Safety Data Base Program is to provide a repository of data for the design and development of safe commercial fusion reactors. The program is sponsored by the United States Department of Energy (DOE), Office of Fusion Energy. The function of the program is to collect, examine, permanently store, and make available the safety data to the entire US magnetic-fusion energy community. The sources of data will include domestic and foreign fusion reactor safety-related research programs. Any participant in the DOE Program may use the Data Base Program from his terminal through user friendly dialog and can view the contents in the form of text, tables, graphs, or system diagrams

  2. Maintaining Relationship Based Procurement

    Directory of Open Access Journals (Sweden)

    Peter Davis

    2012-11-01

    Full Text Available Alliance and relationship projects are increasingin number and represent a large pool of work. Tobe successful relationship style contracts dependon soft-dollar factors, particularly the participants'ability to work together within an agreedframework, generally they are not based on lowbid tendering. Participants should be prepared todo business in an open environment based ontrust and mutually agreed governance. Theresearch evaluates relationship maintenance inthe implementation phase of constructionalliances - a particular derivative of relationshipstyle contracts. To determine the factors thatcontribute to relationship maintenance forty-nineexperienced Australian alliance projectmanagers were interviewed. The main findingswere; the development of relationships early inthe project form building blocks of success fromwhich relationships are maintained and projectvalue added; quality facilitation plays animportant part in relationship maintenance and ahybrid organisation created as a result of alliancedevelopment overcomes destructiveorganisational boundaries. Relationshipmaintenance is integral to alliance project controland failure to formalise it and pay attention toprocess and past outcomes will undermine analliance project's potential for success.

  3. Location-based Scheduling

    DEFF Research Database (Denmark)

    Andersson, Niclas; Christensen, Knud

    on the market. However, CPM is primarily an activity based method that takes the activity as the unit of focus and there is criticism raised, specifically in the case of construction projects, on the method for deficient management of construction work and continuous flow of resources. To seek solutions...... to the identified limitations of the CPM method, an alternative planning and scheduling methodology that includes locations is tested. Location-based Scheduling (LBS) implies a shift in focus, from primarily the activities to the flow of work through the various locations of the project, i.e. the building. LBS uses...... the graphical presentation technique of Line-of-balance, which is adapted for planning and management of work-flows that facilitates resources to perform their work without interruptions caused by other resources working with other activities in the same location. As such, LBS and Lean Construction share...

  4. Trajectory Based Traffic Analysis

    DEFF Research Database (Denmark)

    Krogh, Benjamin Bjerre; Andersen, Ove; Lewis-Kelham, Edwin

    2013-01-01

    We present the INTRA system for interactive path-based traffic analysis. The analyses are developed in collaboration with traffic researchers and provide novel insights into conditions such as congestion, travel-time, choice of route, and traffic-flow. INTRA supports interactive point-and-click a......We present the INTRA system for interactive path-based traffic analysis. The analyses are developed in collaboration with traffic researchers and provide novel insights into conditions such as congestion, travel-time, choice of route, and traffic-flow. INTRA supports interactive point......-and-click analysis, due to a novel and efficient indexing structure. With the web-site daisy.aau.dk/its/spqdemo/we will demonstrate several analyses, using a very large real-world data set consisting of 1.9 billion GPS records (1.5 million trajectories) recorded from more than 13000 vehicles, and touching most...

  5. Carbon Nanotube based Nanotechnolgy

    Science.gov (United States)

    Meyyappan, M.

    2000-10-01

    Carbon nanotube(CNT) was discovered in the early 1990s and is an off-spring of C60(the fullerene or buckyball). CNT, depending on chirality and diameter, can be metallic or semiconductor and thus allows formation of metal-semiconductor and semiconductor-semiconductor junctions. CNT exhibits extraordinary electrical and mechanical properties and offers remarkable potential for revolutionary applications in electronics devices, computing and data storage technology, sensors, composites, storage of hydrogen or lithium for battery development, nanoelectromechanical systems(NEMS), and as tip in scanning probe microscopy(SPM) for imaging and nanolithography. Thus the CNT synthesis, characterization and applications touch upon all disciplines of science and engineering. A common growth method now is based on CVD though surface catalysis is key to synthesis, in contrast to many CVD applications common in microelectronics. A plasma based variation is gaining some attention. This talk will provide an overview of CNT properties, growth methods, applications, and research challenges and opportunities ahead.

  6. Spintronics-based computing

    CERN Document Server

    Prenat, Guillaume

    2015-01-01

    This book provides a comprehensive introduction to spintronics-based computing for the next generation of ultra-low power/highly reliable logic, which is widely considered a promising candidate to replace conventional, pure CMOS-based logic. It will cover aspects from device to system-level, including magnetic memory cells, device modeling, hybrid circuit structure, design methodology, CAD tools, and technological integration methods. This book is accessible to a variety of readers and little or no background in magnetism and spin electronics are required to understand its content.  The multidisciplinary team of expert authors from circuits, devices, computer architecture, CAD and system design reveal to readers the potential of spintronics nanodevices to reduce power consumption, improve reliability and enable new functionality.  .

  7. Knowledge Based Economy Assessment

    OpenAIRE

    Madalina Cristina Tocan

    2012-01-01

    The importance of knowledge-based economy (KBE) in the XXI century is evident. In the article the reflection of knowledge on economy is analyzed. The main point is targeted to the analysis of characteristics of knowledge expression in economy and to the construction of structure of KBE expression. This allows understanding the mechanism of functioning of knowledge economy. The authors highlight the possibility to assess the penetration level of KBE which could manifest itself trough the exist...

  8. Luxury-based Growth

    OpenAIRE

    Shiro Kuwahara

    2006-01-01

    Assuming that there exists a preference for luxury goods and a knowledge spillover from luxury goods production to goods production, this paper constructs an endogenous economic growth model. The model predicts two steady states: one is a steady positive growth state with regard to luxury goods production, and the other is a zero growth state in the absence of luxury goods production. Thus, this study examines the polarization of economies based on luxury goods consumption

  9. Base Stability of Aminocyclopropeniums

    Science.gov (United States)

    2017-11-01

    PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) US Army Research Laboratory Weapons and Materials Research Directorate (ATTN: RDRL-WMM-G) 2800 Powder...Mill Road Adelphi, MD 20783-1138 8. PERFORMING ORGANIZATION REPORT NUMBER ARL-TR-8204 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES...fuel cells to test their utility in anion exchange membranes. While the aminocyclopropeniums showed poor base stability, the cyclopropenium cation

  10. Granular loess classification based

    International Nuclear Information System (INIS)

    Browzin, B.S.

    1985-01-01

    This paper discusses how loess might be identified by two index properties: the granulometric composition and the dry unit weight. These two indices are necessary but not always sufficient for identification of loess. On the basis of analyses of samples from three continents, it was concluded that the 0.01-0.5-mm fraction deserves the name loessial fraction. Based on the loessial fraction concept, a granulometric classification of loess is proposed. A triangular chart is used to classify loess

  11. Educational Process Material Base

    OpenAIRE

    Olga Ozerova; Irina Zabaturina; Vera Kuznetsova; Galina Kovaleva

    2012-01-01

    Based on the data obtained by the Institute for Statistical Studies and the Economics of Knowledge, National Research University - Higher School of Economics Olga Ozerova - Head of the Department for Statistics of Education, Institute for Statistical Studies and the Economics of Knowledge, National Research University - Higher School of Economics, Moscow, Russian Federation. Email: Address: 18 Myasnitskaya St., Moscow, 101000, Russian Federation.Irina Zabaturina - senior resea...

  12. Supramolecular fluorene based materials

    OpenAIRE

    Abbel, R.J.

    2008-01-01

    This thesis describes the use of noncovalent interactions in order to manipulate and control the self-assembly and morphology of electroactive fluorene-based materials. The supramolecular arrangement of p-conjugated polymers and oligomers can strongly influence their electronic and photophysical properties. Therefore, a detailed understanding of such organisation processes is essential for the optimisation of the performance of these materials as applied in optoelectronic devices. In order to...

  13. Graphene-based Nanoelectronics

    Science.gov (United States)

    2013-02-01

    Electrodes were fabricated by drop casting solutions containing the graphene oxide (GO)/CNT/MnAc materials onto titanium (Ti) or stainless steel current...silicon carbide (SiC) substrate can induce a splitting of up to 0.3 eV between the maximum of the valence and minimum of the conduction bands at the...simultaneously hinders the formation of multilayer graphene domains. These results are based on a diffusion-segregation model for carbon precipitation on a Ni

  14. Spiritual-based Leadership

    DEFF Research Database (Denmark)

    Pruzan, Peter

    2015-01-01

    Although far from mainstream, the concept of spiritual-based leadership is emerging as an inclusive and yet highly personal approach to leadership that integrates a leader’s inner perspectives on identity, purpose, responsibility and success with her or his decisions and actions in the outer world...... of business—and therefore it is also emerging as a significant framework for understanding, practicing, communicating and teaching the art and profession of leadership....

  15. Arduino based laser control

    OpenAIRE

    Bernal Muñoz, Ferran

    2015-01-01

    ARDUINO is a vey usefull platform for prototypes. In this project ARDUINO will be used for controling a Semiconductor Tuneable Laser. [ANGLÈS] Diode laser for communications control based on an Arduino board. Temperature control implementation. Software and hardware protection for the laser implementation. [CASTELLÀ] Control de un láser de comunicaciones ópticas desde el ordenador utilizando una placa Arduino. Implementación de un control de temperatura y protección software y hardware ...

  16. Design bases - Concrete structures

    International Nuclear Information System (INIS)

    Diaz-Llanos Ros, M.

    1993-01-01

    The most suitable title for Section 2 is 'Design Bases', which covers not only calculation but also the following areas: - Structural design concepts. - Project criteria. - Material specifications. These concepts are developed in more detail in the following sections. The numbering in this document is neither complete nor hierarchical since, for easier cross referencing, it corresponds to the paragraphs of Eurocode 2 Part 1 (hereinafter 'EUR-2') which are commented on. (author)

  17. Biosphere data base revision

    International Nuclear Information System (INIS)

    Bergstroem, U.; Andersson, K.; Sundblad, B.

    1985-12-01

    The turnover of long-lived radionuclides in the biosphere has been modelled some time ago and the exposure to man was calculated. The nuclides were long-lived actinides and fission products leaking from a simulated deep rock repository for spent nuclear fuel. The data base for these calculations has been updated in the present work and in addition a number of nuclides that were not included in the earlier work have been treated. (G.B.)

  18. Air Force Smart Bases

    Science.gov (United States)

    2017-10-19

    initiates notification to all personnel on the base, the giant voice announces a lock down, everyone’s smart device shows an alarm requesting...location of the detected sound, they easily find a hunter and send his picture back to the IOC, where the hunter’s identity is verified through facial...computer goes into sleep mode, the thermostat goes back to unoccupied mode and his door locks as he walks through. Meanwhile over in the IOC

  19. Polypeptide based hydrogels

    OpenAIRE

    Hanay, Saltuk

    2018-01-01

    There is a need for biocompatible, biodegradable, 3-D printable and stable hydrogels especially in the areas of tissue engineering, drug delivery, bio-sensing technologies and antimicrobial coatings. The main aim of this Ph.D. work was to fabricate polypeptide based hydrogel which may find a potential application in those fields. Focusing on tyrosine or tryptophan-containing copolypeptides prepared by NCarboxyanhydride (NCA) polymerizations, three different crosslinking strategies have been t...

  20. Knowledge-based utility

    International Nuclear Information System (INIS)

    Chwalowski, M.

    1997-01-01

    This presentation provides industry examples of successful marketing practices by companies facing deregulation and competition. The common thread through the examples is that long term survival of today's utility structure is dependent on the strategic role of knowledge. As opposed to regulated monopolies which usually own huge physical assets and have very little intelligence about their customers, unregulated enterprises tend to be knowledge-based, characterized by higher market value than book value. A knowledge-based enterprise gathers data, creates information and develops knowledge by leveraging it as a competitive weapon. It institutionalizes human knowledge as a corporate asset for use over and over again by the use of databases, computer networks, patents, billing, collection and customer services (BCCS), branded interfaces and management capabilities. Activities to become knowledge-based such as replacing inventory/fixed assets with information about material usage to reduce expenditure and achieve more efficient operations, and by focusing on integration and value-adding delivery capabilities, were reviewed

  1. Microbead agglutination based assays

    KAUST Repository

    Kodzius, Rimantas

    2013-01-21

    We report a simple and rapid room temperature assay for point-of-care (POC) testing that is based on specific agglutination. Agglutination tests are based on aggregation of microbeads in the presence of a specific analyte thus enabling the macroscopic observation. Such tests are most often used to explore antibody-antigen reactions. Agglutination has been used for protein assays using a biotin/streptavidin system as well as a hybridization based assay. The agglutination systems are prone to selftermination of the linking analyte, prone to active site saturation and loss of agglomeration at high analyte concentrations. We investigated the molecular target/ligand interaction, explaining the common agglutination problems related to analyte self-termination, linkage of the analyte to the same bead instead of different microbeads. We classified the agglutination process into three kinds of assays: a two- component assay, a three-component assay and a stepped three- component assay. Although we compared these three kinds of assays for recognizing DNA and protein molecules, the assay can be used for virtually any molecule, including ions and metabolites. In total, the optimized assay permits detecting analytes with high sensitivity in a short time, 5 min, at room temperature. Such a system is appropriate for POC testing.

  2. As bases do petismo

    Directory of Open Access Journals (Sweden)

    David Samuels

    2004-10-01

    Full Text Available A partir dos dados do ESEB de 2002 o autor realiza um estudo das bases eleitorais do PT e de hipóteses sobre a natureza do petismo. Através de técnicas estatísticas multivariadas, são testadas relações do petismo com variáveis demográficas, socioeconômicas e variáveis relativas a questões políticas específicas. Os resultados apontam que apenas a escolaridade tem uma associação específica com o petismo, com implicações para o seu comportamento sócio-político.Based on the results of the 2002 Brazilian Electoral Study, the author analyses the electoral bases of the Worker´s Party and the factors associated with the "petismo". The relationships between the "petismo"and the socioeconomic, demographic and political variables are tested using multivariate analysis. The results indicate that the only "social category"associated with "petismo"is level of education, and it has clear implications to their social and political behavior.

  3. Value-based genomics.

    Science.gov (United States)

    Gong, Jun; Pan, Kathy; Fakih, Marwan; Pal, Sumanta; Salgia, Ravi

    2018-03-20

    Advancements in next-generation sequencing have greatly enhanced the development of biomarker-driven cancer therapies. The affordability and availability of next-generation sequencers have allowed for the commercialization of next-generation sequencing platforms that have found widespread use for clinical-decision making and research purposes. Despite the greater availability of tumor molecular profiling by next-generation sequencing at our doorsteps, the achievement of value-based care, or improving patient outcomes while reducing overall costs or risks, in the era of precision oncology remains a looming challenge. In this review, we highlight available data through a pre-established and conceptualized framework for evaluating value-based medicine to assess the cost (efficiency), clinical benefit (effectiveness), and toxicity (safety) of genomic profiling in cancer care. We also provide perspectives on future directions of next-generation sequencing from targeted panels to whole-exome or whole-genome sequencing and describe potential strategies needed to attain value-based genomics.

  4. Nanoplatform-based molecular imaging

    National Research Council Canada - National Science Library

    Chen, Xiaoyuan

    2011-01-01

    "Nanoplathform-Based Molecular Imaging provides rationale for using nanoparticle-based probes for molecular imaging, then discusses general strategies for this underutilized, yet promising, technology...

  5. Polyolefin-Based Aerogels

    Science.gov (United States)

    Lee, Je Kyun; Gould, George

    2012-01-01

    An organic polybutadiene (PB) rubberbased aerogel insulation material was developed that will provide superior thermal insulation and inherent radiation protection, exhibiting the flexibility, resiliency, toughness, and durability typical of the parent polymer, yet with the low density and superior insulation properties associated with the aerogels. The rubbery behaviors of the PB rubber-based aerogels are able to overcome the weak and brittle nature of conventional inorganic and organic aerogel insulation materials. Additionally, with higher content of hydrogen in their structure, the PB rubber aerogels will also provide inherently better radiation protection than those of inorganic and carbon aerogels. Since PB rubber aerogels also exhibit good hydrophobicity due to their hydrocarbon molecular structure, they will provide better performance reliability and durability as well as simpler, more economic, and environmentally friendly production over the conventional silica or other inorganic-based aerogels, which require chemical treatment to make them hydrophobic. Inorganic aerogels such as silica aerogels demonstrate many unusual and useful properties. There are several strategies to overcoming the drawbacks associated with the weakness and brittleness of silica aerogels. Development of the flexible fiber-reinforced silica aerogel composite blanket has proven one promising approach, providing a conveniently fielded form factor that is relatively robust toward handling in industrial environments compared to silica aerogel monoliths. However, the flexible silica aerogel composites still have a brittle, dusty character that may be undesirable, or even intolerable, in certain applications. Although the cross-linked organic aerogels such as resorcinol-formaldehyde (RF), polyisocyanurate, and cellulose aerogels show very high impact strength, they are also very brittle with little elongation (i.e., less rubbery). Also, silica and carbon aerogels are less efficient

  6. Characteristics Data Base

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, E.D.; Moore, R.S. (Automated Sciences Group, Inc., Oak Ridge, TN (USA))

    1990-08-01

    The LWR Serial Numbers Database System (SNDB) contains detailed data about individual, historically discharged LWR spent fuel assemblies. This data includes the reactor where used, the year the assemblies were discharged, the pool where they are currently stored, assembly type, burnup, weight, enrichment, and an estimate of their radiological properties. This information is distributed on floppy disks to users in the nuclear industry to assist in planning for the permanent nuclear waste repository. This document describes the design and development of the SNDB. It provides a complete description of the file structures and an outline of the major code modules. It serves as a reference for a programmer maintaining the system, or for others interested in the technical detail of this database. This is the initial version of the SNDB. It contains historical data through December 31, 1987, obtained from the Energy Information Administration (EIA). EIA obtains the data from the utility companies via the RW-859 Survey Form. It evaluates and standardizes the data and distributes the resulting batch level database as a large file on magnetic tape. The Characteristics Data Base obtains this database for use in the LWR Quantities Data Base. Additionally, the CDB obtains the individual assembly level detail from EIA for use in the SNDB. While the Quantities Data Base retains only the level of detail necessary for its reporting, the SNDB does retain and use the batch level data to assist in the identification of a particular assembly serial number. We expect to update the SNDB on an annual basis, as new historical data becomes available.

  7. Vision-based interaction

    CERN Document Server

    Turk, Matthew

    2013-01-01

    In its early years, the field of computer vision was largely motivated by researchers seeking computational models of biological vision and solutions to practical problems in manufacturing, defense, and medicine. For the past two decades or so, there has been an increasing interest in computer vision as an input modality in the context of human-computer interaction. Such vision-based interaction can endow interactive systems with visual capabilities similar to those important to human-human interaction, in order to perceive non-verbal cues and incorporate this information in applications such

  8. Knowledge based Entrepreneurship

    DEFF Research Database (Denmark)

    Heebøll, John

    This book is dedicated enterprising people with a technical or a scientific background who consider commercializing ideas and inventions within their field of expertise via a new business activity or a new company. It aims at distilling experiences from many successful and not so successful start......-up ventures from the Technical University of Denmark, 1988 – 2008 into practical, portable knowledge that can be used by future knowledge-based entrepreneurs to set up new companies efficiently or to stay away from it; to do what’s needed and avoid the pitfalls....

  9. Polymerization Using Phosphazene Bases

    KAUST Repository

    Zhao, Junpeng

    2015-09-01

    In the recent rise of metal-free polymerization techniques, organic phosphazene superbases have shown their remarkable strength as promoter/catalyst for the anionic polymerization of various types of monomers. Generally, the complexation of phosphazene base with the counterion (proton or lithium cation) significantly improves the nucleophilicity of the initiator/chain end resulting in highly enhanced polymerization rates, as compared with conventional metalbased initiating systems. In this chapter, the general features of phosphazenepromoted/catalyzed polymerizations and the applications in macromolecular engineering (synthesis of functionalized polymers, block copolymers, and macromolecular architectures) are discussed with challenges and perspectives being pointed out.

  10. Web Based Customized Design

    OpenAIRE

    Moi, Morten Benestad

    2013-01-01

    This thesis studies the methods needed to create a web based application to remotely customize a CAD model. This includes customizing a CAD model by using a graphical user interface to be able to remotely control the inputs to- and outputs from the model in NX, and to get the result sent back to the user. Using CAD systems such as NX requires intensive training, is often a slow process and gives a lot of room for errors. An intuitive, simple user interface will eliminate the need for CAD trai...

  11. Location-based games

    DEFF Research Database (Denmark)

    Ejsing-Duun, Stine

    In this dissertation, it is explored which prerequisites are necessary in location-based games (LBGs) to make meaningful the meeting between players and spatiality with an emphasis on physical locations. Throughout the dissertation, it has been shown that LBGs affect players’ perception of and be...... possible. The practical contribution is my creation of the LBG Visions of Sara. People continue to play this game in Odense more than two years after its launch, and DJEEO uses it as a showcase, enabling the company to sell similar LBGs....

  12. LIGHTWEIGHT CONCRETE BASED GRANSHLAK

    Directory of Open Access Journals (Sweden)

    NETESA M. I.

    2016-02-01

    Full Text Available Raising of problem. Concrete advisable to obtain a low strength with local secondary resources for recycling and reduce the environmental burden on the environment. But it is important to design such concrete compositions with a reduced flow of cement. It is known that the coefficient of efficiency of use of cement in the concrete of the heavy and B10 is less than about 0.5, which is almost two times smaller than in class B15 concrete and above. Even lower coefficient of efficiency in light concrete cement low strength. Therefore, it is important to find patterns determining the composition of lightweight concrete based on local-products industry with more efficient use of cement in them. Purpose.. Based on the analysis of earlier research results, including with the use of methods of mathematical planning of experiments to determine the concrete contents, which can provide the requirements for the underlying layers of the floor, the compressive strength of which should correspond to the class B5. It is important to provide the required strength at minimum flow of the cement, which is the most expensive and energy-intensive part of concrete. Conclusion. Analysis of the test results of control samples of concrete in 28-day-old, the following laws. The required tensile strength of concrete compressive strength of 7.0 MPa can be obtained in the test range when used in formulations as a filler as the Dnieper hydroelectric power station fly ash and tailings Krivoy Rog iron ore YuGOK. To ensure providing the required characteristic strength of the concrete in the underlying layers of the floor is advisable to use a nominal composition per cubic meter of concrete: cement 160 kg granshlaka Plant named after Petrovsky, 675 kg of fly ash Dnieper HPP 390 kg, 400 kg of sand, 230 liters of water. Thus, while ensuring rational grain composition components can obtain the desired strength lightweight concrete based granshlaka plant Petrovsky, using as fillers

  13. Accelerator-based BNCT.

    Science.gov (United States)

    Kreiner, A J; Baldo, M; Bergueiro, J R; Cartelli, D; Castell, W; Thatar Vento, V; Gomez Asoia, J; Mercuri, D; Padulo, J; Suarez Sandin, J C; Erhardt, J; Kesque, J M; Valda, A A; Debray, M E; Somacal, H R; Igarzabal, M; Minsky, D M; Herrera, M S; Capoulat, M E; Gonzalez, S J; del Grosso, M F; Gagetti, L; Suarez Anzorena, M; Gun, M; Carranza, O

    2014-06-01

    The activity in accelerator development for accelerator-based BNCT (AB-BNCT) both worldwide and in Argentina is described. Projects in Russia, UK, Italy, Japan, Israel, and Argentina to develop AB-BNCT around different types of accelerators are briefly presented. In particular, the present status and recent progress of the Argentine project will be reviewed. The topics will cover: intense ion sources, accelerator tubes, transport of intense beams, beam diagnostics, the (9)Be(d,n) reaction as a possible neutron source, Beam Shaping Assemblies (BSA), a treatment room, and treatment planning in realistic cases. © 2013 Elsevier Ltd. All rights reserved.

  14. Cellular based cancer vaccines

    DEFF Research Database (Denmark)

    Hansen, M; Met, Ö; Svane, I M

    2012-01-01

    Cancer vaccines designed to re-calibrate the existing host-tumour interaction, tipping the balance from tumor acceptance towards tumor control holds huge potential to complement traditional cancer therapies. In general, limited success has been achieved with vaccines composed of tumor...... to transiently affect in vitro migration via autocrine receptor-mediated endocytosis of CCR7. In the current review, we discuss optimal design of DC maturation focused on pre-clinical as well as clinical results from standard and polarized dendritic cell based cancer vaccines....

  15. WAP - based telemedicine applications

    International Nuclear Information System (INIS)

    Hung, K.; Zhang, Y.T.

    2001-01-01

    Telemedicine refers to the utilization of telecommunication technology for medical diagnosis, treatment, and patient care. Its aim is to provide expert-based health care to remote sites through telecommunication and information technologies. The significant advances in technologies have enabled the introduction of a broad range of telemedicine applications, which are supported by computer networks, wireless communication, and information superhighway. For example, some hospitals are using tele-radiology for remote consultation. Such a system includes medical imaging devices networked with computers and databases. Another growing area is patient monitoring, in which sensors are used to acquire biomedical signals, such as electrocardiogram (ECG), blood pressure, and body temperature, from a remote patient, who could be in bed or moving freely. The signals are then relayed to remote systems for viewing and analysis. Telemedicine can be divided into two basic modes of operations: real-time mode, in which the patient data can be accessed remotely in real-time, and store-and-forward mode, in which the acquired data does not have to be accessed immediately. In the recent years, many parties have demonstrated various telemedicine applications based on the Internet and cellular phone as these two fields have been developing rapidly. A current, recognizable trend in telecommunication is the convergence of wireless communication and computer network technologies. This has been reflected in recently developed telemedicine systems. For example, in 1998 J. Reponen, et al. have demonstrated transmission and display of computerized tomography (CT) examinations using a remote portable computer wirelessly connected to a computer network through TCP/IP on a GSM cellular phone. Two years later, they carried out the same tests with a GSM-based wireless personal digital assistant (PDA). The WAP (Wireless Application Protocol) Forum was founded in 1997 to create a global protocol

  16. Mars base buildup scenarios

    International Nuclear Information System (INIS)

    Blacic, J.D.

    1985-01-01

    Two surface base build-up scenarios are presented in order to help visualize the mission and to serve as a basis for trade studies. In the first scenario, direct manned landings on the Martian surface occur early in the missions and scientific investigation is the main driver and rationale. In the second scenario, early development of an infrastructure to exploite the volatile resources of the Martian moons for economic purposes is emphasized. Scientific exploration of the surface is delayed at first, but once begun develops rapidly aided by the presence of a permanently manned orbital station

  17. Agent-Based Optimization

    CERN Document Server

    Jędrzejowicz, Piotr; Kacprzyk, Janusz

    2013-01-01

    This volume presents a collection of original research works by leading specialists focusing on novel and promising approaches in which the multi-agent system paradigm is used to support, enhance or replace traditional approaches to solving difficult optimization problems. The editors have invited several well-known specialists to present their solutions, tools, and models falling under the common denominator of the agent-based optimization. The book consists of eight chapters covering examples of application of the multi-agent paradigm and respective customized tools to solve  difficult optimization problems arising in different areas such as machine learning, scheduling, transportation and, more generally, distributed and cooperative problem solving.

  18. Refractive index based measurements

    DEFF Research Database (Denmark)

    2014-01-01

    In a method for performing a refractive index based measurement of a property of a fluid such as chemical composition or temperature by observing an apparent angular shift in an interference fringe pattern produced by back or forward scattering interferometry, ambiguities in the measurement caused...... by the apparent shift being consistent with one of a number of numerical possibilities for the real shift which differ by 2n are resolved by combining measurements performed on the same sample using light paths therethrough of differing lengths....

  19. Sustainability Base Construction Update

    Science.gov (United States)

    Mewhinney, Michael

    2012-01-01

    Construction of the new Sustainability Base Collaborative support facility, expected to become the highest performing building in the federal government continues at NASA's Ames Research Center, Moffet Field, Calif. The new building is designed to achieve a platinum rating under the leadership in Energy and Environment Design (LEED) new construction standards for environmentally sustainable construction developed by the U. S. Green Building Council, Washington, D. C. When completed by the end of 2011, the $20.6 million building will feature near zero net energy consumption, use 90 percent less potable water than conventionally build buildings of equivalent size, and will result in reduced building maintenance costs.

  20. Chitosan-based nanocomposites

    CSIR Research Space (South Africa)

    Kesavan Pillai, Sreejarani

    2012-08-01

    Full Text Available , and hygiene devices. They thus represent a strong and emerging answer for improved and eco-friendly materials. This chapter reviews the recent developments in the area of chitosan-based nanocomposites, with a special emphasis on clay-containing nanocomposites...-sized mineral fillers like silica, talc, and clay are added to reduce the cost and improve chitosan’s performance in some way. However, the mechanical properties such as elongation at break and tensile strength of these composites decrease with the incorporation...

  1. Droplet based microfluidics

    International Nuclear Information System (INIS)

    Seemann, Ralf; Brinkmann, Martin; Pfohl, Thomas; Herminghaus, Stephan

    2012-01-01

    Droplet based microfluidics is a rapidly growing interdisciplinary field of research combining soft matter physics, biochemistry and microsystems engineering. Its applications range from fast analytical systems or the synthesis of advanced materials to protein crystallization and biological assays for living cells. Precise control of droplet volumes and reliable manipulation of individual droplets such as coalescence, mixing of their contents, and sorting in combination with fast analysis tools allow us to perform chemical reactions inside the droplets under defined conditions. In this paper, we will review available drop generation and manipulation techniques. The main focus of this review is not to be comprehensive and explain all techniques in great detail but to identify and shed light on similarities and underlying physical principles. Since geometry and wetting properties of the microfluidic channels are crucial factors for droplet generation, we also briefly describe typical device fabrication methods in droplet based microfluidics. Examples of applications and reaction schemes which rely on the discussed manipulation techniques are also presented, such as the fabrication of special materials and biophysical experiments.

  2. DVD Based Electronic Pulser

    International Nuclear Information System (INIS)

    Morris, Scott J.; Pratt, Rick M.; Hughes, Michael A.; Kouzes, Richard T.; Pitts, W K.; Robinson, Eric E.

    2005-01-01

    This paper describes the design, construction, and testing of a DVD based electronic pulser system (DVDEPS). Such a device is used to generate pulse streams for simulation of both gamma and neutron detector systems. The DVDEPS reproduces a random pulse stream of a full HPGe spectrum as well as a digital pulse stream representing the output of a neutron multiplicity detector. The exchangeable DVD media contains over an hour of data for both detector systems and can contain an arbitrary gamma spectrum and neutron pulse stream. The data is written to the DVD using a desktop computer program from either actual or simulated spectra. The targeted use of the DVDEPS is authentication or validation of monitoring equipment for non-proliferation purposes, but it is also of general use whenever a complex data stream is required. The DVD based pulser combines the storage capacity and simplicity of DVD technology with commonly available electronic components to build a relatively inexpensive yet highly capable testing instrument

  3. Evidence-based surgery

    Directory of Open Access Journals (Sweden)

    Miran Rems

    2007-04-01

    Full Text Available Background: Surgery is setting a new ground by the reign of evidence that was brought up by the Evidence Based Medicine (EBM. While experiences and opinion of an expert count the least by the principles of EBM, randomized controlled trials (RCT and other comparative studies have gained their importance. Recommendations that were included in guidelines represent a demanding shift in surgeon’s professional thinking. Their thinking and classical education have not yet been completely based on the results of such studies and are still very very much master-pupil centred. Assessment of someone’s own experiences is threatened by objectivity as negative experiences get recorded in deeper memory. Randomized studies and meta-analyses do appear also in surgery. However, they demand an extra knowledge about critical assessment.Conclusions: Setting a patient to the foreground brings a surgeon’s decision to the field of EBM. The process has already begun and cannot be avoided. Decision hierarchy moves from the experience field to the evidence territory but to a lesser extent when compared to the rest of medicine. There exist objective restrictions with approving a new paradigm. However, these should not stop the process of EBM implementation. Finally, there is an ethic issue to be considered. Too slow activities in research, education and critical assessment can bring the surgeon to the position when a well-informed patient loses his/her trust.

  4. Microlaser-based displays

    Science.gov (United States)

    Bergstedt, Robert; Fink, Charles G.; Flint, Graham W.; Hargis, David E.; Peppler, Philipp W.

    1997-07-01

    Laser Power Corporation has developed a new type of projection display, based upon microlaser technology and a novel scan architecture, which provides the foundation for bright, extremely high resolution images. A review of projection technologies is presented along with the limitations of each and the difficulties they experience in trying to generate high resolution imagery. The design of the microlaser based projector is discussed along with the advantage of this technology. High power red, green, and blue microlasers have been designed and developed specifically for use in projection displays. These sources, in combination with high resolution, high contrast modulator, produce a 24 bit color gamut, capable of supporting the full range of real world colors. The new scan architecture, which reduces the modulation rate and scan speeds required, is described. This scan architecture, along with the inherent brightness of the laser provides the fundamentals necessary to produce a 5120 by 4096 resolution display. The brightness and color uniformity of the display is excellent, allowing for tiling of the displays with far fewer artifacts than those in a traditionally tiled display. Applications for the display include simulators, command and control centers, and electronic cinema.

  5. SPACE BASED INTERCEPTOR SCALING

    Energy Technology Data Exchange (ETDEWEB)

    G. CANAVAN

    2001-02-01

    Space Based Interceptor (SBI) have ranges that are adequate to address rogue ICBMs. They are not overly sensitive to 30-60 s delay times. Current technologies would support boost phase intercept with about 150 interceptors. Higher acceleration and velocity could reduce than number by about a factor of 3 at the cost of heavier and more expensive Kinetic Kill Vehicles (KKVs). 6g SBI would reduce optimal constellation costs by about 35%; 8g SBI would reduce them another 20%. Interceptor ranges fall rapidly with theater missile range. Constellations increase significantly for ranges under 3,000 km, even with advanced interceptor technology. For distributed launches, these estimates recover earlier strategic scalings, which demonstrate the improved absentee ratio for larger or multiple launch areas. Constellations increase with the number of missiles and the number of interceptors launched at each. The economic estimates above suggest that two SBI per missile with a modest midcourse underlay is appropriate. The SBI KKV technology would appear to be common for space- and surface-based boost phase systems, and could have synergisms with improved midcourse intercept and discrimination systems. While advanced technology could be helpful in reducing costs, particularly for short range theater missiles, current technology appears adequate for pressing rogue ICBM, accidental, and unauthorized launches.

  6. Challenge Based Innovation gala

    CERN Multimedia

    CERN. Geneva; Utriainen, Tuuli Maria; Toivonen, Harri; Nordberg, Markus

    2014-01-01

    Challenge Based Innovation gala   There’s a new experiment starting in CERN called IdeaLab where we work together with detector R&D researchers to help them to bridge their knowledge into a more human, societally oriented context. Currently we are located in B153, but will move our activities to a new facility next to the Globe in May 2014. One of our first pilot projects is a 5 month course CBI (Challenge Based Innovation) where two multidisciplinary student teams join forces with Edusafe & TALENT projects at CERN. Their goal is to discover what kind of tools for learning could be created in collaboration with the two groups. After months of user interviews and low resolution prototyping they are ready to share the results with us in the form of an afternoon gala. We warmly welcome you to join us to see the students' results and experience the prototypes they have conceived. The event is in three parts, you are welcome to visit all of them,...

  7. [Competence based medical education].

    Science.gov (United States)

    Bernabó, Jorge G; Buraschi, Jorge; Olcese, Juan; Buraschi, María; Duro, Eduardo

    2007-01-01

    The strategy of curriculum planning in the majority of the Schools of Medicine has shifted, in the past years, from curriculum models based in contents to outcome oriented curricula. Coincidently the interest in defining and evaluating the clinical competences that a graduate must have has grown. In our country, and particularly in the Associated Hospitals belonging to the Unidad Regional de Enseñanza IV of the UBA School of Medicine, evidence has been gathered showing that the acquisition of clinical competences during the grade is in general insufficient. The foundations and characteristics of PREM (Programa de Requisitos Esenciales Mínimos) are described. PREM is a tool to promote the apprenticeship of abilities and necessary skills for the practice of medicine. The objective of the program is to promote the apprenticeship of a well defined list of core competences considered indispensable for a general practitioner. An outcome oriented curriculum with a clear definition of the expected knowledge, skills and attitudes of a graduate of the programme, the promotion of learning experiences centered in the practice and evaluation tools based in direct observation of the student's performance should contribute to close the gap between what the Medicine Schools traditionally teach and evaluate, and what the doctor needs to know and needs to do to perform correctly its profession.

  8. Constraint-based reachability

    Directory of Open Access Journals (Sweden)

    Arnaud Gotlieb

    2013-02-01

    Full Text Available Iterative imperative programs can be considered as infinite-state systems computing over possibly unbounded domains. Studying reachability in these systems is challenging as it requires to deal with an infinite number of states with standard backward or forward exploration strategies. An approach that we call Constraint-based reachability, is proposed to address reachability problems by exploring program states using a constraint model of the whole program. The keypoint of the approach is to interpret imperative constructions such as conditionals, loops, array and memory manipulations with the fundamental notion of constraint over a computational domain. By combining constraint filtering and abstraction techniques, Constraint-based reachability is able to solve reachability problems which are usually outside the scope of backward or forward exploration strategies. This paper proposes an interpretation of classical filtering consistencies used in Constraint Programming as abstract domain computations, and shows how this approach can be used to produce a constraint solver that efficiently generates solutions for reachability problems that are unsolvable by other approaches.

  9. Metasurface-Based Polarimeters

    Directory of Open Access Journals (Sweden)

    Fei Ding

    2018-04-01

    Full Text Available The state of polarization (SOP is an inherent property of light that can be used to gain crucial information about the composition and structure of materials interrogated with light. However, the SOP is difficult to experimentally determine since it involves phase information between orthogonal polarization states, and is uncorrelated with the light intensity and frequency, which can be easily determined with photodetectors and spectrometers. Rapid progress on optical gradient metasurfaces has resulted in the development of conceptually new approaches to the SOP characterization. In this paper, we review the fundamentals of and recent developments within metasurface-based polarimeters. Starting by introducing the concepts of generalized Snell’s law and Stokes parameters, we explain the Pancharatnam–Berry phase (PB-phase which is instrumental for differentiating between orthogonal circular polarizations. Then we review the recent progress in metasurface-based polarimeters, including polarimeters, spectropolarimeters, orbital angular momentum (OAM spectropolarimeters, and photodetector integrated polarimeters. The review is ended with a short conclusion and perspective for future developments.

  10. Risk-based safety indicators

    International Nuclear Information System (INIS)

    Szikszai, T.

    1997-01-01

    The presentation discusses the following issues: The objectives of the risk-based indicator programme. The characteristics of the risk-based indicators. The objectives of risk-based safety indicators - in monitoring safety; in PSA applications. What indicators? How to produce the risk based indicators? PSA requirements

  11. MS Based Metabonomics

    Energy Technology Data Exchange (ETDEWEB)

    Want, Elizabeth J.; Metz, Thomas O.

    2010-03-01

    Metabonomics is the latest and least mature of the systems biology triad, which also includes genomics and proteomics, and has its origins in the early orthomolecular medicine work pioneered by Linus Pauling and Arthur Robinson. It was defined by Nicholson and colleagues in 1999 as the quantitative measurement of perturbations in the metabolite complement of an integrated biological system in response to internal or external stimuli, and is often used today to describe many non-global types of metabolite analyses. Applications of metabonomics are extensive and include toxicology, nutrition, pharmaceutical research and development, physiological monitoring and disease diagnosis. For example, blood samples from millions of neonates are tested routinely by mass spectrometry (MS) as a diagnostic tool for inborn errors of metabolism. The metabonome encompasses a wide range of structurally diverse metabolites; therefore, no single analytical platform will be sufficient. Specialized sample preparation and detection techniques are required, and advances in NMR and MS technologies have led to enhanced metabonome coverage, which in turn demands improved data analysis approaches. The role of MS in metabonomics is still evolving as instrumentation and software becomes more sophisticated and as researchers realize the strengths and limitations of current technology. MS offers a wide dynamic range, high sensitivity, and reproducible, quantitative analysis. These attributes are essential for addressing the challenges of metabonomics, as the range of metabolite concentrations easily exceeds nine orders of magnitude in biofluids, and the diversity of molecular species ranges from simple amino and organic acids to lipids and complex carbohydrates. Additional challenges arise in generating a comprehensive metabolite profile, downstream data processing and analysis, and structural characterization of important metabolites. A typical workflow of MS-based metabonomics is shown in Figure

  12. Skull base tumor model.

    Science.gov (United States)

    Gragnaniello, Cristian; Nader, Remi; van Doormaal, Tristan; Kamel, Mahmoud; Voormolen, Eduard H J; Lasio, Giovanni; Aboud, Emad; Regli, Luca; Tulleken, Cornelius A F; Al-Mefty, Ossama

    2010-11-01

    Resident duty-hours restrictions have now been instituted in many countries worldwide. Shortened training times and increased public scrutiny of surgical competency have led to a move away from the traditional apprenticeship model of training. The development of educational models for brain anatomy is a fascinating innovation allowing neurosurgeons to train without the need to practice on real patients and it may be a solution to achieve competency within a shortened training period. The authors describe the use of Stratathane resin ST-504 polymer (SRSP), which is inserted at different intracranial locations to closely mimic meningiomas and other pathological entities of the skull base, in a cadaveric model, for use in neurosurgical training. Silicone-injected and pressurized cadaveric heads were used for studying the SRSP model. The SRSP presents unique intrinsic metamorphic characteristics: liquid at first, it expands and foams when injected into the desired area of the brain, forming a solid tumorlike structure. The authors injected SRSP via different passages that did not influence routes used for the surgical approach for resection of the simulated lesion. For example, SRSP injection routes included endonasal transsphenoidal or transoral approaches if lesions were to be removed through standard skull base approach, or, alternatively, SRSP was injected via a cranial approach if the removal was planned to be via the transsphenoidal or transoral route. The model was set in place in 3 countries (US, Italy, and The Netherlands), and a pool of 13 physicians from 4 different institutions (all surgeons and surgeons in training) participated in evaluating it and provided feedback. All 13 evaluating physicians had overall positive impressions of the model. The overall score on 9 components evaluated--including comparison between the tumor model and real tumor cases, perioperative requirements, general impression, and applicability--was 88% (100% being the best possible

  13. Plasma based accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Caldwell, Allen [Max-Planck-Institut fuer Physik, Muenchen (Germany)

    2015-05-01

    The concept of laser-induced plasma wakefields as a technique to accelerate charged particles was introduced 35 years ago as a means to go beyond the accelerating gradients possible with metallic cavities supporting radio frequency electromagnetic fields. Significant developments in laser technology have made possible the pulse intensity needed to realize this concept, and rapid progress is now underway in the realization of laser-driven plasma wakefield acceleration. It has also been realized that similar accelerating gradients can be produced by particle beams propagating in plasmas, and experimental programs have also been undertaken to study this possibility. Positive results have been achieved with electron-driven plasma wakefields, and a demonstration experiment with proton-driven wakefields is under construction at CERN. The concepts behind these different schemes and their pros and cons are described, as well as the experimental results achieved. An outlook for future practical uses of plasma based accelerators will also be given.

  14. Gossip-Based Broadcast

    Science.gov (United States)

    Leitão, João; Pereira, José; Rodrigues, Luís

    Gossip, or epidemic, protocols have emerged as a powerful strategy to implement highly scalable and resilient reliable broadcast primitives on large scale peer-to-peer networks. Epidemic protocols are scalable because they distribute the load among all nodes in the system and resilient because they have an intrinsic level of redundancy that masks node and network failures. This chapter provides an introduction to gossip-based broadcast on large-scale unstructured peer-to-peer overlay networks: it surveys the main results in the field, discusses techniques to build and maintain the overlays that support efficient dissemination strategies, and provides an in-depth discussion and experimental evaluation of two concrete protocols, named HyParView and Plumtree.

  15. Sensory bases of navigation.

    Science.gov (United States)

    Gould, J L

    1998-10-08

    Navigating animals need to know both the bearing of their goal (the 'map' step), and how to determine that direction (the 'compass' step). Compasses are typically arranged in hierarchies, with magnetic backup as a last resort when celestial information is unavailable. Magnetic information is often essential to calibrating celestial cues, though, and repeated recalibration between celestial and magnetic compasses is important in many species. Most magnetic compasses are based on magnetite crystals, but others make use of induction or paramagnetic interactions between short-wavelength light and visual pigments. Though odors may be used in some cases, most if not all long-range maps probably depend on magnetite. Magnetitebased map senses are used to measure only latitude in some species, but provide the distance and direction of the goal in others.

  16. Graphene based biosensors

    Energy Technology Data Exchange (ETDEWEB)

    Gürel, Hikmet Hakan, E-mail: hhakan.gurel@kocaeli.edu.tr [Kocaeli University, Kocaeli (Turkey); Salmankurt, Bahadır [Sakarya University, Sakarya (Turkey)

    2016-03-25

    Nanometer-sized graphene as a 2D material has unique chemical and electronic properties. Because of its unique physical, chemical, and electronic properties, its interesting shape and size make it a promising nanomaterial in many biological applications. It is expected that biomaterials incorporating graphene will be developed for the graphene-based drug delivery systems and biomedical devices. The interactions of biomolecules and graphene are long-ranged and very weak. Development of new techniques is very desirable for design of bioelectronics sensors and devices. In this work, we present first-principles calculations within density functional theory to calculate effects of charging on nucleobases on graphene. It is shown that how modify structural and electronic properties of nucleobases on graphene by applied charging.

  17. Integrated data base program

    International Nuclear Information System (INIS)

    Notz, K.J.

    1981-01-01

    The IDB Program provides direct support to the DOE Nuclear Waste Management and Fuel Cycle Programs and their lead sites and support contractors by providing and maintaining a current, integrated data base of spent fuel and radioactive waste inventories and projections. All major waste types (HLW, TRU, and LLW) and sources (government, commerical fuel cycle, and I/I) are included. A major data compilation was issued in September, 1981: Spent Fuel and Radioactive Waste Inventories and Projections as of December 31, 1980, DOE/NE-0017. This report includes chapters on Spent Fuel, HLW, TRU Waste, LLW, Remedial Action Waste, Active Uranium Mill Tailings, and Airborne Waste, plus Appendices with more detailed data in selected areas such as isotopics, radioactivity, thermal power, projections, and land usage. The LLW sections include volumes, radioactivity, thermal power, current inventories, projected inventories and characteristics, source terms, land requirements, and a breakdown in terms of government/commercial and defense/fuel cycle/I and I

  18. Nickel base alloys

    International Nuclear Information System (INIS)

    Gibson, R.C.; Korenko, M.K.

    1980-01-01

    Nickel based alloy, the characteristic of which is that it mainly includes in percentages by weight: 57-63 Ni, 7-18 Cr, 10-20 Fe, 4-6 Mo, 1-2 Nb, 0.2-0.8 Si, 0.01-0.05 Zr, 1.0-2.5 Ti, 1.0-2.5 Al, 0.02-0.06 C and 0.002-0.015 B. The aim is to create new nickel-chromium alloys, hardened in a solid solution and by precipitation, that are stable, exhibit reduced swelling and resistant to plastic deformation inside the reactor. These alloys of the gamma prime type have improved mechanical strengthm swelling resistance, structural stability and welding properties compared with Inconel 625 [fr

  19. Rate based failure detection

    Science.gov (United States)

    Johnson, Brett Emery Trabun; Gamage, Thoshitha Thanushka; Bakken, David Edward

    2018-01-02

    This disclosure describes, in part, a system management component and failure detection component for use in a power grid data network to identify anomalies within the network and systematically adjust the quality of service of data published by publishers and subscribed to by subscribers within the network. In one implementation, subscribers may identify a desired data rate, a minimum acceptable data rate, desired latency, minimum acceptable latency and a priority for each subscription. The failure detection component may identify an anomaly within the network and a source of the anomaly. Based on the identified anomaly, data rates and or data paths may be adjusted in real-time to ensure that the power grid data network does not become overloaded and/or fail.

  20. Behavior based safety

    International Nuclear Information System (INIS)

    Sudhikumaran, T.V.; Mehta, S.C.; Goyal, D.K.

    2009-01-01

    Behaviour Based Safety (popularly known as BBS) is a new methodology for achieving injury free work place and total Safety Culture. BBS is successfully being implemented and is being practiced as a work methodology for achieving a loss and injury free work environment and work practice. Through BBS, it was brought out that the root causes of all Industrial accidents some how originate from the 'at risk' behaviour of some individual or group of individuals at some level. The policy of NPCIL is to excel in the field of Industrial and Fire Safety in comparison to international standards. This article indents to bring out the various parameters helping in installing BBS programme at any plant. (author)

  1. Fuel cycle based safeguards

    International Nuclear Information System (INIS)

    De Montmollin, J.M.; Higinbotham, W.A.; Gupta, D.

    1985-07-01

    In NPT safeguards the same model approach and absolute-quantity inspection goals are applied at present to all similar facilities, irrespective of the State's fuel cycle. There is a continuing interest and activity on the part of the IAEA in new NPT safeguards approaches that more directly address a State's nuclear activities as a whole. This fuel cycle based safeguards system is expected to a) provide a statement of findings for the entire State rather than only for individual facilities; b) allocate inspection efforts so as to reflect more realistically the different categories of nuclear materials in the different parts of the fuel cycle and c) provide more timely and better coordinated information on the inputs, outputs and inventories of nuclear materials in a State. (orig./RF) [de

  2. Bases para proyectiles dirigidos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1959-03-01

    Full Text Available Aunque actualmente no se ha llegado a una línea general de métodos o sistemas que gobiernen un tipo característico de rampa y servicios auxiliares necesarios para el lanzamiento al espacio de proyectiles dirigidos a grandes alturas y distancias, las experiencias obtenidas en diferentes ensayos, utilizando distintos tipos de proyectiles y trayectorias balísticas, han sentado toda una serie de procedimientos, datos y conclusiones de gran valor balístico que, aun teniendo en cuenta la continua evolución del proyectil, sus formas, combustibles y alcances, se conocen ya, con bastante aproximación, las condiciones mínimas que ha de reunir una base dedicada a este tipo de lanzamientos.

  3. Situation based housing

    DEFF Research Database (Denmark)

    Duelund Mortensen, Peder; Welling, Helen; Wiell Nordberg, Lene

    2007-01-01

    of the average family's lifestyle. These dwellings were ground-breaking when they were built, but today are clearly a product of their time. The reaction to functionalism and the postwar mass production gave rise to flexible dwelling with countless possibilities for room division. The housing of this period has...... characteristics which in the long run have proven to be unfortunate both in terms in terms of durability and architectural quality. Today there is a focus on the development of more open and functionally non-determined housing. A number of new housing schemes in and around Copenhagen reveal a variety...... of approaches to these goals. This working paper reviews not only a selection of new housing types, but also dwellings from the past, which each contain an aspect of changeability. Our study is based on information from users in the selected housing schemes, gathered from questionnaires, information about...

  4. Liaison based assembly design

    Energy Technology Data Exchange (ETDEWEB)

    Ames, A.; Kholwadwala, D.; Wilson, R.H.

    1996-12-01

    Liaison Based Assembly Design extends the current information infrastructure to support design in terms of kinematic relationships between parts, or liaisons. These liaisons capture information regarding contact, degrees-of-freedom constraints and containment relationships between parts in an assembly. The project involved defining a useful collection of liaison representations, investigating their properties, and providing for maximum use of the data in downstream applications. We tested our ideas by implementing a prototype system involving extensions to Pro/Engineer and the Archimedes assembly planner. With an expanded product model, the design system is more able to capture design intent. When a product update is attempted, increased knowledge availability improves our ability to understand the effect of design changes. Manufacturing and analysis disciplines benefit from having liaison information available, so less time is wasted arguing over incomplete design specifications and our enterprise can be more completely integrated.

  5. Touching base with OPERA

    CERN Multimedia

    CERN Bulletin

    2011-01-01

    Three seminars – at CERN, at Gran Sasso and in Japan – and an article calling for the scrutiny of the scientific community: the OPERA Collaboration opened its research publicly. In addition to huge press coverage, this triggered welcome reactions from colleagues around the world, many of whom will attempt to independently interpret and reproduce the measurement. OPERA’s Spokesperson touches base with the Bulletin.   The CERN Main Auditorium was crowded as OPERA Physics co-ordinator Dario Autiero presented the results of their research (23 September 2011). According to the OPERA strategy, the results of the measurements are in the hands of the scientific community and, as for any other scientific result, several months will be needed before other groups will be able to perform an independent measurement. In the meantime, the OPERA Collaboration is dealing with an avalanche of emails from the scientific community, members of the general public, and the press. &...

  6. Pathway-based analyses.

    Science.gov (United States)

    Kent, Jack W

    2016-02-03

    New technologies for acquisition of genomic data, while offering unprecedented opportunities for genetic discovery, also impose severe burdens of interpretation and penalties for multiple testing. The Pathway-based Analyses Group of the Genetic Analysis Workshop 19 (GAW19) sought reduction of multiple-testing burden through various approaches to aggregation of highdimensional data in pathways informed by prior biological knowledge. Experimental methods testedincluded the use of "synthetic pathways" (random sets of genes) to estimate power and false-positive error rate of methods applied to simulated data; data reduction via independent components analysis, single-nucleotide polymorphism (SNP)-SNP interaction, and use of gene sets to estimate genetic similarity; and general assessment of the efficacy of prior biological knowledge to reduce the dimensionality of complex genomic data. The work of this group explored several promising approaches to managing high-dimensional data, with the caveat that these methods are necessarily constrained by the quality of external bioinformatic annotation.

  7. Refractive index based measurements

    DEFF Research Database (Denmark)

    2014-01-01

    A refractive index based measurement of a property of a fluid is measured in an apparatus comprising a variable wavelength coherent light source (16), a sample chamber (12), a wavelength controller (24), a light sensor (20), a data recorder (26) and a computation apparatus (28), by - directing...... coherent light having a wavelength along an input light path, - producing scattering of said light from each of a plurality of interfaces within said apparatus including interfaces between said fluid and a surface bounding said fluid, said scattering producing an interference pattern formed by said...... scattered light, - cyclically varying the wavelength of said light in said input light path over a 1 nm to 20nm wide range of wavelengths a rate of from 10Hz to 50 KHz, - recording variation of intensity of the interfering light with change in wavelength of the light at an angle of observation...

  8. Transaction based approach

    Science.gov (United States)

    Hunka, Frantisek; Matula, Jiri

    2017-07-01

    Transaction based approach is utilized in some methodologies in business process modeling. Essential parts of these transactions are human beings. The notion of agent or actor role is usually used for them. The paper on a particular example describes possibilities of Design Engineering Methodology for Organizations (DEMO) and Resource-Event-Agent (REA) methodology. Whereas the DEMO methodology can be regarded as a generic methodology having its foundation in the theory of Enterprise Ontology the REA methodology is regarded as the domain specific methodology and has its origin in accountancy systems. The results of these approaches is that the DEMO methodology captures everything that happens in the reality with a good empirical evidence whereas the REA methodology captures only changes connected with economic events. Economic events represent either change of the property rights to economic resource or consumption or production of economic resources. This results from the essence of economic events and their connection to economic resources.

  9. Pitch Based Sound Classification

    DEFF Research Database (Denmark)

    Nielsen, Andreas Brinch; Hansen, Lars Kai; Kjems, U

    2006-01-01

    A sound classification model is presented that can classify signals into music, noise and speech. The model extracts the pitch of the signal using the harmonic product spectrum. Based on the pitch estimate and a pitch error measure, features are created and used in a probabilistic model with soft......-max output function. Both linear and quadratic inputs are used. The model is trained on 2 hours of sound and tested on publicly available data. A test classification error below 0.05 with 1 s classification windows is achieved. Further more it is shown that linear input performs as well as a quadratic......, and that even though classification gets marginally better, not much is achieved by increasing the window size beyond 1 s....

  10. Telephone-Based Coaching.

    Science.gov (United States)

    Boccio, Mindy; Sanna, Rashel S; Adams, Sara R; Goler, Nancy C; Brown, Susan D; Neugebauer, Romain S; Ferrara, Assiamira; Wiley, Deanne M; Bellamy, David J; Schmittdiel, Julie A

    2017-03-01

    Many Americans continue to smoke, increasing their risk of disease and premature death. Both telephone-based counseling and in-person tobacco cessation classes may improve access for smokers seeking convenient support to quit. Little research has assessed whether such programs are effective in real-world clinical populations. Retrospective cohort study comparing wellness coaching participants with two groups of controls. Kaiser Permanente Northern California, a large integrated health care delivery system. Two hundred forty-one patients who participated in telephonic tobacco cessation coaching from January 1, 2011, to March 31, 2012, and two control groups: propensity-score-matched controls, and controls who participated in a tobacco cessation class during the same period. Wellness coaching participants received an average of two motivational interviewing-based coaching sessions that engaged the patient, evoked their reason to consider quitting, and helped them establish a quit plan. Self-reported quitting of tobacco and fills of tobacco cessation medications within 12 months of follow-up. Logistic regressions adjusting for age, gender, race/ethnicity, and primary language. After adjusting for confounders, tobacco quit rates were higher among coaching participants vs. matched controls (31% vs. 23%, p Coaching participants and class attendees filled tobacco-cessation prescriptions at a higher rate (47% for both) than matched controls (6%, p coaching was as effective as in-person classes and was associated with higher rates of quitting compared to no treatment. The telephonic modality may increase convenience and scalability for health care systems looking to reduce tobacco use and improve health.

  11. Model Based Temporal Reasoning

    Science.gov (United States)

    Rabin, Marla J.; Spinrad, Paul R.; Fall, Thomas C.

    1988-03-01

    Systems that assess the real world must cope with evidence that is uncertain, ambiguous, and spread over time. Typically, the most important function of an assessment system is to identify when activities are occurring that are unusual or unanticipated. Model based temporal reasoning addresses both of these requirements. The differences among temporal reasoning schemes lies in the methods used to avoid computational intractability. If we had n pieces of data and we wanted to examine how they were related, the worst case would be where we had to examine every subset of these points to see if that subset satisfied the relations. This would be 2n, which is intractable. Models compress this; if several data points are all compatible with a model, then that model represents all those data points. Data points are then considered related if they lie within the same model or if they lie in models that are related. Models thus address the intractability problem. They also address the problem of determining unusual activities if the data do not agree with models that are indicated by earlier data then something out of the norm is taking place. The models can summarize what we know up to that time, so when they are not predicting correctly, either something unusual is happening or we need to revise our models. The model based reasoner developed at Advanced Decision Systems is thus both intuitive and powerful. It is currently being used on one operational system and several prototype systems. It has enough power to be used in domains spanning the spectrum from manufacturing engineering and project management to low-intensity conflict and strategic assessment.

  12. Mainstreaming gesture based interfaces

    Directory of Open Access Journals (Sweden)

    David Procházka

    2013-01-01

    Full Text Available Gestures are a common way of interaction with mobile devices. They emerged especially with the iPhone production. Gestures in currently used devices are usually based on the original gestures presented by Apple in its iOS (iPhone Operating System. Therefore, there is a wide agreement on the mobile gesture design. In last years, it is possible to see experiments with gesture usage also in the other areas of consumer electronics and computers. The examples can include televisions, large projections etc. These gestures can be marked as spatial or 3D gestures. They are connected with a natural 3D environment rather than with a flat 2D screen. Nevertheless, it is hard to find a comparable design agreement within the spatial gestures. Various projects are based on completely different gesture sets. This situation is confusing for their users and slows down spatial gesture adoption.This paper is focused on the standardization of spatial gestures. The review of projects focused on spatial gesture usage is provided in the first part. The main emphasis is placed on the usability point-of-view. On the basis of our analysis, we argue that the usability is the key issue enabling the wide adoption. The mobile gesture emergence was possible easily because the iPhone gestures were natural. Therefore, it was not necessary to learn them.The design and implementation of our presentation software, which is controlled by gestures, is outlined in the second part of the paper. Furthermore, the usability testing results are provided as well. We have tested our application on a group of users not instructed in the implemented gestures design. These results were compared with the other ones, obtained with our original implementation. The evaluation can be used as the basis for implementation of similar projects.

  13. DNA-based machines.

    Science.gov (United States)

    Wang, Fuan; Willner, Bilha; Willner, Itamar

    2014-01-01

    The base sequence in nucleic acids encodes substantial structural and functional information into the biopolymer. This encoded information provides the basis for the tailoring and assembly of DNA machines. A DNA machine is defined as a molecular device that exhibits the following fundamental features. (1) It performs a fuel-driven mechanical process that mimics macroscopic machines. (2) The mechanical process requires an energy input, "fuel." (3) The mechanical operation is accompanied by an energy consumption process that leads to "waste products." (4) The cyclic operation of the DNA devices, involves the use of "fuel" and "anti-fuel" ingredients. A variety of DNA-based machines are described, including the construction of "tweezers," "walkers," "robots," "cranes," "transporters," "springs," "gears," and interlocked cyclic DNA structures acting as reconfigurable catenanes, rotaxanes, and rotors. Different "fuels", such as nucleic acid strands, pH (H⁺/OH⁻), metal ions, and light, are used to trigger the mechanical functions of the DNA devices. The operation of the devices in solution and on surfaces is described, and a variety of optical, electrical, and photoelectrochemical methods to follow the operations of the DNA machines are presented. We further address the possible applications of DNA machines and the future perspectives of molecular DNA devices. These include the application of DNA machines as functional structures for the construction of logic gates and computing, for the programmed organization of metallic nanoparticle structures and the control of plasmonic properties, and for controlling chemical transformations by DNA machines. We further discuss the future applications of DNA machines for intracellular sensing, controlling intracellular metabolic pathways, and the use of the functional nanostructures for drug delivery and medical applications.

  14. Base Research Program

    Energy Technology Data Exchange (ETDEWEB)

    Everett Sondreal; John Hendrikson

    2009-03-31

    In June 2009, the Energy & Environmental Research Center (EERC) completed 11 years of research under the U.S. Department of Energy (DOE) Base Cooperative Agreement No. DE-FC26-98FT40320 funded through the Office of Fossil Energy (OFE) and administered at the National Energy Technology Laboratory (NETL). A wide range of diverse research activities were performed under annual program plans approved by NETL in seven major task areas: (1) resource characterization and waste management, (2) air quality assessment and control, (3) advanced power systems, (4) advanced fuel forms, (5) value-added coproducts, (6) advanced materials, and (7) strategic studies. This report summarizes results of the 67 research subtasks and an additional 50 strategic studies. Selected highlights in the executive summary illustrate the contribution of the research to the energy industry in areas not adequately addressed by the private sector alone. During the period of performance of the agreement, concerns have mounted over the impact of carbon emissions on climate change, and new programs have been initiated by DOE to ensure that fossil fuel resources along with renewable resources can continue to supply the nation's transportation fuel and electric power. The agreement has addressed DOE goals for reductions in CO{sub 2} emissions through efficiency, capture, and sequestration while expanding the supply and use of domestic energy resources for energy security. It has further contributed to goals for near-zero emissions from highly efficient coal-fired power plants; environmental control capabilities for SO{sub 2}, NO{sub x}, fine respirable particulate (PM{sub 2.5}), and mercury; alternative transportation fuels including liquid synfuels and hydrogen; and synergistic integration of fossil and renewable resources (e.g., wind-, biomass-, and coal-based electrical generation).

  15. The office based CHIVA

    Directory of Open Access Journals (Sweden)

    Passariello F

    2013-09-01

    Full Text Available Fausto Passariello,1 Stefano Ermini,2 Massimo Cappelli,3 Roberto Delfrate,4 Claude Franceschi5 1Centro Diagnostico Aquarius, Napoli, Italy; 2Private Practice, Grassina, Italy; 3Private Practice, Firenze, Italy; 4Casa di Cure Figlie di Maria, Cremona, Italy; 5Hospital St Joseph, Service d'Explorations Vasculaires, Paris, France Abstract: The cure Conservatrice Hémodynamique de l'Insuffisance Veineuse en Ambulatoire (CHIVA can be office based (OB. The OB-CHIVA protocol is aimed at transferring CHIVA procedures to specialists rooms. The protocol will check the feasibility of OB-CHIVA, data pertaining to recurrence, and will offer the opportunity to study saphenous femoral junction (SFJ stump evolution, the role of the washing vessels and the arch recanalization rate, and gather new data about the effect of the length of the treated saphenous vein. A simplified diagnostic procedure will allow an essential ultrasound examination of the venous net while a schematic and easily readable algorithm guides therapeutic choices. The Riobamba draining crossotomy (RDC tactic is composed of a set of OB procedures. While some of these procedures are, at the moment, only proposals, others are already applied. Devices generally used in ablative procedures such as Light Amplification by Stimulated Emission of Radiation (LASER, radio frequency, steam, and mechanical devices are used in this context to serve to conservative interventions for CHIVA. New techniques have also been proposed for devalvulation and tributary disconnection. Detailed follow-up is necessary in order to determine the effects of therapy and possible disease evolution. Finally, information is added about the informed consent and the ethical considerations of OB-CHIVA research. Keywords: CHIVA, office based procedures, LASER, RF, steam

  16. Organic Biochar Based Fertilization

    Science.gov (United States)

    Schmidt, Hans-Peter; Pandit, Bishnu Hari; Cornelissen, Gerard; Kammann, Claudia

    2017-04-01

    Biochar produced in cost-efficient flame curtain kilns (Kon-Tiki) was nutrient enriched either with cow urine or with dissolved mineral (NPK) fertilizer to produce biochar-based fertilizers containing between 60-100 kg N, 5-60 kg P2O5 and 60-100 kg K2O, respectively, per ton of biochar. In 21 field trials nutrient-enriched biochars were applied at rates of 0.5 to 2 t ha-1 into the root zone of 13 different annual and perennial crops. Treatments combining biochar, compost and organic or chemical fertilizer were evaluated; control treatments contained the same amounts of nutrients but without biochar. All nutrient-enriched biochar substrates improved yields compared to their respective no-biochar controls. Biochar enriched with dissolved NPK produced on average 20% ± 5.1% (N=4) higher yields than standard NPK fertilization without biochar. Cow urine-enriched biochar blended with compost resulted on average in 123% ± 76.7% (N=13) higher yields compared to the organic farmer practice with cow urine-blended compost and outcompeted NPK-enriched biochar (same nutrient dose) by 103% ± 12.4% (N=4) on average. 21 field trials robustly revealed that low-dosage root zone application of organic biochar-based fertilizers caused substantial yield increases in rather fertile silt loam soils compared to traditional organic fertilization and to mineral NPK- or NPK-biochar fertilization. This can likely be explained by the nutrient carrier effect of biochar causing a slow nutrient release behavior, more balanced nutrient fluxes and reduced nutrient losses especially when liquid organic nutrients are used for the biochar enrichment. The results promise new pathways for optimizing organic farming and improving on-farm nutrient cycling.

  17. Loyalty-based management.

    Science.gov (United States)

    Reichheld, F F

    1993-01-01

    Despite a flurry of activities aimed at serving customers better, few companies have systematically revamped their operations with customer loyalty in mind. Instead, most have adopted improvement programs ad hoc, and paybacks haven't materialized. Building a highly loyal customer base must be integral to a company's basic business strategy. Loyalty leaders like MBNA credit cards are successful because they have designed their entire business systems around customer loyalty--a self-reinforcing system in which the company delivers superior value consistently and reinvents cash flows to find and keep high-quality customers and employees. The economic benefits of high customer loyalty are measurable. When a company consistently delivers superior value and wins customer loyalty, market share and revenues go up, and the cost of acquiring new customers goes down. The better economics mean the company can pay workers better, which sets off a whole chain of events. Increased pay boosts employee moral and commitment; as employees stay longer, their productivity goes up and training costs fall; employees' overall job satisfaction, combined with their experience, helps them serve customers better; and customers are then more inclined to stay loyal to the company. Finally, as the best customers and employees become part of the loyalty-based system, competitors are left to survive with less desirable customers and less talented employees. To compete on loyalty, a company must understand the relationships between customer retention and the other parts of the business--and be able to quantify the linkages between loyalty and profits. It involves rethinking and aligning four important aspects of the business: customers, product/service offering, employees, and measurement systems.

  18. Foundry based approach for InP based PIC development

    NARCIS (Netherlands)

    Smit, M.K.

    2014-01-01

    Europe is making significant investments in development of generic photonic foundry platform infrastructures for InP-based and Silicon Photonic ICs. Here we present the present status for the InP-based JePPIX platform.

  19. Introducing short term flexibility in the EU ETS to assure its long-term credibility: a multi-criteria analysis of policy options. Climate Report no. 45

    International Nuclear Information System (INIS)

    Desai, Zuheir; Alberola, Emilie; Berghmans, Nicolas

    2014-07-01

    It is now well established that the European Union Emissions Trading Scheme (EU ETS) needs to be reformed. After more than 18 months of discussions, the EU Commission disclosed, in its communication published in January 2014 on 'A policy framework for climate and energy in the period from 2020 to 2030', its legislative proposal of a market stability reserve (MSR) in the EU ETS. This measure, that should be implemented from the next compliance period (2021-2028) onwards, would reduce the surplus of allowances growing since 2008 and improve the ETS's resilience to external shocks by automatically adjusting the supply of allowances to be auctioned. The operation of this MSR would be determined by predefined rules that, once agreed on, leave no discretion to either the Commission or Member States. The choice of the EU Commission to introduce a reserve in the EU ETS is very innovative even if other emissions trading schemes have already introduced a reserve in their design. Initial discussions began in March and April 2014 in the European Parliament and Council and the question of whether the MSR really improves the functioning of the EU ETS in the long term is still being debated. What other structural mechanism would be better suited in improving the long-term effectiveness of the EU ETS? To help in the decision making process, this report presents a multi-criteria analysis. Without prejudging their political support, five policy options have been evaluated that would introduce some flexibility in the EU ETS and potentially ensure its long-term credibility: an auction reserve price, permit supply rules that target a certain corridor of surplus (market stability reserve), permit supply rules that target economic activity, permit supply rules that target overlap with other energy policies and a rolling emissions cap. The assessment of these five policy options was based on a criteria tree and on the EU ETS experts' panel's votes that expressed

  20. NMR studies concerning base-base interactions in oligonucleotides

    International Nuclear Information System (INIS)

    Hoogen, Y.T. van den.

    1988-01-01

    Two main subjects are treated in the present thesis. The firsst part principally deals with the base-base interactions in single-stranded oligoribonucleotides. The second part presents NMR and model-building studies of DNA and RNA duplexes containing an unpaired base. (author). 242 refs.; 26 figs.; 24 tabs

  1. Computer-based multi-channel analyzer based on internet

    International Nuclear Information System (INIS)

    Zhou Xinzhi; Ning Jiaoxian

    2001-01-01

    Combined the technology of Internet with computer-based multi-channel analyzer, a new kind of computer-based multi-channel analyzer system which is based on browser is presented. Its framework and principle as well as its implementation are discussed

  2. Base Camp Architecture

    Directory of Open Access Journals (Sweden)

    Warebi Gabriel Brisibe

    2016-03-01

    Full Text Available Longitudinal or time line studies of change in the architecture of a particular culture are common, but an area still open to further research is change across space or place. In particular, there is need for studies on architectural change of cultures stemming from the same ethnic source split between their homeland and other Diasporas. This change may range from minor deviations to drastic shifts away from an architectural norm and the accumulation of these shifts within a time frame constitutes variations. This article focuses on identifying variations in the architecture of the Ijo fishing group that migrates along the coastline of West Africa. It examines the causes of cross-cultural variation between base camp dwellings of Ijo migrant fishermen in the Bakassi Peninsula in Cameroon and Bayelsa State in Nigeria. The study draws on the idea of the inevitability of cultural and social change over time as proposed in the theories of cultural dynamism and evolution. It tests aspects of cultural transmission theory using the principal coordinates analysis to ascertain the possible causes of variation. From the findings, this research argues that migration has enhanced the forces of cultural dynamism, which have resulted in significant variations in the architecture of this fishing group.

  3. Evidence-based management.

    Science.gov (United States)

    Pfeffer, Jeffrey; Sutton, Robert I

    2006-01-01

    For the most part, managers looking to cure their organizational ills rely on obsolete knowledge they picked up in school, long-standing but never proven traditions, patterns gleaned from experience, methods they happen to be skilled in applying, and information from vendors. They could learn a thing or two from practitioners of evidence-based medicine, a movement that has taken the medical establishment by storm over the past decade. A growing number of physicians are eschewing the usual, flawed resources and are instead identifying, disseminating, and applying research that is soundly conducted and clinically relevant. It's time for managers to do the same. The challenge is, quite simply, to ground decisions in the latest and best knowledge of what actually works. In some ways, that's more difficult to do in business than in medicine. The evidence is weaker in business; almost anyone can (and many people do) claim to be a management expert; and a motley crew of sources--Shakespeare, Billy Graham,Jack Welch, Attila the Hunare used to generate management advice. Still, it makes sense that when managers act on better logic and strong evidence, their companies will beat the competition. Like medicine, management is learned through practice and experience. Yet managers (like doctors) can practice their craft more effectively if they relentlessly seek new knowledge and insight, from both inside and outside their companies, so they can keep updating their assumptions, skills, and knowledge.

  4. Skull base tumors

    International Nuclear Information System (INIS)

    Kikinis, R.; Matsumae, M.; Jolesz, F.A.; Black, P.M.; Cline, H.E.; Lorenson, W.E.

    1991-01-01

    This paper reports on an image processing procedure for the planning of surgery of skull base tumors that can extract bone, vessels, tumor, and brain parenchyma and that permits resolution of cranial nerves. Three-dimensional (3D) reconstructions were generated from double-echo long TR interleaved conventional spin-echo and fast-spin-echo MR imaging data. Sixteen cases have been analyzed preoperatively. Image processing consisted of a multistep procedure combining a supervised multivariate analysis with neighborhood operations such as connectivity and erosion/dilation. 3D renderings of anatomic structures of interest were then generated. Cases were evaluated preoperatively and manipulated interactively with the computer-generated images by a team consisting of neuroradiologists, neurosurgeons, and craniofacial surgeons. The preparation of 3D reconstructions required only a few hours and was performed mostly by a research assistant. The preoperative analysis of the 3D reconstructions was found to be a valuable tool, providing information complementing the surgeon's understanding of a case as derived from conventional imaging. The interactive manipulation of data proved to be a powerful way to evaluate alternative surgical approaches

  5. Constraint-based scheduling

    Science.gov (United States)

    Zweben, Monte

    1993-01-01

    The GERRY scheduling system developed by NASA Ames with assistance from the Lockheed Space Operations Company, and the Lockheed Artificial Intelligence Center, uses a method called constraint-based iterative repair. Using this technique, one encodes both hard rules and preference criteria into data structures called constraints. GERRY repeatedly attempts to improve schedules by seeking repairs for violated constraints. The system provides a general scheduling framework which is being tested on two NASA applications. The larger of the two is the Space Shuttle Ground Processing problem which entails the scheduling of all the inspection, repair, and maintenance tasks required to prepare the orbiter for flight. The other application involves power allocation for the NASA Ames wind tunnels. Here the system will be used to schedule wind tunnel tests with the goal of minimizing power costs. In this paper, we describe the GERRY system and its application to the Space Shuttle problem. We also speculate as to how the system would be used for manufacturing, transportation, and military problems.

  6. Refractory metal based superalloys

    International Nuclear Information System (INIS)

    Alonso, Paula R.; Vicente, Eduardo E.; Rubiolo, Gerardo H.

    1999-01-01

    Refractory metals are looked as promising materials for primary circuits in fission reactors and even as fusion reactor components. Indeed, superalloys could be developed which take advantage of their high temperature properties together with the benefits of a two- phase (intermetallic compound-refractory metal matrix) coherent structure. In 1993, researchers of the Office National d'Etudes et de Recherches Aerospatiales of France reported the observation of such a coherent structure in the Ta-Ti-Zr-Al-Nb-Mo system although the exact composition is not reported. The intermetallic compound would be Ti 2 AlMo based. However, the formation of this compound and its possible coexistence with a disordered bcc phase in the ternary system Ti-Al-Mo is a controversial subject in the related literature. In this work we develop a technique to obtain homogeneous alloys samples with 50 Ti-25 Al-25 Mo composition. The resulting specimens were characterized by optical and electronic metallography (SEM), microprobe composition measurements (EPMA) and X-ray diffraction (XRD) analyses. The results show the evidence for a bcc (A2→B2) ordering reaction in the Ti-Al-Mo system in the 50 Ti-25 Al-25 Mo composition. (author)

  7. Fluorescence lifetime based bioassays

    Science.gov (United States)

    Meyer-Almes, Franz-Josef

    2017-12-01

    Fluorescence lifetime (FLT) is a robust intrinsic property and material constant of fluorescent matter. Measuring this important physical indicator has evolved from a laboratory curiosity to a powerful and established technique for a variety of applications in drug discovery, medical diagnostics and basic biological research. This distinct trend was mainly driven by improved and meanwhile affordable laser and detection instrumentation on the one hand, and the development of suitable FLT probes and biological assays on the other. In this process two essential working approaches emerged. The first one is primarily focused on high throughput applications employing biochemical in vitro assays with no requirement for high spatial resolution. The second even more dynamic trend is the significant expansion of assay methods combining highly time and spatially resolved fluorescence data by fluorescence lifetime imaging. The latter approach is currently pursued to enable not only the investigation of immortal tumor cell lines, but also specific tissues or even organs in living animals. This review tries to give an actual overview about the current status of FLT based bioassays and the wide range of application opportunities in biomedical and life science areas. In addition, future trends of FLT technologies will be discussed.

  8. Carbon nanotube based photocathodes

    International Nuclear Information System (INIS)

    Hudanski, Ludovic; Minoux, Eric; Schnell, Jean-Philippe; Xavier, Stephane; Pribat, Didier; Legagneux, Pierre; Gangloff, Laurent; Teo, Kenneth B K; Robertson, John; Milne, William I

    2008-01-01

    This paper describes a novel photocathode which is an array of vertically aligned multi-walled carbon nanotubes (MWCNTs), each MWCNT being associated with one p-i-n photodiode. Unlike conventional photocathodes, the functions of photon-electron conversion and subsequent electron emission are physically separated. Photon-electron conversion is achieved with p-i-n photodiodes and the electron emission occurs from the MWCNTs. The current modulation is highly efficient as it uses an optically controlled reconfiguration of the electric field at the MWCNT locations. Such devices are compatible with high frequency and very large bandwidth operation and could lead to their application in compact, light and efficient microwave amplifiers for satellite telecommunication. To demonstrate this new photocathode concept, we have fabricated the first carbon nanotube based photocathode using silicon p-i-n photodiodes and MWCNT bunches. Using a green laser, this photocathode delivers 0.5 mA with an internal quantum efficiency of 10% and an I ON /I OFF ratio of 30

  9. Based on Channel Characteristics

    Directory of Open Access Journals (Sweden)

    Zhuo Hao

    2013-01-01

    Full Text Available A number of key agreement schemes based on wireless channel characteristics have been proposed recently. However, previous key agreement schemes require that two nodes which need to agree on a key are within the communication range of each other. Hence, they are not suitable for multihop wireless networks, in which nodes do not always have direct connections with each other. In this paper, we first propose a basic multihop key agreement scheme for wireless ad hoc networks. The proposed basic scheme is resistant to external eavesdroppers. Nevertheless, this basic scheme is not secure when there exist internal eavesdroppers or Man-in-the-Middle (MITM adversaries. In order to cope with these adversaries, we propose an improved multihop key agreement scheme. We show that the improved scheme is secure against internal eavesdroppers and MITM adversaries in a single path. Both performance analysis and simulation results demonstrate that the improved scheme is efficient. Consequently, the improved key agreement scheme is suitable for multihop wireless ad hoc networks.

  10. Biosensors based on cantilevers.

    Science.gov (United States)

    Alvarez, Mar; Carrascosa, Laura G; Zinoviev, Kiril; Plaza, Jose A; Lechuga, Laura M

    2009-01-01

    Microcantilevers based-biosensors are a new label-free technique that allows the direct detection of biomolecular interactions in a label-less way and with great accuracy by translating the biointeraction into a nanomechanical motion. Low cost and reliable standard silicon technologies are widely used for the fabrication of cantilevers with well-controlled mechanical properties. Over the last years, the number of applications of these sensors has shown a fast growth in diverse fields, such as genomic or proteomic, because of the biosensor flexibility, the low sample consumption, and the non-pretreated samples required. In this chapter, we report a dedicated design and a fabrication process of highly sensitive microcantilever silicon sensors. We will describe as well an application of the device in the environmental field showing the immunodetection of an organic toxic pesticide as an example. The cantilever biofunctionalization process and the subsequent pesticide determination are detected in real time by monitoring the nanometer-scale bending of the microcantilever due to a differential surface stress generated between both surfaces of the device.

  11. Flow-Based Provenance

    Directory of Open Access Journals (Sweden)

    Sabah Al-Fedaghi

    2017-02-01

    Full Text Available Aim/Purpose: With information almost effortlessly created and spontaneously available, current progress in Information and Communication Technology (ICT has led to the complication that information must be scrutinized for trustworthiness and provenance. Information systems must become provenance-aware to be satisfactory in accountability, reproducibility, and trustworthiness of data. Background:\tMultiple models for abstract representation of provenance have been proposed to describe entities, people, and activities involved in producing a piece of data, including the Open Provenance Model (OPM and the World Wide Web Consortium. These models lack certain concepts necessary for specifying workflows and encoding the provenance of data products used and generated. Methodology: Without loss of generality, the focus of this paper is on OPM depiction of provenance in terms of a directed graph. We have redrawn several case studies in the framework of our proposed model in order to compare and evaluate it against OPM for representing these cases. Contribution: This paper offers an alternative flow-based diagrammatic language that can form a foundation for modeling of provenance. The model described here provides an (abstract machine-like representation of provenance. Findings: The results suggest a viable alternative in the area of diagrammatic representation for provenance applications. Future Research: Future work will seek to achieve more accurate comparisons with current models in the field.

  12. Communication Base Station Log Analysis Based on Hierarchical Clustering

    Directory of Open Access Journals (Sweden)

    Zhang Shao-Hua

    2017-01-01

    Full Text Available Communication base stations generate massive data every day, these base station logs play an important value in mining of the business circles. This paper use data mining technology and hierarchical clustering algorithm to group the scope of business circle for the base station by recording the data of these base stations.Through analyzing the data of different business circle based on feature extraction and comparing different business circle category characteristics, which can choose a suitable area for operators of commercial marketing.

  13. Mindfulness-Based Stress Reduction

    Science.gov (United States)

    ... R S T U V W X Y Z Mindfulness-Based Stress Reduction (MBSR) Information 6 Things You ... Disease and Dementia (12/20/13) Research Spotlights Mindfulness-Based Stress Reduction, Cognitive-Behavioral Therapy Shown To ...

  14. Risk-based configuration control

    International Nuclear Information System (INIS)

    Szikszai, T.

    1997-01-01

    The presentation discusses the following issues: The Configuration Control; The Risk-based Configuration Control (during power operation mode, and during shutdown mode). PSA requirements. Use of Risk-based Configuration Control System. Configuration Management (basic elements, benefits, information requirements)

  15. OLBS: Offline location based services

    OpenAIRE

    Coelho, P; Ana Aguiar; João Correia Lopes

    2011-01-01

    Most existing location-based services rely on ubiquitous connectivity to deliver location-based contents to the users. However, connectivity is not available anywhere at anytime even in urban centres. Underground, indoors, remote areas, and foreign countries are examples situations where users commonly do not have guaranteed connectivity but could profit from location-based contents. In this work, we propose an open platform for publishing, distributing and maintaining location-based contents...

  16. ‘"Education-based Research"

    DEFF Research Database (Denmark)

    Degn Johansson, Troels

    This paper lays out a concept of education-based research-the production of research knowledge within the framework of tertiary design education-as an integration of problem-based learning and research-based education. This leads to a critique of reflective practice as the primary way to facilitate...... learning at this level, a discussion of the nature of design problems in the instrumentalist tradition, and some suggestions as to how design studies curricula may facilitate education-based research....

  17. Health Physics Positions Data Base

    International Nuclear Information System (INIS)

    Kerr, G.D.; Borges, T.; Stafford, R.S.; Lu, P.Y.; Carter, D.

    1992-05-01

    The Health Physics Positions (HPPOS) Data Base of the Nuclear Regulatory Commission (NRC) is a collection of summaries of NRC staff positions on a wide range of topics in radiation protection (health physics). The bases for the data base are 247 original documents in the form of letters, memoranda, and excerpts from technical reports. The HPPOS Data Base was developed by the NRC Headquarters and Regional Offices to help ensure uniformity in inspections, enforcement, and licensing actions

  18. Memory-Based Shallow Parsing

    OpenAIRE

    Sang, Erik F. Tjong Kim

    2002-01-01

    We present memory-based learning approaches to shallow parsing and apply these to five tasks: base noun phrase identification, arbitrary base phrase recognition, clause detection, noun phrase parsing and full parsing. We use feature selection techniques and system combination methods for improving the performance of the memory-based learner. Our approach is evaluated on standard data sets and the results are compared with that of other systems. This reveals that our approach works well for ba...

  19. Solar cycle predicts folate-sensitive neonatal genotypes at discrete phases of the first trimester of pregnancy: a novel folate-related human embryo loss hypothesis.

    Science.gov (United States)

    Lucock, Mark; Glanville, Tracey; Yates, Zoë; Walker, James; Furst, John; Simpson, Nigel

    2012-08-01

    Folate, a key periconceptional nutrient, is ultraviolet light (UV-R) sensitive. We therefore hypothesise that a relationship exists between sunspot activity, a proxy for total solar irradiance (particularly UV-R) reaching Earth, and the occurrence of folate-sensitive, epigenomic-related neonatal genotypes during the first trimester of pregnancy. Limited data is provided to support the hypothesis that the solar cycle predicts folate-related human embryo loss: 379 neonates born at latitude 54°N between 1998 and 2000 were examined for three folate-sensitive, epigenome-related polymorphisms, with solar activity for trimester one accessed via the Royal Greenwich Observatory-US Air force/National Oceanic and Atmospheric Administration Sunspot Database (34,110 total observation days). Logistic regression showed solar activity predicts C677T-methylenetetrahydrofolate reductase (C677T-MTHFR) and A66G-methionine synthase reductase (A66G-MSR) genotype at discrete phases of trimester one. Total and maximal sunspot activity predicts C677T-MTHFR genotype for days 31-60 of trimester one (p=0.0181 and 0.0366, respectively) and A66G-MSR genotype for days 61-90 of trimester one (p=0.0072 and 0.0105, respectively). Loss of UV-R sensitive folate associated with the sunspot cycle might therefore interact with variant folate genes to perturb DNA methylation and/or elaboration of the primary base sequence (thymidylate synthesis), as well as increase embryo-toxic homocysteine. We hypothesise that this may influence embryo viability leading to 677CC-MTHFR and 66GG-MSR embryo loss at times of increased solar activity. This provides an interesting and plausible link between well recognised 'folate gene originated developmental disorders' and 'solar activity/seasonality modulated developmental disorders'. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Parametric study of natural circulation flow in molten salt fuel in molten salt reactor

    Energy Technology Data Exchange (ETDEWEB)

    Pauzi, Anas Muhamad, E-mail: Anas@uniten.edu.my [Centre of Nuclear Energy, Universiti Tenaga Nasional (UNITEN), Jalan IKRAM-UNITEN, 43000 Kajang, Selangor (Malaysia); Cioncolini, Andrea; Iacovides, Hector [School of Mechanical, Aerospace, and Civil Engineering (MACE), University of Manchester, Oxford Road, M13 9PL Manchester (United Kingdom)

    2015-04-29

    The Molten Salt Reactor (MSR) is one of the most promising system proposed by Generation IV Forum (GIF) for future nuclear reactor systems. Advantages of the MSR are significantly larger compared to other reactor system, and is mainly achieved from its liquid nature of fuel and coolant. Further improvement to this system, which is a natural circulating molten fuel salt inside its tube in the reactor core is proposed, to achieve advantages of reducing and simplifying the MSR design proposed by GIF. Thermal hydraulic analysis on the proposed system was completed using a commercial computation fluid dynamics (CFD) software called FLUENT by ANSYS Inc. An understanding on theory behind this unique natural circulation flow inside the tube caused by fission heat generated in molten fuel salt and tube cooling was briefly introduced. Currently, no commercial CFD software could perfectly simulate natural circulation flow, hence, modeling this flow problem in FLUENT is introduced and analyzed to obtain best simulation results. Results obtained demonstrate the existence of periodical transient nature of flow problem, hence improvements in tube design is proposed based on the analysis on temperature and velocity profile. Results show that the proposed system could operate at up to 750MW core power, given that turbulence are enhanced throughout flow region, and precise molten fuel salt physical properties could be defined. At the request of the authors and the Proceedings Editor the name of the co-author Andrea Cioncolini was corrected from Andrea Coincolini. The same name correction was made in the Acknowledgement section on page 030004-10 and in reference number 4. The updated article was published on 11 May 2015.

  1. Neurospora discreta as a model to assess adaptation of soil fungi to warming.

    Science.gov (United States)

    Romero-Olivares, Adriana L; Taylor, John W; Treseder, Kathleen K

    2015-09-16

    Short-term experiments have indicated that warmer temperatures can alter fungal biomass production and CO2 respiration, with potential consequences for soil C storage. However, we know little about the capacity of fungi to adapt to warming in ways that may alter C dynamics. Thus, we exposed Neurospora discreta to moderately warm (16 °C) and warm (28 °C) selective temperatures for 1500 mitotic generations, and then examined changes in mycelial growth rate, biomass, spore production, and CO2 respiration. We tested the hypothesis that strains will adapt to its selective temperature. Specifically, we expected that adapted strains would grow faster, and produce more spores per unit biomass (i.e., relative spore production). In contrast, they should generate less CO2 per unit biomass due to higher efficiency in carbon use metabolism (i.e., lower mass specific respiration, MSR). Indeed, N. discreta adapted to warm temperatures, based on patterns of relative spore production. Adapted strains produced more spores per unit biomass than parental strains in the selective temperature. Contrary to our expectations, this increase in relative spore production was accompanied by an increase in MSR and a reduction in mycelial growth rate and biomass, compared to parental strains. Adaptation of N. discreta to warm temperatures may have elicited a tradeoff between biomass production and relative spore production, possibly because relative spore production required higher MSR rates. Therefore, our results do not support the idea that adaptation to warm temperatures will lead to a more efficient carbon use metabolism. Our data might help improve climate change model simulations and provide more concise predictions of decomposition processes and carbon feedbacks to the atmosphere.

  2. High temperature materials

    International Nuclear Information System (INIS)

    2003-01-01

    The aim of this workshop is to share the needs of high temperature and nuclear fuel materials for future nuclear systems, to take stock of the status of researches in this domain and to propose some cooperation works between the different research organisations. The future nuclear systems are the very high temperature (850 to 1200 deg. C) gas cooled reactors (GCR) and the molten salt reactors (MSR). These systems include not only the reactor but also the fabrication and reprocessing of the spent fuel. This document brings together the transparencies of 13 communications among the 25 given at the workshop: 1) characteristics and needs of future systems: specifications, materials and fuel needs for fast spectrum GCR and very high temperature GCR; 2) high temperature materials out of neutron flux: thermal barriers: materials, resistance, lifetimes; nickel-base metal alloys: status of knowledge, mechanical behaviour, possible applications; corrosion linked with the gas coolant: knowledge and problems to be solved; super-alloys for turbines: alloys for blades and discs; corrosion linked with MSR: knowledge and problems to be solved; 3) materials for reactor core structure: nuclear graphite and carbon; fuel assembly structure materials of the GCR with fast neutron spectrum: status of knowledge and ceramics and cermets needs; silicon carbide as fuel confinement material, study of irradiation induced defects; migration of fission products, I and Cs in SiC; 4) materials for hydrogen production: status of the knowledge and needs for the thermochemical cycle; 5) technologies: GCR components and the associated material needs: compact exchangers, pumps, turbines; MSR components: valves, exchangers, pumps. (J.S.)

  3. High temperature materials; Materiaux a hautes temperatures

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The aim of this workshop is to share the needs of high temperature and nuclear fuel materials for future nuclear systems, to take stock of the status of researches in this domain and to propose some cooperation works between the different research organisations. The future nuclear systems are the very high temperature (850 to 1200 deg. C) gas cooled reactors (GCR) and the molten salt reactors (MSR). These systems include not only the reactor but also the fabrication and reprocessing of the spent fuel. This document brings together the transparencies of 13 communications among the 25 given at the workshop: 1) characteristics and needs of future systems: specifications, materials and fuel needs for fast spectrum GCR and very high temperature GCR; 2) high temperature materials out of neutron flux: thermal barriers: materials, resistance, lifetimes; nickel-base metal alloys: status of knowledge, mechanical behaviour, possible applications; corrosion linked with the gas coolant: knowledge and problems to be solved; super-alloys for turbines: alloys for blades and discs; corrosion linked with MSR: knowledge and problems to be solved; 3) materials for reactor core structure: nuclear graphite and carbon; fuel assembly structure materials of the GCR with fast neutron spectrum: status of knowledge and ceramics and cermets needs; silicon carbide as fuel confinement material, study of irradiation induced defects; migration of fission products, I and Cs in SiC; 4) materials for hydrogen production: status of the knowledge and needs for the thermochemical cycle; 5) technologies: GCR components and the associated material needs: compact exchangers, pumps, turbines; MSR components: valves, exchangers, pumps. (J.S.)

  4. Lunar Base Heat Pump

    Science.gov (United States)

    Walker, D.; Fischbach, D.; Tetreault, R.

    1996-01-01

    The objective of this project was to investigate the feasibility of constructing a heat pump suitable for use as a heat rejection device in applications such as a lunar base. In this situation, direct heat rejection through the use of radiators is not possible at a temperature suitable for lde support systems. Initial analysis of a heat pump of this type called for a temperature lift of approximately 378 deg. K, which is considerably higher than is commonly called for in HVAC and refrigeration applications where heat pumps are most often employed. Also because of the variation of the rejection temperature (from 100 to 381 deg. K), extreme flexibility in the configuration and operation of the heat pump is required. A three-stage compression cycle using a refrigerant such as CFC-11 or HCFC-123 was formulated with operation possible with one, two or three stages of compression. Also, to meet the redundancy requirements, compression was divided up over multiple compressors in each stage. A control scheme was devised that allowed these multiple compressors to be operated as required so that the heat pump could perform with variable heat loads and rejection conditions. A prototype heat pump was designed and constructed to investigate the key elements of the high-lift heat pump concept. Control software was written and implemented in the prototype to allow fully automatic operation. The heat pump was capable of operation over a wide range of rejection temperatures and cooling loads, while maintaining cooling water temperature well within the required specification of 40 deg. C +/- 1.7 deg. C. This performance was verified through testing.

  5. Performance-Based Funding Brief

    Science.gov (United States)

    Washington Higher Education Coordinating Board, 2011

    2011-01-01

    A number of states have made progress in implementing performance-based funding (PFB) and accountability. This policy brief summarizes main features of performance-based funding systems in three states: Tennessee, Ohio, and Indiana. The brief also identifies key issues that states considering performance-based funding must address, as well as…

  6. Benefit-based tree valuation

    Science.gov (United States)

    E.G. McPherson

    2007-01-01

    Benefit-based tree valuation provides alternative estimates of the fair and reasonable value of trees while illustrating the relative contribution of different benefit types. This study compared estimates of tree value obtained using cost- and benefit-based approaches. The cost-based approach used the Council of Landscape and Tree Appraisers trunk formula method, and...

  7. Different perspectives on economic base.

    Science.gov (United States)

    Lisa K. Crone; Richard W. Haynes; Nicholas E. Reyna

    1999-01-01

    Two general approaches for measuring the economic base are discussed. Each method is used to define the economic base for each of the counties included in the Interior Columbia Basin Ecosystem Management Project area. A more detailed look at four selected counties results in similar findings from different approaches. Limitations of economic base analysis also are...

  8. Memory-Based Shallow Parsing

    NARCIS (Netherlands)

    Tjong Kim Sang, E.F.

    2002-01-01

    We present memory-based learning approaches to shallow parsing and apply these to five tasks: base noun phrase identification, arbitrary base phrase recognition, clause detection, noun phrase parsing and full parsing. We use feature selection techniques and system combination methods for improving

  9. Condition based spare parts supply

    NARCIS (Netherlands)

    Lin, X.; Basten, Robertus Johannes Ida; Kranenburg, A.A.; van Houtum, Geert-Jan

    2012-01-01

    We consider a spare parts stock point that serves an installed base of machines. Each machine contains the same critical component, whose degradation behavior is described by a Markov process. We consider condition based spare parts supply, and show that an optimal, condition based inventory policy

  10. Evidence-based dentistry.

    Science.gov (United States)

    Chambers, David W

    2010-01-01

    Both panegyric and criticism of evidence-based dentistry tend to be clumsy because the concept is poorly defined. This analysis identifies several contributions to the profession that have been made under the EBD banner. Although the concept of clinicians integrating clinical epidemiology, the wisdom of their practices, and patients' values is powerful, its implementation has been distorted by a too heavy emphasis of computerized searches for research findings that meet the standards of academics. Although EBD advocates enjoy sharing anecdotal accounts of mistakes others have made, faulting others is not proof that one's own position is correct. There is no systematic, high-quality evidence that EBD is effective. The metaphor of a three-legged stool (evidence, experience, values, and integration) is used as an organizing principle. "Best evidence" has become a preoccupation among EBD enthusiasts. That overlong but thinly developed leg of the stool is critiqued from the perspectives of the criteria for evidence, the difference between internal and external validity, the relationship between evidence and decision making, the ambiguous meaning of "best," and the role of reasonable doubt. The strongest leg of the stool is clinical experience. Although bias exists in all observations (including searches for evidence), there are simple procedures that can be employed in practice to increase useful and objective evidence there, and there are dangers in delegating policy regarding allowable treatments to external groups. Patient and practitioner values are the shortest leg of the stool. As they are so little recognized, their integration in EBD is problematic and ethical tensions exist where paternalism privileges science over patient's self-determined best interests. Four potential approaches to integration are suggested, recognizing that there is virtually no literature on how the "seat" of the three-legged stool works or should work. It is likely that most dentists

  11. Barrier Data Base user's guide

    International Nuclear Information System (INIS)

    Worrell, R.B.; Gould, D.J.; Wall, D.W.

    1977-06-01

    A special purpose data base for physical security barriers has been developed. In addition to barriers, the entities accommodated by the Barrier Data Base (BDB) include threats and references. A threat is established as a configuration of people and equipment which has been employed to penetrate (or attempt to penetrate) a barrier. References are used to cite publications pertinent to the barriers and threats in the data base. Utilization and maintenance of the Barrier Data Base is achieved with LIST, QUERY, ENTER, DELETE, and CHANGE commands which are used to manipulate the data base entities

  12. From oil-based mud to water-based mud

    International Nuclear Information System (INIS)

    Christiansen, C.

    1991-01-01

    Maersk Olie og Gas AS has used low toxic oil-based muds extensively since 1982 for drilling development wells and later in the development of horizontal well drilling techniques. However, in view of the strong drive towards a reduction in the amount of oil discharged to the North Sea from the oil industry, Maersk Olie og Gas AS initiated trials with new or improved types of water-based mud, first in deviated wells (1989) and then in horizontal wells (1990). The paper reviews Maersk Olie og Gas As experience with oil-based mud since the drilling of the first horizontal well in 1987, specifically with respect to cuttings washing equipment, oil retention on cuttings, and the procedure for monitoring of this parameter. It describes the circumstances leading to the decision to revert to water-based mud systems. Finally, it reviews the experience gained so far with the new improved types of water-based mud systems, mainly glycol and KCl/polymer mud systems. Comparison of operational data, such as rate of penetration, torque and drag, etc., is made between wells drilled with oil-based mud and water-based mud. The trials with the new improved types of water-based mud systems have been positive, i.e. horizontal wells can be drilled successfully with water-based mud. As a result, Maersk Olie og and Gas AS has decided to discontinue the use of low toxic oil-based muds in the Danish sector of the North Sea

  13. Workplace Based Assessment in Psychiatry

    Directory of Open Access Journals (Sweden)

    Ayse Devrim Basterzi

    2009-11-01

    Full Text Available Workplace based assessment refers to the assessment of working practices based on what doctors actually do in the workplace, and is predominantly carried out in the workplace itself. Assessment drives learning and it is therefore essential that workplace-based assessment focuses on important attributes rather than what is easiest to assess. Workplacebased assessment is usually competency based. Workplace based assesments may well facilitate and enhance various aspects of educational supervisions, including its structure, frequency and duration etc. The structure and content of workplace based assesments should be monitored to ensure that its benefits are maximised by remaining tailored to individual trainees' needs. Workplace based assesment should be used for formative and summative assessments. Several formative assessment methods have been developed for use in the workplace such as mini clinical evaluation exercise (mini-cex, evidence based journal club assesment and case based discussion, multi source feedback etc. This review discusses the need of workplace based assesments in psychiatry graduate education and introduces some of the work place based assesment methods.

  14. Case-based reasoning: The marriage of knowledge base and data base

    Science.gov (United States)

    Pulaski, Kirt; Casadaban, Cyprian

    1988-01-01

    The coupling of data and knowledge has a synergistic effect when building an intelligent data base. The goal is to integrate the data and knowledge almost to the point of indistinguishability, permitting them to be used interchangeably. Examples given in this paper suggest that Case-Based Reasoning is a more integrated way to link data and knowledge than pure rule-based reasoning.

  15. HTGR fuel and fuel cycle technology

    International Nuclear Information System (INIS)

    Lotts, A.L.; Homan, F.J.; Balthesen, E.; Turner, R.F.

    1977-01-01

    Significant advances have occurred in the development of HTGR fuel and fuel cycle. These accomplishments permit a wide choice of fuel designs, reactor concepts, and fuel cycles. Fuels capable of providing helium outlet temperatures of 750 0 C are available, and fuels capable of 1000 0 C outlet temperatures may be expected from extension of present technology. Fuels have been developed for two basic HTGR designs, one using a spherical (pebble bed) element and the other a prismatic element. Within each concept a number of variations of geometry, fuel composition, and structural materials are permitted. Potential fuel cycles include both low-enriched and high-enriched Th- 235 U, recycle Th- 233 U, and Th-Pu or U-Pu cycles. This flexibility offered by the HTGR is of great practical benefit considering the rapidly changing economics of power production. The inflation of ore prices has increased optimum conversion ratios, and increased the necessity of fuel recycle at an early date. Fuel element makeup is very similar for prismatic and spherical designs. Both use spherical fissile and fertile particles coated with combinations of pyrolytic carbon and silicon carbide. Both use carbonaceous binder materials, and graphite as the structural material. Weak-acid resin (WAR) UO 2 -UC 2 fissile fuels and sol-gel-derived ThO 2 fertile fuels have been selected for the Th- 233 U cycle in the prismatic design. Sol-gel-derived UO 2 UC 2 is the reference fissile fuel for the low-enriched pebble bed design. Both the United States and Federal Republic of Germany are developing technology for fuel cycle operations including fabrication, reprocessing, refabrication, and waste handling. Feasibility of basic processes has been established and designs developed for full-scale equipment. Fuel and fuel cycle technology provide the basis for a broad range of applications of the HTGR. Extension of the fuels to higher operating temperatures and development and commercial demonstration of fuel

  16. Knowledge base verification based on enhanced colored petri net

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jong Hyun; Seong, Poong Hyun [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)

    1997-12-31

    Verification is a process aimed at demonstrating whether a system meets it`s specified requirements. As expert systems are used in various applications, the knowledge base verification of systems takes an important position. The conventional Petri net approach that has been studied recently in order to verify the knowledge base is found that it is inadequate to verify the knowledge base of large and complex system, such as alarm processing system of nuclear power plant. Thus, we propose an improved method that models the knowledge base as enhanced colored Petri net. In this study, we analyze the reachability and the error characteristics of the knowledge base and apply the method to verification of simple knowledge base. 8 refs., 4 figs. (Author)

  17. Knowledge base verification based on enhanced colored petri net

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jong Hyun; Seong, Poong Hyun [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)

    1998-12-31

    Verification is a process aimed at demonstrating whether a system meets it`s specified requirements. As expert systems are used in various applications, the knowledge base verification of systems takes an important position. The conventional Petri net approach that has been studied recently in order to verify the knowledge base is found that it is inadequate to verify the knowledge base of large and complex system, such as alarm processing system of nuclear power plant. Thus, we propose an improved method that models the knowledge base as enhanced colored Petri net. In this study, we analyze the reachability and the error characteristics of the knowledge base and apply the method to verification of simple knowledge base. 8 refs., 4 figs. (Author)

  18. XML-Based SHINE Knowledge Base Interchange Language

    Science.gov (United States)

    James, Mark; Mackey, Ryan; Tikidjian, Raffi

    2008-01-01

    The SHINE Knowledge Base Interchange Language software has been designed to more efficiently send new knowledge bases to spacecraft that have been embedded with the Spacecraft Health Inference Engine (SHINE) tool. The intention of the behavioral model is to capture most of the information generally associated with a spacecraft functional model, while specifically addressing the needs of execution within SHINE and Livingstone. As such, it has some constructs that are based on one or the other.

  19. Managing the Gap between Curriculum Based and Problem Based Learning

    DEFF Research Database (Denmark)

    Bygholm, Ann; Buus, Lillian

    2009-01-01

    /or but rather both/and. In this paper we describe an approach to design and delivery of online courses in computer science which on the one hand is based on a specified curriculum and on the other hand gives room for different learning strategies, problem based learning being one of them. We discuss......Traditionally there has been a clear distinction between curriculum based and problem based approaches to accomplish learning. Preferred approaches depend of course on conviction, culture, traditions and also on the specific learning situation. We will argue that it is not a question of either...

  20. Acids and bases solvent effects on acid-base strenght

    CERN Document Server

    Cox, Brian G

    2013-01-01

    Acids and bases are ubiquitous in chemistry. Our understanding of them, however, is dominated by their behaviour in water. Transfer to non-aqueous solvents leads to profound changes in acid-base strengths and to the rates and equilibria of many processes: for example, synthetic reactions involving acids, bases and nucleophiles; isolation of pharmaceutical actives through salt formation; formation of zwitter- ions in amino acids; and chromatographic separation of substrates. This book seeks to enhance our understanding of acids and bases by reviewing and analysing their behaviour in non-aqueous solvents. The behaviour is related where possible to that in water, but correlations and contrasts between solvents are also presented.

  1. Computer-based and web-based radiation safety training

    Energy Technology Data Exchange (ETDEWEB)

    Owen, C., LLNL

    1998-03-01

    The traditional approach to delivering radiation safety training has been to provide a stand-up lecture of the topic, with the possible aid of video, and to repeat the same material periodically. New approaches to meeting training requirements are needed to address the advent of flexible work hours and telecommuting, and to better accommodate individuals learning at their own pace. Computer- based and web-based radiation safety training can provide this alternative. Computer-based and web- based training is an interactive form of learning that the student controls, resulting in enhanced and focused learning at a time most often chosen by the student.

  2. Recommendations for a restart of Molten Salt Reactor development

    International Nuclear Information System (INIS)

    Moir, R. W.

    2007-01-01

    The concept of the molten salt reactor (MSR) refuses to go away. The Generation-IV process lists the MSR as one of the six concepts to be considered for extending fuel resources. Good fuel utilization and good economics are required to meet the often cited goal of 10 TWe globally and 1 TWe for the US by non-carbon energy sources in this century by nuclear fission. A strong incentive for the molten salt reactor design is its good fuel utilization, good economics, amazing flexibility and promised large benefits. It can: - use thorium or uranium; o be designed with lots of graphite to have a fairly thermal neutron spectrum or without graphite moderator to have a fast neutron spectrum reactor; - fission uranium isotopes and plutonium isotopes; - operate with non-weapon grade fissile fuel, or in suitable sites it can operate with enrichment between reactor-grade and weapon-grade fissile fuel; - be a breeder or near breeder; - operate at temperature >1100 degree C if carbon composites are successfully employed. Enhancing 2 32U content in the uranium to over 500 pm makes the fuel undesirable for weapons, but it should not detract from its economic use in liquid fuel reactors: a big advantage in nonproliferation. Economics of the MSR is enhanced by operating at low pressure and high temperature and may even lead to the preferred route to hydrogen production. The cost of the electricity produced from low enriched fuel averaged over the life of the entire process, has been predicted to be about 10% lower than that from LWRs, and 20% lower for high enriched fuel, with uncertainties of about 10%. The development cost has been estimated at about 1 B$ (e.g., a 100 M$/y base program for ten years) not including construction of a series of reactors leading up to the deployment of multiple commercial units at an assumed cost of 9 B$ (450 M$/y over 20 years). A benefit of liquid fuel is that smaller power reactors can faithfully test features of larger reactors, thereby reducing the

  3. Concurrent array-based queue

    Science.gov (United States)

    Heidelberger, Philip; Steinmacher-Burow, Burkhard

    2015-01-06

    According to one embodiment, a method for implementing an array-based queue in memory of a memory system that includes a controller includes configuring, in the memory, metadata of the array-based queue. The configuring comprises defining, in metadata, an array start location in the memory for the array-based queue, defining, in the metadata, an array size for the array-based queue, defining, in the metadata, a queue top for the array-based queue and defining, in the metadata, a queue bottom for the array-based queue. The method also includes the controller serving a request for an operation on the queue, the request providing the location in the memory of the metadata of the queue.

  4. The knowledge base of journalism

    DEFF Research Database (Denmark)

    Svith, Flemming

    In this paper I propose the knowledge base as a fruitful way to apprehend journalism. With the claim that the majority of practice is anchored in knowledge – understood as 9 categories of rationales, forms and levels – this knowledge base appears as a contextual look at journalists’ knowledge......, and place. As an analytical framework, the knowledge base is limited to understand the practice of newspaper journalists, but, conversely, the knowledge base encompasses more general beginnings through the inclusion of overall structural relationships in the media and journalism and general theories...... on practice and knowledge. As the result of an abductive reasoning is a theory proposal, there is a need for more deductive approaches to test the validity of this knowledge base claim. It is thus relevant to investigate which rationales are included in the knowledge base of journalism, as the dimension does...

  5. Aperiodic-metamaterial-based absorber

    Directory of Open Access Journals (Sweden)

    Quanlong Yang

    2017-09-01

    Full Text Available The periodic-metamaterial-based perfect absorber has been studied broadly. Conversely, if the unit cell in the metamaterial-based absorber is arranged aperiodically (aperiodic-metamaterial-based absorber, how does it perform? Inspired by this, here we present a systematic study of the aperiodic-metamaterial-based absorber. By investigating the response of metamaterial absorbers based on periodic, Fibonacci, Thue-Morse, and quasicrystal lattices, we found that aperiodic-metamaterial-based absorbers could display similar absorption behaviors as the periodic one in one hand. However, their absorption behaviors show different tendency depending on the thicknesses of the spacer. Further studies on the angle and polarization dependence of the absorption behavior are also presented.

  6. Estimating North Dakota's Economic Base

    OpenAIRE

    Coon, Randal C.; Leistritz, F. Larry

    2009-01-01

    North Dakota’s economic base is comprised of those activities producing a product paid for by nonresidents, or products exported from the state. North Dakota’s economic base activities include agriculture, mining, manufacturing, tourism, and federal government payments for construction and to individuals. Development of the North Dakota economic base data is important because it provides the information to quantify the state’s economic growth, and it creates the final demand sectors for the N...

  7. Principles of models based engineering

    Energy Technology Data Exchange (ETDEWEB)

    Dolin, R.M.; Hefele, J.

    1996-11-01

    This report describes a Models Based Engineering (MBE) philosophy and implementation strategy that has been developed at Los Alamos National Laboratory`s Center for Advanced Engineering Technology. A major theme in this discussion is that models based engineering is an information management technology enabling the development of information driven engineering. Unlike other information management technologies, models based engineering encompasses the breadth of engineering information, from design intent through product definition to consumer application.

  8. Logically automorphically equivalent knowledge bases

    OpenAIRE

    Aladova, Elena; Plotkin, Tatjana

    2017-01-01

    Knowledge bases theory provide an important example of the field where applications of universal algebra and algebraic logic look very natural, and their interaction with practical problems arising in computer science might be very productive. In this paper we study the equivalence problem for knowledge bases. Our interest is to find out how the informational equivalence is related to the logical description of knowledge. Studying various equivalences of knowledge bases allows us to compare d...

  9. Brain-Based Learning and Standards-Based Elementary Science.

    Science.gov (United States)

    Konecki, Loretta R.; Schiller, Ellen

    This paper explains how brain-based learning has become an area of interest to elementary school science teachers, focusing on the possible relationships between, and implications of, research on brain-based learning to the teaching of science education standards. After describing research on the brain, the paper looks at three implications from…

  10. Fatigue data bases in Europe

    International Nuclear Information System (INIS)

    Olivier, R.; Koettgen, V.B.; Seeger, T.; Boller, C.

    1988-01-01

    Based on an inquiry with well-known European fatigue institutions the paper describes existing more or less extensive collections and data bases of S-N and crack growth data, mainly on unwelded and welded steel and aluminium in organizations and countries as follows: CEC, ESA, Federal Republic of Germany, GDR, Italy, Norway, Republic of Ireland, Switzerland, UK. This documentation of the present state is completed by a short survey on available European fatigue standards and design rules, serving as a data base for nominal materials data. Requirements for data base concepts, contents, user interface and data structure are presented in a short overview. (orig./HP)

  11. Capability-based computer systems

    CERN Document Server

    Levy, Henry M

    2014-01-01

    Capability-Based Computer Systems focuses on computer programs and their capabilities. The text first elaborates capability- and object-based system concepts, including capability-based systems, object-based approach, and summary. The book then describes early descriptor architectures and explains the Burroughs B5000, Rice University Computer, and Basic Language Machine. The text also focuses on early capability architectures. Dennis and Van Horn's Supervisor; CAL-TSS System; MIT PDP-1 Timesharing System; and Chicago Magic Number Machine are discussed. The book then describes Plessey System 25

  12. New Mexico Geothermal Data Base

    International Nuclear Information System (INIS)

    Witcher, J.C.; Whittier, J.; Morgan, R.

    1990-01-01

    This paper reports on the New Mexico Geothermal Data Base (NMGDB) which is a comprehensive public-domain data base of low-temperature geothermal resource information for New Mexico that is designed to assist researchers and developers. A broad range of geoscience, engineering, climatic, economic, and land status information are complied in the dBASE III PLUS data base management system for use on an IBM or IBM-compatible personal computer. A user friendly menu format with on-screen prompts allows easy and convenient use

  13. Isochronous cyclotron data base description

    International Nuclear Information System (INIS)

    Kiyan, I.N.; Vorozhtsov, S.B.; Tarashkevich, R.

    2004-01-01

    The relational data base of the control parameters of the isochronous cyclotron, Isochronous Cyclotron Data Base (ICDB), is described. The relational data base under consideration, written in Transact SQL for the MS SQL Server 2000 with the use of MS Enterprise Manager and MS Query Analyzer, was installed on the server of the AIC144 isochronous cyclotron in Krakow, which operates under the control of the operating system MS Windows Server 2003 (Standard Edition). The interface of the data base under considerations is written in C++ with the use of Visual C++ .NET and is built in the Cyclotron Operator Help Program (COHP), which is used for modeling the operational modes of the isochronous cyclotron. Communication between the COHP and the relational data base is realised on the base of the Open Data Base Connectivity protocol. The relational data base of the control parameter of the isochronous cyclotron is intended: firstly, for systematization and automatic use of all measured and modelled magnetic field maps in the process of modeling the operational modes; secondly, for systematization and convenient access to the stored operational modes; thirdly, for simplifying the operator's work. The relational data base of the control parameter of the isochronous cyclotron reflects its physical structure and the logic of its operator's work. (author)

  14. Theory-Based Stakeholder Evaluation

    Science.gov (United States)

    Hansen, Morten Balle; Vedung, Evert

    2010-01-01

    This article introduces a new approach to program theory evaluation called theory-based stakeholder evaluation or the TSE model for short. Most theory-based approaches are program theory driven and some are stakeholder oriented as well. Practically, all of the latter fuse the program perceptions of the various stakeholder groups into one unitary…

  15. Package-based software development

    NARCIS (Netherlands)

    Jonge, de M.; Chroust, G.; Hofer, C.

    2003-01-01

    The main goal of component-based software engineering is to decrease development time and development costs of software systems, by reusing prefabricated building blocks. Here we focus on software reuse within the implementation of such component-based applications, and on the corresponding software

  16. Cloud-Based Data Storage

    Science.gov (United States)

    Waters, John K.

    2011-01-01

    The vulnerability and inefficiency of backing up data on-site is prompting school districts to switch to more secure, less troublesome cloud-based options. District auditors are pushing for a better way to back up their data than the on-site, tape-based system that had been used for years. About three years ago, Hendrick School District in…

  17. Cluster Based Vector Attribute Filtering

    NARCIS (Netherlands)

    Kiwanuka, Fred N.; Wilkinson, Michael H.F.

    2016-01-01

    Morphological attribute filters operate on images based on properties or attributes of connected components. Until recently, attribute filtering was based on a single global threshold on a scalar property to remove or retain objects. A single threshold struggles in case no single property or

  18. Dog Mathematics: Exploring Base-4

    Science.gov (United States)

    Kurz, Terri L.; Yanik, H. Bahadir; Lee, Mi Yeon

    2016-01-01

    Using a dog's paw as a basis for numerical representation, sixth grade students explored how to count and regroup using the dog's four digital pads. Teachers can connect these base-4 explorations to the conceptual meaning of place value and regrouping using base-10.

  19. Forest biomass-based energy

    Science.gov (United States)

    Janaki R. R. Alavalapati; Pankaj Lal; Andres Susaeta; Robert C. Abt; David N. Wear

    2013-01-01

    Key FindingsHarvesting woody biomass for use as bioenergy is projected to range from 170 million to 336 million green tons by 2050, an increase of 54 to 113 percent over current levels.Consumption projections for forest biomass-based energy, which are based on Energy Information Administration projections, have a high level of...

  20. Generic component failure data base

    International Nuclear Information System (INIS)

    Eide, S.A.; Calley, M.B.

    1992-01-01

    This report discusses comprehensive component generic failure data base which has been developed for light water reactor probabilistic risk assessments. The Nuclear Computerized Library for Assessing Reactor Reliability (NUCLARR) was used to generate component failure rates. Using this approach, most of the failure rates are based on actual plant data rather then existing estimates

  1. Groebner bases in perturbative calculations

    Energy Technology Data Exchange (ETDEWEB)

    Gerdt, Vladimir P. [Laboratory of Information Technologies, Joint Institute for Nuclear Research, 141980 Dubna (Russian Federation)

    2004-10-01

    In this paper we outline the most general and universal algorithmic approach to reduction of loop integrals to basic integrals. The approach is based on computation of Groebner bases for recurrence relations derived from the integration by parts method. In doing so we consider generic recurrence relations when propagators have arbitrary integer powers treated as symbolic variables (indices) for the relations.

  2. Groebner bases in perturbative calculations

    International Nuclear Information System (INIS)

    Gerdt, Vladimir P.

    2004-01-01

    In this paper we outline the most general and universal algorithmic approach to reduction of loop integrals to basic integrals. The approach is based on computation of Groebner bases for recurrence relations derived from the integration by parts method. In doing so we consider generic recurrence relations when propagators have arbitrary integer powers treated as symbolic variables (indices) for the relations

  3. Ground-based photo monitoring

    Science.gov (United States)

    Frederick C. Hall

    2000-01-01

    Ground-based photo monitoring is repeat photography using ground-based cameras to document change in vegetation or soil. Assume those installing the photo location will not be the ones re-photographing it. This requires a protocol that includes: (1) a map to locate the monitoring area, (2) another map diagramming the photographic layout, (3) type and make of film such...

  4. Methods in Logic Based Control

    DEFF Research Database (Denmark)

    Christensen, Georg Kronborg

    1999-01-01

    Desing and theory of Logic Based Control systems.Boolean Algebra, Karnaugh Map, Quine McClusky's algorithm. Sequential control design. Logic Based Control Method, Cascade Control Method. Implementation techniques: relay, pneumatic, TTL/CMOS,PAL and PLC- and Soft_PLC implementation. PLC...

  5. Models for Rational Number Bases

    Science.gov (United States)

    Pedersen, Jean J.; Armbruster, Frank O.

    1975-01-01

    This article extends number bases to negative integers, then to positive rationals and finally to negative rationals. Methods and rules for operations in positive and negative rational bases greater than one or less than negative one are summarized in tables. Sample problems are explained and illustrated. (KM)

  6. Defining Nature-Based Preschools

    Science.gov (United States)

    Larimore, Rachel

    2016-01-01

    Nature-based early childhood education. Nature-based preschool. Nature preschool. Forest kindergarten. Nature kindergarten. Waldkindergarten. Forest school. These are a few of the program terms currently being discussed among early childhood environmental education professionals in the United States. Why is there so much discussion about the names…

  7. Plasma-based accelerator structures

    International Nuclear Information System (INIS)

    Schroeder, Carl B.

    1999-01-01

    Plasma-based accelerators have the ability to sustain extremely large accelerating gradients, with possible high-energy physics applications. This dissertation further develops the theory of plasma-based accelerators by addressing three topics: the performance of a hollow plasma channel as an accelerating structure, the generation of ultrashort electron bunches, and the propagation of laser pulses is underdense plasmas

  8. Machine intelligence and knowledge bases

    Energy Technology Data Exchange (ETDEWEB)

    Furukawa, K

    1981-09-01

    The basic functions necessary in machine intelligence are a knowledge base and a logic programming language such as PROLOG using deductive reasoning. Recently inductive reasoning based on meta knowledge and default reasoning have been developed. The creative thought model of Lenit is reviewed and the concept of knowledge engineering is introduced. 17 references.

  9. Automated deficiency letter data base

    International Nuclear Information System (INIS)

    Jones, R.D.

    1983-12-01

    An automated data base relevant to the various licensee deficiencies that accrue during the materials licensing application review process of the Nuclear Regulatory Commission (NRC) is described. A data base management system (DBMs) is used for data retrieval, file-tending, and examination of the interrelationships among the data types in the data base. Use of word processors to emulate computer terminals for the purpose of data base population (loading) and report generation is discussed. Also described is the technique used to link, for update purposes, the data base (accessed by means of SYSTEM 2000 on a CDC 6600 computer) to the NRC Material License Master File resident on the National Institutes of Health (NIH) IBM System 370 computer. A user's manual that provides easy-to-understand instructions for the nonprogramming user on how to generate ad hoc analytical reports to facilitate management decisions is also included

  10. Power Reactor Embrittlement Data Base

    International Nuclear Information System (INIS)

    Kam, F.B.K.; Stallmann, F.W.; Wang, J.A.

    1990-01-01

    Regulatory and research evaluations of embrittlement predication models and of pressure vessel integrity can be greatly expedited by the use of a well-designed, computerized data base. The Power Reactor Embrittlement Data Base (PR-EDB) is such a comprehensive collection of data for US commercial nuclear reactors. The Nuclear Regulatory Commission (NRC) has provided financial support, and the Electric Power Research Institute (EPRI) has provided technical assistance in the quality assurance (QA) of the data to establish an industry-wide data base that will be maintained and updated on a long-term basis. Successful applications of the data base to several of NRC's evaluations have received favorable response and support for its continuation. The future direction of the data base has been designed to include the test reactor and other types of data of interest to the regulators and the researchers. 1 ref

  11. Team-based global organizations

    DEFF Research Database (Denmark)

    Zander, Lena; Butler, Christina; Mockaitis, Audra

    2015-01-01

    diversity in enhancing team creativity and performance, and 2) the sharing of knowledge in team-based organizations, while the other two themes address global team leadership: 3) the unprecedented significance of social capital for the success of global team leader roles; and 4) the link between shared......This chapter draws on a panel discussion of the future of global organizing as a team-based organization at EIBA 2014 in Uppsala, Sweden. We began by discussing contemporary developments of hybrid forms of hierarchy and teams-based organizing, but we venture to propose that as organizations become...... characterized by decreased importance of hierarchal structures, more fluidity across borders, even a possible dissolution of firm boundaries, we move towards team-based organizing as an alternative to more traditional forms of hierarchical-based organizing in global firms. To provide input for a discussion...

  12. Content-based intermedia synchronization

    Science.gov (United States)

    Oh, Dong-Young; Sampath-Kumar, Srihari; Rangan, P. Venkat

    1995-03-01

    Inter-media synchronization methods developed until now have been based on syntactic timestamping of video frames and audio samples. These methods are not fully appropriate for the synchronization of multimedia objects which may have to be accessed individually by their contents, e.g. content-base data retrieval. We propose a content-based multimedia synchronization scheme in which a media stream is viewed as hierarchial composition of smaller objects which are logically structured based on the contents, and the synchronization is achieved by deriving temporal relations among logical units of media object. content-based synchronization offers several advantages such as, elimination of the need for time stamping, freedom from limitations of jitter, synchronization of independently captured media objects in video editing, and compensation for inherent asynchronies in capture times of video and audio.

  13. Content-Based Image Retrial Based on Hadoop

    Directory of Open Access Journals (Sweden)

    DongSheng Yin

    2013-01-01

    Full Text Available Generally, time complexity of algorithms for content-based image retrial is extremely high. In order to retrieve images on large-scale databases efficiently, a new way for retrieving based on Hadoop distributed framework is proposed. Firstly, a database of images features is built by using Speeded Up Robust Features algorithm and Locality-Sensitive Hashing and then perform the search on Hadoop platform in a parallel way specially designed. Considerable experimental results show that it is able to retrieve images based on content on large-scale cluster and image sets effectively.

  14. Image based Monument Recognition using Graph based Visual Saliency

    DEFF Research Database (Denmark)

    Kalliatakis, Grigorios; Triantafyllidis, Georgios

    2013-01-01

    This article presents an image-based application aiming at simple image classification of well-known monuments in the area of Heraklion, Crete, Greece. This classification takes place by utilizing Graph Based Visual Saliency (GBVS) and employing Scale Invariant Feature Transform (SIFT) or Speeded......, the images have been previously processed according to the Graph Based Visual Saliency model in order to keep either SIFT or SURF features corresponding to the actual monuments while the background “noise” is minimized. The application is then able to classify these images, helping the user to better...

  15. radio frequency based radio frequency based water level monitor

    African Journals Online (AJOL)

    eobe

    ABSTRACT. This paper elucidates a radio frequency (RF) based transmission and reception system used to remotely monitor and .... range the wireless can cover but in this prototype, it ... power supply to the system, the sensed water level is.

  16. Value-based metrics and Internet-based enterprises

    Science.gov (United States)

    Gupta, Krishan M.

    2001-10-01

    Within the last few years, a host of value-based metrics like EVA, MVA, TBR, CFORI, and TSR have evolved. This paper attempts to analyze the validity and applicability of EVA and Balanced Scorecard for Internet based organizations. Despite the collapse of the dot-com model, the firms engaged in e- commerce continue to struggle to find new ways to account for customer-base, technology, employees, knowledge, etc, as part of the value of the firm. While some metrics, like the Balance Scorecard are geared towards internal use, others like EVA are for external use. Value-based metrics are used for performing internal audits as well as comparing firms against one another; and can also be effectively utilized by individuals outside the firm looking to determine if the firm is creating value for its stakeholders.

  17. SB certification for mixture-based specification for flexible base.

    Science.gov (United States)

    2012-10-01

    Presentation topics: : Establish List of Qualified Producers; : Producers Responsible for Process Control/Quality Control; : Reduce TxDOT Sampling and Testing; : Expedite Aggregate Base Acceptance; : Share Responsibility (Producer/TxDOT) for Quality ...

  18. Object-Based Benefits without Object-Based Representations

    OpenAIRE

    Alvarez, George Angelo; Fougnie, Daryl; Cormiea, Sarah M

    2012-01-01

    The organization of visual information into objects strongly influences visual memory: Displays with objects defined by two features (e.g. color, orientation) are easier to remember than displays with twice as many objects defined by one feature (Olson & Jiang, 2002). Existing theories suggest that this ‘object-benefit’ is based on object-based limitations in working memory: because a limited number of objects can be stored, packaging features together so that fewer objects have to be remembe...

  19. Development status and potential program for development of proliferation-resistant molten-salt reactors

    International Nuclear Information System (INIS)

    Engel, J.R.; Bauman, H.F.; Dearing, J.F.; Grimes, W.R.; McCoy, H.E. Jr.

    1979-03-01

    Preliminary studies of existing and conceptual molten-salt reactor (MSR) designs have led to the identification of conceptual systems that are technologically attractive when operated with denatured uranium as the principal fissile fuel. These denatured MSRs would also have favorable resource-utilization characteristics and substantial resistance to proliferation of weapons-usable nuclear materials. The report presents a summary of the current status of technology and a discussion of the major technical areas of a possible base program to develop commercial denatured MSRs. The general areas treated are (1) reactor design and development, (2) safety and safety related technology, (3) fuel-coolant behavior and fuel processing, and (4) reactor materials. A substantial development effort could lead to authorization for construction of a molten-salt test reactor about 5 years after the start of the program and operation of the unit about 10 years later. A prototype commercial denatured MSR could be expected to begin operating 25 years from the start of the program. The postulated base program would extend over 32 years and would cost about $700 million (1978 dollars, unescalated). Additional costs to construct the MSTR, $600 million, and the prototype commercial plant, $1470 million, would bring the total program cost to about $2.8 billion. Additional allowances probably should be made to cover contingencies and incidental technology areas not explicitly treated in this preliminary review

  20. Steady state investigation on neutronics of a molten salt reactor considering the flow effect of fuel salt

    International Nuclear Information System (INIS)

    Zhang Dalin; Qiu Suizheng; Su Guanghui; Liu Changliang

    2008-01-01

    The Molten Salt Reactor (MSR), one of the 'Generation IV' concepts, is a liquid-fuel reactor, which is different from the conventional reactors using solid fissile materials due to the flow effect of fuel salt. The study on its neutronics considering the fuel salt flow, which is the base of the thermal-hydraulic calculation and safety analysis, must be done. In this paper, the theoretical model on neutronics under steady condition for a single-liquid-fueled MSR is conducted and calculated by numerical method. The neutronics model consists of two group neutron diffusion equations for fast and thermal neutron fluxes, and balance equations for six-group delayed neutron precursors considering the flow effect of fuel salt. The spatial discretization of the above models is based on the finite volume method, and the discretization equations are computed by the source iteration method. The distributions of neutron fluxes and the distributions of the delayed neutron precursors in the core are obtained. The numerical calculated results show that, the fuel salt flow has little effect on the distribution of fast and thermal neutron fluxes and the effective multiplication factor; however, it affects the distribution of the delayed neutron precursors significantly, especially the long-lived one. In addition, it could be found that the delayed neutron precursors influence the neutronics slightly under the steady condition. (authors)

  1. Steady state investigation on neutronics of a molten salt reactor considering the flow effect of fuel salt

    Institute of Scientific and Technical Information of China (English)

    ZHANG Da-Lin; QIU Sui-Zheng; LIU Chang-Liang; SU Guang-Hui

    2008-01-01

    The Molten Salt Reactor (MSR),one of the‘Generation Ⅳ'concepts,is a liquid-fuel reactor,which is different from the conventional reactors using solid fissile materials due to the flow effect of fuel salt.The study on its neutronice considering the fuel salt flow,which is the base of the thermal-hydraulic calculation and safety analysis,must be done.In this paper,the theoretical model on neutronics under steady condition for a single-liquid-fueled MSR is conducted and calculated by numerical method.The neutronics model consists of two group neutron diffusion equations for fast and thermal neutron fluxes,and balance equations for six-group delayed neutron precursors considering the flow effect of fuel salt. The spatial discretization of the above models is based on the finite volume method,and the discretization equations are computed by the source iteration method.The distributions of neutron fluxes and the distributions of the delayed neutron precursors in the core are obtained.The numerical calculated results show that,the fuel salt flow has little effect on the distribution of fast and thermal neutron fluxes and the effective multiplication factor;however,it affects the distribution of the delayed neutron precursors significantly,especially the long-lived one.In addition,it could be found that the delayed neutron precursors influence the nentronics slightly under the steady condition.

  2. Development status and potential program for development of proliferation-resistant molten-salt reactors

    Energy Technology Data Exchange (ETDEWEB)

    Engel, J.R.; Bauman, H.F.; Dearing, J.F.; Grimes, W.R.; McCoy, H.E. Jr.

    1979-03-01

    Preliminary studies of existing and conceptual molten-salt reactor (MSR) designs have led to the identification of conceptual systems that are technologically attractive when operated with denatured uranium as the principal fissile fuel. These denatured MSRs would also have favorable resource-utilization characteristics and substantial resistance to proliferation of weapons-usable nuclear materials. The report presents a summary of the current status of technology and a discussion of the major technical areas of a possible base program to develop commercial denatured MSRs. The general areas treated are (1) reactor design and development, (2) safety and safety related technology, (3) fuel-coolant behavior and fuel processing, and (4) reactor materials. A substantial development effort could lead to authorization for construction of a molten-salt test reactor about 5 years after the start of the program and operation of the unit about 10 years later. A prototype commercial denatured MSR could be expected to begin operating 25 years from the start of the program. The postulated base program would extend over 32 years and would cost about $700 million (1978 dollars, unescalated). Additional costs to construct the MSTR, $600 million, and the prototype commercial plant, $1470 million, would bring the total program cost to about $2.8 billion. Additional allowances probably should be made to cover contingencies and incidental technology areas not explicitly treated in this preliminary review.

  3. Designing Android Based Augmented Reality Location-Based Service Application

    Directory of Open Access Journals (Sweden)

    Alim Hardiansyah

    2018-01-01

    Full Text Available Android is an operating system for Linux based smartphone. Android provides an open platform for the developers to create their own application. The most developed and used application now is location based application. This application gives personalization service for mobile device user and is customized to their location. Location based service also gives an opportunity for the developers to develop and increase the value of service. One of the technologies that could be combined with location based application is augmented reality. Augmented reality combines the virtual world with the real one. By the assistance of augmented reality, our surrounding environment could interact in digital form. Information of objects and environment surround us could be added to the augmented reality system and presented. Based on the background, the writers tried to implement those technologies on now rapidly developing android application as a final project to achieve bachelor degree in Department of Informatics Engineering, Faculty of Information Technology and Visual Communication, Al Kamal Science and Technology Institute. This application could be functioned to locate school by using location based service technology with the assistance of navigational applications such as waze and google maps, in form of live direction process through the smartphone

  4. WPS criterion proposition based on experimental data base interpretation

    International Nuclear Information System (INIS)

    Chapuliot, S.; Izard, J.P.; Moinereau, D.; Marie, S.

    2011-01-01

    This article gives the background and the methodology developed to define a K J based criterion for brittle fracture of Reactor Pressure Vessel (RPV) submitted to Pressurized Thermal Shock (PTS), and taking into account Warm Pre Stressing effect (WPS). The first step of this methodology is the constitution of an experimental data base. This work was performed through bibliography and partnerships, and allows merging experimental results dealing with: -) Various ferritic steels; -) Various material states (as received, thermally aged, irradiated...); -) Various mode of fracture (cleavage, inter-granular, mixed mode); -) Various specimen geometry and size (CT, SENB, mock-ups); -) Various thermo-mechanical transients. Based on this experimental data base, a simple K J based limit is proposed and compared to experimental results. Parametric studies are performed in order to define the main parameters of the problem. Finally, a simple proposition based on a detailed analysis of tests results is performed. This proposition giving satisfactory results in every cases, it constitutes a good candidate for integration in French RSE-M code for in service assessment. (authors)

  5. The Organization of Behavior Over Time: Insights from Mid-Session Reversal

    OpenAIRE

    Rayburn-Reeves, Rebecca M.; Cook, Robert G.

    2016-01-01

    What are the mechanisms by which behavior is organized sequentially over time? The recently developed mid-session reversal (MSR) task offers new insights into this fundamental question. The typical MSR task is arranged to have a single reversed discrimination occurring in a consistent location within each session and across sessions. In this task, we examine the relevance of time, reinforcement, and other factors as the switching cue in the sequential modulation of control in MSR. New analyse...

  6. EPICS Application Based on RTEMS

    International Nuclear Information System (INIS)

    Shi Haoli; Wang Chunhong; Tang Jingyu

    2009-01-01

    At present, in the accelerator field all over the world, the control system is established with EPICS, which is a configuration software package based on Ethernet and distributed control system. Early version of EPICS was developed based on VxWorks. Now, EPICS international collaboration group is dedicating to supporting open source, free RTEMS, and extending RTEMS into the newer version of EPICS3.14. The paper illustrates the development, characteristic of RTEMS, compares the performances of several ordinary RTOS, builds RTEMS operating system based on MVME5500, and finally presents an EPICS application example on RTEMS. (authors)

  7. Querying Natural Logic Knowledge Bases

    DEFF Research Database (Denmark)

    Andreasen, Troels; Bulskov, Henrik; Jensen, Per Anker

    2017-01-01

    This paper describes the principles of a system applying natural logic as a knowledge base language. Natural logics are regimented fragments of natural language employing high level inference rules. We advocate the use of natural logic for knowledge bases dealing with querying of classes...... in ontologies and class-relationships such as are common in life-science descriptions. The paper adopts a version of natural logic with recursive restrictive clauses such as relative clauses and adnominal prepositional phrases. It includes passive as well as active voice sentences. We outline a prototype...... for partial translation of natural language into natural logic, featuring further querying and conceptual path finding in natural logic knowledge bases....

  8. Home-based Healthcare Technology

    DEFF Research Database (Denmark)

    Verdezoto, Nervo

    of these systems target a specific treatment or condition and might not be sufficient to support the care management work at home. Based on a case study approach, my research investigates home-based healthcare practices and how they can inform future design of home-based healthcare technology that better account......Sustaining daily, unsupervised healthcare activities in non-clinical settings such as the private home can challenge, among others, older adults. To support such unsupervised care activities, an increasingly number of reminders and monitoring systems are being designed. However, most...

  9. Solar based hydrogen production systems

    CERN Document Server

    Dincer, Ibrahim

    2013-01-01

    This book provides a comprehensive analysis of various solar based hydrogen production systems. The book covers first-law (energy based) and second-law (exergy based) efficiencies and provides a comprehensive understanding of their implications. It will help minimize the widespread misuse of efficiencies among students and researchers in energy field by using an intuitive and unified approach for defining efficiencies. The book gives a clear understanding of the sustainability and environmental impact analysis of the above systems. The book will be particularly useful for a clear understanding

  10. Risk-based safety indicators

    International Nuclear Information System (INIS)

    Sedlak, J.

    2001-12-01

    The report is structured as follows: 1. Risk-based safety indicators: Typology of risk-based indicators (RBIs); Tools for defining RBIs; Requirements for the PSA model; Data sources for RBIs; Types of risks monitored; RBIs and operational safety indicators; Feedback from operating experience; PSO model modification for RBIs; RBI categorization; RBI assessment; RBI applications; Suitable RBI applications. 2. Proposal for risk-based indicators: Acquiring information from operational experience; Method of acquiring safety relevance coefficients for the systems from a PSA model; Indicator definitions; On-line indicators. 3. Annex: Application of RBIs worldwide. (P.A.)

  11. Reconsidering Community-based Retailing

    OpenAIRE

    Maughan, Rebecca; O'Driscoll, Aidan

    2012-01-01

    One of the areas with great potential for economic, social and environmental benefit is community-based retailing. The concept of community based retailing can incorporate a number of different tenets. We suggest that it is retailing that is based close to the community it serves, usually within the town or village centre rather than out-of-town locations, and which is composed of a diverse range of small and medium sized business that are often independently or co-operatively owned. These co...

  12. FEMA DFIRM Base Flood Elevations

    Data.gov (United States)

    Minnesota Department of Natural Resources — The Base Flood Elevation (BFE) table is required for any digital data where BFE lines will be shown on the corresponding Flood Insurance Rate Map (FIRM). Normally,...

  13. Oil-based paint poisoning

    Science.gov (United States)

    Paint - oil-based - poisoning ... Hydrocarbons are the primary poisonous ingredient in oil paints. Some oil paints have heavy metals such as lead, mercury, cobalt, and barium added as pigment. These heavy metals can cause additional ...

  14. Imprinted silicon-based nanophotonics

    DEFF Research Database (Denmark)

    Borel, Peter Ingo; Olsen, Brian Bilenberg; Frandsen, Lars Hagedorn

    2007-01-01

    We demonstrate and optically characterize silicon-on-insulator based nanophotonic devices fabricated by nanoimprint lithography. In our demonstration, we have realized ordinary and topology-optimized photonic crystal waveguide structures. The topology-optimized structures require lateral pattern ...

  15. Generalized eigenvalue based spectrum sensing

    KAUST Repository

    Shakir, Muhammad; Alouini, Mohamed-Slim

    2012-01-01

    of the decision threshold of the respective detectors. The decision threshold has been calculated in a closed form which is based on the approximation of Cumulative Distribution Functions (CDFs) of the respective test statistics. In this context, we exchange

  16. Reliability-Based Code Calibration

    DEFF Research Database (Denmark)

    Faber, M.H.; Sørensen, John Dalsgaard

    2003-01-01

    The present paper addresses fundamental concepts of reliability based code calibration. First basic principles of structural reliability theory are introduced and it is shown how the results of FORM based reliability analysis may be related to partial safety factors and characteristic values....... Thereafter the code calibration problem is presented in its principal decision theoretical form and it is discussed how acceptable levels of failure probability (or target reliabilities) may be established. Furthermore suggested values for acceptable annual failure probabilities are given for ultimate...... and serviceability limit states. Finally the paper describes the Joint Committee on Structural Safety (JCSS) recommended procedure - CodeCal - for the practical implementation of reliability based code calibration of LRFD based design codes....

  17. Cage-based performance capture

    CERN Document Server

    Savoye, Yann

    2014-01-01

    Nowadays, highly-detailed animations of live-actor performances are increasingly easier to acquire and 3D Video has reached considerable attentions in visual media production. In this book, we address the problem of extracting or acquiring and then reusing non-rigid parametrization for video-based animations. At first sight, a crucial challenge is to reproduce plausible boneless deformations while preserving global and local captured properties of dynamic surfaces with a limited number of controllable, flexible and reusable parameters. To solve this challenge, we directly rely on a skin-detached dimension reduction thanks to the well-known cage-based paradigm. First, we achieve Scalable Inverse Cage-based Modeling by transposing the inverse kinematics paradigm on surfaces. Thus, we introduce a cage inversion process with user-specified screen-space constraints. Secondly, we convert non-rigid animated surfaces into a sequence of optimal cage parameters via Cage-based Animation Conversion. Building upon this re...

  18. Physical bases of nuclear medicine

    International Nuclear Information System (INIS)

    Isabelle, D.B.; Ducassou, D.

    1975-01-01

    The physical bases of nuclear medicine are outlined in several chapters devoted successively to: atomic and nuclear structures; nuclear reactions; radioactiity laws; a study of different types of disintegration; the interactions of radiations with matter [fr

  19. GCCS Spatial Data Base Module

    National Research Council Canada - National Science Library

    Bell, Paul

    1998-01-01

    .... JMTK is divided into three primary areas: (1) Visual, (2) Analysis (non-visual), and (3) Spatial Data Base (SDBM). The primary objective of the SDBM effort is to define, design, develop and test mapping, charting and geodesy...

  20. Surface stress-based biosensors.

    Science.gov (United States)

    Sang, Shengbo; Zhao, Yuan; Zhang, Wendong; Li, Pengwei; Hu, Jie; Li, Gang

    2014-01-15

    Surface stress-based biosensors, as one kind of label-free biosensors, have attracted lots of attention in the process of information gathering and measurement for the biological, chemical and medical application with the development of technology and society. This kind of biosensors offers many advantages such as short response time (less than milliseconds) and a typical sensitivity at nanogram, picoliter, femtojoule and attomolar level. Furthermore, it simplifies sample preparation and testing procedures. In this work, progress made towards the use of surface stress-based biosensors for achieving better performance is critically reviewed, including our recent achievement, the optimally circular membrane-based biosensors and biosensor array. The further scientific and technological challenges in this field are also summarized. Critical remark and future steps towards the ultimate surface stress-based biosensors are addressed. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Industry Based Survey (IBS) Yellowtail

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The "Southern New England Yellowtail Flounder Industry-Based Survey" was a collaboration between the Rhode Island Division of Fish and Wildlife and the fishing...

  2. Industry Based Survey (IBS) Cod

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The "Gulf of Maine Atlantic Cod Industry-Based Survey" was a collaboration of the Massachusetts Division of Marine Fisheries and the fishing industry, with support...

  3. US Air Force Base Observations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Hourly observations taken by U.S. Air Force personnel at bases in the United States and around the world. Foreign observations concentrated in the Middle East and...

  4. Studying Sensing-Based Systems

    DEFF Research Database (Denmark)

    Kjærgaard, Mikkel Baun

    2013-01-01

    Recent sensing-based systems involve a multitude of users, devices, and places. These types of systems challenge existing approaches for conducting valid system evaluations. Here, the author discusses such evaluation challenges and revisits existing system evaluation methodologies....

  5. Structure-Based Turbulence Model

    National Research Council Canada - National Science Library

    Reynolds, W

    2000-01-01

    .... Maire carried out this work as part of his Phi) research. During the award period we began to explore ways to simplify the structure-based modeling so that it could be used in repetitive engineering calculations...

  6. SAT-Based Software Certification

    National Research Council Canada - National Science Library

    Chaki, Sagar

    2006-01-01

    ... predicate abstraction and validated by generating and proving verification conditions. In addition, the first part of the report proposes the use of theorem provers based on Boolean propositional satisfiability (SAT...

  7. Consent Based Verification System (CBSV)

    Data.gov (United States)

    Social Security Administration — CBSV is a fee-based service offered by SSA's Business Services Online (BSO). It is used by private companies to verify the SSNs of their customers and clients that...

  8. NORTHWOODS Wildlife Habitat Data Base

    Science.gov (United States)

    Mark D. Nelson; Janine M. Benyus; Richard R. Buech

    1992-01-01

    Wildlife habitat data from seven Great Lakes National Forests were combined into a wildlife-habitat matrix named NORTHWOODS. Several electronic file formats of NORTHWOODS data base and documentation are available on floppy disks for microcomputers.

  9. Forming lead-based anodes

    Energy Technology Data Exchange (ETDEWEB)

    Ogorodnichuk, V I; Voitsekhovich, R I

    1972-01-01

    Lead-based anodes can be produced by forming a layer of lead dioxide by chemical treatment in a solution of sulfuric acid in potassium permanganate at 80 to 100/sup 0/. The solution is mixed by compressed air. (RWR)

  10. Base Flood Elevation (BFE) Lines

    Data.gov (United States)

    Department of Homeland Security — The Base Flood Elevation (BFE) table is required for any digital data where BFE lines will be shown on the corresponding Flood Insurance Rate Map (FIRM). Normally if...

  11. Hospital Value-Based Purchasing

    Data.gov (United States)

    U.S. Department of Health & Human Services — Hospital Value-Based Purchasing (VBP) is part of the Centers for Medicare and Medicaid Services (CMS) long-standing effort to link Medicares payment system to a...

  12. Chip-based droplet sorting

    Energy Technology Data Exchange (ETDEWEB)

    Beer, Neil Reginald; Lee, Abraham; Hatch, Andrew

    2017-11-21

    A non-contact system for sorting monodisperse water-in-oil emulsion droplets in a microfluidic device based on the droplet's contents and their interaction with an applied electromagnetic field or by identification and sorting.

  13. Consumption-based Equity Valuation

    DEFF Research Database (Denmark)

    Bach, Christian; Christensen, Peter O.

    2016-01-01

    implementations of standard valuation models, both in terms of median absolute valuation errors (MAVE) and in terms of excess returns on simple investment strategies based on the differences between model and market prices. The CCAPM-based valuation model yields a significantly lower MAVE than the best performing...... standard valuation model. Both types of models can identify investment strategies with subsequent excess returns. The CCAPM-based valuation model yields time-series of realized hedge returns with more and higher positive returns and fewer and less negative returns compared with the time-series of realized...... through a risk-adjusted cost of equity in the denominator. The risk adjustments are derived based on assumptions about the time-series properties of residual income returns and aggregate consumption rather than on historical stock returns. We compare the performance of the model with several...

  14. Consumption-based Equity Valuation

    DEFF Research Database (Denmark)

    Bach, Christian; Christensen, Peter Ove

    2013-01-01

    the performance of the model with several implementations of standard valuation models, both in terms of absolute valuation errors, and in terms of the returns on simple investment strategies based on the differences between model and market prices in the respective valuation models. The CCAPM-based valuation...... model performs substantially better than the best performing standard valuation model when comparing absolute valuation errors. Both types of models are able to identify investment strategies with subsequent excess returns but also in this setting, the CCAPM-based valuation model outperforms...... residual income for risk in the numerator rather than through a risk-adjusted cost of equity in the denominator. The risk-adjustments are derived based on assumptions about the time-series properties of residual income returns and aggregate consumption rather than on historical stock returns. We compare...

  15. Microprocessor based techniques at CESR

    International Nuclear Information System (INIS)

    Giannini, G.; Cornell Univ., Ithaca, NY

    1981-01-01

    Microprocessor based systems succesfully used in connection with the High Energy Physics experimental program at the Cornell Electron Storage Ring are described. The multiprocessor calibration system for the CUSB calorimeter is analyzed in view of present and future applications. (orig.)

  16. PHYSIOLOGY OF ACID BASE BALANCE

    Directory of Open Access Journals (Sweden)

    Awati

    2014-12-01

    Full Text Available Acid-base, electrolyte, and metabolic disturbances are common in the intensive care unit. Almost all critically ill patients often suffer from compound acid-base and electrolyte disorders. Successful evaluation and management of such patients requires recognition of common patterns (e.g., metabolic acidosis and the ability to dissect one disorder from another. The intensivists needs to identify and correct these condition with the easiest available tools as they are the associated with multiorgan failure. Understanding the elements of normal physiology in these areas is very important so as to diagnose the pathological condition and take adequate measures as early as possible. Arterial blood gas analysis is one such tool for early detection of acid base disorder. Physiology of acid base is complex and here is the attempt to simplify it in our day to day application for the benefit of critically ill patients.

  17. Eye-based head gestures

    DEFF Research Database (Denmark)

    Mardanbegi, Diako; Witzner Hansen, Dan; Pederson, Thomas

    2012-01-01

    A novel method for video-based head gesture recognition using eye information by an eye tracker has been proposed. The method uses a combination of gaze and eye movement to infer head gestures. Compared to other gesture-based methods a major advantage of the method is that the user keeps the gaze...... mobile phone screens. The user study shows that the method detects a set of defined gestures reliably.......A novel method for video-based head gesture recognition using eye information by an eye tracker has been proposed. The method uses a combination of gaze and eye movement to infer head gestures. Compared to other gesture-based methods a major advantage of the method is that the user keeps the gaze...

  18. Base compaction specification feasibility analysis.

    Science.gov (United States)

    2012-12-01

    The objective of this research is to establish the technical engineering and cost : analysis concepts that will enable WisDOT management to objectively evaluate the : feasibility of switching construction specification philosophies for aggregate base...

  19. Polyethylene-Based Tadpole Copolymers

    KAUST Repository

    Alkayal, Nazeeha; Zhang, Zhen; Bilalis, Panayiotis; Gnanou, Yves; Hadjichristidis, Nikolaos

    2017-01-01

    Novel well-defined polyethylene-based tadpole copolymers ((c-PE)-b-PS, PE: polyethylene, PS: polystyrene) with ring PE head and linear PS tail are synthesized by combining polyhomologation, atom transfer radical polymerization (ATRP), and Glaser

  20. Knowledge-based Telecom Industry

    OpenAIRE

    Vinje, Villeman; Nordkvelde, Marius

    2011-01-01

    BI Norwegian School of Management is conducting a national research project entitled “A knowledge-based Norway”. Thirteen major knowledge-based industries in Norway are being analyzed under the auspices of the project. This study assesses the underlying properties of a global knowledge hub to examine the extent to which the Norwegian telecom industry – which encompasses all telecom firms located in Norway regardless of ownership – constitutes a global knowledge hub. It commences with a ge...

  1. Power Reactor Embrittlement Data Base

    International Nuclear Information System (INIS)

    Kam, F.B.K.; Stallmann, F.W.; Wang, J.A.

    1990-01-01

    Regulatory and research evaluations of embrittlement prediction models and of vessel integrity under load can be greatly expedited by the use of a well designed, computerized embrittlement data base. The Power Reactor Embrittlement Data Base (PR-EDB) is a comprehensive collection of data from surveillance reports and other published reports of commercial nuclear reactors. The uses of the data base require that as many different data as available are collected from as many sources as possible with complete references and that subsets of relevant data can be easily retrieved and processed. The objectives of this NRC-sponsored program are the following: (1) to compile and to verify the quality of the PR-EDB; (2) to provide user-friendly software to access and process the data; (3) to explore or confirm embrittlement prediction models; and (4) to interact with standards organizations to provide the technical bases for voluntary consensus standards that can be used in regulatory guides, standard review plans, and codes. To achieve these goals, the data base architecture was designed after much discussion and planning with prospective users, namely, material scientists and members of the research staff. The current compilation of the PR-EDB (Version 1) contains results from surveillance capsule reports of 78 reactors with 381 data points for 110 different irradiated base materials and 161 data points for 79 different welds. Results from heat-affected zone materials are also listed. The time and effort required to process and evaluate different types of data in the PR-EDB have been drastically reduced from previous data bases. The Electric Power Research Institute (EPRI), reactor vendors, and utilities are in the process of providing back-up quality assurance checks of PR-EDB and will be supplementing the data base with additional data and documentation

  2. [Bases and methods of suturing].

    Science.gov (United States)

    Vogt, P M; Altintas, M A; Radtke, C; Meyer-Marcotty, M

    2009-05-01

    If pharmaceutic modulation of scar formation does not improve the quality of the healing process over conventional healing, the surgeon must rely on personal skill and experience. Therefore a profound knowledge of wound healing based on experimental and clinical studies supplemented by postsurgical means of scar management and basic techniques of planning incisions, careful tissue handling, and thorough knowledge of suturing remain the most important ways to avoid abnormal scarring. This review summarizes the current experimental and clinical bases of surgical scar management.

  3. Chevron closing base wedge bunionectomy.

    Science.gov (United States)

    Bruyn, J M

    1993-01-01

    The Chevron-base wedge Association for Osteosynthesis fixated bunionectomy provides a stable, aggressive correction of the severe hallux abducto valgus deformity. It is intended for the bunion requiring a double osteotomy in order to adequately reduce both intermetatarsal and proximal articular facet angle with minimal shortening and elevation. This article presents the rationale for the procedure, technique, and a 4-year follow-up of six patients with eight Chevron-base wedge bunionectomies.

  4. TFC Base de datos relacionales

    OpenAIRE

    Moreno Pozuelo, Isabel

    2015-01-01

    El objetivo de este proyecto es desarrollar una base de datos relacional que contenga los datos necesarios para realizar la gestión de carteras de inversión. L'objectiu d'aquest projecte és desenvolupar una base de dades relacional que contingui les dades necessàries per realitzar la gestió de carteres d'inversió. Bachelor thesis for the Computer Science program on Databases.

  5. Instance-Based Question Answering

    Science.gov (United States)

    2006-12-01

    cluster-based query expan- sion, learning answering strategies, machine learning in NLP To my wife Monica Abstract During recent years, question...process is typically tedious and involves expertise in crafting and implement- ing these models (e.g. rule-based), utilizing NLP resources, and...questions. For languages that use capitalization (e.g. not Chinese or Arabic ) for named entities, IBQA can make use of NE classing (e.g. “Bob Marley

  6. System Based Code: Principal Concept

    International Nuclear Information System (INIS)

    Yasuhide Asada; Masanori Tashimo; Masahiro Ueta

    2002-01-01

    This paper introduces a concept of the 'System Based Code' which has initially been proposed by the authors intending to give nuclear industry a leap of progress in the system reliability, performance improvement, and cost reduction. The concept of the System Based Code intends to give a theoretical procedure to optimize the reliability of the system by administrating every related engineering requirement throughout the life of the system from design to decommissioning. (authors)

  7. RSA-Based Secret Handshakes

    OpenAIRE

    Vergnaud , Damien

    2006-01-01

    A secret handshake mechanism allows two entities, members of a same group, to authenticate each other secretly. This primitive was introduced recently by Balfanz, Durfee, Shankar, Smetters, Staddon and Wong and, so far, all the schemes proposed are based on discrete log systems. This paper proposes three new secret handshake protocols secure against active impersonator and detector adversaries. Inspired by two RSA-based key agreement protocols introduced by Okamoto and Tanaka in 1989 and Gira...

  8. Evidence-based cancer imaging

    Energy Technology Data Exchange (ETDEWEB)

    Shinagare, Atul B.; Khorasani, Ramin [Dept. of Radiology, Brigham and Women' s Hospital, Boston (Korea, Republic of)

    2017-01-15

    With the advances in the field of oncology, imaging is increasingly used in the follow-up of cancer patients, leading to concerns about over-utilization. Therefore, it has become imperative to make imaging more evidence-based, efficient, cost-effective and equitable. This review explores the strategies and tools to make diagnostic imaging more evidence-based, mainly in the context of follow-up of cancer patients.

  9. Evidence based medical imaging (EBMI)

    International Nuclear Information System (INIS)

    Smith, Tony

    2008-01-01

    Background: The evidence based paradigm was first described about a decade ago. Previous authors have described a framework for the application of evidence based medicine which can be readily adapted to medical imaging practice. Purpose: This paper promotes the application of the evidence based framework in both the justification of the choice of examination type and the optimisation of the imaging technique used. Methods: The framework includes five integrated steps: framing a concise clinical question; searching for evidence to answer that question; critically appraising the evidence; applying the evidence in clinical practice; and, evaluating the use of revised practices. Results: This paper illustrates the use of the evidence based framework in medical imaging (that is, evidence based medical imaging) using the examples of two clinically relevant case studies. In doing so, a range of information technology and other resources available to medical imaging practitioners are identified with the intention of encouraging the application of the evidence based paradigm in radiography and radiology. Conclusion: There is a perceived need for radiographers and radiologists to make greater use of valid research evidence from the literature to inform their clinical practice and thus provide better quality services

  10. Entanglement in mutually unbiased bases

    Energy Technology Data Exchange (ETDEWEB)

    Wiesniak, M; Zeilinger, A [Vienna Center for Quantum Science and Technology (VCQ), Faculty of Physics, University of Vienna, Boltzmanngasse 5, 1090 Vienna (Austria); Paterek, T, E-mail: tomasz.paterek@nus.edu.sg [Centre for Quantum Technologies, National University of Singapore, 3 Science Drive 2, 117543 Singapore (Singapore)

    2011-05-15

    One of the essential features of quantum mechanics is that most pairs of observables cannot be measured simultaneously. This phenomenon manifests itself most strongly when observables are related to mutually unbiased bases. In this paper, we shed some light on the connection between mutually unbiased bases and another essential feature of quantum mechanics, quantum entanglement. It is shown that a complete set of mutually unbiased bases of a bipartite system contains a fixed amount of entanglement, independent of the choice of the set. This has implications for entanglement distribution among the states of a complete set. In prime-squared dimensions we present an explicit experiment-friendly construction of a complete set with a particularly simple entanglement distribution. Finally, we describe the basic properties of mutually unbiased bases composed of product states only. The constructions are illustrated with explicit examples in low dimensions. We believe that the properties of entanglement in mutually unbiased bases may be one of the ingredients to be taken into account to settle the question of the existence of complete sets. We also expect that they will be relevant to applications of bases in the experimental realization of quantum protocols in higher-dimensional Hilbert spaces.

  11. A comprehensive physiologically based pharmacokinetic ...

    Science.gov (United States)

    Published physiologically based pharmacokinetic (PBPK) models from peer-reviewed articles are often well-parameterized, thoroughly-vetted, and can be utilized as excellent resources for the construction of models pertaining to related chemicals. Specifically, chemical-specific parameters and in vivo pharmacokinetic data used to calibrate these published models can act as valuable starting points for model development of new chemicals with similar molecular structures. A knowledgebase for published PBPK-related articles was compiled to support PBPK model construction for new chemicals based on their close analogues within the knowledgebase, and a web-based interface was developed to allow users to query those close analogues. A list of 689 unique chemicals and their corresponding 1751 articles was created after analysis of 2,245 PBPK-related articles. For each model, the PMID, chemical name, major metabolites, species, gender, life stages and tissue compartments were extracted from the published articles. PaDEL-Descriptor, a Chemistry Development Kit based software, was used to calculate molecular fingerprints. Tanimoto index was implemented in the user interface as measurement of structural similarity. The utility of the PBPK knowledgebase and web-based user interface was demonstrated using two case studies with ethylbenzene and gefitinib. Our PBPK knowledgebase is a novel tool for ranking chemicals based on similarities to other chemicals associated with existi

  12. Home-based versus centre-based cardiac rehabilitation.

    Science.gov (United States)

    Taylor, Rod S; Dalal, Hayes; Jolly, Kate; Moxham, Tiffany; Zawada, Anna

    2010-01-20

    The burden of cardiovascular disease world-wide is one of great concern to patients and health care agencies alike. Traditionally centre-based cardiac rehabilitation (CR) programmes are offered to individuals after cardiac events to aid recovery and prevent further cardiac illness. Home-based cardiac rehabilitation programmes have been introduced in an attempt to widen access and participation. To determine the effectiveness of home-based cardiac rehabilitation programmes compared with supervised centre-based cardiac rehabilitation on mortality and morbidity, health-related quality of life and modifiable cardiac risk factors in patients with coronary heart disease. We updated the search of a previous review by searching the Cochrane Central Register of Controlled Trials (CENTRAL) in The Cochrane Library (2007, Issue 4), MEDLINE, EMBASE and CINAHL from 2001 to January 2008. We checked reference lists and sought advice from experts. No language restrictions were applied. Randomised controlled trials (RCTs) that compared centre-based cardiac rehabilitation (e.g. hospital, gymnasium, sports centre) with home-based programmes, in adults with myocardial infarction, angina, heart failure or who had undergone revascularisation. Studies were selected independently by two reviewers, and data extracted by a single reviewer and checked by a second one. Authors were contacted where possible to obtain missing information. Twelve studies (1,938 participants) met the inclusion criteria. The majority of studies recruited a lower risk patient following an acute myocardial infarction (MI) and revascularisation. There was no difference in outcomes of home- versus centre-based cardiac rehabilitation in mortality risk ratio (RR) was1.31 (95% confidence interval (C) 0.65 to 2.66), cardiac events, exercise capacity standardised mean difference (SMD) -0.11 (95% CI -0.35 to 0.13), as well as in modifiable risk factors (systolic blood pressure; diastolic blood pressure; total cholesterol

  13. From conventional software based systems to knowledge based systems

    International Nuclear Information System (INIS)

    Bologna, S.

    1995-01-01

    Even if todays nuclear power plants have a very good safety record, there is a continuous search for still improving safety. One direction of this effort address operational safety, trying to improve the handling of disturbances and accidents partly by further automation, partly by creating a better control room environment, providing the operator with intelligent support systems to help in the decision making process. Introduction of intelligent computerised operator support systems has proved to be an efficient way of improving the operators performance. A number of systems have been developed worldwide, assisting in tasks like process fault detection and diagnosis, selection and implementation of proper remedial actions. Unfortunately, the use of Knowledge Based Systems (KBSs), introduces a new dimension to the problem of the licensing process. KBSs, despite the different technology employed, are still nothing more than a computer program. Unfortunately, quite a few people building knowledge based systems seem to ignore the many good programming practices that have evolved over the years for producing traditional computer programs. In this paper the author will try to point out similarities and differences between conventional software based systems, and knowledge based systems, introducing also the concept of model based reasoning. (orig.) (25 refs., 2 figs.)

  14. New exploration on TMSR: modelling and simulation

    Energy Technology Data Exchange (ETDEWEB)

    Si, S.; Chen, Q.; Bei, H.; Zhao, J., E-mail: ssy@snerdi.com.cn [Shanghai Nuclear Engineering Research & Design Inst., Shanghai (China)

    2015-07-01

    A tightly coupled multi-physics model for MSR (Molten Salt Reactor) system involving the reactor core and the rest of the primary loop has been developed and employed in an in-house developed computer code TANG-MSR. In this paper, the computer code is used to simulate the behavior of steady state operation and transient for our redesigned TMSR. The presented simulation results demonstrate that the models employed in TANG-MSR can capture major physics phenomena in MSR and the redesigned TMSR has excellent performance of safety and sustainability. (author)

  15. Mechanical structure and problem of thorium molten salt reactor

    International Nuclear Information System (INIS)

    Kamei, Takashi

    2011-01-01

    After Fukushima Daiichi accident, there became great interest in Thorium Molten Salt Reactor (MSR) for the safety as station blackout leading to auto drainage of molten salts with freeze valve. This article described mechanical structure of MSR and problems of materials and pipes. Material corrosion problem by molten salts would be solved using modified Hastelloy N with Ti and Nb added, which should be confirmed by operation of an experimental reactor. Trends in international activities of MSR were also referred including China declaring MSR development in January 2011 to solve thorium contamination issues at rare earth production and India rich in thorium resources. (T. Tanaka)

  16. ORF Alignment: NC_004116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available de methionine ... sulfoxide reductase msrB ... Length = 140 ... Query: 2 ... KETQEELRQRIGHTAYQVTQNS...ATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 61 ... KETQEELRQRIGHTAYQVTQNSATEHAF...TGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG Sbjct: 1 ... KETQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 60

  17. ORF Alignment: NC_004368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available de methionine ... sulfoxide reductase msrB ... Length = 140 ... Query: 2 ... KETQEELRQRIGHTAYQVTQNS...ATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 61 ... KETQEELRQRIGHTAYQVTQNSATEHAF...TGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG Sbjct: 1 ... KETQEELRQRIGHTAYQVTQNSATEHAFTGKYDDFFEEGIYVDIVSGEVLFSSLDKFQSG 60

  18. From scientifically based research to evidence based learning

    Directory of Open Access Journals (Sweden)

    Rosa Cera

    2016-02-01

    Full Text Available This essay is a reflection on the peculiarities of the scientifically based research and on the distinctive elements of the EBL (evidence based learning, methodology used in the study on the “Relationship between Metacognition, Self-efficacy and Self-regulation in Learning”. The EBL method, based on the standardization of data, explains how the students’ learning experience can be considered as a set of “data” and can be used to explain how and when the research results can be considered generalizable and transferable to other learning situations. The reflections present in this study have also allowed us to illustrate the impact that its results have had on the micro and macro level of reality. They helped to fill in the gaps concerning the learning/teaching processes, contributed to the enrichment of the scientific literature on this subject and allowed to establish standards through rigorous techniques such as systematic reviews and meta-analysis.

  19. Nasal base narrowing: the combined alar base excision technique.

    Science.gov (United States)

    Foda, Hossam M T

    2007-01-01

    To evaluate the role of the combined alar base excision technique in narrowing the nasal base and correcting excessive alar flare. The study included 60 cases presenting with a wide nasal base and excessive alar flaring. The surgical procedure combined an external alar wedge resection with an internal vestibular floor excision. All cases were followed up for a mean of 32 (range, 12-144) months. Nasal tip modification and correction of any preexisting caudal septal deformities were always completed before the nasal base narrowing. The mean width of the external alar wedge excised was 7.2 (range, 4-11) mm, whereas the mean width of the sill excision was 3.1 (range, 2-7) mm. Completing the internal excision first resulted in a more conservative external resection, thus avoiding any blunting of the alar-facial crease. No cases of postoperative bleeding, infection, or keloid formation were encountered, and the external alar wedge excision healed with an inconspicuous scar that was well hidden in the depth of the alar-facial crease. Finally, the risk of notching of the alar rim, which can occur at the junction of the external and internal excisions, was significantly reduced by adopting a 2-layered closure of the vestibular floor (P = .01). The combined alar base excision resulted in effective narrowing of the nasal base with elimination of excessive alar flare. Commonly feared complications, such as blunting of the alar-facial crease or notching of the alar rim, were avoided by using simple modifications in the technique of excision and closure.

  20. Generalized eigenvalue based spectrum sensing

    KAUST Repository

    Shakir, Muhammad

    2012-01-01

    Spectrum sensing is one of the fundamental components in cognitive radio networks. In this chapter, a generalized spectrum sensing framework which is referred to as Generalized Mean Detector (GMD) has been introduced. In this context, we generalize the detectors based on the eigenvalues of the received signal covariance matrix and transform the eigenvalue based spectrum sensing detectors namely: (i) the Eigenvalue Ratio Detector (ERD) and two newly proposed detectors which are referred to as (ii) the GEometric Mean Detector (GEMD) and (iii) the ARithmetic Mean Detector (ARMD) into an unified framework of generalize spectrum sensing. The foundation of the proposed framework is based on the calculation of exact analytical moments of the random variables of the decision threshold of the respective detectors. The decision threshold has been calculated in a closed form which is based on the approximation of Cumulative Distribution Functions (CDFs) of the respective test statistics. In this context, we exchange the analytical moments of the two random variables of the respective test statistics with the moments of the Gaussian (or Gamma) distribution function. The performance of the eigenvalue based detectors is compared with the several traditional detectors including the energy detector (ED) to validate the importance of the eigenvalue based detectors and the performance of the GEMD and the ARMD particularly in realistic wireless cognitive radio network. Analytical and simulation results show that the newly proposed detectors yields considerable performance advantage in realistic spectrum sensing scenarios. Moreover, the presented results based on proposed approximation approaches are in perfect agreement with the empirical results. © 2012 Springer Science+Business Media Dordrecht.