WorldWideScience

Sample records for text appendices a-c

  1. Appendiceal Diverticulitis Clinically Masquerading as an Appendiceal Carcinoma

    Directory of Open Access Journals (Sweden)

    Tadashi Terada

    2014-01-01

    Full Text Available Appendiceal diverticulosis is a rare condition. Herein reported is a case of appendiceal diverticulosis and diverticulitis clinically masquerading as appendiceal carcinoma. A 62-year-old woman presented with abdominal pain. US and CT showed a tumor measuring 5 × 4 × 4 cm in vermiform appendix. Colon endoscopy showed mucosal elevation and irregularity in the orifice of vermiform appendix. A biopsy of the appendiceal mucosa showed no significant changes. Clinical diagnosis was appendiceal carcinoma and wide excision of terminal ileum, appendix, cecum, and ascending colon was performed. Grossly, the appendix showed a tumor measuring 5 × 3 × 4 cm. The appendiceal lumen was opened, and the appendiceal mucosa was elevated and irregular. The periappendiceal tissue showed thickening. Microscopically, the lesion was multiple appendiceal diverticula. The diverticula were penetrating the muscle layer. The mucosa showed erosions in places. Much fibrosis, abscess formations, and lymphocytic infiltration were seen in the subserosa. Abscesses were also seen in the diverticular lumens. Some diverticula penetrated into the subserosa. The pathologic diagnosis was appendiceal diverticulitis. When they encounter an appendiceal mass, clinicians should consider appendiceal diverticulitis as a differential diagnosis.

  2. Appendiceal Abscesses Reduced in Size by Drainage of Pus from the Appendiceal Orifice during Colonoscopy: A Report of Three Cases

    Directory of Open Access Journals (Sweden)

    Shinjiro Kobayashi

    2014-11-01

    Full Text Available Interval appendectomy (IA for appendiceal abscesses is useful for avoiding extended surgery and preventing postoperative complications. However, IA has problems in that it takes time before an abscess is reduced in size in some cases and in that elective surgery may result in a delay in treatment in patients with a malignant tumor of the appendix. In order to rule out malignancy, we performed colonoscopy on three patients with an appendiceal abscess that did not decrease in size 5 or more days after IA. After malignancy had been ruled out by examination of the area of the appendiceal orifice, the appendiceal orifice was compressed with a colonoscope, and a catheter was inserted through the orifice. Then, drainage of pus was observed from the appendiceal orifice into the cecal lumen. Computed tomography performed 3 days after colonoscopy revealed a marked reduction in abscess size in all patients. No endoscopy-related complication was noted. Colonoscopy in patients with an appendiceal abscess may not only differentiate malignant tumors, but also accelerate reduction in abscess size.

  3. Acute abdominal pain presenting as a rare appendiceal duplication: a case report

    Directory of Open Access Journals (Sweden)

    Mahmood Ali

    2012-03-01

    Full Text Available Abstract Introduction Appendiceal duplication is a rare anomaly that can manifest as right lower quadrant pain. There are several variations described for this condition. We recommend aggressive operative management should this anatomical variation present in the presence of acute appendicitis. Case presentation We report the case of a 15-year-old African American girl who presented to our hospital with right lower quadrant pain and was subsequently found to have appendiceal duplication. Conclusion There are two categorical systems that have described and stratified appendiceal duplication. Both classification systems have been outlined and referenced in this case report. A computed tomography scan has been included to provide a visual aid to help identify true vermiform appendiceal duplication. The presence of this anatomical abnormality is not a reason for surgical intervention; however, should this be found in the setting of acute appendicitis, aggressive resection of both appendices is mandatory.

  4. Appendiceal Adenocarcinoma Presenting as a Rectal Polyp

    Directory of Open Access Journals (Sweden)

    Erin Fitzgerald

    2016-02-01

    Full Text Available Appendiceal adenocarcinoma typically presents as an incidentally noted appendiceal mass, or with symptoms of right lower quadrant pain that can mimic appendicitis, but local involvement of adjacent organs is uncommon, particularly as the presenting sign. We report on a case of a primary appendiceal cancer initially diagnosed as a rectal polyp based on its appearance in the rectal lumen. The management of the patient was in keeping with standard practice for a rectal polyp, and the diagnosis of appendiceal adenocarcinoma was made intraoperatively. The operative strategy had to be adjusted due to this unexpected finding. Although there are published cases of appendiceal adenocarcinoma inducing intussusception and thus mimicking a cecal polyp, there are no reports in the literature describing invasion of the appendix through the rectal wall and thus mimicking a rectal polyp. The patient is a 75-year-old female who presented with spontaneous hematochezia and, on colonoscopy, was noted to have a rectal polyp that appeared to be located within a diverticulum. When endoscopic mucosal resection was not successful, she was referred to colorectal surgery for a low anterior resection. Preoperative imaging was notable for an enlarged appendix adjacent to the rectum. Intraoperatively, the appendix was found to be densely adherent to the right lateral rectal wall. An en bloc resection of the distal sigmoid colon, proximal rectum and appendix was performed, with pathology demonstrating appendiceal adenocarcinoma that invaded through the rectal wall. The prognosis in this type of malignancy weighs heavily on whether or not perforation and spread throughout the peritoneal cavity have occurred. In this unusual presentation, an en bloc resection is required for a complete resection and to minimize the risk of peritoneal spread. Unusual appearing polyps do not always originate from the bowel wall. Abnormal radiographic findings adjacent to an area of

  5. Cerebral Metastasis from a Previously Undiagnosed Appendiceal Adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Antonio Biroli

    2012-01-01

    Full Text Available Brain metastases arise in 10%–40% of all cancer patients. Up to one third of the patients do not have previous cancer history. We report a case of a 67-years-old male patient who presented with confusion, tremor, and apraxia. A brain MRI revealed an isolated right temporal lobe lesion. A thorax-abdomen-pelvis CT scan showed no primary lesion. The patient underwent a craniotomy with gross-total resection. Histopathology revealed an intestinal-type adenocarcinoma. A colonoscopy found no primary lesion, but a PET-CT scan showed elevated FDG uptake in the appendiceal nodule. A right hemicolectomy was performed, and the specimen showed a moderately differentiated mucinous appendiceal adenocarcinoma. Whole brain radiotherapy was administrated. A subsequent thorax-abdomen CT scan revealed multiple lung and hepatic metastasis. Seven months later, the patient died of disease progression. In cases of undiagnosed primary lesions, patients present in better general condition, but overall survival does not change. Eventual identification of the primary tumor does not affect survival. PET/CT might be a helpful tool in detecting lesions of the appendiceal region. To the best of our knowledge, such a case was never reported in the literature, and an appendiceal malignancy should be suspected in patients with brain metastasis from an undiagnosed primary tumor.

  6. Bladder metastases of appendiceal mucinous adenocarcinoma: a case presentation

    Directory of Open Access Journals (Sweden)

    Giusti Guido

    2010-02-01

    Full Text Available Abstract Background Appendiceal adenocarcinoma is rare with a frequency of 0.08% of all surgically removed appendices. Few cases of appendiceal carcinoma infiltrating the bladder wall for spatial contiguity have been documented. Case Presentation A case is reported of a 45-years old woman with mucinous cystadenocarcinoma of the appendix with bladder metastasis. Although ultrasonography and voided urinary cytology were negative, abdomen computed tomography (CT scan and cystoscopy and subsequent pathological examination revealed a mass exclusively located in the anterior wall of the bladder. Histopathology of the transurethral bladder resection revealed a bladder adenocarcinoma [6 cm (at the maximum diameter × 2,5 cm; approximate weight: 10 gr] with focal mucinous aspects penetrating the muscle and perivisceral fat. Laparotomy evidenced the presence of a solid mass of the appendix (2,5 cm × 3 cm × 2 cm extending to the loco-regional lymph nodes. Appendectomy and right hemicolectomy, linfoadenectomy and partial cystectomy were performed. The subsequent pathological examination revealed a mucinous cystadenocarcinoma of the appendix with metastatic cells colonising the anterior bladder wall and several colic lymph nodes. Conclusions The rarity of the appendiceal carcinoma invading the urinary bladder and its usual involvement of nearest organs and the posterior bladder wall, led us to describe this case which demonstrates the ability of the appendiceal cancer to metastasize different regions of urinary bladder.

  7. C-reactive Protein may Predict the Recurrence of Appendicitis in Children Formerly with Appendiceal Mass after Successful Non-operative Treatment.

    Science.gov (United States)

    Chang, Yi-Jung; Chao, Hsun-Chin; Chen, Chyi-Liang; Chen, Shin-Yann; Yan, Dah-Chin; Tsai, Ming-Han

    2017-08-01

    This study identified factors associated with the recurrence of appendicitis in children with appendiceal masses after successful nonsurgical treatment. In this retrospective study, children who were diagnosed as having appendiceal masses after undergoing conservative treatment between 2000 and 2014 were enrolled and the medical records of those who did not undergo an interval appendectomy were reviewed. The clinical features and outcomes of patients with and those without recurrent appendicitis were compared. Regression analysis was used to identify risk factors of appendicitis recurrence. Seventy patients were included and successfully discharged after receiving nonsurgical treatment for appendiceal masses. Of the patients, 35 (50.0%) developed recurrent appendicitis and 85.7% (30/35) recurrences developed within 3 months. Multivariate analyses showed that patients with a higher serum C-reactive protein (CRP) level and peritonitis more frequently developed recurrence. The appendicitis recurrence rate was significantly higher in the patients with CRP levels of ≥103 mg/L with an odds ratio of 16.9 or in those with peritonitis with an odds ratio of 4.9. Children with appendiceal masses who develop peritonitis or have CRP levels of ≥103 mg/L have a higher recurrence rate of appendicitis and should undergo an interval appendectomy. Copyright © 2017. Published by Elsevier B.V.

  8. A Case of Appendiceal Adenocarcinoma with Clinical Benefit from FOLFOX and Bevacizumab

    Directory of Open Access Journals (Sweden)

    Erin D. Powell

    2009-07-01

    Full Text Available A 44-year-old woman presented with lower abdominal pain and bilateral ovarian masses on ultrasound. Exploratory laparotomy revealed extensive peritoneal and intra-abdominal disease and an abnormal appendix. Bilateral salpingo-oophorectomy, infracolic omentectomy, ileocolic resection and primary anastomosis were performed. Final pathology revealed a primary appendiceal adenocarcinoma, poorly differentiated, of signet ring cell type. CT scan postoperatively revealed gross residual disease. The patient was treated with FOLFOX chemotherapy combined with bevacizumab. Repeat CT scan showed a decrease in residual disease and the patient clinically improved. After her treatment has been continued for 13 months, she remains clinically well and her CT scan shows sustained disease stability. Disseminated appendiceal carcinoma is generally considered to be refractory to 5-FU-based chemotherapy and, to our knowledge, this is the first reported case of a patient with appendiceal adenocarcinoma demonstrating clinical benefit and sustained stability of disease with combination chemotherapy plus bevacizumab.

  9. Resolution of the Task A-11 reactor-vessel materials-toughness safety issue. Appendices C-K

    International Nuclear Information System (INIS)

    1982-10-01

    The central problem in the unresolved safety issue A-11, Reactor Vessel Materials Toughness, was to provide guidance in performing analyses required by 10 CFR Part 50, Appendix G, Section V.C. for reactor pressure vessels (RPVs) which fail to meet the toughness requirement during service life as a result of neutron radiation embrittlement. Although the methods of linear-elastic fracture mechanics (LEFM) were adequate for low-temperature RPV problems, they were inapplicable under operating conditions because vessel steels, even those which exhibit less than 50 ft-lb of C/sub v/ energy, were relatively tough at temperatures where the impact energy reached its upper shelf values. A technical team of recognized experts was organized to assist the NRC staff in addressing the problem. Using the foundation of the tearing modulus concept, which had been developed under earlier NRC sponsorship, relationships were obtained which provided approximate solutions to the problem of RPV fracture with assumed beltline region flaws. The first paper of this report is a summary of the problem, the solutions, and the results of verification analyses. The details are provided in a series of appendices in Volumes I and II

  10. Bladder metastases of appendiceal mucinous adenocarcinoma: a case presentation

    International Nuclear Information System (INIS)

    Taverna, Gianluigi; Graziotti, Pierpaolo; Corinti, Matteo; Colombo, Piergiuseppe; Grizzi, Fabio; Severo, Mauro; Piccinelli, Alessando; Giusti, Guido; Benetti, Alessio; Zucali, Paolo A

    2010-01-01

    Appendiceal adenocarcinoma is rare with a frequency of 0.08% of all surgically removed appendices. Few cases of appendiceal carcinoma infiltrating the bladder wall for spatial contiguity have been documented. A case is reported of a 45-years old woman with mucinous cystadenocarcinoma of the appendix with bladder metastasis. Although ultrasonography and voided urinary cytology were negative, abdomen computed tomography (CT) scan and cystoscopy and subsequent pathological examination revealed a mass exclusively located in the anterior wall of the bladder. Histopathology of the transurethral bladder resection revealed a bladder adenocarcinoma [6 cm (at the maximum diameter) × 2,5 cm; approximate weight: 10 gr] with focal mucinous aspects penetrating the muscle and perivisceral fat. Laparotomy evidenced the presence of a solid mass of the appendix (2,5 cm × 3 cm × 2 cm) extending to the loco-regional lymph nodes. Appendectomy and right hemicolectomy, linfoadenectomy and partial cystectomy were performed. The subsequent pathological examination revealed a mucinous cystadenocarcinoma of the appendix with metastatic cells colonising the anterior bladder wall and several colic lymph nodes. The rarity of the appendiceal carcinoma invading the urinary bladder and its usual involvement of nearest organs and the posterior bladder wall, led us to describe this case which demonstrates the ability of the appendiceal cancer to metastasize different regions of urinary bladder

  11. No-migration variance petition. Appendices C--J: Volume 5, Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1990-03-01

    Volume V contains the appendices for: closure and post-closure plans; RCRA ground water monitoring waver; Waste Isolation Division Quality Program Manual; water quality sampling plan; WIPP Environmental Procedures Manual; sample handling and laboratory procedures; data analysis; and Annual Site Environmental Monitoring Report for the Waste Isolation Pilot Plant.

  12. CT features of appendiceal mucocele

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Won Jong; Byun, Jae Young; Jung, Jung Im; Lee, Hae Gyu; Park, Young Ha; Shin, Kyung Sub [Catholic University Medical College, Seoul (Korea, Republic of)

    1995-10-15

    To evaluate the usefulness of CT features of appendiceal mucocele in the diagnosis and evaluation of complications. We retrospectively reviewed CT findings and compared with operative findings in 7 cases of pathologically proven appendiceal mucocele. CT findings such as location and extent of the lesion, tissue density, thickness or calcification of the wall, presence of adjacent inflammatory infiltration, and visualization of normal vermiform appendix were analyzed. Appendiceal mucocele was found as homogeneous low density cystic mass adjacent to the cecum, which has no surrounding inflammatory infiltration except in one case of perforation and one case of intussusception. Mean CT number measured in 4 cases was 21 Hounsfield unit. Thin curvilinear calcifications were noted along the cystic wall in 2 cases. Normal vermiform appendix couldn't be demonstrated in all cases. Appendiceal mucocele is characterized by homogeneously low density and thin walled cystic tumor adjacent to cecum without surrounding inflammatory infiltration, and absence of normal vermiform appendix on CT. Therefore, CT is valuable in preventing operative complications of appendiceal mucocele.

  13. The environmental impact statement for the Nevada Test Site and off-site locations in the State of Nevada. Volume 1, Appendices A-F

    International Nuclear Information System (INIS)

    1996-01-01

    This volume contains appendices to the named document. The Appendices are entitled (A) Description of Projects and Activities, (2) Federal Register Notice, (C) Relevant Regulatory Requirements, (D) Distribution Lists, (E) Impact Assessment Methods, and (F) Project-Specific Environmental Analysis

  14. Economic evaluation of the annual cycle energy system (ACES). Final report. Volume III, appendices

    Energy Technology Data Exchange (ETDEWEB)

    1980-06-01

    This volume consists of seven appendices related to ACES, the first three of which are concerned with computer programs. The appendices are entitled: (A) ACESIM: Residential Program Listing; (B) Typical Inputs and Outputs of ACESIM; (C) CACESS: Commercial Building Program Listing; (D) Typical Weather-Year Selection Requirements; (E) Building Characteristics; (F) List of Major Variables Used in the Computer Programs; and (G) Bibliography. 79 references.

  15. Low-Grade Appendiceal Mucinous Neoplasm Involving the Endometrium and Presenting with Mucinous Vaginal Discharge

    Directory of Open Access Journals (Sweden)

    Vera Vavinskaya

    2016-01-01

    Full Text Available Primary appendiceal mucinous lesions are uncommon and represent a spectrum from nonneoplastic mucous retention cysts to invasive adenocarcinoma. Low-grade appendiceal mucinous neoplasms (LAMNs represent an intermediate category on this spectrum and can be classified according to whether or not they are confined to the appendix. Although LAMNs are frequently confined to the appendix, they can also spread to the peritoneum and clinically progress as pseudomyxoma peritonei (i.e., mucinous ascites. Thus, the appropriate classification of appendiceal primary neoplasia is essential for prognosis and influences clinical management. In addition, the precise classification, management, and clinical outcome of patients with disseminated peritoneal disease remain controversial. Here, we report an unusual case of LAMN with pseudomyxoma peritonei that initially presented with mucinous and bloody vaginal discharge. Pathological evaluation revealed low-grade appendiceal mucinous neoplasm with secondary involvement of the peritoneum, ovaries, and endometrial surface. Therefore, LAMN should be considered in the differential diagnosis of mucinous vaginal discharge.

  16. Large scale solar district heating. Evaluation, modelling and designing - Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Heller, A.

    2000-07-01

    The appendices present the following: A) Cad-drawing of the Marstal CSHP design. B) Key values - large-scale solar heating in Denmark. C) Monitoring - a system description. D) WMO-classification of pyranometers (solarimeters). E) The computer simulation model in TRNSYS. F) Selected papers from the author. (EHS)

  17. Appendiceal Mucocele in an Elderly Patient: How Much Surgery

    Directory of Open Access Journals (Sweden)

    C. Kim-Fuchs

    2011-09-01

    Full Text Available Appendiceal mucoceles are rare cystic lesions with an incidence of 0.3–0.7% of all appendectomies. They are divided into four subgroups according to their histology. Even though the symptoms may vary – depending on the level of complication – from right lower quadrant pain, signs of intussusception, gastrointestinal bleeding to an acute abdomen with sepsis, most mucoceles are asymptomatic and found incidentally. We present the case of a 70-year-old patient with an incidentally found appendiceal mucocele. He was seen at the hospital for backache. The CT scan showed a vertebral fracture and a 7-cm appendiceal mass. A preoperative colonoscopy displayed several synchronous adenomas in the transverse and left colon with high-grade dysplasia. In order to lower the cancer risk of this patient, we performed a subtotal colectomy. The appendiceal mass showed no histopathological evidence of malignancy and no sign of perforation. The follow-up was therefore limited to 2 months. In this case, appendectomy would have been sufficient to treat the mucocele alone. The synchronous high-grade dysplastic adenomas were detected in the preoperative colonoscopy and determined the therapeutic approach. Generally, in the presence of positive lymph nodes, a right colectomy is the treatment of choice. In the histological presence of mucinous peritoneal carcinomatosis, cytoreductive surgery with hyperthermic intraperitoneal chemotherapy is indicated. In conclusion, mucoceles of the appendix are detected with high sensitivity by CT scan. If there is no evidence of synchronous tumor preoperatively and no peritoneal spillage, invasion or positive sentinel lymph nodes during surgery, a mucocele is adequately treated by appendectomy.

  18. Hyperbilirubinemia as a predictor for appendiceal perforation

    DEFF Research Database (Denmark)

    Burcharth, J; Pommergaard, H C; Rosenberg, J

    2013-01-01

    Delayed or wrong diagnosis in patients with appendicitis can result in perforation and consequently increased morbidity and mortality. Serum bilirubin may be a useful marker for appendiceal perforation. The purpose of this systematic review was to evaluate studies investigating elevated serum...

  19. Radiation dose to construction workers at operating nuclear power plant sites. Volume 2. Appendices A--F. Final report, September 1975--September 1978

    International Nuclear Information System (INIS)

    Endres, G.W.R.; Shipler, D.B.

    1978-12-01

    These appendices contain the dosimetry procedures and details of the personnel and environmental dosimeters used for the Radiation Dose to Construction Workers at Operating Nuclear Power Plant Sites Study. A printout of the computer codes used to analyze dosimeter data is included along with all the raw data obtained. Appendices C through F contain computer output and log-normal plots of dosimetry data for environmental location and construction worker groups

  20. Remedial Action Plan for the codisposal and stabilization of the Monument Valley and Mexican Hat uranium mill tailings at Mexican Hat, Utah: Appendices C--E. Final report

    International Nuclear Information System (INIS)

    1993-02-01

    This document provides appendices C, D, and E this Remedial Action Plan (RAP) which is a revision of the original Mexican Hat Remedial Action Plan and RAP Modification submitted in July 1988 and January 1989, respectively, along with updated design documents. Appendix C provide the Radiological Support Plan, Appendix D provides the Site Characterization, and Appendix E provides the Water Resources Protection Strategy

  1. Remedial Action Plan for the codisposal and stabilization of the Monument Valley and Mexican Hat uranium mill tailings at Mexican Hat, Utah: Appendices C--E. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1993-02-01

    This document provides appendices C, D, and E this Remedial Action Plan (RAP) which is a revision of the original Mexican Hat Remedial Action Plan and RAP Modification submitted in July 1988 and January 1989, respectively, along with updated design documents. Appendix C provide the Radiological Support Plan, Appendix D provides the Site Characterization, and Appendix E provides the Water Resources Protection Strategy.

  2. Comment Hobbes tente de rendre son matérialisme acceptable dans les appendices du Léviathan

    Directory of Open Access Journals (Sweden)

    Anne Staquet

    2011-11-01

    Full Text Available Le Léviathan de Hobbes [1651] a subi de nombreuses attaques, au point qu’il est jugé responsable de la grande peste de 1665 et de l’incendie de Londres l’année suivante et que le parlement ouvre une procédure contre l’ouvrage. Aussi, lorsqu’en 1666, Thomas Hobbes veut publier la traduction latine de ce livre, il y adjoint trois appendices. La version latine de l’œuvre est généralement jugée plus acceptable que le texte originaire anglais. En étudiant la manière dont Hobbes traite de son matérialisme dans ces appendices, je tente de montrer que les addenda latins ne constituent en aucune manière un retour en arrière du texte, mais que le philosophe enrobe simplement davantage des propos que, par ailleurs, il rend plus radicaux.Hobbes’s Leviathan [1651] has been critiqued so much that it was held responsible for the Great Plague of 1665 and the Fire of London during the following year, resulting in the Parliament instituting proceedings against the book. Therefore, when in 1666 Thomas Hobbes wanted to publish a Latin translation of this book, he added three appendices. Generally, the Latin version of the work is considered more acceptable than the English original text. By studying how Hobbes deals with his materialism in these appendices, I try to show that the Latin additions are in no way a reversal of the text, but that the philosopher simply veiled more propositions, while at the same time making them more radical.

  3. Foothills Parkway Section 8B Final Environmental Report, Volume 2, Appendices A-C

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NW, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this EN there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constricting Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER, which consists of Appendices A, B, and C, assesses the potential geologic impacts of the proposed Section 8B construction, presents the results of the Section 8B soil survey, and describes the water quality studies and analyses performed for the ER. The following summary sections provide information for geology, soils, and water quality.

  4. Appendiceal-sigmoid fistula presenting in a man with ulcerative colitis: a case report

    Directory of Open Access Journals (Sweden)

    Minutolo Vincenzo

    2010-07-01

    Full Text Available Abstract Introduction Ulcerative colitis is a chronic disease characterized by diffuse mucosal inflammation limited to the colon. It mostly affects young adults, yet a large number of middle-aged and older patients with ulcerative colitis have also been reported. Case presentation A 58-year-old Caucasian man presented to our hospital in August 2006 with continuous and diffuse abdominal pain, meteorism, fever and bloody diarrhea. He had a two-year history of ulcerative colitis. Our patient was treated with intravenous medical therapy. As his condition worsened, he underwent surgery. An explorative laparotomy revealed that the entire colon was distended and pus was found around an appendiceal-sigmoid fistula. Conclusions Therapy for ulcerative colitis is a rapidly evolving field, with many new biological agents under investigation that are likely to change therapeutic strategies radically in the next decade. Indications for surgery are intractability (49%, stricture, dysplasia, toxic colitis, hemorrhage and perforation. To the best of our knowledge, this is the first case of an appendiceal-sigmoid fistula in a patient affected by ulcerative colitis reported in the literature. Fistulae between the appendix and the sigmoid tract are rarely reported in cases of diverticular disease and appendicitis.

  5. Special Education Finance in California. Technical Appendices

    Science.gov (United States)

    Hill, Laura; Warren, Paul; Murphy, Patrick; Ugo, Iwunze; Pathak, Aditi

    2016-01-01

    This document presents the technical appendices that accompany the full report, "Special Education Finance in California." The appendices include: (1) Problems with AB 602 and Other State Funding Programs for Special Education; (2) Additional Figures for Analysis of Distribution of Students with Disabilities; (3) Using Supplemental and…

  6. Transmission System Vegetation Management Program. Draft Environmental Impact Statement - Appendices

    International Nuclear Information System (INIS)

    1999-01-01

    The appendices covered in this Draft Environmental Impact Statement are: Appendix A--Public involvement; Appendix B--Biological weed control agents; Appendix C--BPA herbicide licensing plan; Appendix D--Sample educational information; Appendix E--Clearance criteria; Appendix F--USFS mitigation measures and background; Appendix G--BLM mitigation measures and background and Appendix H--Pesticide fact sheets

  7. Appendiceal diameter: CT versus sonographic measurements

    Energy Technology Data Exchange (ETDEWEB)

    Orscheln, Emily S. [University of Cincinnati Medical Center, Department of Radiology, Cincinnati, OH (United States); Trout, Andrew T. [Cincinnati Children' s Hospital Medical Center, Department of Radiology, Cincinnati, OH (United States)

    2016-03-15

    Ultrasound and CT are the dominant imaging modalities for assessment of suspected pediatric appendicitis, and the most commonly applied diagnostic criterion for both modalities is appendiceal diameter. The classically described cut-off diameter for the diagnosis of appendicitis is 6 mm when using either imaging modality. To demonstrate the fallacy of using the same cut-off diameter for both CT and US in the diagnosis of appendicitis. We conducted a retrospective review of patients younger than 18 years who underwent both US and CT of the appendix within 24 h. The shortest transverse dimension of the appendix was measured at the level of the proximal, mid and distal appendix on US and CT images. We compared mean absolute difference in appendiceal diameter between US and CT, using the paired t-test. We reviewed exams of 155 children (58.7% female) with a mean age of 11.3 ± 4.2 years; 38 of the children (24.5%) were diagnosed with appendicitis. The average time interval between US and CT was 7.0 ± 5.4 h. Mean appendiceal diameter measured by CT was significantly larger than that measured by US in cases without appendicitis (5.3 ± 1.0 mm vs. 4.7 ± 1.1 mm, P < 0.0001) and in cases with appendicitis (8.3 ± 2.2 mm vs. 7.0 ± 2.0 mm, P < 0.0001). Mean absolute diameter difference at any location along the appendix was 1.3-1.4 mm in normal appendices and 2 mm in cases of appendicitis. Measured appendiceal diameter differs between US and CT by 1-2 mm, calling into question use of the same diameter cut-off (6 mm) for both modalities for the diagnosis of appendicitis. (orig.)

  8. Appendiceal diameter: CT versus sonographic measurements

    International Nuclear Information System (INIS)

    Orscheln, Emily S.; Trout, Andrew T.

    2016-01-01

    Ultrasound and CT are the dominant imaging modalities for assessment of suspected pediatric appendicitis, and the most commonly applied diagnostic criterion for both modalities is appendiceal diameter. The classically described cut-off diameter for the diagnosis of appendicitis is 6 mm when using either imaging modality. To demonstrate the fallacy of using the same cut-off diameter for both CT and US in the diagnosis of appendicitis. We conducted a retrospective review of patients younger than 18 years who underwent both US and CT of the appendix within 24 h. The shortest transverse dimension of the appendix was measured at the level of the proximal, mid and distal appendix on US and CT images. We compared mean absolute difference in appendiceal diameter between US and CT, using the paired t-test. We reviewed exams of 155 children (58.7% female) with a mean age of 11.3 ± 4.2 years; 38 of the children (24.5%) were diagnosed with appendicitis. The average time interval between US and CT was 7.0 ± 5.4 h. Mean appendiceal diameter measured by CT was significantly larger than that measured by US in cases without appendicitis (5.3 ± 1.0 mm vs. 4.7 ± 1.1 mm, P < 0.0001) and in cases with appendicitis (8.3 ± 2.2 mm vs. 7.0 ± 2.0 mm, P < 0.0001). Mean absolute diameter difference at any location along the appendix was 1.3-1.4 mm in normal appendices and 2 mm in cases of appendicitis. Measured appendiceal diameter differs between US and CT by 1-2 mm, calling into question use of the same diameter cut-off (6 mm) for both modalities for the diagnosis of appendicitis. (orig.)

  9. Advisory Committee on human radiation experiments. Supplemental Volume 2a, Sources and documentation appendices. Final report

    International Nuclear Information System (INIS)

    1995-01-01

    This large document provides a catalog of the location of large numbers of reports pertaining to the charge of the Presidential Advisory Committee on Human Radiation Research and is arranged as a series of appendices. Titles of the appendices are Appendix A- Records at the Washington National Records Center Reviewed in Whole or Part by DoD Personnel or Advisory Committee Staff; Appendix B- Brief Descriptions of Records Accessions in the Advisory Committee on Human Radiation Experiments (ACHRE) Research Document Collection; Appendix C- Bibliography of Secondary Sources Used by ACHRE; Appendix D- Brief Descriptions of Human Radiation Experiments Identified by ACHRE, and Indexes; Appendix E- Documents Cited in the ACHRE Final Report and other Separately Described Materials from the ACHRE Document Collection; Appendix F- Schedule of Advisory Committee Meetings and Meeting Documentation; and Appendix G- Technology Note

  10. Advisory Committee on human radiation experiments. Supplemental Volume 2a, Sources and documentation appendices. Final report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-01

    This large document provides a catalog of the location of large numbers of reports pertaining to the charge of the Presidential Advisory Committee on Human Radiation Research and is arranged as a series of appendices. Titles of the appendices are Appendix A- Records at the Washington National Records Center Reviewed in Whole or Part by DoD Personnel or Advisory Committee Staff; Appendix B- Brief Descriptions of Records Accessions in the Advisory Committee on Human Radiation Experiments (ACHRE) Research Document Collection; Appendix C- Bibliography of Secondary Sources Used by ACHRE; Appendix D- Brief Descriptions of Human Radiation Experiments Identified by ACHRE, and Indexes; Appendix E- Documents Cited in the ACHRE Final Report and other Separately Described Materials from the ACHRE Document Collection; Appendix F- Schedule of Advisory Committee Meetings and Meeting Documentation; and Appendix G- Technology Note.

  11. Laboratory Evaluation of In Situ Chemical Oxidation for Groundwater Remediation, Test Area North, Operable Unit 1-07B, Idaho National Engineering and Environmental Laboratory, Volume Two, Appendices C, D, and E

    Energy Technology Data Exchange (ETDEWEB)

    Cline, S.R.; Denton, D.L.; Giaquinto, J.M.; McCracken, M.K.; Starr, R.C.

    1999-04-01

    These appendices support the results and discussion of the laboratory work performed to evaluate the feasibility of in situ chemical oxidation for Idaho National Environmental and Engineering Laboratory's (INEEL) Test Area North (TAN) which is contained in ORNL/TM-1371 l/Vol. This volume contains Appendices C-E. Appendix C is a compilation of all recorded data and mathematical calculations made to interpret the data. For the Task 3 and Task 4 work, the spreadsheet column definitions are included immediately before the actual spreadsheet pages and are listed as ''Sample Calculations/Column Definitions'' in the table of contents. Appendix D includes the chronological order in which the experiments were conducted and the final project costs through October 1998. Appendix E is a compilation of the monthly progress reports submitted to INEEL during the course of the project.

  12. Radiological performance assessment for the E-Area Vaults Disposal Facility. Appendices A through M

    Energy Technology Data Exchange (ETDEWEB)

    Cook, J.R.

    1994-04-15

    These document contains appendices A-M for the performance assessment. They are A: details of models and assumptions, B: computer codes, C: data tabulation, D: geochemical interactions, E: hydrogeology of the Savannah River Site, F: software QA plans, G: completeness review guide, H: performance assessment peer review panel recommendations, I: suspect soil performance analysis, J: sensitivity/uncertainty analysis, K: vault degradation study, L: description of naval reactor waste disposal, M: porflow input file. (GHH)

  13. Appendiceal Endometriosis: A case Report and Literature Review ...

    African Journals Online (AJOL)

    Appendiceal endometriosis is a very rare and usually asymptomatic condiction, but can result in severe complications such as intestinal perforation, massive gastrointestinal bleeding or intussusception. We report a case of endometriosis of the appendix presenting as acute appendicitis. The patient was a 36 year old ...

  14. Report on corrections and future considerations for Appendices II–VIII of the International Code of Nomenclature for Algae, Fungi, and Plants

    Science.gov (United States)

    For the first time, the main text and Appendices II–VIII of the International Code of Nomenclature were separately published following decisions of the Melbourne Nomenclature Section, which contributed to subsequent development of an online resource capable of producing the Appendices in real time. ...

  15. Significance of appendiceal thickening in association with typhlitis in pediatric oncology patients

    International Nuclear Information System (INIS)

    McCarville, M.B.; Thompson, J.; Adelman, C.S.; Lee, M.O.; Li, C.; Alsammarae, D.; Rao, B.N.; May, M.V.; Jones, S.C.; Sandlund, J.T.

    2004-01-01

    Background: The management of pediatric oncology patients with imaging evidence of appendiceal thickening is complex because they are generally poor surgical candidates and often have confounding clinical findings. Objective: We sought to determine the significance of appendiceal thickening in pediatric oncology patients who also had typhlitis. Specifically, we evaluated the impact of this finding on the duration of typhlitis, its clinical management, and outcome. Materials and methods: From a previous review of the management of typhlitis in 90 children with cancer at our institution, we identified 4 with imaging evidence of appendiceal thickening. We compared colonic wall measurements, duration of typhlitis symptoms, management, and outcome of patients with appendiceal thickening and typhlitis to patients with typhlitis alone. Results: There was no significant difference in duration of typhlitis symptoms between patients with typhlitis only (15.6 ± 1.2 days) and those with typhlitis and appendiceal thickening (14.5 ± 5.8 days; P = 0.9). Two patients with appendiceal thickening required surgical treatment for ischemic bowel, and two were treated medically. Only one patient in the typhlitis without appendiceal thickening group required surgical intervention. There were no deaths in children with appendiceal thickening; two patients died of complications of typhlitis alone. (orig.)

  16. Radiographic features of appendiceal colic in children

    International Nuclear Information System (INIS)

    Schisgall, R.M.

    1986-01-01

    The concept of appendiceal colic was introduced in 1980 to explain the common problem of recurrent crampy abdominal pain (RAP) in children. Children with appendiceal colic often have inspissated casts of stool as foreign bodies of the appendix. The radiographic findings of 115 children operated upon for appendiceal colic have been reviewed. The radiographic features of this syndrom have included: filling defects of the appendix (83% incidence of inspissated casts of stool within the appendix); partial filling of the appendix (44% incidence of fecal casts); retained barium behind 72 h (92% incidence of fecal casts blocking egress of barium); non-visualization of the appendix (42% incidence of fecal casts); and distention of the appendix (100% incidence of fecal casts). The correlation of radiographic and operative findings will be presented. A rational approach to the radiographic workup of a child with RAP will be presented. (orig.)

  17. Computed tomography of appendiceal mucocele and peritoneal pseudomyxoma

    International Nuclear Information System (INIS)

    Lund, G.; Lien, H.H.

    1982-01-01

    Peritoneal pseudomyxoma is a colloidal growth, which develops on the peritoneum, often secondary to an ovarian tumor or mucocele of the appendix. The conventional radiographic findings of appendiceal mucocele were described by Akerlund, and the CT-pseudomyxoma have been reported by Seshul and Coulam. The present case illustrates the CT-findings of an appendiceal mucocele as well as the complicating peritoneal pseudomyxoma. (orig.)

  18. Development of a dynamic model to evaluate economic recovery following a nuclear attack. Volume 2. Model equations (appendices C and D). Final report

    International Nuclear Information System (INIS)

    Peterson, D.W.; Silverman, W.S.; Weil, H.B.; Willard, S.

    1980-11-01

    A highly-robust, dynamic simulation model of the US economy has been constructed to evaluate the likely economic response after various nuclear attacks or other severe disruptions, under various policies and assumptions. The model consists of a large system of nonlinear, recursive, time-difference equations. The solution-interval of the model is adjustable, with a maximum value of three weeks. The model represents the economy in thirteen sectors. Each sector contains a detailed representation of production, distribution, supply constraints, finance, employment, pricing, and wages. Also included are a full input-output representation of the interconnections among the sectors, and the psychological responses of corporate planners, consumers, and the labor force. The model's equations are formulated to remain consistent and realistic for all values of the variables, including the most extreme conditions. Therefore, the model can realistically simulate any degree or time sequence of nuclear attacks, pre-attack surges, mobilization, or policy shifts. Simulation experiments with the model suggest that the economy is highly vulnerable to nuclear attack, and that recovery requires extensive preparation, including psychological readiness, technology maintenance, special financial policies, and (if possible) maintenance of foreign trade. Civil defense policies must be adaptive (contingent on the nature of the damage) and must strive for balance among sectors, rather than maximum survival. The simulation model itself consists of an interrelated set of mathematical equations, written in the computer language DYNAMO. Two appendices to the report are presented in this volume. Appendix C gives a brief introduction to the conventions and notations of the DYNAMO language. The equations, definitions, and variables of the model are listed in Appendix D. For the convenience of the reader, these two appendices are bound separately

  19. Immunohistochemistry - Microarray Analysis of Patients with Peritoneal Metastases of Appendiceal or Colorectal Origin

    Directory of Open Access Journals (Sweden)

    Danielle E Green

    2015-01-01

    Full Text Available BackgroundThe value of immunohistochemistry (IHC-microarray analysis of pathological specimens in the management of patients is controversial although preliminary data suggests potential benefit. We describe the characteristics of patients undergoing a commercially available IHC-microarray method in patients with peritoneal metastases (PM and the feasibility of this technique in this population.MethodsWe retrospectively analyzed consecutive patients with pathologically confirmed PM from appendiceal or colorectal primary who underwent Caris Molecular IntelligenceTM testing. IHC, microarray, FISH and mutational analysis were included and stratified by PCI score, histology and treatment characteristics. Statistical analysis was performed using non-parametric tests.ResultsOur study included 5 patients with appendiceal and 11 with colorectal PM. The median age of patients was 51 (IQR 39-65 years, with 11(68% female. The median PCI score of the patients was 17(IQR 10-25. Hyperthermic intra-peritoneal chemoperfusion (HIPEC was performed in 4 (80% patients with appendiceal primary tumors and 4 (36% with colorectal primary. KRAS mutations were encountered in 40% of appendiceal vs. 30% colorectal tumors, while BRAF mutations were seen in 40% of colorectal PM and none of the patients with appendiceal PM (p=0.06. IHC biomarker expression was not significantly different between the two primaries. Sufficient tumor for microarray analysis was found in 44% (n=7 patients, which was not associated with previous use of chemotherapy (p>0.20 for 5-FU/LV, Irinotecan and Oxaliplatin.ConclusionsIn a small sample of patients with peritoneal metastases, the feasibility and results of IHC-microarray staining based on a commercially available test is reported. The apparent high incidence of the BRAF mutation in patients with PM may potentially offer opportunities for novel therapeutics and suggest that IHC-microarray is a method that can be used in this population.

  20. Appendiceal immunoglobulin G4-related disease mimicking appendiceal tumor or appendicitis: A case report

    International Nuclear Information System (INIS)

    Kim, Hyun Soo; Kang, Won Kyung; Chung, Dong Jin

    2016-01-01

    Immunoglobulin G4 (IgG4)-related disease is an autoimmune disease that forms tumorous lesions. Several cases involving various organs are reported, however, IgG4-related disease involving appendix has not been reported yet. In this report, we presented a case of IgG4-related disease of appendix, which raised a suspicion of appendiceal tumor or usual appendicitis and, therefore, led to unnecessary surgical resection. IgG4-related disease should be considered in the differential diagnosis for a mass-like swelling of the appendix, in order to avoid unnecessary surgery

  1. Appendiceal immunoglobulin G4-related disease mimicking appendiceal tumor or appendicitis: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Hyun Soo; Kang, Won Kyung; Chung, Dong Jin [Yeouido St. Mary' s Hospital, The Catholic University of Korea, Seoul (Korea, Republic of)

    2016-02-15

    Immunoglobulin G4 (IgG4)-related disease is an autoimmune disease that forms tumorous lesions. Several cases involving various organs are reported, however, IgG4-related disease involving appendix has not been reported yet. In this report, we presented a case of IgG4-related disease of appendix, which raised a suspicion of appendiceal tumor or usual appendicitis and, therefore, led to unnecessary surgical resection. IgG4-related disease should be considered in the differential diagnosis for a mass-like swelling of the appendix, in order to avoid unnecessary surgery.

  2. Market analysis of shale oil co-products. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1980-12-01

    Data are presented in these appendices on the marketing and economic potential for soda ash, aluminia, and nahcolite as by-products of shale oil production. Appendices 1 and 2 contain data on the estimated capital and operating cost of an oil shales/mineral co-products recovery facility. Appendix 3 contains the marketing research data.

  3. 12 CFR Appendices F-I to Part 41 - [Reserved

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false [Reserved] F Appendices F-I to Part 41 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR CREDIT REPORTING Appendices F-I to Part 41[Reserved] ...

  4. Chronic appendicitis and complete appendiceal invagination: UC, CT and MRI findings

    International Nuclear Information System (INIS)

    Diaz, Gabriel; Seehaus, Alberto; Ocantos, Jorge; Diaz, Claudia; Coccaro, Nicolas; Piccioni, Hector

    2003-01-01

    The appendiceal intussusception is a rare entity. Usually there is a predisposing factor such as a tumor, mucocele, etc. We report the case of a 61 years old female patient, with recurrent abdominal pain, localized in the right lower quadrant. We performed different diagnostic imaging exams including: double-contrast barium enema, enteroclysis, ultrasonography, computed tomography and magnetic resonance. After endoscopy a surgical procedure removed the appendix. The pathological anatomy confirmed the diagnosis of an appendiceal intussusception, complicated with a chronic inflammatory process. Appendiceal intussusception and chronic appendicitis are infrequent; it is even more uncommon the association of both entities. In addition, it was not found a predisposing cause to intussusception. For the reasons described above, we conclude that this case is an unusual presentation of appendiceal intussusception, not previously reported. (author)

  5. Normal patterns of 18F-FDG appendiceal uptake in children

    Energy Technology Data Exchange (ETDEWEB)

    Reavey, Hamilton E. [Emory University, Department of Radiology and Imaging Sciences, Division of Nuclear Medicine Molecular Imaging, Atlanta, GA (United States); Alazraki, Adina L.; Simoneaux, Stephen F. [Emory University, Department of Radiology and Imaging Sciences, Division of Pediatric Imaging, Children' s Healthcare of Atlanta at Egleston, Atlanta, GA (United States)

    2014-04-15

    Prior to interpreting PET/CT, it is crucial to understand the normal biodistribution of fluorodeoxyglucose (FDG). It is also important to realize that the normal biodistribution can vary between adults and children. Although many studies have defined normal patterns of pediatric FDG uptake in structures like the thymus, brown fat and bone marrow, patterns of normal pediatric bowel activity, specifically uptake within the appendix, have not been well described. Active lymphoid tissue has increased FDG uptake when compared with inactive tissue. Since children have more active lymphoid tissue than adults, and because the appendix contains aggregated lymphoid tissue, we postulated that appendiceal uptake may be increased in pediatric patients. To define the normal level of appendiceal FDG activity in children by evaluating a series of consecutive FDG PET/CT scans performed for other indications. After obtaining IRB approval, we retrospectively reviewed 128 consecutive whole-body pediatric FDG PET/CT examinations obtained for a variety of clinical indications. CT scans on which the appendix could not be visualized were excluded from analysis. CT scans on which the appendix could be visualized were evaluated for underlying appendiceal pathology. Studies with appendiceal or periappendiceal pathology by CT criteria were excluded. A region of interest (ROI) was placed over a portion of each appendix and appendiceal maximum standardized uptake value (SUVmax) was calculated. If an adjacent loop of bowel activity interfered with accurate measurements of the appendix SUVmax, the scan was excluded from the analysis. A chart review was performed on patients with elevated appendiceal SUVmax values to ensure that the patients did not have clinical symptomatology suggestive of acute appendicitis. When the appendix or a portion of the appendix could be visualized and accurately measured, the SUVmax was determined. SUVmax of the appendix was compared to the SUVmax of normal liver and

  6. Appendiceal pathology at the time of oophorectomy for ovarian neoplasms.

    Science.gov (United States)

    Timofeev, Julia; Galgano, Mary T; Stoler, Mark H; Lachance, Jason A; Modesitt, Susan C; Jazaeri, Amir A

    2010-12-01

    To investigate the prevalence of appendiceal pathology in women undergoing surgery for a suspected ovarian neoplasm and the predictive value of intraoperative findings to determine the need for appendectomy at the time of surgery. Retrospective analysis of patients who underwent oophorectomy and appendectomy during the same surgical procedures at the University of Virginia Health System from 1992 to 2007. Observations were stratified based on the nature (benign, borderline, or malignant) and histology (serous compared with mucinous) of the ovarian neoplasm, frozen compared with final pathological diagnosis, and the gross appearance of the appendix. Among the 191 patients identified, frozen section was consistent with seven mucinous and 35 serous carcinomas, 16 serous and 33 mucinous borderline tumors, 71 mucinous and serous cystadenomas, and 29 cases of suspected metastatic tumor from a gastrointestinal primary. The highest rates of coexisting appendiceal pathology were associated with serous ovarian cancers (94.4% of grossly abnormal and 35.3% of normal appendices) and ovarian tumors suspected to be of primary gastrointestinal origin (83.3% grossly abnormal and 60.0% normal appendices harbored coexisting mucinous neoplasms). Linear regression analysis revealed that appearance of the appendix and frozen section diagnosis of the ovarian pathology were statistically significant predictors of coexisting appendiceal pathology, but the latter was more important. The prevalence of coexisting, clinically significant appendiceal pathology is low with a frozen section diagnosis of serous or mucinous cystadenoma. Appendectomy is recommended when frozen section diagnosis is mucinous or serous ovarian carcinoma, borderline tumor or metastatic carcinoma of suspected gastrointestinal origin.

  7. Intra-appendiceal air at CT: Is it a seful or a onfusing sign for the diagnosis of acute appendicitis?

    International Nuclear Information System (INIS)

    Hong, Hye Suk; Cho, Hyun Suk; Woo, Ji Young; Lee, Yul; Yang, Ik; Hwang, Ji Young; Kim, Han Myun; Kim, Jeong Won

    2016-01-01

    To investigate the significance of intra-appendiceal air at CT for the evaluation of appendicitis. We retrospectively analyzed 458 patients (216 men, 242 women; age range, 18-91 years) who underwent CT for suspected appendicitis. Two independent readers reviewed the CT. Prevalence, amount, and appearance of intra-appendiceal air were assessed and compared between the patients with and without appendicitis. Performance of CT diagnosis was evaluated in two reading strategies: once ignoring appendiceal air (strategy 1), and the other time considering presence of appendiceal air as indicative of no appendicitis in otherwise indeterminate cases (strategy 2), using receiver operating characteristic (ROC) analysis. Of the 458 patients, 102 had confirmed appendicitis. The prevalence of intra-appendiceal air was significantly different between patients with (13.2%) and without (79.8%) appendicitis (p < 0.001). The amount of appendiceal air was significantly lesser in patients having appendicitis as compared with the normal group, for both reader 1 (p = 0.011) and reader 2 (p = 0.002). Stool-like appearance and air-fluid levels were more common in the appendicitis group than in the normal appendix for both readers (p < 0.05). Areas under the ROC curves were not significantly different between strategies 1 and 2 in reader 1 (0.971 vs. 0.985, respectively; p = 0.056), but showed a small difference in reader 2 (0.969 vs. 0.986, respectively; p = 0.042). Although significant differences were seen in the prevalence, amount, and appearance of intra-appendiceal air between patients with and without appendicitis, it has a limited incremental value for the diagnosis of acute appendicitis

  8. Intra-appendiceal air at CT: Is it a seful or a onfusing sign for the diagnosis of acute appendicitis?

    Energy Technology Data Exchange (ETDEWEB)

    Hong, Hye Suk; Cho, Hyun Suk; Woo, Ji Young; Lee, Yul; Yang, Ik; Hwang, Ji Young; Kim, Han Myun; Kim, Jeong Won [Kangnam Sacred Heart Hospital, Hallym University College of Medicine, Seoul (Korea, Republic of)

    2016-02-15

    To investigate the significance of intra-appendiceal air at CT for the evaluation of appendicitis. We retrospectively analyzed 458 patients (216 men, 242 women; age range, 18-91 years) who underwent CT for suspected appendicitis. Two independent readers reviewed the CT. Prevalence, amount, and appearance of intra-appendiceal air were assessed and compared between the patients with and without appendicitis. Performance of CT diagnosis was evaluated in two reading strategies: once ignoring appendiceal air (strategy 1), and the other time considering presence of appendiceal air as indicative of no appendicitis in otherwise indeterminate cases (strategy 2), using receiver operating characteristic (ROC) analysis. Of the 458 patients, 102 had confirmed appendicitis. The prevalence of intra-appendiceal air was significantly different between patients with (13.2%) and without (79.8%) appendicitis (p < 0.001). The amount of appendiceal air was significantly lesser in patients having appendicitis as compared with the normal group, for both reader 1 (p = 0.011) and reader 2 (p = 0.002). Stool-like appearance and air-fluid levels were more common in the appendicitis group than in the normal appendix for both readers (p < 0.05). Areas under the ROC curves were not significantly different between strategies 1 and 2 in reader 1 (0.971 vs. 0.985, respectively; p = 0.056), but showed a small difference in reader 2 (0.969 vs. 0.986, respectively; p = 0.042). Although significant differences were seen in the prevalence, amount, and appearance of intra-appendiceal air between patients with and without appendicitis, it has a limited incremental value for the diagnosis of acute appendicitis.

  9. Portsmouth Gaseous Diffusion Plant expansion: final environmental statement. Volume 2. Appendices. [Appendices only

    Energy Technology Data Exchange (ETDEWEB)

    Liverman, James L.

    1977-09-01

    Volume 2 is comprised of appendices: Portsmouth Gaseous Diffusion Plant Existing Facilities; Ecology; Civic Involvement; Social Analysis; Population Projections; Toxicity of Air Pollutants to Biota at Portsmouth Gaseous Diffusion Plant; and Assessment of Noise Effects of an Add-On to the Portsmouth Gaseous Diffusion Plant. (LK)

  10. Analysis and evaluation of GAVE chains. Part 3 of 3. Appendices; Analyse en evaluatie van GAVE-ketens. Deel 3 van 3. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Bosma, W.J.P. [Arthur D. Little International, Rotterdam (Netherlands)

    1999-12-01

    The final report (part 2) contains the detailed findings of the analysis, evaluation, and integration of Novem GAVE options and aims at the reader who is interested in the detailed findings, as well as an overview of the results. For readers who are mainly interested in the high-level results, and are comfortable with Dutch, there is a short text summary of our results, entitled 'Analyse en evaluatie van GAVE-ketens, management summary' (part 1). These appendices is for readers who are interested in the underlying data and detailed assumptions. 70 refs.

  11. Intra-Appendiceal Air at CT: Is It a Useful or a Confusing Sign for the Diagnosis of Acute Appendicitis?

    Science.gov (United States)

    Cho, Hyun Suk; Woo, Ji Young; Lee, Yul; Yang, Ik; Hwang, Ji-Young; Kim, Han Myun; Kim, Jeong Won

    2016-01-01

    Objective To investigate the significance of intra-appendiceal air at CT for the evaluation of appendicitis. Materials and Methods We retrospectively analyzed 458 patients (216 men, 242 women; age range, 18-91 years) who underwent CT for suspected appendicitis. Two independent readers reviewed the CT. Prevalence, amount, and appearance of intra-appendiceal air were assessed and compared between the patients with and without appendicitis. Performance of CT diagnosis was evaluated in two reading strategies: once ignoring appendiceal air (strategy 1), and the other time considering presence of appendiceal air as indicative of no appendicitis in otherwise indeterminate cases (strategy 2), using receiver operating characteristic (ROC) analysis. Results Of the 458 patients, 102 had confirmed appendicitis. The prevalence of intra-appendiceal air was significantly different between patients with (13.2%) and without (79.8%) appendicitis (p appendicitis as compared with the normal group, for both reader 1 (p = 0.011) and reader 2 (p = 0.002). Stool-like appearance and air-fluid levels were more common in the appendicitis group than in the normal appendix for both readers (p appendicitis, it has a limited incremental value for the diagnosis of acute appendicitis. PMID:26798214

  12. Electric and Magnetic Fields (EMF) RAPID Program Engineering Project 8: FINAL REPORT, Evaluation of Field Reduction Technologies, Volume 1 (Report) and Volume 2 (Appendices)

    Energy Technology Data Exchange (ETDEWEB)

    Commonwealth Associates, Inc.; IIT Research Institute

    1997-08-01

    This draft report consists of two volumes. Volume 1, the main body, contains an introducto~ sectionj an overview of magnetic fields sectio~ and field reduction technology evaluation section. Magnetic field reduction methods are evalpated for transmission lines, distribution Iines,sulxtations, building wiring applkmd machinery, and transportation systems. The evaluation considers effectiveness, co% and other ftiors. Volume 2 contains five appendices, Append~ A presents magnetic field shielding information. Appendices B and C present design assumptions and magnetic field plots for transmission and distribution lines, respectively. Appendices D and E present cost estimate details for transmission and distribution limes, respectively.

  13. US Fish and Wildlife Service biomonitoring operations manual, Appendices A--K

    Energy Technology Data Exchange (ETDEWEB)

    Gianotto, D.F.; Rope, R.C.; Mondecar, M.; Breckenridge, R.P.; Wiersma, G.B.; Staley, C.S.; Moser, R.S.; Sherwood, R.; Brown, K.W.

    1993-04-01

    Volume 2 contains Appendices and Summary Sheets for the following areas: A-Legislative Background and Key to Relevant Legislation, B- Biomonitoring Operations Workbook, C-Air Monitoring, D-Introduction to the Flora and Fauna for Biomonitoring, E-Decontamination Guidance Reference Field Methods, F-Documentation Guidance, Sample Handling, and Quality Assurance/Quality Control Standard Operating Procedures, G-Field Instrument Measurements Reference Field Methods, H-Ground Water Sampling Reference Field Methods, I-Sediment Sampling Reference Field Methods, J-Soil Sampling Reference Field Methods, K-Surface Water Reference Field Methods. Appendix B explains how to set up strategy to enter information on the ``disk workbook``. Appendix B is enhanced by DE97006389, an on-line workbook for users to be able to make revisions to their own biomonitoring data.

  14. Uranium milling: Draft generic environmental impact statement: Volume 2, Appendices

    International Nuclear Information System (INIS)

    1979-04-01

    This volume contains appendices supporting the discussions in Volume 1. In some cases, the appendices expound upon arguments developed in the main document; in other cases, supplementary material considered to be relevant but not presented in Volume 1 is included. A third category encompasses reprinting of pertinent documents felt to be necessary for a comprehensive presentation of the current situation, e.g., Public Law 95-604

  15. A tale of two appendices – an unexpected finding | Heetun | South ...

    African Journals Online (AJOL)

    Abstract. Anomalies of the appendix are uncommon and are usually discovered incidentally during surgery for appendicitis. We present a rare case of appendiceal duplication, which can have serious consequences if overlooked during an operation.

  16. Appendiceal hemorrhage – An uncommon cause of lower gastrointestinal bleeding

    Directory of Open Access Journals (Sweden)

    Ching-Chung Chiang

    2011-06-01

    Full Text Available Lower gastrointestinal bleeding is a common disease among elderly patients. The common sources of lower gastrointestinal bleeding include vascular disease, Crohn’s disease, neoplasms, inflammatory bowel disease, hemorrhoids, and ischemic colitis. Lower gastrointestinal bleeding arising from the appendix is an extremely rare condition. We report a case of appendiceal hemorrhage in a young male. Diagnosis was made by multidetector computerized tomography during survey for hematochezia. The patient recovered well after appendectomy. The histological finding revealed focal erosion of appendix mucosa with bleeding.

  17. The safety of Ontario's nuclear power reactors. A scientific and technical review. Vol. 2: Appendices

    International Nuclear Information System (INIS)

    Hare, F.K.

    1988-01-01

    These appendices contain seven detailed elaborations of matters covered more superficially in the Technical Report. They have been written by well-known authorities, or by the professional staff of the Review. They are essential supplements to the condensed material of the Technical Report. Several of the appendices contain detailed recommendations. Some of these have been incorporated into the Review's overall conclusions and recommendations. Others stand alone, as the opinions of the appendices' authors. I am in broad agreement with most of them, but have preferred to leave them within the authors' material. I hope that they will be given detailed study by appropriate bodies, especially Ontario Hydro and the Atomic Energy Control Board

  18. Extra-appendiceal findings in pediatric abdominal CT for suspected appendicitis

    Energy Technology Data Exchange (ETDEWEB)

    Halverson, Mark; Delgado, Jorge; Mahboubi, Soroosh [The Children' s Hospital of Philadelphia, Department of Radiology, Philadelphia, PA (United States)

    2014-07-15

    Much has been written regarding the incidence, types, importance and management of abdominal CT incidental findings in adults, but there is a paucity of literature on incidental findings in children. We sought to determine the prevalence and characteristics of extra-appendiceal and incidental findings in pediatric abdominal CT performed for suspected appendicitis. A retrospective review was performed of abdominal CT for suspected appendicitis in a pediatric emergency department from July 2010 to June 2012. Extra-appendiceal findings were recorded. Any subsequent imaging was noted. Extra-appendiceal findings were divided into incidental findings of doubtful clinical significance, alternative diagnostic findings potentially providing a diagnosis other than appendicitis explaining the symptoms, and incidental findings that were abnormalities requiring clinical correlation and sometimes requiring further evaluation but not likely related to the patient symptoms. One hundred sixty-five children had abdominal CT for suspected appendicitis. Seventy-seven extra-appendiceal findings were found in 57 (34.5%) patients. Most findings (64 of 77) were discovered in children who did not have appendicitis. Forty-one of these findings (53%) could potentially help explain the patient's symptoms, while 30 of the findings (39%) were abnormalities that were unlikely to be related to the symptoms but required clinical correlation and sometimes further work-up. Six of the findings (8%) had doubtful or no clinical significance. Extra-appendiceal findings are common in children who undergo abdominal CT in the setting of suspected appendicitis. A significant percentage of these patients have findings that help explain their symptoms. Knowledge of the types and prevalence of these findings may help radiologists in the planning and interpretation of CT examinations in this patient population. (orig.)

  19. 1992 Columbia River Salmon Flow Measures Options Analysis/EIS : Appendices.

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    This Options Analysis/Environmental Impact Statement (OA/EIS) identifies, presents effects of, and evaluates the potential options for changing instream flow levels in efforts to increase salmon populations in the lower Columbia and Snake rivers. The potential actions would be implemented during 1992 to benefit juvenile and adult salmon during migration through eight run-of-river reservoirs. The Corps of Engineers (Corps) prepared this document in cooperation with the Bonneville Power Administration and the Bureau of Reclamation. The US Fish and Wildlife Service (FWS) is a participating agency. The text and appendices of the document describe the characteristics of 10 Federal projects and one private water development project in the Columbia River drainage basin. Present and potential operation of these projects and their effects on the salmon that spawn and rear in the Columbia and Snake River System are presented. The life history, status, and response of Pacific salmon to current environmental conditions are described. The document concludes with an evaluation of the potential effects that could result from implementing proposed actions. The conclusions are based on evaluation of existing data, utilization of numerical models, and application of logical inference. This volume contains the appendices.

  20. 1992 Columbia River salmon flow measures Options Analysis/EIS: Appendices

    International Nuclear Information System (INIS)

    1992-01-01

    This Options Analysis/Environmental Impact Statement (OA/EIS) identifies, presents effects of, and evaluates the potential options for changing instream flow levels in efforts to increase salmon populations in the lower Columbia and Snake rivers. The potential actions would be implemented during 1992 to benefit juvenile and adult salmon during migration through eight run-of-river reservoirs. The Corps of Engineers (Corps) prepared this document in cooperation with the Bonneville Power Administration and the Bureau of Reclamation. The US Fish and Wildlife Service (FWS) is a participating agency. The text and appendices of the document describe the characteristics of 10 Federal projects and one private water development project in the Columbia River drainage basin. Present and potential operation of these projects and their effects on the salmon that spawn and rear in the Columbia and Snake River System are presented. The life history, status, and response of Pacific salmon to current environmental conditions are described. The document concludes with an evaluation of the potential effects that could result from implementing proposed actions. The conclusions are based on evaluation of existing data, utilization of numerical models, and application of logical inference. This volume contains the appendices

  1. Combined cycle solar central receiver hybrid power system study. Volume III. Appendices. Final technical report

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-11-01

    A design study for a 100 MW gas turbine/steam turbine combined cycle solar/fossil-fuel hybrid power plant is presented. This volume contains the appendices: (a) preconceptual design data; (b) market potential analysis methodology; (c) parametric analysis methodology; (d) EPGS systems description; (e) commercial-scale solar hybrid power system assessment; and (f) conceptual design data lists. (WHK)

  2. Severe accident risks: An assessment for five US nuclear power plants: Appendices A, B, and C

    International Nuclear Information System (INIS)

    1990-12-01

    This report summarizes an assessment of the risks from severe accidents in five commercial nuclear power plants in the United States. These risks are measured in a number of ways, including: the estimated frequencies of core damage accidents from internally initiated accidents and externally initiated accidents for two or the plants; the performance of containment structures under severe accident loadings; the potential magnitude of radionuclide release and offsite consequences of such accidents; and the overall risk (the product of accident frequencies and consequences). Supporting this summary report are a large number of reports written under contract to NRC that provide the detailed discussion of the methods used and results obtained in these risk studies. Volume 2 of this report contains three appendices, providing greater detail on the methods used, an example risk calculation, and more detailed discussion of particular technical issues found important in the risk studies

  3. Sonographic study about differential diagnosis between acute appendicitis and non-appendicitis in appendices of borderline diameter

    International Nuclear Information System (INIS)

    Chung, Hwan Hoon; Kim, Yun Hwan; Kim, Hong Won; Park, Seung Cheol; Lee, Eun Jeong; Chung, Kyoo Byung; Suh, Won Hyuck

    2000-01-01

    To find out the sonographic criteria which can be effectively used to differentiate acute appendicitis from non-appendicitis in patients with appendices with borderline diameter(5-8 mm). Sixteen patients diagnosed as acute appendicitis, another 16 patients diagnosed as non-appendicitis were included in this study. They complained of RLQ pain and their appendices measured 5-8 mm in diameter on sonogram. Features such as appendiceal wall thickness, presence or absence of air in appendiceal lumen, movability of tip of the appendix, compressibility of the appendix were evaluated on gray-scale sonogram and thereafter, presence or absence of color flow in the wall of the appendix was evaluated on color Doppler sonogram. Thickness of appendiceal wall is 2.98 ± 0.77 mm in acute appendicitis group and 1.73 ± 0.44 mm in non-appendicitis group (p<0.05). When 2.5 mm thickness of appendiceal wall is applied for diagnosis of acute appendicitis, sensitivity is 81.3%, specificity is 87.5% and accuracy is 84.4%. With absence of air in appendiceal lumen, sensitivity is 93.8%, specificity is 68.8% and accuracy is 81.3%. With absence of movability of appendiceal tip, sensitivity is 87.5%, specificity is 50% and accuracy is 68.8%. With absence of compressibility of the appendix, sensitivity is 100%, specificity is 31.3% and accuracy is 65.6%. With color flow in appendiceal wall, sensitivity is 81.3%, specificity is 62.5% and accuracy is 71.9%. The above mentioned criteria show statistically significant difference between acute appendicitis and non-appendicitis groups (p<0.05). When the diameter of the appendix measures 5-8 mm on sonogram, evaluation of thickness of appendiceal wall, air in appendiceal lumen, movability of tip, compressibility and color flow in the wall will be helpful to diagnose the acute appendicitis with confidence.

  4. Research reactor core conversion guidebook. V. 4: Fuels (Appendices I-K)

    International Nuclear Information System (INIS)

    1992-04-01

    Volume 4 consists of detailed Appendices I-K, which contain useful information on the properties, irradiation testing, and specifications and inspection procedures for fuels with reduced uranium enrichments. Summaries of these appendices can be found in Chapters 9-11 of Volume 1 of this guidebook. Refs, figs, tabs and samples

  5. Appendiceal and ovarian Burkitt's lymphoma presenting as acute appendicitis

    Directory of Open Access Journals (Sweden)

    Donovan Hui

    2018-05-01

    Full Text Available Burkitt's lymphoma is an extremely aggressive B-cell non-Hodgkin lymphoma. Patients with the sporadic form of Burkitt's lymphoma typically present with a rapidly growing abdominal mass, pain and distension. Involvement of either the appendix and/or ovaries in females is a rare manifestation of the disease. We present an unusual case of a 13 year old girl with appendiceal and ovarian Burkitt's lymphoma presenting with signs of acute appendicitis. This case demonstrates the potential for secondary involvement of the appendix and/or ovaries from Burkitt's lymphoma as well as the importance of the histopathology. Keywords: Appendicitis, Appendix, Burkitt's lymphoma, Lymphoma, Ovarian tumor

  6. Inflammatory markers in blood and serum tumor markers predict survival in patients with epithelial appendiceal neoplasms undergoing surgical cytoreduction and intraperitoneal chemotherapy.

    Science.gov (United States)

    Chua, Terence C; Chong, Chanel H; Liauw, Winston; Zhao, Jing; Morris, David L

    2012-08-01

    The study examines the role inflammatory and tumor markers as biomarkers to preoperatively predict outcome in patients with epithelial appendiceal neoplasm undergoing cytoreduction and intraperitoneal chemotherapy. Associations between baseline variables, tumor markers [CEA (carcinoembyronic antigen], CA125, CA199), inflammatory markers including neutrophils-lymphocyte ratio (NLR), platelet-lymphocyte ratio (PLR), and C-reactive protein (CRP) with progression-free survival (PFS) and overall survival (OS) were examined in patients undergoing surgical cytoreduction and intraperitoneal chemotherapy for epithelial appendiceal neoplasm. A total of 174 patients with epithelial appendiceal neoplasm (low-grade pseudomyxoma, n = 117; appendiceal cancer, n = 57) underwent cytoreduction. On univariate analysis, all 3 inflammatory and tumor markers predicted for both PFS and OS, respectively; NLR ≤ 2.6 (P = 0.01, P = 0.002), PLR ≤ 166 (P = 0.006, P = 0.016), CRP ≤ 12.5 (P = 0.001, P = 0.008), CEA (P 37 (P = 0.003), and a CRP > 12.5 (P = 0.013). A higher peritoneal cancer index (PCI > 24) was associated with elevation in CEA > 12, CA125 > 39, CA199 > 37, PLR > 166 and CRP > 12. The tumor histologic subtype was associated with CA 199 levels. The results from this investigation suggest that preoperative inflammatory markers in blood and serologic tumor markers may predict outcomes and are associated with tumor biology in patients with epithelial appendiceal neoplasm undergoing cytoreduction and intraperitoneal chemotherapy treatment.

  7. Low-grade appendiceal mucinous neoplasm mimicking an adnexal mass.

    Science.gov (United States)

    Cristian, Daniel Alin; Grama, Florin Andrei; Becheanu, Gabriel; Pop, Anamaria; Popa, Ileana; Şurlin, Valeriu; Stănilescu, Sorin; Bratu, Ana Magdalena; Burcoş, Traean

    2015-01-01

    We present a rare case of malignant epithelial neoplasm of the appendix, an uncommon disorder encountered in clinical practice, which poses a variety of diagnostic and therapeutic challenges. We report a particular case in which the appendix was abnormally located in the pelvis, mimicking an adnexal mass. Therefore, it was difficult to make the preoperative diagnosis on clinical examination, imaging studies and laboratory tests and we discovered the lesion during the diagnostic laparoscopy. No lymphadenopathy or mucinous ascites were found. The case was completely handled via the laparoscopic approach keeping the appendix intact during the operation. The frozen section, the detailed histopathology overview as well as multiple immunostaining with a complex panel of markers report diagnosed a low-grade appendiceal mucinous neoplasm (LAMN) with no invasion of the wall. No adjuvant therapy was considered needed. At a one-year follow-up oncological assessment, the patient was free of disease. In women with cystic mass in the right iliac fossa an appendiceal mucocele should be considered in the differential diagnosis. Laparoscopic appendectomy can represent an adequate operation for the appendiceal mucinous neoplasm if the histological report is clear and surgical precautionary measures are taken.

  8. Single-incision laparoscopic cecectomy for low-grade appendiceal mucinous neoplasm after laparoscopic rectectomy

    Science.gov (United States)

    Fujino, Shiki; Miyoshi, Norikatsu; Noura, Shingo; Shingai, Tatsushi; Tomita, Yasuhiko; Ohue, Masayuki; Yano, Masahiko

    2014-01-01

    In this case report, we discuss single-incision laparoscopic cecectomy for low-grade appendiceal neoplasm after laparoscopic anterior resection for rectal cancer. The optimal surgical therapy for low-grade appendiceal neoplasm is controversial; currently, the options include appendectomy, cecectomy, right hemicolectomy, and open or laparoscopic surgery. Due to the risk of pseudomyxoma peritonei, complete resection without rupture is necessary. We have encountered 5 cases of low-grade appendiceal neoplasm and all 5 patients had no lymph node metastasis. We chose the appendectomy or cecectomy without lymph node dissection if preoperative imaging studies did not suspect malignancy. In the present case, we performed cecectomy without lymph node dissection by single-incision laparoscopic surgery (SILS), which is reported to be a reduced port surgery associated with decreased invasiveness and patient stress compared with conventional laparoscopic surgery. We are confident that SILS is a feasible alternative to traditional surgical procedures for borderline tumors, such as low-grade appendiceal neoplasms. PMID:24868331

  9. tmBioC: improving interoperability of text-mining tools with BioC.

    Science.gov (United States)

    Khare, Ritu; Wei, Chih-Hsuan; Mao, Yuqing; Leaman, Robert; Lu, Zhiyong

    2014-01-01

    The lack of interoperability among biomedical text-mining tools is a major bottleneck in creating more complex applications. Despite the availability of numerous methods and techniques for various text-mining tasks, combining different tools requires substantial efforts and time owing to heterogeneity and variety in data formats. In response, BioC is a recent proposal that offers a minimalistic approach to tool interoperability by stipulating minimal changes to existing tools and applications. BioC is a family of XML formats that define how to present text documents and annotations, and also provides easy-to-use functions to read/write documents in the BioC format. In this study, we introduce our text-mining toolkit, which is designed to perform several challenging and significant tasks in the biomedical domain, and repackage the toolkit into BioC to enhance its interoperability. Our toolkit consists of six state-of-the-art tools for named-entity recognition, normalization and annotation (PubTator) of genes (GenNorm), diseases (DNorm), mutations (tmVar), species (SR4GN) and chemicals (tmChem). Although developed within the same group, each tool is designed to process input articles and output annotations in a different format. We modify these tools and enable them to read/write data in the proposed BioC format. We find that, using the BioC family of formats and functions, only minimal changes were required to build the newer versions of the tools. The resulting BioC wrapped toolkit, which we have named tmBioC, consists of our tools in BioC, an annotated full-text corpus in BioC, and a format detection and conversion tool. Furthermore, through participation in the 2013 BioCreative IV Interoperability Track, we empirically demonstrate that the tools in tmBioC can be more efficiently integrated with each other as well as with external tools: Our experimental results show that using BioC reduces >60% in lines of code for text-mining tool integration. The tmBioC toolkit

  10. INEL environmental characterization report. Volume II. Appendices A-D

    International Nuclear Information System (INIS)

    1984-09-01

    This volume contains appendices: (1) a socioeconomic data base for southeastern Idaho; (2) an ecological characterization of the INEL; (3) site-specific climatology summary, NPR primary and alternate sites; (4) NPR site borehole completion; (5) an investigation of the principal lineament at the INEL; (6) an investigation of Clay Butte, Idaho; (7) Arco and Howe fault study; (8) seismology of the INEL; (9) geologic map of the INEL; and (1) geologic ages of the INEL

  11. NEW CLASSIFICATION AND DIAGNOSIS OF APPENDICEAL CARCINOID TUMORS

    Directory of Open Access Journals (Sweden)

    Vuka Katić

    2012-03-01

    Full Text Available Carcinoid tumours are rare lesions that belong to the APUDoma category having the capacity of Amine Precursor Uptake and Decarboxylase. Gastrointestinal system comprises 90% of all carcinoids in the body and they are the most common type of primary malignant lesions of the appendix. New WHO classification of gastrointestinal carcinoids, diagnostic dilemmas of some carcinoid variants and, sometimes unpredictable prognosis are the reasons for the following study: clinical, macro- and microscopical as well as cytochemical and immunocytochemical examination of the vermiform appendix carcinoids, surgically removed from 16 patients. The appendectomy was induced by acute appendicitis or tumorous mass, without carcinoid syndrome. After two-day fixation in 10% formaldehyde, routinelly processed and embedded in paraffin, laboratory sections were stained with H&E, Fontana-Masson’s, Grimelius’, FIF and ABPAS methods. ABC method has been used for immunohistochemical examination. The antibodies for Chromogranin A, NSE, Synaptophysin, Cytokeratin 7, S-100 protein, Ki67 and CEA (primary antibodies and ABC (secondary antibody (Dako Kopenhagen were tested. The patients had no carcinoid syndrome. The most frequent was classic appendiceal carcinoid, well differentiated - NETG1 (8 cases, without metastases; goblet cell carcinoids were rare (3 cases, one case with liver metastases. The second case of goblet cell carcinoid was associated with cystadenoma papillare mucinosum, complicated by pseudomixoma peritonei and the third case was limited only to appendiceal wall. The patient with liver metastases died five months after appendectomy. The patient with goblet cell carcinoid associated with papillary mucinous cystadenoma and complicated by pseudomixoma peritonei had re-operation with both partial cecal and right ovarial resection, associated with washing the peritoneal cavity. The patient was feeling well during six years from the second operation. Based on our

  12. Mars power system concept definition study. Volume 2: Appendices

    Science.gov (United States)

    Littman, Franklin D.

    1994-01-01

    This report documents the work performed by Rockwell International's Rocketdyne Division on NASA Contract No. NAS3-25808 (Task Order No. 16) entitled 'Mars Power System Definition Study'. This work was performed for NASA's Lewis Research Center (LeRC). The report is divided into two volumes as follows: Volume 1 - Study Results; and Volume 2 - Appendices. The results of the power system characterization studies, operations studies, and technology evaluations are summarized in Volume 1. The appendices include complete, standalone technology development plans for each candidate power system that was investigated.

  13. Initial Northwest Power Act Power Sales Contracts : Final Environmental Impact Statement. Volume 2, Appendices A--L.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1992-01-01

    This report consists of appendices A-L of the final environmental impact statement for the Bonneville Power Administration. The appendices provide information on the following: Ninth circuit Court opinion in Forelaws on Board v. Johnson; guide to Northwest Power act contracts; guide to hydro operations; glossary; affected environment supporting documentation; environmental impacts of generic resource types; information on models used; technical information on analysis; public involvement activities; bibliography; Pacific Northwest Electric Power Planning and Conservation Act; and biological assessment. (CBS)

  14. Calculus of Elementary Functions, Part I. Student Text. Revised Edition.

    Science.gov (United States)

    Herriot, Sarah T.; And Others

    This course is intended for students who have a thorough knowledge of college preparatory mathematics, including algebra, axiomatic geometry, trigonometry, and analytic geometry. This text, Part I, contains the first five chapters of the course and two appendices. Chapters included are: (1) Polynomial Functions; (2) The Derivative of a Polynomial…

  15. Review of energy policy. Vol. 1. A discussion paper; Vol. 2. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1986-01-01

    Following the accident at the Chernobyl reactor in April 1986, the 1986 Annual Delegate Conference of the Institution of Professional Civil Servants set up a Working Party to review the Institution's energy policy, including safety and environmental factors. The review is presented in two volumes as the basis for discussion by the members. Volume I is the main report. Section A, the introduction, includes a summary of the detailed conclusions and recommendations of the Working Party. Section B (chapters 4-12) concerns all aspects of nuclear power including fuel reprocessing and waste management. Section C (chapters 13-16) considers the alternatives to nuclear power and Section D (chapters 17-24) looks at the economic and social aspects of energy policy. The appendices, which contain the detailed technical and source information used by the Working Party in reaching its conclusions, are printed separately in Volume II.

  16. Low-Grade Appendiceal Mucinous Neoplasm Involving the Endometrium and Presenting with Mucinous Vaginal Discharge.

    Science.gov (United States)

    Vavinskaya, Vera; Baumgartner, Joel M; Ko, Albert; Saenz, Cheryl C; Valasek, Mark A

    2016-01-01

    Primary appendiceal mucinous lesions are uncommon and represent a spectrum from nonneoplastic mucous retention cysts to invasive adenocarcinoma. Low-grade appendiceal mucinous neoplasms (LAMNs) represent an intermediate category on this spectrum and can be classified according to whether or not they are confined to the appendix. Although LAMNs are frequently confined to the appendix, they can also spread to the peritoneum and clinically progress as pseudomyxoma peritonei (i.e., mucinous ascites). Thus, the appropriate classification of appendiceal primary neoplasia is essential for prognosis and influences clinical management. In addition, the precise classification, management, and clinical outcome of patients with disseminated peritoneal disease remain controversial. Here, we report an unusual case of LAMN with pseudomyxoma peritonei that initially presented with mucinous and bloody vaginal discharge. Pathological evaluation revealed low-grade appendiceal mucinous neoplasm with secondary involvement of the peritoneum, ovaries, and endometrial surface. Therefore, LAMN should be considered in the differential diagnosis of mucinous vaginal discharge.

  17. Subseabed disposal program annual report, January-December 1980. Volume II. Appendices (principal investigator progress reports). Part 1

    International Nuclear Information System (INIS)

    Hinga, K.R.

    1981-07-01

    Volume II of the sixth annual report describing the progress and evaluating the status of the Subseabed Disposal Program contains the appendices referred to in Volume I, Summary and Status. Because of the length of Volume II, it has been split into two parts for publication purposes. Part 1 contains Appendices A-Q; Part 2 contains Appendices R-MM. Separate abstracts have been prepared for each appendix for inclusion in the Energy Data Base

  18. Subseabed disposal program annual report, January-December 1980. Volume II. Appendices (principal investigator progress reports). Part 1

    Energy Technology Data Exchange (ETDEWEB)

    Hinga, K.R. (ed.)

    1981-07-01

    Volume II of the sixth annual report describing the progress and evaluating the status of the Subseabed Disposal Program contains the appendices referred to in Volume I, Summary and Status. Because of the length of Volume II, it has been split into two parts for publication purposes. Part 1 contains Appendices A-Q; Part 2 contains Appendices R-MM. Separate abstracts have been prepared for each appendix for inclusion in the Energy Data Base.

  19. A Curriculum Activities Guide to Water Pollution and Environmental Studies, Volume II - Appendices.

    Science.gov (United States)

    Hershey, John T., Ed.; And Others

    This publication, Volume II of a two volume set of water pollution studies, contains seven appendices which support the studies. Appendix 1, Water Quality Parameters, consolidates the technical aspects of water quality including chemical, biological, computer program, and equipment information. Appendix 2, Implementation, outlines techniques…

  20. RF model of the distribution system as a communication channel, phase 2. Volume 3: Appendices

    Science.gov (United States)

    Rustay, R. C.; Gajjar, J. T.; Rankin, R. W.; Wentz, R. C.; Wooding, R.

    1982-01-01

    Program documentation concerning the design, implementation, and verification of a computerized model for predicting the steady-state sinusoidal response of radial configured distribution feeders is presented in these appendices.

  1. Multiple caeco-appendiceal fistulas and diverticulosis: a newly defined congenital anomaly of the appendix-report of the first case.

    Science.gov (United States)

    Yucel, Ahmet Fikret; Pergel, Ahmet; Kocakusak, Ahmet; Aydin, Ibrahim; Bagci, Pelin; Sahin, Dursun Ali

    2011-11-01

    Congenital anomalies of the appendix are extremely rare. They are usually found incidentally during operations other than appendectomies. Congenital appendix diverticula are even less frequent. Congenital caeco-appendiceal fistulae have not been reported until today. Herein, we present real diverticula of the appendix with multiple caeco-appendiceal fistulae which, to our knowledge, is the first in the literature.

  2. Canton hydroelectric project: feasibility study. Final report, appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-05-01

    These appendices contain legal, environmental, regulatory, technical and economic information used in evaluating the feasibility of redeveloping the hydroelectric power generating facilities at the Upper and Lower Dams of the Farmington River at Collinsville, CT. (LCL)

  3. 1986 resource strategy technical appendices. Volume 2

    International Nuclear Information System (INIS)

    1986-01-01

    The following appendices are included: Decision Analysis Model Documentation; WNP-1 and WNP-3 Preservation Cost Analysis; Regional Costs vs. Net Benefits; Supplemental Conservation Results; National Science Foundation (NSF) Definition of Research and Development; Research and Development: ''Short-Term'' Need and ''Long-Term'' Capability Building; and Value of Energy

  4. 2004 Power marketing program final EIS - final environmental impact statement. Volume 2 - appendices

    International Nuclear Information System (INIS)

    1997-02-01

    This volume contains appendices to the Final Environmental Impact Statement (FEIS) for the Power Marketing Program proposal of the Western Area Power Administration. The FEIS identified peaking power scheduling as the environmentally preferred alternative, and presented the analysis of alternatives and environmental impacts. Sixteen appendices to the FEIS are included in this document. The appendices are: Statutory and Legal Framework; Sierra Nevada Region Customer Groups and Economic Regions; Renewable Technology Cost Information Matrix; Hydrological Assumptions; Recreation Resources; Archaeological and Historical Resources; Incremental Power Resources; Air Quality Regulatory Structure; Energy Generation; Stage Contents Relationships for Regulating Reservoirs; Power Costs; Socioeconomic Impacts; Projected Air Resource Impacts; Land use, Water Quality, and Solid Waste Impact Factors; Draft Environmental Impact Statement Comments and Responses, and Contractor Disclosure Statements. 21 figs., 24 tabs

  5. Low-Grade Appendiceal Mucinous Neoplasm Involving the Endometrium and Presenting with Mucinous Vaginal Discharge

    OpenAIRE

    Vavinskaya, Vera; Baumgartner, Joel M.; Ko, Albert; Saenz, Cheryl C.; Valasek, Mark A.

    2016-01-01

    Primary appendiceal mucinous lesions are uncommon and represent a spectrum from nonneoplastic mucous retention cysts to invasive adenocarcinoma. Low-grade appendiceal mucinous neoplasms (LAMNs) represent an intermediate category on this spectrum and can be classified according to whether or not they are confined to the appendix. Although LAMNs are frequently confined to the appendix, they can also spread to the peritoneum and clinically progress as pseudomyxoma peritonei (i.e., mucinous ascit...

  6. Appendiceal diverticulum associated with chronic appendicitis

    OpenAIRE

    Zubieta-O’Farrill, Gregorio; Guerra-Mora, José Raúl; Gudiño-Chávez, Andrés; Gonzalez-Alvarado, Carlos; Cornejo-López, Gilberto Bernabe; Villanueva-Sáenz, Eduardo

    2014-01-01

    INTRODUCTION: Appendiceal diverticulosis is a rare entity, with a global incidence between 0.004% and 2.1% of all appendectomies. It has been related with an elevated risk of perforation in comparison to acute appendicitis, as well as an increased risk for synchronic appendicular cancer in 48% of the cases, and colonic cancer in 43%. The incidence of chronic appendicitis has been reported in 1.5% of all appendicitis cases. PRESENTATION OF CASE: We present a 73-year-old female, with no rele...

  7. INEL environmental characterization report. Volume III. Appendices E-H

    International Nuclear Information System (INIS)

    1984-09-01

    This volume contains the following appendices: (1) INEL subsurface hydrology; (2) cultural resources assessment of two study areas on the INEL; (3) description of INEL facilities; and (4) effluent measurements and environmental monitoring programs

  8. Subseabed disposal program annual report, January-December 1979. Volume II. Appendices (principal investigator progress reports). Part 1 of 2

    International Nuclear Information System (INIS)

    Talbert, D.M.

    1981-04-01

    Volume II of the sixth annual report describing the progress and evaluating the status of the Subseabed Disposal Program contains the appendices referred to in Volume I, Summary and Status. Because of the length of Volume II, it has been split into two parts for publication purposes. Part 1 contains Appendices A-O; Part 2 contains Appendices P-FF. Separate abstracts have been prepared of each Appendix for inclusion in the Energy Data Base

  9. Subseabed disposal program annual report, January-December 1979. Volume II. Appendices (principal investigator progress reports). Part 2 of 2

    International Nuclear Information System (INIS)

    Talbert, D.M.

    1981-04-01

    Volume II of the sixth annual report describing the progress and evaluating the status of the Subseabed Disposal Program contains the appendices referred to in Volume II, Summary and Status. Because of the length of Volume II, it has been split into two parts for publication purposes. Part 1 contains Appendices A-O; Part 2 contains Appendices P-FF. Separate abstracts have been prepared for each appendix for inclusion in the Energy Data Base

  10. NASAwide electronic publishing system-prototype STI electronic document distribution: Stage-4 evaluation report. Part 2; Appendices

    Science.gov (United States)

    Tuey, Richard C.; Collins, Mary; Caswell, Pamela; Haynes, Bob; Nelson, Michael L.; Holm, Jeanne; Buquo, Lynn; Tingle, Annette; Cooper, Bill; Stiltner, Roy

    1996-01-01

    This evaluation report contains an introduction, seven chapters, and five appendices. The Introduction describes the purpose, conceptual framework, functional description, and technical report server of the Scientific and Technical Information (STI) Electronic Document Distribution (EDD) project. Chapter 1 documents the results of the prototype STI EDD in actual operation. Chapter 2 documents each NASA center's post processing publication processes. Chapter 3 documents each center's STI software, hardware. and communications configurations. Chapter 7 documents STI EDD policy, practices, and procedures. The appendices consist of (A) the STI EDD Project Plan, (B) Team members, (C) Phasing Schedules, (D) Accessing On-line Reports, and (E) Creating an HTML File and Setting Up an xTRS. In summary, Stage 4 of the NASAwide Electronic Publishing System is the final phase of its implementation through the prototyping and gradual integration of each NASA center's electronic printing systems, desk top publishing systems, and technical report servers, to be able to provide to NASA's engineers, researchers, scientists, and external users, the widest practicable and appropriate dissemination of information concerning its activities and the result thereof to their work stations.

  11. Usefulness of measurement of the outer appendiceal diameter on abdominal computer tomography in the diagnosis of acute appendicitis

    International Nuclear Information System (INIS)

    Chisuwa, Hisanao; Tauchi, Katsunori; Mori, Shusuke; Kishimoto, Hirofumi; Koike, Hideo; Higuchi, Kayoko; Ohmori, Toshihiro; Miyazawa, Masahisa

    2008-01-01

    The purpose of this study was to evaluate the accuracy of our computer tomography (CT)-based protocol and the usefulness of measurement of the outer appendiceal diameter on CT in the diagnosis of acute appendicitis. Two-hundred thirty-nine consecutive patients with clinical diagnoses of acute appendicitis during the period from January 2002 to Jun 2004 were evaluated. The CT criterion of acute appendicitis was the outer appendiceal diameter of 6 mm or more, and/or other associated inflammatory changes. The histological criterion of acute appendicitis was the presentation of polymorphic granulocytes throughout the appendiceal wall. Of 239 patients, 235 underwent CT examination. Among 222 patients with appendectomy, 205 had histologically proven acute appendicitis. Of 200 patients who had the outer appendiceal diameter of 6 mm or more on CT, 193 had histologically proven acute appendicitis. The positive predictive value for diagnosing acute appendicitis was 92.3% in the surgery group, and 96.5% in the group that the outer appendiceal diameter was 6 mm or more on CT. The recurrence rate of acute appendicitis diagnosed by CT following conservative therapy was 35.3%, and was high (50%) in the group with the appendiceal diameter of at least 10 mm. CT is useful in the diagnosis for acute appendicitis. (author)

  12. Remote-handled transuranic system assessment appendices. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-11-01

    Volume 2 of this report contains six appendices to the report: Inventory and generation of remote-handled transuranic waste; Remote-handled transuranic waste site storage; Characterization of remote-handled transuranic waste; RH-TRU waste treatment alternatives system analysis; Packaging and transportation study; and Remote-handled transuranic waste disposal alternatives.

  13. Remote-handled transuranic system assessment appendices. Volume 2

    International Nuclear Information System (INIS)

    1995-11-01

    Volume 2 of this report contains six appendices to the report: Inventory and generation of remote-handled transuranic waste; Remote-handled transuranic waste site storage; Characterization of remote-handled transuranic waste; RH-TRU waste treatment alternatives system analysis; Packaging and transportation study; and Remote-handled transuranic waste disposal alternatives

  14. Jabiluka project - Draft Environmental Impact Statement. Appendices

    International Nuclear Information System (INIS)

    1996-01-01

    The Appendices provide various technical data in support of studies presented in the Main Report, including the guidelines for an EIS at Jabiluka, environmental requirements, waste management plan, water management system criteria, water quality data, transport licensing and security procedures, rehabilitation plus specialist studies into ore characteristics, noise issues and haulage risk assessment. Copyright (1996) Energy Resources of Australia Limited

  15. Evaluation, engineering and development of advanced cyclone processes. Final separating media evaluation and test report (FSMER). Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    This report consists of appendices pertaining to the separating media evaluation (calcium nitrate solution) and testing for an advanced cyclone process. Appendices include: materials safety data, aqueous medium regeneration, pH control strategy, and other notes and data.

  16. Alternative fuels for vehicles fleet demonstration program. Final report, volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    The Alternative Fuels for Vehicles Fleet Demonstration Program (AFV-FDP) was a multiyear effort to collect technical data for use in determining the costs and benefits of alternative-fuel vehicles (AFVs) in typical applications in New York State. This report, Volume 2, includes 13 appendices to Volume 1 that expand upon issues raised therein. Volume 1 provides: (1) Information about the purpose and scope of the AFV-FDP; (2) A summary of AFV-FDP findings organized on the basis of vehicle type and fuel type; (3) A short review of the status of AFV technology development, including examples of companies in the State that are active in developing AFVs and AFV components; and (4) A brief overview of the status of AFV deployment in the State. Volume 3 provides expanded reporting of AFV-FDP technical details, including the complete texts of the brochure Garage Guidelines for Alternative Fuels and the technical report Fleet Experience Survey Report, plus an extensive glossary of AFV terminology. The appendices cover a wide range of issues including: emissions regulations in New York State; production and health effects of ozone; vehicle emissions and control systems; emissions from heavy-duty engines; reformulated gasoline; greenhouse gases; production and characteristics of alternative fuels; the Energy Policy Act of 1992; the Clean Fuel Fleet Program; garage design guidelines for alternative fuels; surveys of fleet managers using alternative fuels; taxes on conventional and alternative fuels; and zero-emission vehicle technology.

  17. Appendices for: Improper Signaling in Two-Path Relay Channels

    KAUST Repository

    Gaafar, Mohamed

    2016-12-01

    This document contains the appendices for the work in “Improper Signaling in Two-Path Relay Channels,” which is submitted to 2017 IEEE International Conference on Communications (ICC) Workshop on Full-Duplex Communications for Future Wireless Networks, Paris, France.

  18. Appendices for: Improper Signaling in Two-Path Relay Channels

    KAUST Repository

    Gaafar, Mohamed; Amin, Osama; Schaefer, Rafael F.; Alouini, Mohamed-Slim

    2016-01-01

    This document contains the appendices for the work in “Improper Signaling in Two-Path Relay Channels,” which is submitted to 2017 IEEE International Conference on Communications (ICC) Workshop on Full-Duplex Communications for Future Wireless Networks, Paris, France.

  19. Recommendations for a Department of Energy Nuclear Energy R and D Agenda Volume 2 Appendices

    International Nuclear Information System (INIS)

    1997-01-01

    The current US nuclear energy policy is primarily formulated as part of the nation's overall energy policy. In addition, nuclear energy policy is impacted by other US policies, such as those for defense and environment, and by international obligations through their effects on nuclear weapons dismantlement and stewardship, continued reliance on space and naval nuclear power sources, defense waste cleanup, and on nuclear nonproliferation. This volume is composed of the following appendices: Appendix 1--Objectives of the Federal Government Nuclear Energy Related Policies and Research and Development Programs; Appendix 2--Nuclear Energy and Related R and D in the US; Appendix 3--Summary of Issues That Drive Nuclear Energy Research and Development; Appendix 4: Options for Policy and Research and Development; Appendix 5--Pros and Cons of Objectives and Options; and Appendices 6--Recommendations

  20. Recommendations for a Department of Energy Nuclear Energy R and D Agenda Volume 2 Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-12-01

    The current US nuclear energy policy is primarily formulated as part of the nation`s overall energy policy. In addition, nuclear energy policy is impacted by other US policies, such as those for defense and environment, and by international obligations through their effects on nuclear weapons dismantlement and stewardship, continued reliance on space and naval nuclear power sources, defense waste cleanup, and on nuclear nonproliferation. This volume is composed of the following appendices: Appendix 1--Objectives of the Federal Government Nuclear Energy Related Policies and Research and Development Programs; Appendix 2--Nuclear Energy and Related R and D in the US; Appendix 3--Summary of Issues That Drive Nuclear Energy Research and Development; Appendix 4: Options for Policy and Research and Development; Appendix 5--Pros and Cons of Objectives and Options; and Appendices 6--Recommendations.

  1. The environmental energy sector programme. Poland: Appendices to feasibility study

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-07-01

    The appendices contain Energy Law, Act of 10 April 1997 and also more specific details from the feasibility study for the procurement of a financial solution to the modernisation of the combined heat and power plant in the city of Zielona Gora, Poland. (EHS)

  2. Theoretical studies of fusion physics. Volume II. Appendices. Final report

    International Nuclear Information System (INIS)

    1983-01-01

    The following appendices are given: (1) absorption of waves near the cyclotron frequency by relativistic electrons in EBT, (2) power balance in a stable, adiabatic hot electron annulus, (3) whistler instability in a relativistic electron annulus, and (4) adiabatic limit on electron temperature in the EBT annulus

  3. Life prediction methodology for ceramic components of advanced vehicular heat engines: Volume 3, Appendices 3, 4, 5, 6, and 7. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Khandelwal, P.K.; Provenzano, N.J.; Schneider, W.E. [Allison Engine Co., Indianapolis, IN (United States)

    1996-02-01

    The appendices contain: dynamic fatigue testing of MOR specimens in air at Allison from 1000 to 1400 C; dynamic fatigue testing of MOR specimens in air and Ar at ORNL from 1000-1400 C; dynamic fatigue testing of button-head tensile specimens in air at Southern Research Institute; tensile creep curves for dogbone specimens tested at the National Institute of Science and Technology; and oxidation behavior of PY-6 Si nitride between 1000-1400 C in air.

  4. N+3 Aircraft Concept Designs and Trade Studies. Volume 2; Appendices-Design Methodologies for Aerodynamics, Structures, Weight, and Thermodynamic Cycles

    Science.gov (United States)

    Greitzer, E. M.; Bonnefoy, P. A.; delaRosaBlanco, E.; Dorbian, C. S.; Drela, M.; Hall, D. K.; Hansman, R. J.; Hileman, J. I.; Liebeck, R. H.; Lovegren, J.; hide

    2010-01-01

    Appendices A to F present the theory behind the TASOPT methodology and code. Appendix A describes the bulk of the formulation, while Appendices B to F develop the major sub-models for the engine, fuselage drag, BLI accounting, etc.

  5. Funding California Schools: The Revenue Limit System. Technical Appendices

    Science.gov (United States)

    Weston, Margaret

    2010-01-01

    This document presents the technical appendices accompanying the report, "Funding California Schools: The Revenue Limit System." Included are: (1) Revenue Limit Calculation and Decomposition; (2) Data and Methods; and (3) Base Funding Alternative Simulation Results. (Contains 5 tables and 26 footnotes.) [For the main report,…

  6. Technology, safety, and costs of decommissioning a reference pressurized water reactor power station. Appendices

    International Nuclear Information System (INIS)

    Smith, R.I.; Konzek, G.J.; Kennedy, W.E. Jr.

    1978-05-01

    Detailed appendices are presented under the following headings: reference PWR facility description, reference PWR site description, estimates of residual radioactivity, alternative methods for financing decommissioning, radiation dose methodology, generic decommissioning activities, intermediate dismantlement activities, safe storage and deferred dismantlement activities, compilation of unit cost factors, and safety assessment details

  7. Alternatives for managing wastes from reactors and post-fission operations in the LWR fuel cycle. Volume 5. Appendices

    International Nuclear Information System (INIS)

    1976-05-01

    Volume V of the five-volume report consists of appendices, which provide supplementary information, with emphasis on characteristics of geologic formations that might be used for final storage or disposal. Appendix titles are: selected glossary; conversion factors; geologic isolation, including, (a) site selection factors for repositories of wastes in geologic media, (b) rock types--geologic occurrence, (c) glossary of geohydrologic terms, and (d) 217 references; the ocean floor; and, government regulations pertaining to the management of radioactive materials

  8. Alternatives for managing wastes from reactors and post-fission operations in the LWR fuel cycle. Volume 5. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1976-05-01

    Volume V of the five-volume report consists of appendices, which provide supplementary information, with emphasis on characteristics of geologic formations that might be used for final storage or disposal. Appendix titles are: selected glossary; conversion factors; geologic isolation, including, (a) site selection factors for repositories of wastes in geologic media, (b) rock types--geologic occurrence, (c) glossary of geohydrologic terms, and (d) 217 references; the ocean floor; and, government regulations pertaining to the management of radioactive materials. (JGB)

  9. WECC Variable Generation Planning Reference Book: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Makarov, Yuri V.; Du, Pengwei; Etingov, Pavel V.; Ma, Jian; Vyakaranam, Bharat

    2013-05-13

    The document titled “WECC Variable Generation Planning Reference Book”. This book is divided into two volumes; one is the main document (volume 1)and the other is appendices (volume 2). The main document is a collection of the best practices and the information regarding the application and impact of variables generation on power system planning. This volume (appendices) has additional information on the following topics: Probabilistic load flow problems. 2. Additional useful indices. 3. high-impact low-frequency (HILF) events. 4. Examples of wide-area nomograms. 5. Transmission line ratings, types of dynamic rating methods. 6. Relative costs per MW-km of different electric power transmission technologies. 7. Ultra-high voltage (UHV) transmission. 8.High voltage direct current (VSC-HVDC). 9. HVDC. 10. Rewiring of existing transmission lines. 11. High-temperature low sag (HTLS) conductors. 12. The direct method and energy functions for transient stability analysis in power systems. 13.Blackouts caused by voltage instability. 14. Algorithm for parameter continuation predictor-corrector methods. 15. Approximation techniques available for security regions. 16. Impacts of wind power on power system small signals stability. 17. FIDVR. 18. FACTS. 19. European planning standard and practices. 20. International experience in wind and solar energy sources. 21. Western Renewable Energy Zones (WREZ). 22. various energy storage technologies. 23. demand response. 24. BA consolidation and cooperation options. 25. generator power management requirements and 26. European planning guidelines.

  10. First measurement of $C\\!P$ violation in $B^0_s\\!\\rightarrow J\\!/\\psi K^0_{\\text{S}}$ decays with the LHCb experiment

    CERN Document Server

    AUTHOR|(INSPIRE)INSPIRE-00257624

    This thesis presents the first measurement of $C\\!P$ violation in decays of $B^0_s$ and $\\overline{B^0_s}$ mesons into the final state $J\\!/\\psi K^0_{\\text{S}}$, where the $C\\!P$ observables allow to constrain the contribution of penguin topologies in $B^0\\!\\rightarrow J\\!/\\psi K^0_{\\text{S}}$ decays. The measurement is performed on a dataset corresponding to an integrated luminosity of 3 $\\text{fb}^{-1}$ of proton-proton collisions, which were recorded by the LHCb experiment at centre-of-mass energies of 7 and 8 TeV. Using an unbinned maximum-likelihood fit, the $C\\!P$ observables are measured as \\begin{equation*} \\begin{alignedat}{2} A_{B^0_s\\!\\rightarrow J\\!/\\psi K^0_{\\text{S}}}^{\\Delta\\mathit{\\Gamma}} &= \\phantom{-}0.49 \\pm \\,{}^{0.77}_{0.65} &&\\text{\\,(stat)} \\pm 0.06 \\text{\\,(syst)} \\,\\text{,}\\\\ C_{B^0_s\\!\\rightarrow J\\!/\\psi K^0_{\\text{S}}} &= -0.28 \\pm 0.41 &&\\text{\\,(stat)} \\pm 0.08 \\text{\\,(syst)} \\,\\text{,}\\\\ S_{B^0_s\\!\\rightarrow J\\!/\\psi K^0_{\\text{S}}} &...

  11. Waste-Management Education and Research Consortium (WERC) annual progress report, 1992--1993. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1993-02-15

    This report contains the following appendices: Appendix A - Requirements for Undergraduate Level; Appendix B - Requirements for Graduate Level; Appendix C - Graduate Degree In Environmental Engineeringat New Mexico State University; Appendix D - Non-degree Certificate program; Appendix E - Curriculum for Associate Degree Program in Radioactive & Hazardous Waste Materials; Appendix F - Curriculum for NCC Program in Earth & Environmental Sciences; Appendix G - Brochure of 1992 Teleconference Series; Appendix H - Sites for Hazardous/Radioactive Waste Management Series; Appendix I - WERC Interactive Television Courses; Appendix J - WERC Research Seminar Series Brochures; Appendix K - Summary of Technology Development of the Third Year; Appendix L - List of Major Publications Resulting From WERC; Appendix M - Types of Equipment at WERC Laboratories; and Appendix N - WERC Newsletter Examples.

  12. Potential actionable targets in appendiceal cancer detected by immunohistochemistry, fluorescent in situ hybridization, and mutational analysis

    Science.gov (United States)

    Millis, Sherri Z.; Kimbrough, Jeffery; Doll, Nancy; Von Hoff, Daniel; Ramanathan, Ramesh K.

    2017-01-01

    Background Appendiceal cancers are rare and consist of carcinoid, mucocele, pseudomyxoma peritonei (PMP), goblet cell carcinoma, lymphoma, and adenocarcinoma histologies. Current treatment involves surgical resection or debulking, but no standard exists for adjuvant chemotherapy or treatment for metastatic disease. Methods Samples were identified from approximately 60,000 global tumors analyzed at a referral molecular profiling CLIA-certified laboratory. A total of 588 samples with appendix primary tumor sites were identified (male/female ratio of 2:3; mean age =55). Sixty-two percent of samples were adenocarcinomas (used for analysis); the rest consisted of 9% goblet cell, 15% mucinous; 6% pseudomyxoma, and less than 5% carcinoids and 2% neuroendocrine. Tests included sequencing [Sanger, next generation sequencing (NGS)], protein expression/immunohistochemistry (IHC), and gene amplification [fluorescent in situ hybridization (FISH) or CISH]. Results Profiling across all appendiceal cancer histological subtypes for IHC revealed: 97% BRCP, 81% MRP1, 81% COX-2, 71% MGMT, 56% TOPO1, 5% PTEN, 52% EGFR, 40% ERCC1, 38% SPARC, 35% PDGFR, 35% TOPO2A, 25% RRM1, 21% TS, 16% cKIT, and 12% for TLE3. NGS revealed mutations in the following genes: 50.4% KRAS, 21.9% P53, 17.6% GNAS, 16.5% SMAD4, 10% APC, 7.5% ATM, 5.5% PIK3CA, 5.0% FBXW7, and 1.8% BRAF. Conclusions Appendiceal cancers show considerable heterogeneity with high levels of drug resistance proteins (BCRP and MRP1), which highlight the difficulty in treating these tumors and suggest an individualized approach to treatment. The incidence of low TS (79%) could be used as a backbone of therapy (using inhibitors such as 5FU/capecitabine or newer agents). Therapeutic options includeTOPO1 inhibitors (irinotecan/topotecan), EGFR inhibitors (erlotinib, cetuximab), PDGFR antagonists (regorafenib, axitinib), MGMT (temozolomide). Clinical trials targeting pathways involving KRAS, p53, GNAS, SMAD4, APC, ATM, PIK3CA, FBXW7, and

  13. Benefit-Cost Analysis of Integrated Paratransit Systems : Volume 6. Technical Appendices.

    Science.gov (United States)

    1979-09-01

    This last volume, includes five technical appendices which document the methodologies used in the benefit-cost analysis. They are the following: Scenario analysis methodology; Impact estimation; Example of impact estimation; Sensitivity analysis; Agg...

  14. Focus on Mentee-Mentor Relationships: The 10th Grade Implementation of iMentor's College Ready Program. Technical Appendices

    Science.gov (United States)

    Merrill, Lisa; Kang, David; Siman, Nina; Soltani, Jasmine

    2016-01-01

    This document presents the technical appendices that accompany the full report entitled:"Focus on Mentee-Mentor Relationships: The 10th Grade Implementation of iMentor's College Ready Program." The appendices include: (1) Mentor Survey Construct Items; (2) Qualative Data Collection and Analysis Methods; and (3) Methods for Estimating the…

  15. Risk-informed appendices G and E for section XI of the ASME Boiler and Pressure Vessel Code

    International Nuclear Information System (INIS)

    Carter, B; Spanner, J.; Server, W.; Gamble, R.; Bishop, B.; Palm, N.; Heinecke, C.

    2011-01-01

    Full text of publication follows: The American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel Code, Section XI, contains two appendices (G and E) related to reactor pressure boundary integrity. Appendix G provides procedures for defining Service Level A and B pressure temperature limits for ferritic components in the reactor coolant pressure boundary. Recently, an alternative risk informed methodology has been developed for ASME Section XI, Appendix G. The alternative methodology provides simple procedures to define risk informed pressure temperature limits for Service Level A and B events, including leak testing and reactor start up and shut down for both pressurized water reactors (PWRs) and boiling water reactors (BWRs). Risk informed pressure temperature limits provide more operational flexibility, particularly for reactor pressure vessels (RPV) with relatively high irradiation levels and radiation sensitive materials. Appendix E of Section XI provides a methodology for assessing conditions when the Appendix G limits are exceeded. A similar risk informed methodology is being considered for Appendix E. The probabilistic fracture mechanics evaluations used to develop the risk informed relationships included appropriate material properties for the range of RPV materials in operating plants in the United States and operating history and system operational constraints in both BWRs and PWRs. The analysis results were used to define pressure temperature relationships that provide an acceptable level of risk, consistent with safety goals defined by the U.S. Nuclear Regulatory Commission. The alternative methodologies for Appendices G and E will provide greater operational flexibility, especially for Service Level A and B events that may adversely affect efficient and safe plant operation, such as low temperature over pressurization for PWRs and BWR leak testing. Overall, application of the risk informed appendices can result in increased plant

  16. [Expression of receptors of estrogens and androgens in the testicular appendices].

    Science.gov (United States)

    Paredes Esteban, R M; Luque Barona, R J; Velasco Sánchez, B; Rodríguez Vargas, J; Lorite, A; García Ruiz, M

    2008-07-01

    The appendices or hidátides of the testicle are structures that are considered an embryonic rest. In testicular hidátide estrogen receivers have been demonstrated but in the epididimys the results vary. Has been theorized that the elevation of the estrogen levels in the puberty can produce an inflammation and torsion of hidátide, nevertheless, in the epididimys in which the estrogen expression is not clear (and also they are twisted) the theory is put in doubt. This controversy takes us to the accomplishment of this work. A prospective study is made in 20 testicular appendices, of which 7 from the epididimys are extirpated of patients to whom an escrotal exploration is made in the development of surgery of processes of the inguino-escrotal channel (hidroceles, hernias). Optical microscopy and inmunohistoquímical study are analyzed by means of using prediluted monoclonales antibodies, for receivers of estrogens, androgens and proliferative index. The results were proceed and analyzed by means of SPSS statistical program. All hidátides, testicular and from the epididimarys expressed receivers for estrogens without significant difference among them, not existing differences as far as the location of receiving sayings within the three compartments of hidátide. The number of estrogen receivers was in relation to the age of the patient. Only hidátides from the epididimys fundamentally expressed receivers of located androgens and at level of ductus. We have not found significant relation between the proliferative index and the expression of estrogen receivers. The proliferative index was more elevated at level of ductus. 1) As much the testicular appendices as those from the epididimays expressed receivers of estrogens at level of the three compartments. It makes think about a same embryonic origin, although only the epididimal ones expressed androgen receivers. 2) the observation of estrogen receivers in both types of hidátides, as well as the relation of the

  17. An Evaluation of Project Learning Tree in British Columbia. Appendices.

    Science.gov (United States)

    Conry, Robert F.; And Others

    The volume contains seven appendices (A-G) which accompany the first volume. Appendix A provides a list of project personnel and of teachers who participated in the unit development workshop. Appendix B, composed of six sections, includes the unit lesson plans and teachers' guides used in the field study for grades 3, 5, and 7. The grade materials…

  18. Business plan: Supplemental draft environmental impact statement. Volume 2. Appendices

    International Nuclear Information System (INIS)

    1995-02-01

    This document contains the appendices for the Bonneville Power Administration (BPA) Business Plan: Supplemental Draft Environmental Impact Statement. Included are: BPA products and services; Rate design; Methodology and assumptions for numerical analysis; Retail utility operations; Comments and responses to the draft business plan EIS

  19. Business Plan : Supplemental Draft Environmental Impact Statement, Volume 2, Appendices.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1995-02-01

    This document contains the appendices for the Bonneville Power Administration (BPA) Business Plan: Supplemental Draft Environmental Impact Statement. Included are: BPA products and services; Rate design; Methodology and assumptions for numerical analysis; Retail utility operations; Comments and responses to the draft business plan EIS.

  20. [Acute abdomen secondary to appendiceal intussusception].

    Science.gov (United States)

    Betancourth-Alvarenga, J E; Vázquez-Rueda, F; Murcia-Pascual, F J; Ayala-Montoro, J

    2015-01-01

    Appendiceal intussusception is a rare condition that can occur at any age. Only a few cases have been reported, and most are found during surgery. The therapeutic approach is usually surgical, ranging from an appendectomy to a hemicolectomy, primarily for biopsy and to rule out possible malignancy. Three cases of children under 14 years who underwent surgery for acute abdominal pain located in the right iliac fossa are presented; one with preoperative diagnosis by ultrasound, and the other two with positive intraoperative findings of intussusception of the cecal appendix, with acute appendicitis being histologically confirmed. Copyright © 2013 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.

  1. Fuel Rod Consolidation Project: Phase 2, Final report: Volume 2, Appendices

    International Nuclear Information System (INIS)

    1987-01-01

    This document, Volume 2, provides the appendices to Volume 1 of the Fuel Rod Consolidation Project. It provides information on the following: References; Trade-off Studies; Instrument List; RAM Data; Fabrication Specifications; Software Specifications; and Design Requirements

  2. Component Fragility Research Program: Phase 1, Demonstration tests: Volume 2, Appendices

    International Nuclear Information System (INIS)

    Holman, G.S.; Chou, C.K.; Shipway, G.D.; Glozman, V.

    1987-08-01

    Appendices are presented which contain information concerning: details of controller and relay installation; resonance search transmissibility plots; time-history data from runs 17, 31, 46, and 56; and response spectra from runs 17, 31, 46, and 56

  3. Assessment of accident risks in the CRBRP. Volume 2. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    None

    1977-03-01

    Appendices to Volume I include core-related accident-sequence definition, CRBRP risk-assessment sequence-probability determinations, failure-probability data, accident scenario evaluation, radioactive material release analysis, ex-core accident analysis, safety philosophy and design features, calculation of reactor accident consequences, sensitivity study, and risk from fires.

  4. Appendicitis complicated by appendiceal metastasis via peritoneal dissemination from lung cancer.

    Science.gov (United States)

    Shiota, Naoki; Furonaka, Makoto; Kikutani, Kazuya; Haji, Keiko; Fujisaki, Seiji; Nishida, Toshihiro

    2016-07-01

    Peritoneal disseminations from lung cancer are difficult to detect during the patient's clinical course. Therefore, complications of this condition are unclear. We report a case in which peritoneal dissemination from lung cancer complicated appendicitis. A 74-year-old man with lung cancer who was receiving maintenance therapy presented at our hospital because of abdominal pain. It was the seventh day after the 14th cycle of maintenance therapy with bevacizumab. He was diagnosed with acute appendicitis. The resected appendix showed acute appendicitis complicated by appendiceal metastasis from lung cancer. Adenocarcinoma was observed predominantly in the serous membrane from the neck to the tail of the appendix. The distribution of the adenocarcinoma was diffuse. Peritoneal dissemination was considered the route of metastasis. He was admitted to the palliative care unit 10 months after appendectomy. Appendiceal metastasis via peritoneal dissemination from lung cancer complicated appendicitis in our patient who had been receiving bevacizumab.

  5. Acute appendiceal abscess and atraumatic splenic rupture: A case of dual pathology.

    Science.gov (United States)

    Ananthavarathan, Piriyankan; Patel, Kamlesh; Doran, Catherine; Suggett, Nigel

    2016-01-01

    Atraumatic splenic rupture is a rare surgical emergency that is often attributed to neoplastic or infectious causes. Rarely, it has been identified to also occur in the setting of an acute severe sepsis and in cases of pelvic or splenic abscess formation post-appendicectomy. However, to our knowledge, the co-presentation of acute appendiceal abscess and splenic rupture has not been previously described. We present the case of a 67-year old male with decompensating haemorrhagic shock secondary to atraumatic splenic rupture on a background of an inadequately treated complicated appendicitis originally managed as diverticulitis with antibiotics in the community. Intra-operatively, in addition to a de-gloved, ruptured spleen; an acutely inflamed appendiceal abscess was also identified. A concomitant splenectomy, washout and appendicectomy and was therefore performed. Histopathological examination revealed a normal spleen with a stripped capsular layer. Mucosal ulceration, transmural inflammation and serositis of the appendix appeared to be consistent with acute appendicitis. Our case demonstrates how inadequately treated sepsis may predispose to an acute presentation of splenic rupture with associated haemorrhagic shock; which may initially be interpreted as septic shock. However, we demonstrate how insults such as sepsis and haemorrhagic shock may co-exist warranting careful consideration of possible dual pathologies in complex presentations which may be life-threatening. While the causal relationship between acute appendicitis and atraumatic spontaneous splenic rupture remains unclear, our case considers and highlights the importance of considering dual pathology in patients presenting in the acute setting. Copyright © 2016. Published by Elsevier Ltd.

  6. Shipping container response to severe highway and railway accident conditions: Appendices

    International Nuclear Information System (INIS)

    Fischer, L.E.; Chou, C.K.; Gerhard, M.A.; Kimura, C.Y.; Martin, R.W.; Mensing, R.W.; Mount, M.E.; Witte, M.C.

    1987-02-01

    Volume 2 contains the following appendices: Severe accident data; truck accident data; railroad accident data; highway survey data and bridge column properties; structural analysis; thermal analysis; probability estimation techniques; and benchmarking for computer codes used in impact analysis. (LN)

  7. Mesh Inguinal Hernia Repair and Appendectomy in the Treatment of Amyand’s Hernia with Non-Inflamed Appendices

    Directory of Open Access Journals (Sweden)

    Emin Kose

    2017-01-01

    Full Text Available Amyand’s hernia is defined as protrusion of the vermiform appendix in an inguinal hernia sac. It is a rare entity with variable clinical presentation from normal vermiform appendix to abscess formation due to perforation of acute appendicitis. Although surgical treatment includes appendectomy and hernia repair, appendectomy in the absence of an inflamed appendix and use of a mesh in cases of appendectomy remain to be controversial. The aim of this study was to review the experience of mesh inguinal hernia repair plus appendectomy performed for Amyand’s hernia with noninflamed appendices. There were five male patients with a mean age of 42.4 ± 16.1 years in this retrospective study in which Amyand’s hernia was treated with mesh inguinal hernia repair plus appendectomy for noninflamed appendices. Patients with acute appendicitis and perforated vermiform appendix were excluded. There were four right sided and one bilateral inguinal hernia. Postoperative courses were uneventful. During the follow-up period (14.0 ± 7.7 months, there was no inguinal hernia recurrence. Mesh inguinal hernia repair with appendectomy can be performed for Amyand’s hernia in the absence of acute appendicitis. However, presence of fibrous connections between the vermiform appendix and the surrounding hernia sac may be regarded as a parameter to perform appendectomy.

  8. Research reactor core conversion guidebook. V.2: Analysis (Appendices A-F)

    International Nuclear Information System (INIS)

    1992-04-01

    Volume 2 consists of detailed Appendices, covering safety analyses for generic 10 MW reactor, safety analysis - probabilistic methods, methods for preventing LOCA, radiological consequence analyses, examples of safety report amendments and safety specifications. Included in Volume 2 are example analyses for cores with with highly enriched uranium and low enriched uranium fuels showing differences that can be expected in the safety parameters and radiological consequences of postulated accidents. There are seven examples of licensing documents related to core conversion and two examples of methods for determining power limits for safety specifications in the document. Refs, figs, bibliographies and tabs

  9. Ileocecal Burkitt's Lymphoma Presenting as Ileocolic Intussusception With Appendiceal Invagination and Acute Appendicitis

    Directory of Open Access Journals (Sweden)

    Sheng-Mine Wang

    2010-06-01

    Full Text Available Intussusception is a common cause of abdominal pain in children. Although most cases are idiopathic, about 10% of cases have a pathologic lead point. Burkitt's lymphoma is not a common etiology. Burkitt's lymphoma might present primarily as intussusception in children but has rarely been associated with appendicitis. We report a case in which a 10-year-old obese boy who initially presented with acute appendicitis due to ileocolic intussusception with appendiceal invagination. He underwent one-trocar laparoscopy and antibiotic treatment. The symptoms recurred 10 days after discharge. Colonoscopy disclosed ileocecal Burkitt's lymphoma as the pathological lead point. This case emphasizes the importance of the age of the patient and the anatomic location of the intussusception related to possible etiology, and hence the most appropriate surgical procedure.

  10. International Photovoltaic Program Plan. Volume II. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Costello, D.; Koontz, R.; Posner, D.; Heiferling, P.; Carpenter, P.; Forman, S.; Perelman, L.

    1979-12-01

    This second volume of a two-part report on the International Photovoltaic Program Plan contains appendices summarizing the results of analyses conducted in preparation of the plan. These analyses include compilations of relevant statutes and existing Federal programs; strategies designed to expand the use of photovoltaics abroad; information on the domestic photovoltaic plan and its impact on the proposed international plan; perspectives on foreign competition; industry views on the international photovoltaic market and ideas about how US government actions could affect this market; international financing issues; and information on issues affecting foreign policy and developing countries.

  11. Local Agenda 21 in Apeldoorn, Netherlands. Appendices

    International Nuclear Information System (INIS)

    Dullens, M.; Schouw, J.C.; Straatman, T.G.

    1999-08-01

    The (im)possibilities of concrete projects to start Local Agenda 21 activities in Apeldoorn, Netherlands, are discussed. Attention is paid to options with respect to transportation, energy conservation, water use, soil pollution, waste management, and nature. Local Agenda 21 is a program by means of which local governments can contribute to sustainable targets as formulated during the 1992 conference Agenda 21 of the United Nations (UN). The appendices contain background information (reports of meetings, elaboration of ecological subjects in relation with socio-economic subjects, and a table with all the recommendations) and are published in this report. The main report is a separate publication

  12. Membranous appendices of spherosomes (oleosomes) : Possible role in fat utilization in germinating oil seeds.

    Science.gov (United States)

    Wanner, G; Theimer, R R

    1978-01-01

    Spherosomes (oleosomes) of cotyledons of rape (Brassica napus L.), sunflower (Helianthus annuus L.), and watermelon (Citrullus vulgaris, Schrad.) seedlings are delimited by a "half unit membrane" that appears to be continuous with each of the osmiophilic layers of a tripartite unit membrane forming a handlelike appendix of the spherosomes. Prior to any noticeable utilization of the spherosomal storage fat, ribosomes were found to be attached to these "handles". At later stages appendices of the spherosomes are smooth, showing a diameter of about 22 nm that greatly exceeds the thickness of any other unit membrane profiles identical in structure and diameter osomes appears to be continuous with the thick lipid layer of the handles. In intermediate stages of fat depletion the spherosomal bodies become invaginated with cytoplasmic material. Finally vesicles with cytoplasmic contents surrounded by a membrane with a typically thick lipid layer are left in the cells. Membrane profiles indentical in structure and diameter to the spherosomal appendices were also present in electron micrographs of the lipolytic membrane fraction recovered from sucrose density gradients after centrifugation of a microsomal cell fraction. The ultrastructural observations are taken for evidence that the spherosomal appendices represent the lipase-carrying membranes isolated previously (Theimer and Rosnitschek, 1978). A novel hypothesis for development and utilization of fat-storing spherosomes is also proposed.

  13. Portsmouth Gaseous Diffusion Plant expansion: final environmental statement. Volume 2. Appendices

    International Nuclear Information System (INIS)

    1977-09-01

    Volume 2 is comprised of appendices: Portsmouth Gaseous Diffusion Plant Existing Facilities; Ecology; Civic Involvement; Social Analysis; Population Projections; Toxicity of Air Pollutants to Biota at Portsmouth Gaseous Diffusion Plant; and Assessment of Noise Effects of an Add-On to the Portsmouth Gaseous Diffusion Plant

  14. Primary appendiceal lymphoma presenting as suspected perforated acute appendicitis: clinical, sonography and CT findings with pathologic correlation.

    Science.gov (United States)

    Guo, Jingjing; Wu, Gang; Chen, Xiaojun; Li, Xiaodong

    2014-01-01

    The gastrointestinal tract is the most common site for extranodal involvement by non-Hodgkin's lymphoma. However, primary appendiceal lymphomas presenting as perforated acute appendicitis are very rare: they occur in only 0.015% of all gastrointestinal lymphoma cases. The management of this condition is still controversial, and a multimodality approach (e.g., surgery, radiation therapy, and chemotherapy) is the optimal treatment. In these cases, appendiceal non-Hodgkin's lymphomas typically manifest with acute symptoms in patients with no prior lymphoma history. Additionally, we treated our patient with a right hemicolectomy and postoperative multiagent chemotherapy.

  15. Geothermal resource assessment for the state of Texas: status of progress, November 1980. Final report. Appendices A through D

    Energy Technology Data Exchange (ETDEWEB)

    Woodruff, C.M. Jr.; Caran, S.C.; Gever, C.; Henry, C.D.; Macpherson, G.L.; McBride, M.W.

    1982-03-01

    These appendices include: a folio of county maps showing locations of well data across the state; a computerized tabulation of the wells depicted; an explanation of the computer coding procedures; and a selected bibliography on heat flow and geothermics. (MHR)

  16. Magnetic Fusion Energy Program. Volume I. Introduction, technical summaries, list of publications, etc., Appendices A-K. Annual report

    International Nuclear Information System (INIS)

    Aamodt, R.E.; Byrne, R.N.; Catto, P.J.

    1979-12-01

    An abstract was prepared for the progress summary on transport theory for open and closed magnetic configurations. Seven abstracts were prepared for included appendices of more detailed work on individual devices. Also included is a list of publications, technical presentations, and DOE program contributions

  17. Report on AECB consultative document C-70: The use of fault trees in licensing submissions

    International Nuclear Information System (INIS)

    1984-01-01

    The Atomic Energy Control Board (AECB) has issued Consultative Document C-70, 'The Use of Fault Trees in Licensing Submissions', for public comment. The Advisory Committee on Nuclear Safety (ACNS) has examined this document and ACNS members have met with AECB staff and representatives of the nuclear industry to discuss it. The ACNS presents its comments and recommendations in this report. The consultative document defines a fault tree as a hierarchically-structured graphical representation of system failures and their potential causes. The document then states certain basic characteristics or attributes which fault trees should possess, and certain conditions affecting the use of fault trees. It defines fault tree fundamentals, sets criteria for the application of fault trees to systems and defines ground rules for a fault tree format. Finally, in two appendices, it includes specific rules for fault tree symbols and fault tree description files for computer use. The appendices are referred to in the text as 'acceptable' standards or methods

  18. Socioeconomic effects of the DOE Gas Centrifuge Enrichment Plant. Volume 2: appendices

    International Nuclear Information System (INIS)

    1979-01-01

    Volume 2 contains 18 appendices: schools; fire protection; law enforcement; water and sewer systems; solid waste; health care; transportation; recreation; labor force; economic effects; finance; school finance; bibliography; contacts; project methodology; service impacts; reference tables; and response to comments

  19. Design tradeoff studies and sensitivity analysis. Appendices B1-B4. [HYBRID

    Energy Technology Data Exchange (ETDEWEB)

    1979-05-25

    These four appendices to the report on the Near-Term Hybrid Vehicle (NTHV) report contain information on: HYBRID computer program documentation; material substitution study for advanced hybrid vehicles; NTHV market potential; battery compartment weight distribution; and vehicle handling dynamics. (LCL)

  20. Risk of appendiceal endometriosis among women with deep-infiltrating endometriosis.

    Science.gov (United States)

    Moulder, Janelle K; Siedhoff, Matthew T; Melvin, Kathryn L; Jarvis, Elizabeth G; Hobbs, Kumari A; Garrett, Joanne

    2017-11-01

    To determine whether deep-infiltrating endometriosis (DE) carries an increased risk of appendiceal endometriosis (AppE) as compared with superficial endometriosis or no endometriosis. In a retrospective study, data were obtained by chart review of an internal database for women who underwent coincidental appendectomy during benign gynecologic surgery between July 2009 and February 2014 at a tertiary referral center in the USA. Univariate, bivariate, and regression analyses were performed. The primary exposure was surgically documented endometriosis (DE, superficial, or no endometriosis). The primary outcome was AppE. Endometriosis was diagnosed for 151 (38.2%) of 395 women; 82 (54.3%) had DE. The prevalence of AppE was 13.2% (52/395) overall; 8 (11.6%) of 69 women with superficial endometriosis and 32 (39.0%) of 82 with DE were affected. Frequency of AppE was increased among women with DE, abnormal appendix appearance, and surgical indication (all Pendometriosis, controlling for appendiceal appearance and surgical indication, and a 2.7-fold (95% CI 1.2-6.2) higher risk of AppE compared with those with superficial endometriosis. Women with DE have increased risk of AppE. Coincidental appendectomy should form part of complete endometriosis excision for these patients. © 2017 International Federation of Gynecology and Obstetrics.

  1. The backfilling and sealing of radioactive waste repositories. V. 2. Figure - Tables - Appendices

    International Nuclear Information System (INIS)

    1984-01-01

    The two volumes of this report present a review study about backfilling and sealing of radioactive waste repositories in granites, argillaceous and salt formations. Volume 2 contains all the figures, table and appendices A detailed account of candidate backfill materials is given in a standardized format

  2. Solar central receiver hybrid power system, Phase I. Volume 3. Appendices. Final technical report, October 1978-August 1979

    Energy Technology Data Exchange (ETDEWEB)

    None

    1979-09-01

    A design study for a central receiver/fossil fuel hybrid power system using molten salts for heat transfer and heat storage is presented. This volume contains the appendices: (A) parametric salt piping data; (B) sample heat exchanger calculations; (C) salt chemistry and salt/materials compatibility evaluation; (D) heliostat field coordinates; (E) data lists; (F) STEAEC program input data; (G) hybrid receiver design drawings; (H) hybrid receiver absorber tube thermal math model; (I) piping stress analysis; (J) 100-MWe 18-hour storage solar central receiver hybrid power system capital cost worksheets; and (K) 500-MWe 18-hour solar central receiver hybrid power system cost breakdown. (WHK)

  3. Remedial Investigation/Feasibility Study, Operable Unit 5, Elmendorf AFB, Anchorage, Alaska. Volume 2. Text and Appendices A - J

    Science.gov (United States)

    1994-03-04

    hitting abandoned paper sheathed copper wire telephone cable at 4.2’. Boring moved. No discernible floating product. 35.0 . 40.0 45.0 50.0 55.0 - jPROJECT...0.60 U N/C Magnesium, Mg 14.3 U 14.3 U N/C Manganese, Mn 0.80 U 0.80 U N/C Mercury, Hg 0.10 U 0.10 U N/C Nikel , Ni 7.7 U 7.7 U N/C Potassium, K 191 U

  4. Developing maintainability for tokamak fusion power systems. Phase I report. Volume II. Appendices

    International Nuclear Information System (INIS)

    Zahn, H.S.

    1977-10-01

    This volume contains the following appendices: (1) baseline large module time estimates, (2) baseline intermediate module time estimates, (3) baseline small module time estimates, (4) alternate concept estimates, (5) maintenance equipment concepts, (6) additional reactor design definition, and (7) TOCOMO supplements

  5. US Department of Energy Nevada Operations Office annual site environmental report: 1993. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Black, S.C.; Glines, W.M.; Townsend, Y.E.

    1994-09-01

    This report is comprised of appendices which support monitoring and surveillance on and around the Nevada Test Site (NTS) during 1993. Appendix A contains onsite Pu-238, gross beta, and gamma-emitting radionuclides in air. Appendix B contains onsite tritium in air. Appendix C contains onsite Pu-238, Sr-90, gross alpha and beta, gamma-emitting radionuclides, Ra-226, Ra-228 and tritium in water. A summary of 1993 results of offsite radiological monitoring is included in Appendix D. Appendix E contains radioactive noble gases in air onsite. Appendix F contains onsite thermoluminescent dosimeter data. Historical trends in onsite thermoluminescent dosimeter data are contained in Appendix G. Appendix H summarizes 1993 compliance at the DOE/NV NTS and non-NTS facilities. Appendix I summarizes the 1993 results of non radiological monitoring.

  6. US Department of Energy Nevada Operations Office annual site environmental report: 1993. Volume 2: Appendices

    International Nuclear Information System (INIS)

    Black, S.C.; Glines, W.M.; Townsend, Y.E.

    1994-09-01

    This report is comprised of appendices which support monitoring and surveillance on and around the Nevada Test Site (NTS) during 1993. Appendix A contains onsite Pu-238, gross beta, and gamma-emitting radionuclides in air. Appendix B contains onsite tritium in air. Appendix C contains onsite Pu-238, Sr-90, gross alpha and beta, gamma-emitting radionuclides, Ra-226, Ra-228 and tritium in water. A summary of 1993 results of offsite radiological monitoring is included in Appendix D. Appendix E contains radioactive noble gases in air onsite. Appendix F contains onsite thermoluminescent dosimeter data. Historical trends in onsite thermoluminescent dosimeter data are contained in Appendix G. Appendix H summarizes 1993 compliance at the DOE/NV NTS and non-NTS facilities. Appendix I summarizes the 1993 results of non radiological monitoring

  7. Case-study application of venture analysis: the integrated energy utility. Volume 3. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Fein, E; Gordon, T J; King, R; Kropp, F G; Shuchman, H L; Stover, J; Hausz, W; Meyer, C

    1978-11-01

    The appendices for a case-study application of venture analysis for an integrated energy utility for commercialization are presented. The following are included and discussed: utility interviews; net social benefits - quantitative calculations; the financial analysis model; market penetration decision model; international district heating systems; political and regulatory environment; institutional impacts.

  8. Siting, design and cost of shallow land burial facilities in Northern New England. Volume 2. Appendices A-G

    International Nuclear Information System (INIS)

    1985-05-01

    Volume 2 comprises the following Appendices: Existing Environmental Data Base in Maine; Wetland Definition and Classification; Marine Clay; Screening Study; Basal Till Screening Study; Engineering Design Specifications and Costing; New York State Low-Level Radioactive Waste Management; and Maine Yankee's Cost of Low-Level Waste Disposal - 1973-1983

  9. Developing maintainability for tokamak fusion power systems. Phase I report. Volume II. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Zahn, H.S.

    1977-10-01

    This volume contains the following appendices: (1) baseline large module time estimates, (2) baseline intermediate module time estimates, (3) baseline small module time estimates, (4) alternate concept estimates, (5) maintenance equipment concepts, (6) additional reactor design definition, and (7) TOCOMO supplements. (MOW)

  10. Analysis of some nuclear waste management options. Volume II. Appendices

    International Nuclear Information System (INIS)

    Berman, L.E.; Ensminger, D.A.; Giuffre, M.S.; Koplik, C.M.; Oston, S.G.; Pollak, G.D.; Ross, B.I.

    1978-01-01

    This report describes risk analyses performed on that portion of a nuclear fuel cycle which begins following solidification of high-level waste. Risks associated with handling, interim storage and transportation of the waste are assessed, as well as the long term implications of disposal in deep mined cavities. The risk is expressed in terms of expected dose to the general population and peak dose to individuals in the population. This volume consists of appendices which provide technical details of the work performed

  11. Analysis of some nuclear waste management options. Volume II. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Berman, L.E.; Ensminger, D.A.; Giuffre, M.S.; Koplik, C.M.; Oston, S.G.; Pollak, G.D.; Ross, B.I.

    1978-10-10

    This report describes risk analyses performed on that portion of a nuclear fuel cycle which begins following solidification of high-level waste. Risks associated with handling, interim storage and transportation of the waste are assessed, as well as the long term implications of disposal in deep mined cavities. The risk is expressed in terms of expected dose to the general population and peak dose to individuals in the population. This volume consists of appendices which provide technical details of the work performed.

  12. Report of the Bulletins and Orders Task Force. Volume II. Appendices

    International Nuclear Information System (INIS)

    1980-01-01

    Appendices include: Office of Inspection and Enforcement bulletins; NRR status report on feedwater transients in BWR plants; orders on Babcock and Wilcox Company plants; letters lifting orders; letters issuing auxiliary feedwater system requirements; letter to licensees of all operating reactors, dated October 30, 1979 concerning short-term lessons learned requirements; and letters approving guidelines for preparation of small-break LOCA operating procedures

  13. Demonstration, testing, & evaluation of in situ heating of soil. Draft final report, Volume II: Appendices A to E

    Energy Technology Data Exchange (ETDEWEB)

    Dev, H.; Enk, J.; Jones, D.; Saboto, W.

    1996-02-12

    This document is a draft final report for US DOE contract entitled, {open_quotes}Demonstration Testing and Evaluation of In Situ Soil Heating,{close_quotes} Contract No. DE-AC05-93OR22160, IITRI Project No. C06787. This report is presented in two volumes. Volume I contains the technical report This document is Volume II, containing appendices with background information and data. In this project approximately 300 cu. yd. of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOCs and other organic chemicals boiling up to 120{degrees}to 130{degrees}C in the vadose zone. Although it may applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by low air flow.

  14. Advanced Neutron Source enrichment study. Volume 2: Appendices -- Final report, Revision 12/94

    International Nuclear Information System (INIS)

    Bari, R.A.; Ludewig, H.; Weeks, J.

    1994-01-01

    A study has been performed of the impact on performance of using low enriched uranium (20% 235 U) or medium enriched uranium (35% 235 U) as an alternative fuel for the Advanced Neutron Source, which is currently designed to use uranium enriched to 93% 235 U. Higher fuel densities and larger volume cores were evaluated at the lower enrichments in terms of impact on neutron flux, safety, safeguards, technical feasibility, and cost. The feasibility of fabricating uranium silicide fuel at increasing material density was specifically addressed by a panel of international experts on research reactor fuels. The most viable alternative designs for the reactor at lower enrichments were identified and discussed. Several sensitivity analyses were performed to gain an understanding of the performance of the reactor at parametric values of power, fuel density, core volume, and enrichment that were interpolations between the boundary values imposed on the study or extrapolations from known technology. Volume 2 of this report contains 26 appendices containing results, meeting minutes, and fuel panel presentations. There are 26 appendices in this volume

  15. BPA/Lower Valley transmission project. Final environmental impact statement. Appendices A, B, D, E, G-N

    International Nuclear Information System (INIS)

    1998-06-01

    Bonneville Power Administration is investigating the feasibility of constructing an additional transmission line, which for the most part will be adjacent to the existing transmission line. This would require the construction or acquisition of additional access roads, used for routine and emergency maintenance and construction activities. A survey was conducted to map any occurrences of threatened, endangered and sensitivity plant species and weed species along the Swan Valley-Teton Line. This report contains Appendices A, B, D, E, G--N

  16. Airborne gamma-ray spectrometer and magnetometer survey, Durango C, Colorado. Final report Volume II A. Detail area

    International Nuclear Information System (INIS)

    1983-01-01

    Geology of Durango C detail area, radioactive mineral occurrences in Colorado, and geophysical data interpretation are included in this report. Eight appendices provide: stacked profiles, geologic histograms, geochemical histograms, speed and altitude histograms, geologic statistical tables, magnetic and ancillary profiles, and test line data

  17. Master plan study - District heating Sillamaee municipality. Estonia. Final report. Appendices for chapter 9

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The appendices to the final report on the master plan study on district heating in the municipality in Estonia, chapter nine, gives data related to general economic assumptions for financial and economic calculations, fuel consumption, financing, prices, fuel consumption. (ARW)

  18. 76 FR 64112 - Privacy Act of 1974; Privacy Act System of Records Appendices

    Science.gov (United States)

    2011-10-17

    ... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice (11-091)] Privacy Act of 1974; Privacy Act...: Revisions of NASA Appendices to Privacy Act System of Records. SUMMARY: Notice is hereby given that NASA is... Privacy Act of 1974. This notice publishes those amendments as set forth below under the caption...

  19. Technology, safety and costs of decommissioning a reference boiling water reactor power station. Appendices. Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    Oak, H.D.; Holter, G.M.; Kennedy, W.E. Jr.; Konzek, G.J.

    1980-06-01

    Appendices are presented concerning the evaluations of decommissioning financing alternatives; reference site description; reference BWR facility description; radiation dose rate and concrete surface contamination data; radionuclide inventories; public radiation dose models and calculated maximum annual doses; decommissioning methods; generic decommissioning information; immediate dismantlement details; passive safe storage, continuing care, and deferred dismantlement details; entombment details; demolition and site restoration details; cost estimating bases; public radiological safety assessment details; and details of alternate study bases.

  20. Worldwide status of energy standards for buildings: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Janda, K.B.; Busch, J.F.

    1993-02-01

    This informal survey was designed to gain information about the worldwide status of energy efficiency standards for buildings, particularly non-residential buildings such as offices, schools, and hotels. The project has three goals: 1. To understand and learn from the experience of countries with existing building energy standards; 2. To locate areas where these lessons might be applied and energy standards might be effectively proposed and developed; and 3. To share the information gathered with all participating countries. These appendices include the survey cover letter, the survey, and the details of selected energy standards in 35 countries, thus providing supporting material for the authors` article of the same title.

  1. Review of technology for Arctic offshore oil and gas recovery. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Sackinger, W. M.

    1980-06-06

    This volume contains appendices of the following: US Geological Survey Arctic operating orders, 1979; Det Noske Vertas', rules for the design, construction and inspection of offshore technology, 1977; Alaska Oil and Gas Association, industry research projects, March 1980; Arctic Petroleum Operator's Association, industry research projects, January 1980; selected additional Arctic offshore bibliography on sea ice, icebreakers, Arctic seafloor conditions, ice-structures, frost heave and structure icing.

  2. Technology, Safety and Costs of Decommissioning a Reference Low-Level Waste Burial Ground. Appendices

    International Nuclear Information System (INIS)

    None

    1980-01-01

    Safety and cost information are developed for the conceptual decommissioning of commercial low-level waste (LLW) burial grounds. Two generic burial grounds, one located on an arid western site and the other located on a humid eastern site, are used as reference facilities for the study. The two burial grounds are assumed to have the same site capacity for waste, the same radioactive waste inventory, and similar trench characteristics and operating procedures. The climate, geology. and hydrology of the two sites are chosen to be typical of real western and eastern sites. Volume 2 (Appendices) contains the detailed analyses and data needed to support the results given in Volume 1.

  3. Demonstration, testing, ampersand evaluation of in situ heating of soil. Draft final report, Volume II: Appendices A to E

    International Nuclear Information System (INIS)

    Dev, H.; Enk, J.; Jones, D.; Saboto, W.

    1996-01-01

    This document is a draft final report for US DOE contract entitled, open-quotes Demonstration Testing and Evaluation of In Situ Soil Heating,close quotes Contract No. DE-AC05-93OR22160, IITRI Project No. C06787. This report is presented in two volumes. Volume I contains the technical report This document is Volume II, containing appendices with background information and data. In this project approximately 300 cu. yd. of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOCs and other organic chemicals boiling up to 120 degrees to 130 degrees C in the vadose zone. Although it may applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by low air flow

  4. Preliminary conceptual design study of the RIGGATRON approach to fusion power. Appendices P--T

    International Nuclear Information System (INIS)

    1978-01-01

    The following appendices are included: (1) background information on high strength materials; (2) parametric systems analysis and economic studies; (3) RIGGATRON plants for materials irradiation testing; (4) RIGGATRON recycling model and cost; and (5) impact analysis of the commerical application of RIGGATRON fusion power concept

  5. New York City School Survey 2008-2010: Assessing the Reliability and Validity of a Progress Report Measure. Technical Appendices

    Science.gov (United States)

    Nathanson, Lori; Cole, Rachel; Kemple, James J.; Lent, Jessica; McCormick, Meghan; Segeritz, Micha

    2013-01-01

    The Research Alliance for New York City Schools examined Department of Education (DOE) School Survey data from 2008-2010 to better understand the richness and complexities of the information elicited by the Survey from parents, students, and teachers. This document provides the appendices to the technical report "New York City School Survey…

  6. Tank characterization report for single-shell tank 241-C-109

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, B.C.

    1997-05-23

    One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices.

  7. Tank characterization report for single-shell tank 241-C-109

    International Nuclear Information System (INIS)

    Simpson, B.C.

    1997-01-01

    One of the major functions of the Tank Waste Remediation System (TWRS) is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-109. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241 C-109 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices

  8. Replacement Nuclear Research Reactor: Draft Environmental Impact Statement. Vol. 2. Appendices

    International Nuclear Information System (INIS)

    1998-07-01

    The appendices contains additional relevant information on: Environment Australia EIS Guidelines, composition of the Study Team, Consultation Activities and Resuits, Relevant Legislation and Regulatory Requirements, Exampies of Multi-Purpose Research Reactors, Impacts of Radioactive Emissions and Wastes Generated at Lucas Heights Science and Technology Centre, Technical Analysis of the Reference Accident, Flora and Fauna Species Lists, Summary of Environmental Commitments and an Outline of the Construction Environmental Management Plan Construction Environmental Management Plan

  9. The environmental survey manual: Appendices E, F, G, H, I, J, and K

    International Nuclear Information System (INIS)

    1987-08-01

    Appendices E, F, G, H, I, J and K of the Environmental Survey Manual address the following topics: Field Sampling Protocols and Guidance; Guidelines for Preparation of Quality Assurance Plans; Decontamination Guidance; Data Management and Analysis; Sample and Document Management; Health and Safety Guidance for Sampling and Analysis Teams; Documents for Sampling and Analysis Program

  10. [Appendiceal abscess in the third gestational trimester of pregnancy, complications pre and postoperatively].

    Science.gov (United States)

    Cyrkowicz, A; Cibor, Z; Słowińska-Zabówka, M; Kisiel, W; Oleksy, P; Orczyk, K; Bajorek, M; Kwiek, G

    1996-01-01

    Delayed surgical intervention connected with misdiagnosis of preterm labour and urinary tract infection caused in gravida 3 in 34th gestational week appendiceal abscess, septic shock, stillbirth by cesarean section, necessity of hysterectomy, recidivism of multi peritoneal and pleural abscesses. Although the patient was rescued the retrospective pro memoria considerations of our procedure are regarded.

  11. Technical area status report for chemical/physical treatment. Volume 2, Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Brown, C.H. Jr. [Oak Ridge National Lab., TN (United States); Schwinkendorf, W.E. [BDM Federal, Inc., Arlington, VA (United States)

    1993-08-01

    These Appendices describe various technologies that may be applicable to the Mixed Waste Treatment Plant (MWTP) Chemical/Physical Treatment System (CPTS). These technologies were identified by the CPTS Technical Support Group (TSG) as potentially applicable to a variety of separation, volume reduction, and decontamination requirements. The purpose was to identify all available and developing technologies, and their characteristics, for subsequent evaluation for specific requirements identified for the CPTS. However, the technologies described herein are not necessarily all inclusive, nor are they necessarily all applicable.

  12. Ocean Thermal Energy Conversion (OTEC) Programmatic Environmental Analysis--Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Authors, Various

    1980-01-01

    The programmatic environmental analysis is an initial assessment of Ocean Thermal Energy Conversion (OTEC) technology considering development, demonstration and commercialization. It is concluded that the OTEC development program should continue because the development, demonstration, and commercialization on a single-plant deployment basis should not present significant environmental impacts. However, several areas within the OTEC program require further investigation in order to assess the potential for environmental impacts from OTEC operation, particularly in large-scale deployments and in defining alternatives to closed-cycle biofouling control: (1) Larger-scale deployments of OTEC clusters or parks require further investigations in order to assess optimal platform siting distances necessary to minimize adverse environmental impacts. (2) The deployment and operation of the preoperational platform (OTEC-1) and future demonstration platforms must be carefully monitored to refine environmental assessment predictions, and to provide design modifications which may mitigate or reduce environmental impacts for larger-scale operations. These platforms will provide a valuable opportunity to fully evaluate the intake and discharge configurations, biofouling control methods, and both short-term and long-term environmental effects associated with platform operations. (3) Successful development of OTEC technology to use the maximal resource capabilities and to minimize environmental effects will require a concerted environmental management program, encompassing many different disciplines and environmental specialties. This volume contains these appendices: Appendix A -- Deployment Scenario; Appendix B -- OTEC Regional Characterization; and Appendix C -- Impact and Related Calculations.

  13. Resource Programs : Draft Environmental Impact Statement, Volume 2, Appendices.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration.

    1992-03-01

    Every two years, Bonneville Power Administration (BPA) prepares a Resource Program which identifies the resource actions BPA will take to meet its obligation to serve the forecasted power requirements of its customers. The Resource Program`s Environmental Impact Statement (RPEIS) is a programmatic environmental document which will support decisions made in several future Resource Programs. Environmental documents tiered to the EIS may be prepared on a site-specific basis. The RPEIS includes a description of the environmental effects and mitigation for the various resource types available in order to evaluate the trade-offs among them. It also assesses the environmental impacts of adding thirteen alternative combinations of resources to the existing power system. This report contains the appendices to the RPEIS.

  14. Assessment of LWR spent fuel disposal options. Volume 3. Study bases and system design considerations (Appendices). Technical report

    Energy Technology Data Exchange (ETDEWEB)

    1979-07-01

    Volume 3 (Appendices) provides a tabulation of the bases and assumptions used in the study as well as preconceptual design description and cost estimates of the facilities and transportation systems necessary to implement the various study cases.

  15. Assessment of LWR spent fuel disposal options. Volume 3. Study bases and system design considerations (Appendices). Technical report

    International Nuclear Information System (INIS)

    1979-07-01

    Volume 3 (Appendices) provides a tabulation of the bases and assumptions used in the study as well as preconceptual design description and cost estimates of the facilities and transportation systems necessary to implement the various study cases

  16. Master plan study - District heating Kohtla-Jaerve and Johvi municipalities. Estonia. Final report. Appendices for chapter 7

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The appendices to chapter 7 of the master plan study on district heating in the municipalities of Kohtla-Jarve and Johvi (Estonia) present technical data on production units, also with regard to new facilities. (ARW)

  17. Tank characterization report for single-shell tank 241-C-104

    Energy Technology Data Exchange (ETDEWEB)

    Baldwin, J.H.

    1997-05-21

    A major function of the Tank Waste Remediation System is to characterize wastes in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, along with other available information about a tank, are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for single-shell tank 241-C-104. The objectives of this report are: (1) to use characterization data in response to technical issues associated with tank 241-C-104 waste; and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. The response to technical issues is summarized in Section 2.0, and the best-basis inventory estimate is presented in Section 3.0. Recommendations regarding safety status and additional sampling needs are provided in Section 4.0. Supporting data and information are contained in the appendices. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1996) milestone M-44-10.

  18. Residential photovoltaic module and array requirement study. Low-Cost Solar Array Project engineering area. Final report appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-06-01

    This volume contains the appendices to a study to identify design requirements for photovoltaic modules and arrays used in residential applications. Appendices include: (1) codes, standards, and manuals of accepted practice-definition and importance; (2) regional code variations-impact; (3) model and city codes-review; (4) National Electric Code (NEC)-review; (5) types of standards-definition and importance; (6) federal standards-review; (7) standards review method; (8) manuals of accepted practice; (9) codes and referenced standards-summary; (10) public safety testing laboratories; (11) insurance review; (12) studies approach; (13) mounting configurations; (14) module/panel size and shape cost analysis; (15) grounding, wiring, terminal and voltage studies; (16) array installation cost summary; (17) photovoltaic shingle/module comparison; (18) retrofit application; (19) residential photovoltaic module performance criteria; (20) critique of JPL's solar cell module design and test specifications for residential applications; and (21) CSI format specification. (WHK)

  19. CT and MR imaging findings of appendiceal and hepatic mucormycosis in a patient with acute T-lymphoblastic leukemia

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Seo Youn; Lee, Min Hee; Lee, Hae Kyung; Yi, Boem Ha; Chin, Su Sie; Park, Seong Kyu; Chung, Jun Chul [Soonchunhyang University Bucheon Hospital, Bucheon (Korea, Republic of)

    2015-11-15

    Fungal infections occur in severely immunocompromised patients having profound and prolonged neutropenia. Here, we report a case of a 41-year-old female who, at the conclusion of induction chemotherapy for acute T-lymphoblastic leukemia, developed angioinvasive mucormycosis involving the appendix and liver, which presented as abdominal pain. This case is the first to provide detailed computed tomography and magnetic resonance imaging findings of angioinvasive appendiceal and hepatic mucormycosis. The implications of these findings as well as the diagnosis and management of mucormycosis, is further discussed.

  20. CT and MR imaging findings of appendiceal and hepatic mucormycosis in a patient with acute T-lymphoblastic leukemia

    International Nuclear Information System (INIS)

    Choi, Seo Youn; Lee, Min Hee; Lee, Hae Kyung; Yi, Boem Ha; Chin, Su Sie; Park, Seong Kyu; Chung, Jun Chul

    2015-01-01

    Fungal infections occur in severely immunocompromised patients having profound and prolonged neutropenia. Here, we report a case of a 41-year-old female who, at the conclusion of induction chemotherapy for acute T-lymphoblastic leukemia, developed angioinvasive mucormycosis involving the appendix and liver, which presented as abdominal pain. This case is the first to provide detailed computed tomography and magnetic resonance imaging findings of angioinvasive appendiceal and hepatic mucormycosis. The implications of these findings as well as the diagnosis and management of mucormycosis, is further discussed

  1. Replacement Nuclear Research Reactor: Draft Environmental Impact Statement. Vol. 2. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-07-01

    The appendices contains additional relevant information on: Environment Australia EIS Guidelines, composition of the Study Team, Consultation Activities and Resuits, Relevant Legislation and Regulatory Requirements, Exampies of Multi-Purpose Research Reactors, Impacts of Radioactive Emissions and Wastes Generated at Lucas Heights Science and Technology Centre, Technical Analysis of the Reference Accident, Flora and Fauna Species Lists, Summary of Environmental Commitments and an Outline of the Construction Environmental Management Plan Construction Environmental Management Plan figs., ills., refs. Prepared for Australian Nuclear Science and Technology Organisation (ANSTO)

  2. GPU v. B and W lawsuit review and its effect on TMI-1 (Docket 50-289). Volume 2. Appendices

    International Nuclear Information System (INIS)

    1983-09-01

    Volume II of the GPU v. B and W lawsuit review contains four appendices supporting the review of the GPU v. B and W lawsuit discussed in Volume I of this report. As outlined in the Background section of Volume I under (3) Review Method Utilized by the Staff, the GPU v. B and W lawsuit review was partitioned into 10 categories. The 154 certification items and the 19 long-term actions (hearing items or restart issues) resulting from Commission Orders and the hearing process were each placed in one or more of the 10 categories. These appendices contain the hearing items by category; lawsuit record by category; category location matrix for lawsuit record; and uncategorized lawsuit record

  3. The backfilling and sealing of radioactive waste repositories. V. 1. Text - Reference - List of symbols

    International Nuclear Information System (INIS)

    1984-01-01

    The report is in two volumes: Volume 1 contains the main text, the references and a list of symbols, and Volume 2, all the figues, tables and appendices. In Volume 1, backfilling and sealing is considered in relation to the geological, physical and chemical environments. There follows a detailed evaluation of the role and performance of the backfilling and sealing system in terms of thermal, hydraulic, chemical buffering, radionuclide retention, mechanical properties and behaviour as well as longevity. The results of the listing, screening and classification of a comprehensive range of candidate backfill materials are summarized. The different candidate materials are examined

  4. Technology, safety, and costs of decommissioning reference light-water reactors following postulated accidents. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, E S; Holter, G M

    1982-11-01

    Appendices contain information concerning the reference site description; reference PWR facility description; details of reference accident scenarios and resultant contamination levels; generic cleanup and decommissioning information; details of activities and manpower requirements for accident cleanup at a reference PWR; activities and manpower requirements for decommissioning at a reference PWR; costs of decommissioning at a reference PWR; cost estimating bases; safety assessment details; and details of post-accident cleanup and decommissioning at a reference BWR.

  5. College Students' Perceptions of the C-Print Speech-to-Text Transcription System.

    Science.gov (United States)

    Elliot, L B; Stinson, M S; McKee, B G; Everhart, V S; Francis, P J

    2001-01-01

    C-Print is a real-time speech-to-text transcription system used as a support service with deaf students in mainstreamed classes. Questionnaires were administered to 36 college students in 32 courses in which the C-Print system was used in addition to interpreting and note taking. Twenty-two of these students were also interviewed. Questionnaire items included student ratings of lecture comprehension. Student ratings indicated good comprehension with C-Print, and the mean rating was significantly higher than that for understanding of the interpreter. Students also rated the hard copy printout provided by C-Print as helpful, and they reported that they used these notes more frequently than the handwritten notes from a paid student note taker. Interview results were consistent with those for the questionnaire. Questionnaire and interview responses regarding use of C-Print as the only support service indicated that this arrangement would be acceptable to many students, but not to others. Communication characteristics were related to responses to the questionnaire. Students who were relatively proficient in reading and writing English, and in speech-reading, responded more favorably to C-Print.

  6. 14 CFR Appendix A to Part 147 - Curriculum Requirements

    Science.gov (United States)

    2010-01-01

    ...) SCHOOLS AND OTHER CERTIFICATED AGENCIES AVIATION MAINTENANCE TECHNICIAN SCHOOLS Pt. 147, App. A Appendix A... must be taught, as outlined in appendices B, C, and D. (a) Definitions. As used in appendices B, C, and... application. (3) Level 3 requires: (i) Knowledge of general principles, and performance of a high degree of...

  7. Yucca Mountain transportation routes: Preliminary characterization and risk analysis; Volume 2, Figures [and] Volume 3, Technical Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Souleyrette, R.R. II; Sathisan, S.K.; di Bartolo, R. [Nevada Univ., Las Vegas, NV (United States). Transportation Research Center

    1991-05-31

    This report presents appendices related to the preliminary assessment and risk analysis for high-level radioactive waste transportation routes to the proposed Yucca Mountain Project repository. Information includes data on population density, traffic volume, ecologically sensitive areas, and accident history.

  8. Energy conservation in existing office buildings. Appendices to report, Phase I, Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1977-06-01

    A blank form of Questionnaire No. 1 is first presented, followed by data compiled from that questionnaire. Then data are presented on the analyses of the 436 buildings, statistical validation for selection of the 44 building sample, and some examples of the matching buildings for the 44 building sample. Questionnaire No. 2 is then given, followed by additional data collected from the study concerning energy consumption and building characteristics. To complete the appendices, a simulation of a typical building and a hypothetical building is included. (MCW)

  9. Rate of Appendiceal Metastasis with Non-Serous Epithelial Ovarian Cancer in Manitoba.

    Science.gov (United States)

    Altman, Alon D; Lefas, Georgia; Power, Laura; Lambert, Pascal; Lotocki, Robert; Dean, Erin; Nachtigal, Mark W

    2018-02-01

    This study sought to evaluate the rate of appendiceal involvement in non-serous mucinous and endometrioid-associated epithelial ovarian cancers. The Manitoba Cancer Registry and CancerCare database were used to find all women with non-serous epithelial ovarian, fallopian tube, or primary peritoneal cancer between 1995 and 2011. All patients with an appendectomy were then identified, and their final pathology findings were reviewed. Women who did not receive treatment or lacked follow-up were excluded. We identified 338 patients from 1995-2011 with no prior appendectomy. Of these, 16.6% received an appendectomy, and 22.8% were clinically evaluated. Most cases within this cohort were mucinous (62%) and stage 1 (63%). Four appendiceal metastases were identified (7.2%), and one half appeared clinically normal at the time of surgery (3.6%). Within the mucinous histologic type, 32.7% of patients received an appendectomy, with a metastatic rate of 5.7%. Of the 127 endometrioid cases, only 10 patients received an appendectomy, and 2 were found to have metastases. No metastases were found in the 85 patients in the clear cell cohort, only 5 of whom received an appendectomy. Routine appendectomy or clinical assessment of the appendix is valuable for all non-serous ovarian cancers. The rate of involvement for endometriosis-associated ovarian cancers may be significantly higher than expected, and further studies need to be conducted. Copyright © 2018 Society of Obstetricians and Gynaecologists of Canada. Published by Elsevier Inc. All rights reserved.

  10. Uranium milling, project M-25. Volume I. summary and text. Final generic environmental impact statement

    International Nuclear Information System (INIS)

    1980-09-01

    The Final Generic Environmental Impact Statement (GEIS) on Uranium Milling focuses primarily upon the matter of mill tailings disposal. It evaluates both the costs and benefits of alternative tailings disposal modes and draws conclusions about criteria which should be incorporated into regulations. Both institutional and technical controls are evaluated. Health impacts considered were both short and long term. Restatement and resolution of all public comments received on the draft (GEIS) are presented. There are three volumes: Volume I is the main text and Volumes II and III are supporting appendices

  11. Representativeness in corpora of literary texts: introducing the C18P project

    Directory of Open Access Journals (Sweden)

    Gemeinböck, Iris

    2016-07-01

    Full Text Available Currently there are very few specialised corpora of literary texts that are tailored to the needs of literary critics who are interested in corpus stylistic analyses of prose fiction. Many existing corpora including literary texts were compiled for linguistic research interests and are often unsuitable for corpus stylistic purposes. The paper addresses three of the main problems: the absence of labelling of the texts for literary genre, the use of extracts, and the prevalence of linguistic periodisation schemes. C18P is a corpus of prose fiction designed specifically to address these issues. It traces the early development of the novel from 1700 up until the Victorian era. It can, for instance, be used for an analysis of the characteristic linguistic features of individual literary genres and forms. The following paper introduces the design of the corpus as well as some of its potential uses.

  12. A Randomized Controlled Trial of a Text Messaging Intervention to Promote Virologic Suppression and Retention in Care in an Urban Safety-Net HIV Clinic: The Connect4Care (C4C) Trial.

    Science.gov (United States)

    Christopoulos, Katerina A; Riley, Elise D; Carrico, Adam W; Tulsky, Jacqueline; Moskowitz, Judith T; Dilworth, Samantha; Coffin, Lara S; Wilson, Leslie; Peretz, Jason Johnson; Hilton, Joan F

    2018-02-21

    Text messaging is a promising strategy to support HIV care engagement, but little is known about its efficacy in urban safety-net HIV clinic populations. We conducted a randomized controlled trial of a supportive and motivational text messaging intervention, Connect4Care (C4C), among viremic patients who had a history of poor retention or were new to clinic. Participants were randomized (stratified by new HIV diagnosis status) to receive one of the following for 12 months: 1) thrice-weekly intervention messages, plus texted primary care appointment reminders and a monthly text message requesting confirmation of study participation, or; 2) texted reminders and monthly messages alone. Viral load was assessed at 6 and 12 months. The primary outcome was virologic suppression (<200 copies/mL) at 12 months, estimated via repeated measures log-binomial regression, adjusted for new diagnosis status. The secondary outcome was retention in clinic care. Between August 2013-November 2015, 230 participants were randomized. Virologic suppression at 12 months was similar between intervention and control participants (48.8% vs. 45.8%), with negligible change from 6-month estimates, yielding RR 1.07 (95% CI: 0.82, 1.39). Suppression was higher in the newly diagnosed (78.3% vs. 45.3%). There were no intervention effects on the secondary outcome. Exploratory analyses suggested that patients with more responses to study text messages had better outcomes, regardless of arm. The C4C text messaging intervention did not significantly increase virologic suppression or retention in care. Response to text messages may be a useful way for providers to gauge risk for poor HIV outcomes. NCT01917994.

  13. Generic environmental impact statement on handling and storage of spent light water power reactor fuel. Appendices

    International Nuclear Information System (INIS)

    1978-03-01

    Detailed appendices are included with the following titles: light water reactor fuel cycle, present practice, model 1000MW(e) coal-fired power plant, increasing fuel storage capacity, spent fuel transshipment, spent fuel generation and storage data (1976-2000), characteristics of nuclear fuel, and ''away-from-reactor'' storage concept

  14. Characterization of Class A low-level radioactive waste 1986--1990. Volume 7: Appendices K--P

    Energy Technology Data Exchange (ETDEWEB)

    Dehmel, J.C.; Loomis, D.; Mauro, J. [S. Cohen & Associates, Inc., McLean, VA (United States); Kaplan, M. [Eastern Research Group, Inc., Lexington, MA (United States)

    1994-01-01

    Under contract to the US Nuclear Regulatory Commission, Office of Nuclear Regulatory Research, the firms of S. Cohen & Associates, Inc. (SC&A) and Eastern Research Group (ERG) have compiled a report that describes the physical, chemical, and radiological properties of Class-A low-level radioactive waste. The report also presents information characterizing various methods and facilities used to treat and dispose non-radioactive waste. A database management program was developed for use in accessing, sorting, analyzing, and displaying the electronic data provided by EG&G. The program was used to present and aggregate data characterizing the radiological, physical, and chemical properties of the waste from descriptions contained in shipping manifests. The data thus retrieved are summarized in tables, histograms, and cumulative distribution curves presenting radionuclide concentration distributions in Class-A waste as a function of waste streams, by category of waste generators, and regions of the United States. The report also provides information characterizing methods and facilities used to treat and dispose non-radioactive waste, including industrial, municipal, and hazardous waste regulated under Subparts C and D of the Resource Conservation and Recovery Act (RCRA). The information includes a list of disposal options, the geographical locations of the processing and disposal facilities, and a description of the characteristics of such processing and disposal facilities. Volume 1 contains the Executive Summary, Volume 2 presents the Class-A waste database, Volume 3 presents the information characterizing non-radioactive waste management practices and facilities, and Volumes 4 through 7 contain Appendices A through P with supporting information.

  15. Injection of radioactive waste by hydraulic fracturing at West Valley, New York. Volume 3. Appendices

    International Nuclear Information System (INIS)

    1978-05-01

    Ten appendices are included: log data, elastic constants for transversely isotropic elastic media by ultrasonic velocity measurement, fracture toughness anisotropy of West Valley shale, in-situ stress measurement techniques, stress measurement data, hydraulic fracturing measurements, enhancement of horizontal crack initiation by jetting, finite element programs for analysis of crack propagation and for groundwater flow analysis, and well data

  16. Compliance problems of small utility systems with the Powerplant and Industrial Fuel Use Act of 1978: volume II - appendices

    Energy Technology Data Exchange (ETDEWEB)

    None

    1981-01-01

    A study of the problems of compliance with the Powerplant and Industrial Fuel Use Act of 1978 experienced by electric utility systems which have a total generating capacity of less than 2000 MW is presented. This volume presents the following appendices: (A) case studies (Farmington, New Mexico; Lamar, Colorado; Dover, Delaware; Wolverine Electric Cooperative, Michigan; Central Telephone and Utilities, Kansas; Sierra Pacific Power Company, Nevada; Vero Beach, Florida; Lubbock, Texas; Western Farmers Cooperative, Oklahoma; and West Texas Utilities Company, Texas); (B) contacts and responses to study; (C) joint action legislation chart; (D) Texas Municipal Power Agency case study; (E) existing generating units jointly owned with small utilities; (F) future generating units jointly owned with small utilities; (G) Federal Register Notice of April 17, 1980, and letter of inquiry to utilities; (H) small utility responses; and (I) Section 744, PIFUA. (WHK)

  17. Multi-Path Transportation Futures Study. Vehicle Characterization and Scenario Analyses: Main Text and Appendices A, B, C, D, and F

    Energy Technology Data Exchange (ETDEWEB)

    Plotkin, Steve [Argonne National Lab. (ANL), Argonne, IL (United States); Singh, Margaret [Argonne National Lab. (ANL), Argonne, IL (United States); Patterson, Phil [U.S. Dept. of Energy, Washington, DC (United States); Ward, Jake [U.S. Dept. of Energy, Washington, DC (United States); Wood, Frances [OnLocation Inc., Vienna, VA (United States); Kydes, Niko [OnLocation Inc., Vienna, VA (United States); Holte, John [OnLocation Inc., Vienna, VA (United States); Moore, Jim [TA Engineering, Inc., Catonsville, MD (United States); Miller, Grant [TA Engineering, Inc., Catonsville, MD (United States); Das, Sujit [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Greene, David [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2009-07-22

    This report provides details for Phase 2 of the Multi-Path Transportation Futures Study, which compares alternative ways to make significant reductions in oil use and carbon emissions from U.S. light vehicles to 2050. Phase I, completed in 2009, examined the full range of pathways of interest to EERE, with multiple scenarios aimed at revealing the issues and impacts associated with a national effort to reduce U.S. dependence on oil use in transportation. Phase 2 expanded the scope of the analysis by examining the interactive effects of multiple pathways on each other and on oil and feedstock prices, focusing far more on costs; and substantially increasing the number of metrics used to compare pathways and scenarios.

  18. Partition of Ni between olivine and sulfide: the effect of temperature, f_{{text{O}}_{text{2}} } and f_{{text{S}}_{text{2}} }

    Science.gov (United States)

    Fleet, M. E.; Macrae, N. D.

    1987-03-01

    The experimental distribution coefficient for Ni/ Fe exchange between olivine and monosulfide (KD3) is 35.6±1.1 at 1385° C, f_{{text{O}}_{text{2}} } = 10^{ - 8.87} ,f_{{text{S}}_{text{2}} } = 10^{ - 1.02} , and olivine of composition Fo96 to Fo92. These are the physicochemical conditions appropriate to hypothesized sulfur-saturated komatiite magma. The present experiments equilibrated natural olivine grains with sulfide-oxide liquid in the presence of a (Mg, Fe)-alumino-silicate melt. By a variety of different experimental procedures, K D3 is shown to be essentially constant at about 30 to 35 in the temperature range 900 to 1400° C, for olivine of composition Fo97 to FoO, monosulfide composition with up to 70 mol. % NiS, and a wide range of f_{{text{O}}_{text{2}} } and f_{{text{S}}_{text{2}} }.

  19. Master plan study - District heating Kohtla-Jaerve and Johvi municipalities. Estonia. Final report. Appendices for chapter 9

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    The appendices to chapter nine of the final report of the master plan study on district heating in the municipalities of Kohtla-Jarve and Johvi municipalities (Estonia) present extensive data relating to economic, financial and environmental calculations, fuel consumption, energy balance and prices. (ARW)

  20. Biomass, the green motor in transition. State-of-the-art after the second phase. Appendices

    International Nuclear Information System (INIS)

    Gigler, J.

    2004-01-01

    The project Transition Biomass is part of the transition towards a sustainable energy economy in the Netherlands, initiated by the Ministry of Economic Affairs. The aim of the project is to start a societal process of changes to realize a large-scale and sustainable use of biomass for the production of energy, transportation fuels and products. In the main report an overview is given of the results in 2003. This report comprises the appendices [nl

  1. The safety culture of the nuclear plants of Sydkraft. Appendices 5-7

    International Nuclear Information System (INIS)

    Edmondson, B.; Firing, J.A.; Nordland, O.S.; Ottne, E.

    1994-01-01

    This separate volume of appendices contains three contributions: ''Safety in Nuclear Electric'' by Bryan Edmondson, which reviews the legislation for nuclear safety in Britain, reproduces the Health and Policy Statement by Nuclear Electric, and describes the management of health and safety in the company. ''Safety in Norwegian off-shore industry'' by Joergen A. Firing, describing the safety practices of the Statoil Group and reproducing the relevant Norwegian law. ''The safety management in SAS Airline. The safety and quality in airline industries'' by O.S. Nordland and E. Ottne describing safety organization, internal control systems, and education and training in SAS

  2. Evaluation of Agency Non-Code Layered Pressure Vessels (LPVs) . Volume 2; Appendices

    Science.gov (United States)

    Prosser, William H.

    2014-01-01

    In coordination with the Office of Safety and Mission Assurance and the respective Center Pressure System Managers (PSMs), the NASA Engineering and Safety Center (NESC) was requested to formulate a consensus draft proposal for the development of additional testing and analysis methods to establish the technical validity, and any limitation thereof, for the continued safe operation of facility non-code layered pressure vessels. The PSMs from each NASA Center were asked to participate as part of the assessment team by providing, collecting, and reviewing data regarding current operations of these vessels. This document contains the appendices to the main report.

  3. Final report from VFL Technologies for the pilot-scale thermal treatment of Lower East Fork Poplar Creek floodplain soils. LEFPC appendices. Volume 6. Appendix VI-X

    International Nuclear Information System (INIS)

    1994-09-01

    This final report from VFL Technologies for the pilot-scale thermal treatment of lower East Fork Poplar Creek floodplain soils dated September 1994 contains LEFPC Appendices, Volume 6, Appendix VI - X. These appendices cover the following areas: chain of custody, miscellaneous process calculations (residence time and orifice plate calculations), waste management (mercury and radiation confirmatory testing before and after final verification run), health and safety (training, respirator fit test and radiation work permits), and transportation (soil receipt documentation)

  4. Final environmental impact statement, Beaufort Sea oil and gas development/Northstar Project. Appendices B through K

    International Nuclear Information System (INIS)

    1999-02-01

    BP Exploration (Alaska) Inc. (BPXA) submitted a permit application to the US. Army Engineer District, Alaska to initiate the review process for BPXA's plans to develop and produce oil and gas from the Northstar Unit. This report contains Appendices B--K of an Environmental Impact Statement which was undertaken to identify and evaluate the potential effects the proposed project may have on the environment

  5. Final environmental impact statement, Beaufort Sea oil and gas development/Northstar Project. Appendices L through P

    International Nuclear Information System (INIS)

    1999-02-01

    BP Exploration (Alaska) Inc. (BPXA) submitted a permit application to the US Army Engineer District, Alaska to initiate the review process for BPXA's plans to develop and produce oil and gas from the Northstar Unit. This report contains Appendices L-P of an Environmental Impact Statement which was undertaken to identify and evaluate the potential effects the proposed project may have on the environment

  6. Backfilling and sealing of tunnels, shafts and boreholes. Volume 2: Appendices

    International Nuclear Information System (INIS)

    Studer, J.; Ammann, W.; Meier, P.; Mueller, Ch.; Glauser, E.

    1984-12-01

    The present report is a synthesis of the state of knowledge regarding backfilling and sealing of nuclear waste repositories. It is based on an evaluation of both the general and special publications concerning this problem (articles in scientific journals, research reports, conference papers and textbooks) and represents the state of knowledge up to summer 1984. In addition, it contains an outlook on the continuing work. This will serve to broaden the scientific base and to achieve the technical as well as economical optimization. The report consists of two volumes: Volume 1 Main Part, Volume 2 Appendices. Starting with the functions of backfilling and sealing in the safety concept assessment criteria and from these, taking into consideration the given conditions in the project 'Gewaehr 1985' ('Guarantee'), the requirements for the backfilling and sealing materials are formulated. The properties of several materials under consideration are discussed in the Appendix together with a detailed description of the most important of these materials. The reasons are given for the choice of the proposed materials for the project 'Gewaehr 1985'. Alternative backfilling and sealing concepts for repositories Type B and Type C are presented and reasons are given for the selected variants for the project 'Gewaehr 1985'. Chapter 10 represents a review of the report. This report is intended as a reference work for the corresponding chapters in the NGB reports (cf. /NGB 85-03, 1985/, /NGB 85-06, 1985/). (author)

  7. Conceptual design of advanced central receiver power systems sodium-cooled receiver concept. Volume 2, Book 2. Appendices. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1979-03-01

    The appendices include: (A) design data sheets and P and I drawing for 100-MWe commercial plant design, for all-sodium storage concept; (B) design data sheets and P and I drawing for 100-MWe commercial plant design, for air-rock bed storage concept; (C) electric power generating water-steam system P and I drawing and equipment list, 100-MWe commercial plant design; (D) design data sheets and P and I drawing for 281-MWe commercial plant design; (E) steam generator system conceptual design; (F) heat losses from solar receiver surface; (G) heat transfer and pressure drop for rock bed thermal storage; (H) a comparison of alternative ways of recovering the hydraulic head from the advanced solar receiver tower; (I) central receiver tower study; (J) a comparison of mechanical and electromagnetic sodium pumps; (K) pipe routing study of sodium downcomer; and (L) sodium-cooled advanced central receiver system simulation model. (WHK)

  8. Report to Congress on the feasibility of establishing a heating oil component to the Strategic Petroleum Reserve. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-06-01

    Nine appendices to the main report are included in this volume. They are: Northeastern US distillate supply systems; New England fuel oil storage capacities and inventories; Characteristics of the northeast natural gas market; Documentation of statistical models and calculation of benefits; Regional product reserve study; Other countries` experience with refined product storage; Global refining supply demand appraisal; Summary of federal authorities relevant to the establishment of petroleum product reserves; Product stability and turnover requirements.

  9. Geothermal resource assessment for the state of Texas: status of progress, November 1980. Final report. Appendices E through H

    Energy Technology Data Exchange (ETDEWEB)

    Woodruff, C.M. Jr.; Caran, S.C.; Gever, C.; Henry, C.D.; Macpherson, G.L.; McBride, M.W.

    1982-03-01

    These appendices include: a folio of maps showing lineaments perceived across the state; an index and critique of the Landsat images used in perceiving the lineaments; a selected bibliography on lineaments; and a discussion of area-specific assessments of geothermal resources near military bases in Bexar, Travis, and Val Verde Counties. (MHR)

  10. EMR of laterally spreading lesions around or involving the appendiceal orifice: technique, risk factors for failure, and outcomes of a tertiary referral cohort (with video).

    Science.gov (United States)

    Tate, David J; Desomer, Lobke; Awadie, Halim; Goodrick, Kathleen; Hourigan, Luke; Singh, Rajvinder; Williams, Stephen J; Bourke, Michael J

    2018-05-01

    EMR of sessile periappendiceal laterally spreading lesions (PA-LSLs) is technically demanding because of poor endoscopic access to the appendiceal lumen and the thin colonic wall at the base of the cecum. We aimed to assess the feasibility and safety of EMR for PA-LSLs. Consecutive LSLs ≥20 mm and PA-LSLs ≥10 mm detected at 3 academic endoscopy centers from September 2008 until January 2017 were eligible. Prospective patient, procedural, and lesion data were collected. PA-LSLs were compared with LSLs in other colonic locations. Thirty-eight PA-LSLs were compared with 1721 LSLs. Referral for surgery without an attempt at EMR was more likely with PA-LSLs (28.9% vs 5.1%, P < .001), and those that involved a greater percentage of the appendiceal orifice (AO) were less likely to be attempted (P = .038). Most PA-LSLs (10/11) were not attempted because of deep extension into the appendiceal lumen; 2 of 11 of these surgical specimens contained invasive cancer. Once attempted, complete clearance of visible adenoma (92.6% PA-LSLs vs 97.6% LSLs, P = .14), adverse events, and rates of adenoma recurrence did not vary significantly between PA-LSLs and LSLs. All 7 patients with prior appendicectomy achieved complete adenoma clearance. There were no cases of post-EMR appendicitis. Twenty of 22 PA-LSLs (91%) eligible for surveillance avoided surgery to longest follow-up. EMR is a safe, effective, and durable treatment for PA-LSLs when specific criteria are fulfilled. If the distal margin of the PA-LSL within the AO cannot be visualized or if more than 50% of the circumference of the orifice is involved, surgery should be considered. (Clinical trial registration number: NTC01368289.). Copyright © 2018. Published by Elsevier Inc.

  11. Methodologies for Verification and Validation of Space Launch System (SLS) Structural Dynamic Models: Appendices

    Science.gov (United States)

    Coppolino, Robert N.

    2018-01-01

    Verification and validation (V&V) is a highly challenging undertaking for SLS structural dynamics models due to the magnitude and complexity of SLS subassemblies and subassemblies. Responses to challenges associated with V&V of Space Launch System (SLS) structural dynamics models are presented in Volume I of this paper. Four methodologies addressing specific requirements for V&V are discussed. (1) Residual Mode Augmentation (RMA). (2) Modified Guyan Reduction (MGR) and Harmonic Reduction (HR, introduced in 1976). (3) Mode Consolidation (MC). Finally, (4) Experimental Mode Verification (EMV). This document contains the appendices to Volume I.

  12. Iodine-131 Releases from Radioactive Lanthanum Processing at the X-10 Site in Oak Ridge, Tennessee (1944-1956)- An Assessment of Quantities released, Off-Site Radiation Doses, and Potential Excess Risks of Thyroid Cancer- APPENDICES Appendices-Volume 1A

    International Nuclear Information System (INIS)

    Apostoaei, A.I.; Burns, R.E.; Hoffman, F.O.; Ijaz, T.; Lewis, C.J.; Nair, S.K.; Widner, T.E.

    1999-01-01

    This report consists of all the appendices for the report described below: In the early 1990s, concern about the Oak Ridge Reservation's past releases of contaminants to the environment prompted Tennessee's public health officials to pursue an in-depth study of potential off-site health effects at Oak Ridge. This study, the Oak Ridge dose reconstruction, was supported by an agreement between the U.S. Department of Energy (DOE) and the State of Tennessee, and was overseen by a 12-member panel appointed by Tennessee's Commissioner of Health. One of the major contaminants studied in the dose reconstruction was radioactive iodine, which was released to the air by X-10 (now called Oak Ridge National Laboratory) as it processed spent nuclear reactor fuel from 1944 through 1956. The process recovered radioactive lanthanum for use in weapons development. Iodine concentrates in the thyroid gland so health concerns include various diseases of the thyroid, such as thyroid cancer. The large report, ''Iodine-131 Releases from Radioactive Lanthanum Processing at the X-10 Site in Oak Ridge, Tennessee (1944-1956) - An Assessment of Quantities Released, Off-site Radiation Doses, and Potential Excess Risks of Thyroid Cancer,'' is in two volumes. Volume 1 is the main body of the report, and Volume 1A, which has the same title, consists of 22 supporting appendices. Together, these reports serve the following purposes: (1) describe the methodologies used to estimate the amount of iodine-131 (I-131) released; (2) evaluate I-131's pathway from air to vegetation to food to humans; (3) estimate doses received by human thyroids; (4) estimate excess risk of acquiring a thyroid cancer during ones lifetime; and (5) provide equations, examples of historical documents used, and tables of calculated values as appendices. Results indicate that females born in 1952 who consumed milk from a goat pastured a few miles east of X-10 received the highest doses from I-131 and would have had the highest

  13. Iodine-131 Releases from Radioactive Lanthanum Processing at the X-10 Site in Oak Ridge, Tennessee (1944-1956)- An Assessment of Quantities released, Off-Site Radiation Doses, and Potential Excess Risks of Thyroid Cancer- APPENDICES Appendices-Volume 1A

    Energy Technology Data Exchange (ETDEWEB)

    Apostoaei, A.I.; Burns, R.E.; Hoffman, F.O.; Ijaz, T.; Lewis, C.J.; Nair, S.K.; Widner, T.E.

    1999-07-01

    This report consists of all the appendices for the report described below: In the early 1990s, concern about the Oak Ridge Reservation's past releases of contaminants to the environment prompted Tennessee's public health officials to pursue an in-depth study of potential off-site health effects at Oak Ridge. This study, the Oak Ridge dose reconstruction, was supported by an agreement between the U.S. Department of Energy (DOE) and the State of Tennessee, and was overseen by a 12-member panel appointed by Tennessee's Commissioner of Health. One of the major contaminants studied in the dose reconstruction was radioactive iodine, which was released to the air by X-10 (now called Oak Ridge National Laboratory) as it processed spent nuclear reactor fuel from 1944 through 1956. The process recovered radioactive lanthanum for use in weapons development. Iodine concentrates in the thyroid gland so health concerns include various diseases of the thyroid, such as thyroid cancer. The large report, ''Iodine-131 Releases from Radioactive Lanthanum Processing at the X-10 Site in Oak Ridge, Tennessee (1944-1956) - An Assessment of Quantities Released, Off-site Radiation Doses, and Potential Excess Risks of Thyroid Cancer,'' is in two volumes. Volume 1 is the main body of the report, and Volume 1A, which has the same title, consists of 22 supporting appendices. Together, these reports serve the following purposes: (1) describe the methodologies used to estimate the amount of iodine-131 (I-131) released; (2) evaluate I-131's pathway from air to vegetation to food to humans; (3) estimate doses received by human thyroids; (4) estimate excess risk of acquiring a thyroid cancer during ones lifetime; and (5) provide equations, examples of historical documents used, and tables of calculated values as appendices. Results indicate that females born in 1952 who consumed milk from a goat pastured a few miles east of X-10 received the highest doses from

  14. Technology, safety, and costs of decommissioning reference nuclear research and test reactors. Appendices

    International Nuclear Information System (INIS)

    Konzek, G.J.; Ludwick, J.D.; Kennedy, W.E. Jr.; Smith, R.I.

    1982-03-01

    Safety and Cost Information is developed for the conceptual decommissioning of two representative licensed nuclear research and test reactors. Three decommissioning alternatives are studied to obtain comparisons between costs (in 1981 dollars), occupational radiation doses, potential radiation dose to the public, and other safety impacts. The alternatives considered are: DECON (immediate decontamination), SAFSTOR (safe storage followed by deferred decontamination), and EMTOMB (entombment). The study results are presented in two volumes. Volume 2 (Appendices) contains the detailed data that support the results given in Volume 1, including unit-component data

  15. Technology, safety, and costs of decommissioning reference nuclear research and test reactors. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Konzek, G.J.; Ludwick, J.D.; Kennedy, W.E. Jr.; Smith, R.I.

    1982-03-01

    Safety and Cost Information is developed for the conceptual decommissioning of two representative licensed nuclear research and test reactors. Three decommissioning alternatives are studied to obtain comparisons between costs (in 1981 dollars), occupational radiation doses, potential radiation dose to the public, and other safety impacts. The alternatives considered are: DECON (immediate decontamination), SAFSTOR (safe storage followed by deferred decontamination), and EMTOMB (entombment). The study results are presented in two volumes. Volume 2 (Appendices) contains the detailed data that support the results given in Volume 1, including unit-component data.

  16. Data package for the Low-Level Waste Disposal Development and Demonstration Program environmental impact statement: Volume 2, Appendices E-O

    Energy Technology Data Exchange (ETDEWEB)

    Ketelle, R.H.

    1988-09-01

    This volume contains 11 appendices to the main document in Volume 1. Topics in Volume 2 include hydrologic data for a proposed solid waste storage area, soil characterizations, well logs, surface water discharge data, water quality data, atmospheric precipitation and stream flow, a small mammal survey, and general ecological information. (TEM)

  17. Local Agenda 21 in Apeldoorn, Netherlands. Appendices; Lokale Agenda 21 in Apeldoorn. Bijlagenrapport

    Energy Technology Data Exchange (ETDEWEB)

    Dullens, M.; Schouw, J.C.; Straatman, T.G.

    1999-08-01

    The (im)possibilities of concrete projects to start Local Agenda 21 activities in Apeldoorn, Netherlands, are discussed. Attention is paid to options with respect to transportation, energy conservation, water use, soil pollution, waste management, and nature. Local Agenda 21 is a program by means of which local governments can contribute to sustainable targets as formulated during the 1992 conference Agenda 21 of the United Nations (UN). The appendices contain background information (reports of meetings, elaboration of ecological subjects in relation with socio-economic subjects, and a table with all the recommendations) and are published in this report. The main report is a separate publication.

  18. Tiger Team Assessment of the Savannah River Site: Appendices

    International Nuclear Information System (INIS)

    1990-06-01

    This draft document contains findings identified during the Tiger Team Compliance Assessment of the US Department of Energy Savannah River Site (SRS), located in three countries (Aiken, Barnwell and Allendale), South Carolina. The Assessment was directed by the Department's Office of the Assistant Secretary for Environment, Safety, and Health (ES ampersand H) and was conducted from January 29 to March 23, 1990. The Savannah River Site Tiger Team Compliance Assessment was broad in scope covering the Environment, Safety and Health, and Management areas and was designed to determine the site's compliance with applicable Federal (including DOE), state, and local regulations and requirements. The scope of the Environmental assessment was sitewide while the Safety and Health assessments included site operating facilities (except reactors), and the sitewide elements of Aviation Safety, Emergency Preparedness, Medical Services, and Packaging and Transportation. This report contains the appendices to the assessment

  19. On the worldsheet theory of the type IIA {text{Ad}}{{text{S}}_4} × mathbb{C}{mathbb{P}_3} superstring

    Science.gov (United States)

    Sundin, Per

    2010-04-01

    We perform a detailed study of the type IIA superstring in {text{Ad}}{{text{S}}_4} × mathbb{C}{mathbb{P}_3} . After introducing suitable bosonic light-cone and fermionic kappa worldsheet gauges we derive the pure boson and fermion SU(2|2)×U(1) covariant light-cone Hamiltonian up to quartic order in fields. As a first application of our derivation we calculate energy shifts for string configurations in a closed fermionic subsector and successfully match these with a set of light-cone Bethe equations. We then turn to investigate the mismatch between the degrees of freedom of scattering states and oscillatory string modes. Since only light string modes appear as fundamental Bethe roots in the scattering theory, the physical role of the remaining 4 F + 4 B massive oscillators is rather unclear. By continuing a line of research initiated by Zarembo, we shed light on this question by calculating quantum corrections for the propagators of the bosonic massive fields. We show that, once loop corrections are incorporated, the massive coordinates dissolve in a continuum state of two light particles.

  20. Annual report to the Atomic Energy Control Board on the regulatory research and support program April 1, 1993 - March 31, 1994. Appendices

    International Nuclear Information System (INIS)

    1995-05-01

    Detailed information has been compiled into six appendices giving presenting information on the scope of RSP activities during the year and describes how the program was managed, organized and implemented. The membership of active review panels is given in Appendix A. Appendix B contains summary descriptions and information on the status of individual projects. Appendix C presents a list of those projects which were within the overall RSP but were not active during the year. Appendix D lists the projects which were complete but for which the post project evaluation had as yet to be completed. All projects worked on during the year are listed in Appendix E. Specific objectives set for the RSP for Fiscal Year 1993/94 and the degree to which the objectives were achieved are outlined in Appendix F. (DM). 207 tabs

  1. Annual report to the Atomic Energy Control Board on the regulatory research and support program April 1, 1993 - March 31, 1994. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-05-01

    Detailed information has been compiled into six appendices giving presenting information on the scope of RSP activities during the year and describes how the program was managed, organized and implemented. The membership of active review panels is given in Appendix A. Appendix B contains summary descriptions and information on the status of individual projects. Appendix C presents a list of those projects which were within the overall RSP but were not active during the year. Appendix D lists the projects which were complete but for which the post project evaluation had as yet to be completed. All projects worked on during the year are listed in Appendix E. Specific objectives set for the RSP for Fiscal Year 1993/94 and the degree to which the objectives were achieved are outlined in Appendix F. (DM). 207 tabs.

  2. Draft environmental impact statement for the siting, construction, and operation of New Production Reactor capacity. Volume 3, Sections 7-12, Appendices A-C

    Energy Technology Data Exchange (ETDEWEB)

    1991-04-01

    This Environmental Impact Statement (EIS) assesses the potential environmental impacts, both on a broad programmatic level and on a project-specific level, concerning a proposed action to provide new tritium production capacity to meet the nation`s nuclear defense requirements well into the 21st century. A capacity equivalent to that of about a 3,000-megawatt (thermal) heavy-water reactor was assumed as a reference basis for analysis in this EIS; this is the approximate capacity of the existing production reactors at DOE`s Savannah River Site near Aiken, South Carolina. The EIS programmatic alternatives address Departmental decisions to be made on whether to build new production facilities, whether to build one or more complexes, what size production capacity to provide, and when to provide this capacity. Project-specific impacts for siting, constructing, and operating new production reactor capacity are assessed for three alternative sites: the Hanford Site near Richland, Washington; the Idaho National Engineering Laboratory near Idaho Falls, Idaho; and the Savannah River Site. For each site, the impacts of three reactor technologies (and supporting facilities) are assessed: a heavy-water reactor, a light-water reactor, and a modular high-temperature gas-cooled reactor. Impacts of the no-action alternative also are assessed. The EIS evaluates impacts related to air quality; noise levels; surface water, groundwater, and wetlands; land use; recreation; visual environment; biotic resources; historical, archaeological, and cultural resources; socioeconomics; transportation; waste management; and human health and safety. The EIS describes in detail the potential radioactive releases from new production reactors and support facilities and assesses the potential doses to workers and the general public. This volume contains references; a list of preparers and recipients; acronyms, abbreviations, and units of measure; a glossary; an index and three appendices.

  3. Crew Exploration Vehicle (CEV) (Orion) Occupant Protection. Part 1; Appendices

    Science.gov (United States)

    Currie-Gregg, Nancy J.; Gernhardt, Michael L.; Lawrence, Charles; Somers, Jeffrey T.

    2016-01-01

    Dr. Nancy J. Currie, of the NASA Engineering and Safety Center (NESC), Chief Engineer at Johnson Space Center (JSC), requested an assessment of the Crew Exploration Vehicle (CEV) occupant protection as a result of issues identified by the Constellation Program and Orion Project. The NESC, in collaboration with the Human Research Program (HRP), investigated new methods associated with occupant protection for the Crew Exploration Vehicle (CEV), known as Orion. The primary objective of this assessment was to investigate new methods associated with occupant protection for the CEV, known as Orion, that would ensure the design provided minimal risk to the crew during nominal and contingency landings in an acceptable set of environmental and spacecraft failure conditions. This documents contains the appendices to the NESC assessment report. NASA/TM-2013-217380, Application of the Brinkley Dynamic Response Criterion to Spacecraft Transient Dynamic Events supersedes this document.

  4. Measurement of Lake Roosevelt biota in relation to reservoir operations. Appendices 1991

    International Nuclear Information System (INIS)

    Griffith, J.R.; McDowell, A.C.; Scholz, A.T.

    1991-01-01

    This report consists of appendices A-F containing the biological data which were collected from Lake Roosevelt, Washington. The data are to be used in the design of a computer model that would predict biological responses of reservoir operations as part of the System Operation Review program. Major components of the model included: Quantification of impacts to phytoplankton, zooplanktons, benthic invertebrates, and fish caused by reservoir drawdowns and low water retention times; quantification of number, distribution, and use of fish food organisms in the reservoir by season; determination of seasonal growth of fish species as related to reservoir operations, prey abundance and utilization; and quantification of entrainment levels of zooplankton and fish as related to reservoir operations and water retention times

  5. Technology, safety and costs of decommissioning a reference boiling water reactor power station. Volume 2. Appendices. Technical report, September 1977-October 1979

    International Nuclear Information System (INIS)

    Oak, H.D.; Holter, G.M.; Kennedy, W.E. Jr.; Konzek, G.J.

    1980-06-01

    Technology, safety and cost information is given for the conceptual decommissioning of a large (1100MWe) boiling water reactor (BWR) power station. Three approaches to decommissioning, immediate dismantlement, safe storage with deferred dismantlement and entombment, were studied to obtain comparisons between costs, occupational radiation doses, potential dose to the public and other safety impacts. It also shows the sensitivity of decommissioning safety and costs to the power rating of a BWR in the range of 200 to 1100 MWE. This volume contains the appendices

  6. Technology, safety and costs of decommissioning a reference boiling water reactor power station. Volume 2. Appendices. Technical report, September 1977-October 1979

    Energy Technology Data Exchange (ETDEWEB)

    Oak, H.D.; Holter, G.M.; Kennedy, W.E. Jr.; Konzek, G.J.

    1980-06-01

    Technology, safety and cost information is given for the conceptual decommissioning of a large (1100MWe) boiling water reactor (BWR) power station. Three approaches to decommissioning, immediate dismantlement, safe storage with deferred dismantlement and entombment, were studied to obtain comparisons between costs, occupational radiation doses, potential dose to the public and other safety impacts. It also shows the sensitivity of decommissioning safety and costs to the power rating of a BWR in the range of 200 to 1100 MWE. This volume contains the appendices.

  7. Evaluation of severe accident risks, Grand Gulf, Unit 1: Appendices

    International Nuclear Information System (INIS)

    Brown, T.D.; Breeding, R.J.; Jow, H.N.; Higgins, S.J.; Shiver, A.W.; Helton, J.C.; Amos, C.N.

    1990-12-01

    In support of the Nuclear Regulatory Commission's (NRC's) assessment of the risk from severe accidents at commercial nuclear power plants in the US report in NUREG-1150, the Severe Accident Risk Reduction Program (SARRP) has completed a revised calculation of the risk to the general public from severe accidents at the Grand Gulf Nuclear Station, Unit 1. This power plant, located in Port Gibson, Mississippi, is operated by the System Energy Resources, Inc. (SERI). The emphasis in this risk analysis was not on determining a ''so-called'' point estimate of risk. Rather, it was to determine the distribution of risk, and to discover the uncertainties that account for the breadth of this distribution. Off-site risk initiated by events internal to the power plant was assessed. This document provides Appendices A through E for this report. Topics included are, respectively: supporting information for the accident progression analysis; supporting information for the source term analysis; supporting information for the consequence analysis; risk results; and sampling information

  8. The BioC-BioGRID corpus: full text articles annotated for curation of protein–protein and genetic interactions

    Science.gov (United States)

    Kim, Sun; Chatr-aryamontri, Andrew; Chang, Christie S.; Oughtred, Rose; Rust, Jennifer; Wilbur, W. John; Comeau, Donald C.; Dolinski, Kara; Tyers, Mike

    2017-01-01

    A great deal of information on the molecular genetics and biochemistry of model organisms has been reported in the scientific literature. However, this data is typically described in free text form and is not readily amenable to computational analyses. To this end, the BioGRID database systematically curates the biomedical literature for genetic and protein interaction data. This data is provided in a standardized computationally tractable format and includes structured annotation of experimental evidence. BioGRID curation necessarily involves substantial human effort by expert curators who must read each publication to extract the relevant information. Computational text-mining methods offer the potential to augment and accelerate manual curation. To facilitate the development of practical text-mining strategies, a new challenge was organized in BioCreative V for the BioC task, the collaborative Biocurator Assistant Task. This was a non-competitive, cooperative task in which the participants worked together to build BioC-compatible modules into an integrated pipeline to assist BioGRID curators. As an integral part of this task, a test collection of full text articles was developed that contained both biological entity annotations (gene/protein and organism/species) and molecular interaction annotations (protein–protein and genetic interactions (PPIs and GIs)). This collection, which we call the BioC-BioGRID corpus, was annotated by four BioGRID curators over three rounds of annotation and contains 120 full text articles curated in a dataset representing two major model organisms, namely budding yeast and human. The BioC-BioGRID corpus contains annotations for 6409 mentions of genes and their Entrez Gene IDs, 186 mentions of organism names and their NCBI Taxonomy IDs, 1867 mentions of PPIs and 701 annotations of PPI experimental evidence statements, 856 mentions of GIs and 399 annotations of GI evidence statements. The purpose, characteristics and possible future

  9. Safe Operation of Nuclear Power Plants. Code of Practice and Technical Appendices

    International Nuclear Information System (INIS)

    1969-01-01

    This book is in two parts. The first is a Code of Practice for the Safe Operation of Nuclear Power Plants and the second part is a compilation of technical appendices. Its object is to give information and illustrative examples that would be helpful in implementing the Code of Practice. This second part, although published under the same cover, is not part of the Code. Safe operation of a nuclear power plant postulates suitable siting and proper design, construction and management of the plant. Under the present Code of Practice for the Safe Operation of Nuclear Power Plants, those intending to operate the plant are recommended to prepare documentation which would deal with its operation and include safety analyses. The documentation in question would be reviewed by a regulatory body independent of the operating organization; operation would be authorized on the understanding that it would comply with limits and conditions designed to ensure safety. The Code may be subject to revision in the light of experience. The Appendices provide additional information together with some examples relating to certain topics dealt with in the Code; it must be emphasized that they are included as examples for information only and are not part of any recommendation. Purpose and scope: The recommendations in the Code are designed to protect the general public and the operating personnel from radiation hazards, and the Code forms part of the Agency's Safety Standards. The Code, which should be used in conjunction with the Agency's other Safety Standards, provides guidance and information to persons and authorities responsible for the operation of stationary nuclear power plants whose main function is the generation of thermal, mechanical or electrical power; it is not intended to apply to reactors used solely for experimental or research purposes. It sets forth minimum requirements which, it is believed, in the light of experience, must be met in order to achieve safe operation of a

  10. BioC-compatible full-text passage detection for protein-protein interactions using extended dependency graph.

    Science.gov (United States)

    Peng, Yifan; Arighi, Cecilia; Wu, Cathy H; Vijay-Shanker, K

    2016-01-01

    There has been a large growth in the number of biomedical publications that report experimental results. Many of these results concern detection of protein-protein interactions (PPI). In BioCreative V, we participated in the BioC task and developed a PPI system to detect text passages with PPIs in the full-text articles. By adopting the BioC format, the output of the system can be seamlessly added to the biocuration pipeline with little effort required for the system integration. A distinctive feature of our PPI system is that it utilizes extended dependency graph, an intermediate level of representation that attempts to abstract away syntactic variations in text. As a result, we are able to use only a limited set of rules to extract PPI pairs in the sentences, and additional rules to detect additional passages for PPI pairs. For evaluation, we used the 95 articles that were provided for the BioC annotation task. We retrieved the unique PPIs from the BioGRID database for these articles and show that our system achieves a recall of 83.5%. In order to evaluate the detection of passages with PPIs, we further annotated Abstract and Results sections of 20 documents from the dataset and show that an f-value of 80.5% was obtained. To evaluate the generalizability of the system, we also conducted experiments on AIMed, a well-known PPI corpus. We achieved an f-value of 76.1% for sentence detection and an f-value of 64.7% for unique PPI detection.Database URL: http://proteininformationresource.org/iprolink/corpora. © The Author(s) 2016. Published by Oxford University Press.

  11. Obesity and Peritoneal Surface Disease: Outcomes after Cytoreductive Surgery with Hyperthermic Intraperitoneal Chemotherapy for Appendiceal and Colon Primary Tumors

    Science.gov (United States)

    Votanopoulos, Konstantinos I.; Swords, Douglas S.; Swett, Katrina R.; Randle, Reese W.; Shen, Perry; Stewart, John H.; Levine, Edward A.

    2014-01-01

    Background It is estimated that 37 % of the U.S. population is obese. It is unknown how obesity influences the operative and survival outcomes of cytoreductive surgery (CRS)/hyperthermic intraperitoneal chemotherapy (HIPEC) procedures. Methods A retrospective analysis of a prospective database of 1,000 procedures was performed. Type of malignancy, performance status, resection status, hospital and intensive care unit stay, comorbidities, morbidity, mortality, and survival were reviewed. Results A total of 246 patients with body mass index (BMI) of >30 kg/m2 underwent 272 CRS/HIPEC procedures. Ninety-five (38.6 %) were severely obese (BMI > 35 kg/m2). A total of 135 (49.6 %) procedures were performed for appendiceal and 60 (22.1 %) for colon cancer. Median follow-up was 52 months. Both major and minor morbidity were similar for obese and non-obese patients. The 30-day mortality rates for obese and nonobese patients were 1.5 and 2.5 %, respectively. Median intensive care unit and hospital stay were 1 and 9 days, regardless of BMI. The 30-day readmission rate was similar between obese and non-obese patients (24.8 vs. 19.4 %, p = 0.11). Median survival for low-grade appendiceal cancer (LGA) was 76 months for obese patients and 107 months for non-obese patients (p = 0.32). Survival was worse for severely obese patients (median survival 54 months) versus non-obese patients with LGA (p = 0.04). Survival was similar for obese and non-obese patients with peritoneal surface disease (PSD) from colon cancer or high-grade appendiceal cancer. Conclusions Obesity does not influence postoperative morbidity or mortality of patients with PSD, regardless of primary tumor. Severe obesity is associated with decreased long-term survival only in patients with LGA primary disease; however, application of CRS/HIPEC still offers meaningful prolongation of life. Obesity should not be considered a contraindication for CRS/HIPEC procedures. PMID:23800899

  12. Kress indirect dry cooling system, Bethlehem Steel's Coke Plant demonstration at Sparrows Point, Maryland. Volume 2. Appendices G-N. Final report, February 1990-February 1992

    International Nuclear Information System (INIS)

    Ossman, A.G.

    1993-05-01

    The report provides an evaluation of the Kress Indirect Dry Cooling (KIDC) process. The KIDC process is an innovative system for the handling and cooling of coke produced from a slot type by-product coke oven battery. The report is based on the test work and demonstration of the system at Bethlehem Steel Corporation's Sparrows Point facility in 1991. The report covers both environmental and operational impacts of the KIDC process. The report, Volume 2, contains appendices G-N. Volume 1, PB93-191302, contains the technical report as well as appendices A-F. Volume 2 contains appendixes on coke quality data, blast furnace balwax model report, KIDC operating cost and maintenance requirements, Kress box thickness readings, KIDC coke discharge temperature, QA/QC program, door leak data, and coal data

  13. Draft site characterization analysis of the site characterization report for the Basalt Waste Isolation Project, Hanford, Washington Site. Main report and Appendices A through D

    International Nuclear Information System (INIS)

    1983-03-01

    On November 12, 1982, the US Department of Energy submitted to the US Nuclear Regulatory Commission the Site Characterization Report for the Basalt Waste Isolation Project (DOE/RL 82-3). The Basalt Waste Isolation Project is located on DOE's Hanford Reservation in the State of Washington. NUREG-0960 contains the detailed analysis, by the NRC staff, of the site characterization report. Supporting technical material is contained in Appendices A through W

  14. Sierra Pacific Power Company Alturas Transmission Line Project, Final Environmental Impact Report/Environmental Impact Statement. Volume 3: Appendices

    International Nuclear Information System (INIS)

    1995-11-01

    Sierra Pacific Power Company has proposed the construction and operation of a 345,000 volt overhead electric power transmission line from Alturas, California to Reno, Nevada. This Environmental Impact Report/Environmental Impact Statement will assess the potential environmental impacts of the proposed project and alternatives. This report contains Appendices A--I which contain the following: glossary/abbreviations; scoping report; structure coordinate summary; air quality; biological resources; geology; noise; visual contrast rating forms; and cultural resources

  15. Nigel: A Systemic Grammar for Text Generation.

    Science.gov (United States)

    1983-02-01

    presumed. Basic references on the systemic framework include [Berry 75, Berry 77, Halliday 76a, Halliday 76b, Hudson 76, Halliday 81, de Joia 80...Edinburgh, 1979. [do Joia 80] de Joia , A., and A. Stanton, Terms in Systemic Linguistics, Batsford Academic and Educational, Ltd., London, 1980. -’C...1 A Grammar for Text Generation- -The Challenge ................................. 1 *1.2 A Grammar for Text Generation--The Design

  16. The BioC-BioGRID corpus: full text articles annotated for curation of protein-protein and genetic interactions.

    Science.gov (United States)

    Islamaj Dogan, Rezarta; Kim, Sun; Chatr-Aryamontri, Andrew; Chang, Christie S; Oughtred, Rose; Rust, Jennifer; Wilbur, W John; Comeau, Donald C; Dolinski, Kara; Tyers, Mike

    2017-01-01

    A great deal of information on the molecular genetics and biochemistry of model organisms has been reported in the scientific literature. However, this data is typically described in free text form and is not readily amenable to computational analyses. To this end, the BioGRID database systematically curates the biomedical literature for genetic and protein interaction data. This data is provided in a standardized computationally tractable format and includes structured annotation of experimental evidence. BioGRID curation necessarily involves substantial human effort by expert curators who must read each publication to extract the relevant information. Computational text-mining methods offer the potential to augment and accelerate manual curation. To facilitate the development of practical text-mining strategies, a new challenge was organized in BioCreative V for the BioC task, the collaborative Biocurator Assistant Task. This was a non-competitive, cooperative task in which the participants worked together to build BioC-compatible modules into an integrated pipeline to assist BioGRID curators. As an integral part of this task, a test collection of full text articles was developed that contained both biological entity annotations (gene/protein and organism/species) and molecular interaction annotations (protein-protein and genetic interactions (PPIs and GIs)). This collection, which we call the BioC-BioGRID corpus, was annotated by four BioGRID curators over three rounds of annotation and contains 120 full text articles curated in a dataset representing two major model organisms, namely budding yeast and human. The BioC-BioGRID corpus contains annotations for 6409 mentions of genes and their Entrez Gene IDs, 186 mentions of organism names and their NCBI Taxonomy IDs, 1867 mentions of PPIs and 701 annotations of PPI experimental evidence statements, 856 mentions of GIs and 399 annotations of GI evidence statements. The purpose, characteristics and possible future

  17. Production of K[Formula: see text](892)[Formula: see text] and [Formula: see text](1020) in p-Pb collisions at [Formula: see text] = 5.02 TeV.

    Science.gov (United States)

    Adam, J; Adamová, D; Aggarwal, M M; Aglieri Rinella, G; Agnello, M; Agrawal, N; Ahammed, Z; Ahmad, S; Ahn, S U; Aiola, S; Akindinov, A; Alam, S N; Aleksandrov, D; Alessandro, B; Alexandre, D; Alfaro Molina, R; Alici, A; Alkin, A; Almaraz, J R M; Alme, J; Alt, T; Altinpinar, S; Altsybeev, I; Alves Garcia Prado, C; Andrei, C; Andronic, A; Anguelov, V; Antičić, T; Antinori, F; Antonioli, P; Aphecetche, L; Appelshäuser, H; Arcelli, S; Arnaldi, R; Arnold, O W; Arsene, I C; Arslandok, M; Audurier, B; Augustinus, A; Averbeck, R; Azmi, M D; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Balasubramanian, S; Baldisseri, A; Baral, R C; Barbano, A M; Barbera, R; Barile, F; Barnaföldi, G G; Barnby, L S; Barret, V; Bartalini, P; Barth, K; Bartke, J; Bartsch, E; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Batista Camejo, A; Batyunya, B; Batzing, P C; Bearden, I G; Beck, H; Bedda, C; Behera, N K; Belikov, I; Bellini, F; Bello Martinez, H; Bellwied, R; Belmont, R; Belmont-Moreno, E; Belyaev, V; Benacek, P; Bencedi, G; Beole, S; Berceanu, I; Bercuci, A; Berdnikov, Y; Berenyi, D; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhat, I R; Bhati, A K; Bhattacharjee, B; Bhom, J; Bianchi, L; Bianchi, N; Bianchin, C; Bielčík, J; Bielčíková, J; Bilandzic, A; Biro, G; Biswas, R; Biswas, S; Bjelogrlic, S; Blair, J T; Blau, D; Blume, C; Bock, F; Bogdanov, A; Bøggild, H; Boldizsár, L; Bombara, M; Book, J; Borel, H; Borissov, A; Borri, M; Bossú, F; Botta, E; Bourjau, C; Braun-Munzinger, P; Bregant, M; Breitner, T; Broker, T A; Browning, T A; Broz, M; Brucken, E J; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buncic, P; Busch, O; Buthelezi, Z; Butt, J B; Buxton, J T; Caffarri, D; Cai, X; Caines, H; Calero Diaz, L; Caliva, A; Calvo Villar, E; Camerini, P; Carena, F; Carena, W; Carnesecchi, F; Castillo Castellanos, J; Castro, A J; Casula, E A R; Ceballos Sanchez, C; Cerello, P; Cerkala, J; Chang, B; Chapeland, S; Chartier, M; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Chauvin, A; Chelnokov, V; Cherney, M; Cheshkov, C; Cheynis, B; Chibante Barroso, V; Chinellato, D D; Cho, S; Chochula, P; Choi, K; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Conesa Balbastre, G; Conesa Del Valle, Z; Connors, M E; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortés Maldonado, I; Cortese, P; Cosentino, M R; Costa, F; Crochet, P; Cruz Albino, R; Cuautle, E; Cunqueiro, L; Dahms, T; Dainese, A; Danisch, M C; Danu, A; Das, D; Das, I; Das, S; Dash, A; Dash, S; De, S; De Caro, A; de Cataldo, G; de Conti, C; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; Deisting, A; Deloff, A; Dénes, E; Deplano, C; Dhankher, P; Di Bari, D; Di Mauro, A; Di Nezza, P; Diaz Corchero, M A; Dietel, T; Dillenseger, P; Divià, R; Djuvsland, Ø; Dobrin, A; Domenicis Gimenez, D; Dönigus, B; Dordic, O; Drozhzhova, T; Dubey, A K; Dubla, A; Ducroux, L; Dupieux, P; Ehlers, R J; Elia, D; Endress, E; Engel, H; Epple, E; Erazmus, B; Erdemir, I; Erhardt, F; Espagnon, B; Estienne, M; Esumi, S; Eum, J; Evans, D; Evdokimov, S; Eyyubova, G; Fabbietti, L; Fabris, D; Faivre, J; Fantoni, A; Fasel, M; Feldkamp, L; Feliciello, A; Feofilov, G; Ferencei, J; Fernández Téllez, A; Ferreiro, E G; Ferretti, A; Festanti, A; Feuillard, V J G; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Fleck, M G; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Frankenfeld, U; Fronze, G G; Fuchs, U; Furget, C; Furs, A; Fusco Girard, M; Gaardhøje, J J; Gagliardi, M; Gago, A M; Gallio, M; Gangadharan, D R; Ganoti, P; Gao, C; Garabatos, C; Garcia-Solis, E; Gargiulo, C; Gasik, P; Gauger, E F; Germain, M; Gheata, A; Gheata, M; Ghosh, P; Ghosh, S K; Gianotti, P; Giubellino, P; Giubilato, P; Gladysz-Dziadus, E; Glässel, P; Goméz Coral, D M; Gomez Ramirez, A; Gonzalez, V; González-Zamora, P; Gorbunov, S; Görlich, L; Gotovac, S; Grabski, V; Grachov, O A; Graczykowski, L K; Graham, K L; Grelli, A; Grigoras, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grinyov, B; Grion, N; Gronefeld, J M; Grosse-Oetringhaus, J F; Grossiord, J-Y; Grosso, R; Guber, F; Guernane, R; Guerzoni, B; Gulbrandsen, K; Gunji, T; Gupta, A; Gupta, R; Haake, R; Haaland, Ø; Hadjidakis, C; Haiduc, M; Hamagaki, H; Hamar, G; Hamon, J C; Harris, J W; Harton, A; Hatzifotiadou, D; Hayashi, S; Heckel, S T; Hellbär, E; Helstrup, H; Herghelegiu, A; Herrera Corral, G; Hess, B A; Hetland, K F; Hillemanns, H; Hippolyte, B; Horak, D; Hosokawa, R; Hristov, P; Huang, M; Humanic, T J; Hussain, N; Hussain, T; Hutter, D; Hwang, D S; Ilkaev, R; Inaba, M; Incani, E; Ippolitov, M; Irfan, M; Ivanov, M; Ivanov, V; Izucheev, V; Jacazio, N; Jacobs, P M; Jadhav, M B; Jadlovska, S; Jadlovsky, J; Jahnke, C; Jakubowska, M J; Jang, H J; Janik, M A; Jayarathna, P H S Y; Jena, C; Jena, S; Jimenez Bustamante, R T; Jones, P G; Jusko, A; Kalinak, P; Kalweit, A; Kamin, J; Kang, J H; Kaplin, V; Kar, S; Karasu Uysal, A; Karavichev, O; Karavicheva, T; Karayan, L; Karpechev, E; Kebschull, U; Keidel, R; Keijdener, D L D; Keil, M; Mohisin Khan, M; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Kileng, B; Kim, D W; Kim, D J; Kim, D; Kim, H; Kim, J S; Kim, M; Kim, M; Kim, S; Kim, T; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, C; Klein, J; Klein-Bösing, C; Klewin, S; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Kofarago, M; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Kondratyuk, E; Konevskikh, A; Kopcik, M; Kostarakis, P; Kour, M; Kouzinopoulos, C; Kovalenko, O; Kovalenko, V; Kowalski, M; Koyithatta Meethaleveedu, G; Králik, I; Kravčáková, A; Kretz, M; Krivda, M; Krizek, F; Kryshen, E; Krzewicki, M; Kubera, A M; Kučera, V; Kuhn, C; Kuijer, P G; Kumar, A; Kumar, J; Kumar, L; Kumar, S; Kurashvili, P; Kurepin, A; Kurepin, A B; Kuryakin, A; Kweon, M J; Kwon, Y; La Pointe, S L; La Rocca, P; Ladron de Guevara, P; Lagana Fernandes, C; Lakomov, I; Langoy, R; Lara, C; Lardeux, A; Lattuca, A; Laudi, E; Lea, R; Leardini, L; Lee, G R; Lee, S; Lehas, F; Lemmon, R C; Lenti, V; Leogrande, E; León Monzón, I; León Vargas, H; Leoncino, M; Lévai, P; Li, S; Li, X; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Ljunggren, H M; Lodato, D F; Loenne, P I; Loginov, V; Loizides, C; Lopez, X; López Torres, E; Lowe, A; Luettig, P; Lunardon, M; Luparello, G; Lutz, T H; Maevskaya, A; Mager, M; Mahajan, S; Mahmood, S M; Maire, A; Majka, R D; Malaev, M; Maldonado Cervantes, I; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manko, V; Manso, F; Manzari, V; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Margutti, J; Marín, A; Markert, C; Marquard, M; Martin, N A; Martin Blanco, J; Martinengo, P; Martínez, M I; Martínez García, G; Martinez Pedreira, M; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Massacrier, L; Mastroserio, A; Matyja, A; Mayer, C; Mazer, J; Mazzoni, M A; Mcdonald, D; Meddi, F; Melikyan, Y; Menchaca-Rocha, A; Meninno, E; Mercado Pérez, J; Meres, M; Miake, Y; Mieskolainen, M M; Mikhaylov, K; Milano, L; Milosevic, J; Minervini, L M; Mischke, A; Mishra, A N; Miśkowiec, D; Mitra, J; Mitu, C M; Mohammadi, N; Mohanty, B; Molnar, L; Montaño Zetina, L; Montes, E; Moreira De Godoy, D A; Moreno, L A P; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Mühlheim, D; Muhuri, S; Mukherjee, M; Mulligan, J D; Munhoz, M G; Munzer, R H; Murakami, H; Murray, S; Musa, L; Musinsky, J; Naik, B; Nair, R; Nandi, B K; Nania, R; Nappi, E; Naru, M U; Natal da Luz, H; Nattrass, C; Navarro, S R; Nayak, K; Nayak, R; Nayak, T K; Nazarenko, S; Nedosekin, A; Nellen, L; Ng, F; Nicassio, M; Niculescu, M; Niedziela, J; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Noferini, F; Nomokonov, P; Nooren, G; Noris, J C C; Norman, J; Nyanin, A; Nystrand, J; Oeschler, H; Oh, S; Oh, S K; Ohlson, A; Okatan, A; Okubo, T; Olah, L; Oleniacz, J; Oliveira Da Silva, A C; Oliver, M H; Onderwaater, J; Oppedisano, C; Orava, R; Ortiz Velasquez, A; Oskarsson, A; Otwinowski, J; Oyama, K; Ozdemir, M; Pachmayer, Y; Pagano, P; Paić, G; Pal, S K; Pan, J; Pandey, A K; Papikyan, V; Pappalardo, G S; Pareek, P; Park, W J; Parmar, S; Passfeld, A; Paticchio, V; Patra, R N; Paul, B; Pei, H; Peitzmann, T; Pereira Da Costa, H; Peresunko, D; Pérez Lara, C E; Perez Lezama, E; Peskov, V; Pestov, Y; Petráček, V; Petrov, V; Petrovici, M; Petta, C; Piano, S; Pikna, M; Pillot, P; Pimentel, L O D L; Pinazza, O; Pinsky, L; Piyarathna, D B; Płoskoń, M; Planinic, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Polichtchouk, B; Poljak, N; Poonsawat, W; Pop, A; Porteboeuf-Houssais, S; Porter, J; Pospisil, J; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puccio, M; Puddu, G; Pujahari, P; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Raha, S; Rajput, S; Rak, J; Rakotozafindrabe, A; Ramello, L; Rami, F; Raniwala, R; Raniwala, S; Räsänen, S S; Rascanu, B T; Rathee, D; Read, K F; Redlich, K; Reed, R J; Rehman, A; Reichelt, P; Reidt, F; Ren, X; Renfordt, R; Reolon, A R; Reshetin, A; Revol, J-P; Reygers, K; Riabov, V; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Ristea, C; Rocco, E; Rodríguez Cahuantzi, M; Rodriguez Manso, A; Røed, K; Rogochaya, E; Rohr, D; Röhrich, D; Romita, R; Ronchetti, F; Ronflette, L; Rosnet, P; Rossi, A; Roukoutakis, F; Roy, A; Roy, C; Roy, P; Rubio Montero, A J; Rui, R; Russo, R; Ryabinkin, E; Ryabov, Y; Rybicki, A; Sadovsky, S; Šafařík, K; Sahlmuller, B; Sahoo, P; Sahoo, R; Sahoo, S; Sahu, P K; Saini, J; Sakai, S; Saleh, M A; Salzwedel, J; Sambyal, S; Samsonov, V; Šándor, L; Sandoval, A; Sano, M; Sarkar, D; Sarma, P; Scapparone, E; Scarlassara, F; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schuchmann, S; Schukraft, J; Schulc, M; Schuster, T; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Šefčík, M; Seger, J E; Sekiguchi, Y; Sekihata, D; Selyuzhenkov, I; Senosi, K; Senyukov, S; Serradilla, E; Sevcenco, A; Shabanov, A; Shabetai, A; Shadura, O; Shahoyan, R; Shangaraev, A; Sharma, A; Sharma, M; Sharma, M; Sharma, N; Shigaki, K; Shtejer, K; Sibiriak, Y; Siddhanta, S; Sielewicz, K M; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Simonetti, G; Singaraju, R; Singh, R; Singha, S; Singhal, V; Sinha, B C; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Slupecki, M; Smirnov, N; Snellings, R J M; Snellman, T W; Søgaard, C; Song, J; Song, M; Song, Z; Soramel, F; Sorensen, S; Souza, R D de; Sozzi, F; Spacek, M; Spiriti, E; Sputowska, I; Spyropoulou-Stassinaki, M; Stachel, J; Stan, I; Stankus, P; Stefanek, G; Stenlund, E; Steyn, G; Stiller, J H; Stocco, D; Strmen, P; Suaide, A A P; Sugitate, T; Suire, C; Suleymanov, M; Suljic, M; Sultanov, R; Šumbera, M; Szabo, A; Szanto de Toledo, A; Szarka, I; Szczepankiewicz, A; Szymanski, M; Tabassam, U; Takahashi, J; Tambave, G J; Tanaka, N; Tangaro, M A; Tarhini, M; Tariq, M; Tarzila, M G; Tauro, A; Tejeda Muñoz, G; Telesca, A; Terasaki, K; Terrevoli, C; Teyssier, B; Thäder, J; Thomas, D; Tieulent, R; Timmins, A R; Toia, A; Trogolo, S; Trombetta, G; Trubnikov, V; Trzaska, W H; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ullaland, K; Uras, A; Usai, G L; Utrobicic, A; Vajzer, M; Vala, M; Valencia Palomo, L; Vallero, S; Van Der Maarel, J; Van Hoorne, J W; van Leeuwen, M; Vanat, T; Vande Vyvre, P; Varga, D; Vargas, A; Vargyas, M; Varma, R; Vasileiou, M; Vasiliev, A; Vauthier, A; Vechernin, V; Veen, A M; Veldhoen, M; Velure, A; Venaruzzo, M; Vercellin, E; Vergara Limón, S; Vernet, R; Verweij, M; Vickovic, L; Viesti, G; Viinikainen, J; Vilakazi, Z; Villalobos Baillie, O; Villatoro Tello, A; Vinogradov, A; Vinogradov, L; Vinogradov, Y; Virgili, T; Vislavicius, V; Viyogi, Y P; Vodopyanov, A; Völkl, M A; Voloshin, K; Voloshin, S A; Volpe, G; von Haller, B; Vorobyev, I; Vranic, D; Vrláková, J; Vulpescu, B; Wagner, B; Wagner, J; Wang, H; Wang, M; Watanabe, D; Watanabe, Y; Weber, M; Weber, S G; Weiser, D F; Wessels, J P; Westerhoff, U; Whitehead, A M; Wiechula, J; Wikne, J; Wilk, G; Wilkinson, J; Williams, M C S; Windelband, B; Winn, M; Yang, H; Yang, P; Yano, S; Yasar, C; Yin, Z; Yokoyama, H; Yoo, I-K; Yoon, J H; Yurchenko, V; Yushmanov, I; Zaborowska, A; Zaccolo, V; Zaman, A; Zampolli, C; Zanoli, H J C; Zaporozhets, S; Zardoshti, N; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zgura, I S; Zhalov, M; Zhang, H; Zhang, X; Zhang, Y; Zhang, C; Zhang, Z; Zhao, C; Zhigareva, N; Zhou, D; Zhou, Y; Zhou, Z; Zhu, H; Zhu, J; Zichichi, A; Zimmermann, A; Zimmermann, M B; Zinovjev, G; Zyzak, M

    The production of K[Formula: see text](892)[Formula: see text] and [Formula: see text](1020) mesons has been measured in p-Pb collisions at [Formula: see text][Formula: see text] 5.02 TeV. K[Formula: see text] and [Formula: see text] are reconstructed via their decay into charged hadrons with the ALICE detector in the rapidity range [Formula: see text]. The transverse momentum spectra, measured as a function of the multiplicity, have a p[Formula: see text] range from 0 to 15 GeV/ c for K[Formula: see text] and from 0.3 to 21 GeV/ c for [Formula: see text]. Integrated yields, mean transverse momenta and particle ratios are reported and compared with results in pp collisions at [Formula: see text][Formula: see text] 7 TeV and Pb-Pb collisions at [Formula: see text][Formula: see text] 2.76 TeV. In Pb-Pb and p-Pb collisions, K[Formula: see text] and [Formula: see text] probe the hadronic phase of the system and contribute to the study of particle formation mechanisms by comparison with other identified hadrons. For this purpose, the mean transverse momenta and the differential proton-to-[Formula: see text] ratio are discussed as a function of the multiplicity of the event. The short-lived K[Formula: see text] is measured to investigate re-scattering effects, believed to be related to the size of the system and to the lifetime of the hadronic phase.

  18. Final Generic Environmental Impact Statement. Handling and storage of spent light water power reactor fuel. Volume 2. Appendices

    International Nuclear Information System (INIS)

    1979-08-01

    This volume contains the following appendices: LWR fuel cycle, handling and storage of spent fuel, termination case considerations (use of coal-fired power plants to replace nuclear plants), increasing fuel storage capacity, spent fuel transshipment, spent fuel generation and storage data, characteristics of nuclear fuel, away-from-reactor storage concept, spent fuel storage requirements for higher projected nuclear generating capacity, and physical protection requirements and hypothetical sabotage events in a spent fuel storage facility

  19. Report to Congress on Server and Data Center Energy Efficiency: Public Law 109-431: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Alliance to Save Energy; ICF Incorporated; ERG Incorporated; U.S. Environmental Protection Agency; Brown, Richard E; Brown, Richard; Masanet, Eric; Nordman, Bruce; Tschudi, Bill; Shehabi, Arman; Stanley, John; Koomey, Jonathan; Sartor, Dale; Chan, Peter; Loper, Joe; Capana, Steve; Hedman, Bruce; Duff, Rebecca; Haines, Evan; Sass, Danielle; Fanara, Andrew

    2007-08-02

    This report is the appendices to a companion report, prepared in response to the request from Congress stated in Public Law 109-431 (H.R. 5646),"An Act to Study and Promote the Use of Energy Efficient Computer Servers in the United States." This report assesses current trends in energy use and energy costs of data centers and servers in the U.S. (especially Federal government facilities) and outlines existing and emerging opportunities for improved energy efficiency. It also makes recommendations for pursuing these energy-efficiency opportunities broadly across the country through the use of information and incentive-based programs.

  20. MELSAR: a mesoscale air quality model for complex terrain. Volume 2. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Allwine, K.J.; Whiteman, C.D.

    1985-04-01

    This final report is submitted as part of the Green River Ambient Model Assessment (GRAMA) project conducted at the US Department of Energy's Pacific Northwest Laboratory for the US Environmental Protection Agency. The GRAMA Program has, as its ultimate goal, the development of validated air quality models that can be applied to the complex terrain of the Green River Formation of western Colorado, eastern Utah and southern Wyoming. The Green River Formation is a geologic formation containing large reserves of oil shale, coal, and other natural resources. Development of these resources may lead to a degradation of the air quality of the region. Air quality models are needed immediately for planning and regulatory purposes to assess the magnitude of these regional impacts. This report documents one of the models being developed for this purpose within GRAMA - specifically a model to predict short averaging time (less than or equal to 24 h) pollutant concentrations resulting from the mesoscale transport of pollutant releases from multiple sources. MELSAR has not undergone any rigorous operational testing, sensitivity analyses, or validation studies. Testing and evaluation of the model are needed to gain a measure of confidence in the model's performance. This report consists of two volumes. This volume contains the Appendices, which include listings of the FORTRAN code and Volume 1 contains the model overview, technical description, and user's guide. 13 figs., 10 tabs.

  1. Alkaline Waterflooding Demonstration Project, Ranger Zone, Long Beach Unit, Wilmington Field, California. Fourth annual report, June 1979-May 1980. Volume 3. Appendices II-XVII

    Energy Technology Data Exchange (ETDEWEB)

    Carmichael, J.D.

    1981-03-01

    Volume 3 contains Appendices II through XVII: mixing instructions for sodium orthosilicate; oil displacement studies using THUMS C-331 crude oil and extracted reservoir core material from well B-110; clay mineral analysis of B-827-A cores; sieve analysis of 4 Fo sand samples from B-110-IA and 4 Fo sand samples from B-827-A; core record; delayed secondary caustic consumption tests; long-term alkaline consumption in reservoir sands; demulsification study for THUMS Long Beach Company, Island White; operating plans and instructions for DOE injection demonstration project, alkaline injection; caustic pilot-produced water test graphs; well test irregularities (6/1/79-5/31/80); alkaline flood pump changes (6/1/79-5/31/80); monthly DOE pilot chemical waterflood injection reports (preflush injection, alkaline-salt injection, and alkaline injection without salt); and caustic safety procedures-alkaline chemicals.

  2. DOE standard: Integration of environment, safety, and health into facility disposition activities. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-05-01

    This volume contains the appendices that provide additional environment, safety, and health (ES and H) information to complement Volume 1 of this Standard. Appendix A provides a set of candidate DOE ES and H directives and external regulations, organized by hazard types that may be used to identify potentially applicable directives to a specific facility disposition activity. Appendix B offers examples and lessons learned that illustrate implementation of ES and H approaches discussed in Section 3 of Volume 1. Appendix C contains ISMS performance expectations to guide a project team in developing and implementing an effective ISMS and in developing specific performance criteria for use in facility disposition. Appendix D provides guidance for identifying potential Applicable or Relevant and Appropriate Requirements (ARARs) when decommissioning facilities fall under the Comprehensive Environmental Response, Compensation, Liability Act (CERCLA) process. Appendix E discusses ES and H considerations for dispositioning facilities by privatization. Appendix F is an overview of the WSS process. Appendix G provides a copy of two DOE Office of Nuclear Safety Policy and Standards memoranda that form the bases for some of the guidance discussed within the Standard. Appendix H gives information on available hazard analysis techniques and references. Appendix I provides a supplemental discussion to Sections 3.3.4, Hazard Baseline Documentation, and 3.3.6, Environmental Permits. Appendix J presents a sample readiness evaluation checklist.

  3. DOE standard: Integration of environment, safety, and health into facility disposition activities. Volume 2: Appendices

    International Nuclear Information System (INIS)

    1998-05-01

    This volume contains the appendices that provide additional environment, safety, and health (ES and H) information to complement Volume 1 of this Standard. Appendix A provides a set of candidate DOE ES and H directives and external regulations, organized by hazard types that may be used to identify potentially applicable directives to a specific facility disposition activity. Appendix B offers examples and lessons learned that illustrate implementation of ES and H approaches discussed in Section 3 of Volume 1. Appendix C contains ISMS performance expectations to guide a project team in developing and implementing an effective ISMS and in developing specific performance criteria for use in facility disposition. Appendix D provides guidance for identifying potential Applicable or Relevant and Appropriate Requirements (ARARs) when decommissioning facilities fall under the Comprehensive Environmental Response, Compensation, Liability Act (CERCLA) process. Appendix E discusses ES and H considerations for dispositioning facilities by privatization. Appendix F is an overview of the WSS process. Appendix G provides a copy of two DOE Office of Nuclear Safety Policy and Standards memoranda that form the bases for some of the guidance discussed within the Standard. Appendix H gives information on available hazard analysis techniques and references. Appendix I provides a supplemental discussion to Sections 3.3.4, Hazard Baseline Documentation, and 3.3.6, Environmental Permits. Appendix J presents a sample readiness evaluation checklist

  4. State of the Art Report on Fracture Mechanics (Fracture in the Creep Range). Volume 2: Appendices A - G

    International Nuclear Information System (INIS)

    Ellison, E.G.; Musicco, G.G.; Pineau, A.

    1988-01-01

    A CEC State of the Art Report on Fracture Mechanics for Fast Breeder Reactors (Fracture below the Creep Range) has recently been published by Bhandari and coworkers (1984). There has also been a compilation of Creep Crack Growth Data from Germany, France and the U.K. for 304 and 316 stainles steel by Lloyd et al (1984). The present Report provides considerably more data and analytical techniques taken from Worldwide sources on creep crack initiation and propagation. Since the subject is moving quickly there is an emphasis on the most recent work; indeed research studies as yet unpublished are also included. The total Report is in 3 volumes. Volume 2 contains the most important and up-to-date information in some detail in Appendices A to G; this provides a sound base for the Report and for future workers

  5. Temperature measurements in the TORMAC IV-c plasma

    Energy Technology Data Exchange (ETDEWEB)

    Greenwald, M.

    1978-09-01

    This thesis is divided into four main parts. The first is an introduction to the Tormac concept and a brief summary of the theoretical problems involved. The second part describes the experimental work with little detail. Both the construction and diagnostics are summarized. The third section is broken into two parts, a summary of the data taken on TORMAC IV-c and an explanation and discussion of the data. Finally, a number of lengthy appendices are included. These detail the construction and operation of the device and describe the principles and practice of the diagnostics employed.

  6. Temperature measurements in the TORMAC IV-c plasma

    International Nuclear Information System (INIS)

    Greenwald, M.

    1978-09-01

    This thesis is divided into four main parts. The first is an introduction to the Tormac concept and a brief summary of the theoretical problems involved. The second part describes the experimental work with little detail. Both the construction and diagnostics are summarized. The third section is broken into two parts, a summary of the data taken on TORMAC IV-c and an explanation and discussion of the data. Finally, a number of lengthy appendices are included. These detail the construction and operation of the device and describe the principles and practice of the diagnostics employed

  7. Probabilistic accident consequence uncertainty analysis: Food chain uncertainty assessment. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Brown, J. [National Radiological Protection Board (United Kingdom); Goossens, L.H.J.; Kraan, B.C.P. [Delft Univ. of Technology (Netherlands)] [and others

    1997-06-01

    This volume is the second of a two-volume document that summarizes a joint project by the US Nuclear Regulatory and the Commission of European Communities to assess uncertainties in the MACCS and COSYMA probabilistic accident consequence codes. These codes were developed primarily for estimating the risks presented by nuclear reactors based on postulated frequencies and magnitudes of potential accidents. This two-volume report, which examines mechanisms and uncertainties of transfer through the food chain, is the first in a series of five such reports. A panel of sixteen experts was formed to compile credible and traceable uncertainty distributions for food chain transfer that affect calculations of offsite radiological consequences. Seven of the experts reported on transfer into the food chain through soil and plants, nine reported on transfer via food products from animals, and two reported on both. The expert judgment elicitation procedure and its outcomes are described in these volumes. This volume contains seven appendices. Appendix A presents a brief discussion of the MAACS and COSYMA model codes. Appendix B is the structure document and elicitation questionnaire for the expert panel on soils and plants. Appendix C presents the rationales and responses of each of the members of the soils and plants expert panel. Appendix D is the structure document and elicitation questionnaire for the expert panel on animal transfer. The rationales and responses of each of the experts on animal transfer are given in Appendix E. Brief biographies of the food chain expert panel members are provided in Appendix F. Aggregated results of expert responses are presented in graph format in Appendix G.

  8. Probabilistic accident consequence uncertainty analysis: Food chain uncertainty assessment. Volume 2: Appendices

    International Nuclear Information System (INIS)

    Brown, J.; Goossens, L.H.J.; Kraan, B.C.P.

    1997-06-01

    This volume is the second of a two-volume document that summarizes a joint project by the US Nuclear Regulatory and the Commission of European Communities to assess uncertainties in the MACCS and COSYMA probabilistic accident consequence codes. These codes were developed primarily for estimating the risks presented by nuclear reactors based on postulated frequencies and magnitudes of potential accidents. This two-volume report, which examines mechanisms and uncertainties of transfer through the food chain, is the first in a series of five such reports. A panel of sixteen experts was formed to compile credible and traceable uncertainty distributions for food chain transfer that affect calculations of offsite radiological consequences. Seven of the experts reported on transfer into the food chain through soil and plants, nine reported on transfer via food products from animals, and two reported on both. The expert judgment elicitation procedure and its outcomes are described in these volumes. This volume contains seven appendices. Appendix A presents a brief discussion of the MAACS and COSYMA model codes. Appendix B is the structure document and elicitation questionnaire for the expert panel on soils and plants. Appendix C presents the rationales and responses of each of the members of the soils and plants expert panel. Appendix D is the structure document and elicitation questionnaire for the expert panel on animal transfer. The rationales and responses of each of the experts on animal transfer are given in Appendix E. Brief biographies of the food chain expert panel members are provided in Appendix F. Aggregated results of expert responses are presented in graph format in Appendix G

  9. A Customizable Text Classifier for Text Mining

    Directory of Open Access Journals (Sweden)

    Yun-liang Zhang

    2007-12-01

    Full Text Available Text mining deals with complex and unstructured texts. Usually a particular collection of texts that is specified to one or more domains is necessary. We have developed a customizable text classifier for users to mine the collection automatically. It derives from the sentence category of the HNC theory and corresponding techniques. It can start with a few texts, and it can adjust automatically or be adjusted by user. The user can also control the number of domains chosen and decide the standard with which to choose the texts based on demand and abundance of materials. The performance of the classifier varies with the user's choice.

  10. The development of coal-based technologies for Department of Defense facilities. Volume 2, Appendices. Semiannual technical progress report, September 28, 1994--March 27, 1995

    International Nuclear Information System (INIS)

    Miller, B.G.; Bartley, D.A.; Hatcher, P.

    1996-01-01

    This semiannual progress report contains the following appendices: description of the 1,000 lb steam/h watertube research boiler; the Pennsylvania CGE model; Phase II, subtask 3.9 coal market analysis; the CGE model; and sector definition

  11. Public Comments on the proposed 10 CFR Part 51 rule for renewal of nuclear power plant operating licenses and supporting documents: Review of concerns and NRC staff response. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    This volume contains several appendices. Appendix A contains the list of individuals and organizations providing comments at various stages of the rulemaking process. The names of commenters at the public meetings are listed in the order that they spoke at the meeting; those who submitted written comments are listed by docket number. Appendix B contains the summaries of comments made. Each comment summary is identified by a unique comment number. Appendix C presents the concerns and NRC staff responses. Each concern embodies one or more comments on similar or related issues. The associated comment numbers are referenced for each concern. The concerns are organized by topic areas. A three-letter identifier for the topic, followed by a number, is assigned to each concern.

  12. Public Comments on the proposed 10 CFR Part 51 rule for renewal of nuclear power plant operating licenses and supporting documents: Review of concerns and NRC staff response. Appendices

    International Nuclear Information System (INIS)

    1996-05-01

    This volume contains several appendices. Appendix A contains the list of individuals and organizations providing comments at various stages of the rulemaking process. The names of commenters at the public meetings are listed in the order that they spoke at the meeting; those who submitted written comments are listed by docket number. Appendix B contains the summaries of comments made. Each comment summary is identified by a unique comment number. Appendix C presents the concerns and NRC staff responses. Each concern embodies one or more comments on similar or related issues. The associated comment numbers are referenced for each concern. The concerns are organized by topic areas. A three-letter identifier for the topic, followed by a number, is assigned to each concern

  13. Computational text analysis and reading comprehension exam complexity towards automatic text classification

    CERN Document Server

    Liontou, Trisevgeni

    2014-01-01

    This book delineates a range of linguistic features that characterise the reading texts used at the B2 (Independent User) and C1 (Proficient User) levels of the Greek State Certificate of English Language Proficiency exams in order to help define text difficulty per level of competence. In addition, it examines whether specific reader variables influence test takers' perceptions of reading comprehension difficulty. The end product is a Text Classification Profile per level of competence and a formula for automatically estimating text difficulty and assigning levels to texts consistently and re

  14. Systems study of the feasibility of high-level nuclear waste fractionation for thermal stress control in a geologic repository: appendices

    International Nuclear Information System (INIS)

    McKee, R.W.; Elder, H.K.; McCallum, R.F.; Silviera, D.J.; Swanson, J.L.; Wiles, L.E.

    1983-06-01

    This study assesses the benefits and costs of fractionating the cesium and strontium (Cs/Sr) components in commercial high-level waste (HLW) to a separate waste stream for the purpose of reducing geologic-repository thermal stresses in the region of the HLW. The major conclusion is that the Cs/Sr fractionation concept offers the prospect of a substantial total system cost advantage for HLW disposal if reduced HLW package temperatures in a basalt repository are desired. However there is no cost advantage if currently designated maximum design temperatures are acceptable. Aging the HLW for 50 to 100 years can accomplish similar results at equivalent or lower costs. Volume II contains appendices for: (1) thermal analysis supplement; (2) fractionation process experimental results supplement; (3) cost analysis supplement; and (4) radiological risk analysis supplement

  15. Resource Conservation and Recovery Act, Part B Permit Application [for the Waste Isolation Pilot Plant (WIPP)]. Volume 6, Chapter D, Appendices D4--D13: Revision 1.0

    Energy Technology Data Exchange (ETDEWEB)

    1991-12-31

    This report (Vol. 6) for the WIPP facility contains appendices on the following information: Site characterization; general geology; ecological monitoring; and chemical compatibility of waste forms and container materials.

  16. Molecular profiling of appendiceal epithelial tumors using massively parallel sequencing to identify somatic mutations.

    Science.gov (United States)

    Liu, Xiaoying; Mody, Kabir; de Abreu, Francine B; Pipas, J Marc; Peterson, Jason D; Gallagher, Torrey L; Suriawinata, Arief A; Ripple, Gregory H; Hourdequin, Kathryn C; Smith, Kerrington D; Barth, Richard J; Colacchio, Thomas A; Tsapakos, Michael J; Zaki, Bassem I; Gardner, Timothy B; Gordon, Stuart R; Amos, Christopher I; Wells, Wendy A; Tsongalis, Gregory J

    2014-07-01

    Some epithelial neoplasms of the appendix, including low-grade appendiceal mucinous neoplasm and adenocarcinoma, can result in pseudomyxoma peritonei (PMP). Little is known about the mutational spectra of these tumor types and whether mutations may be of clinical significance with respect to therapeutic selection. In this study, we identified somatic mutations using the Ion Torrent AmpliSeq Cancer Hotspot Panel v2. Specimens consisted of 3 nonneoplastic retention cysts/mucocele, 15 low-grade mucinous neoplasms (LAMNs), 8 low-grade/well-differentiated mucinous adenocarcinomas with pseudomyxoma peritonei, and 12 adenocarcinomas with/without goblet cell/signet ring cell features. Barcoded libraries were prepared from up to 10 ng of extracted DNA and multiplexed on single 318 chips for sequencing. Data analysis was performed using Golden Helix SVS. Variants that remained after the analysis pipeline were individually interrogated using the Integrative Genomics Viewer. A single Janus kinase 3 (JAK3) mutation was detected in the mucocele group. Eight mutations were identified in the V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS) and GNAS complex locus (GNAS) genes among LAMN samples. Additional gene mutations were identified in the AKT1 (v-akt murine thymoma viral oncogene homolog 1), APC (adenomatous polyposis coli), JAK3, MET (met proto-oncogene), phosphatidylinositol-4,5-bisphosphate 3-kinase (PIK3CA), RB1 (retinoblastoma 1), STK11 (serine/threonine kinase 11), and tumor protein p53 (TP53) genes. Among the PMPs, 6 mutations were detected in the KRAS gene and also in the GNAS, TP53, and RB1 genes. Appendiceal cancers showed mutations in the APC, ATM (ataxia telangiectasia mutated), KRAS, IDH1 [isocitrate dehydrogenase 1 (NADP+)], NRAS [neuroblastoma RAS viral (v-ras) oncogene homolog], PIK3CA, SMAD4 (SMAD family member 4), and TP53 genes. Our results suggest molecular heterogeneity among epithelial tumors of the appendix. Next generation sequencing efforts

  17. Greater-than-Class C low-level radioactive waste characterization. Appendix E-3: GTCC LLW assumptions matrix

    International Nuclear Information System (INIS)

    1995-01-01

    This study identifies four categories of GTCC LLW: nuclear utility; sealed sources; DOE-held; and other generators. Within each category, inventory and projection data are modeled in three scenarios: (1) Unpackaged volume--this is the unpackaged volume of waste that would exceed Class C limits if the waste calculation methods in 10 CFR 61.55 were applied to the discrete items before concentration averaging methods were applied to the volume; (2) Not-concentration-averaged (NCA) packaged volume--this is the packaged volume of GTCC LLW assuming that no concentration averaging is allowed; and (3) After-concentration-averaging (ACA) packaged volume--this is the packaged volume of GTCC LLW, which, for regulatory or practical reasons, cannot be disposed of in a LLW disposal facility using allowable concentration averaging practices. Three cases are calculated for each of the volumes described above. These values are defined as the low, base, and high cases. The following tables explain the assumptions used to determine low, base, and high case estimates for each scenario, within each generator category. The appendices referred to in these tables are appendices to Greater-Than-Class C Low-Level Radioactive Waste Characterization: Estimated Volumes, Radionuclide Activities, and Other Characteristics (DOE/LLW-114, Revision 1)

  18. Understanding utility regulation : a participants' guide to the British Columbia Utilities Commission

    International Nuclear Information System (INIS)

    1996-10-01

    Information regarding British Columbia's regulated energy industries is presented with particular emphasis on the regulatory functions of the British Columbia Utilities Commission (BCUC). The objective of providing the information is to make the regulatory process as transparent as possible and to make it easy for ratepayers to effectively and economically participate in the regulation of energy utilities. The issue of why electricity and natural gas utilities are regulated is addressed, but the greater part of the report is devoted to describing opportunities for public participation at the BCUC, explaining how to get involved in the Commission's proceedings and the nature of the hearings used by the Commission. An introduction to rate making is also presented, along with an overview of other institutions involved in energy regulation. Appendices contain the text of the Utilities Commission Act (App. A), the Negotiated Settlement Process Policy, Procedures and Guidelines (App. B), Participant Funding and Cost Awards (App. C), and the Integrated Resource Planning Guide (App. D). tabs., figs., 4 appendices

  19. Territorial Climate-Energy Plan - Le Mans region. Complete file + synthesis + Action sheets + Actor file + Appendices + Territory file

    International Nuclear Information System (INIS)

    Boulard, Jean-Claude

    2014-07-01

    A first document presents the meaning, objectives and implementation of the Territorial Climate Energy Plan (PCET) for Le Mans region, and then its five main steps: definition, diagnosis, actors, roadmap, assessment. A synthetic version is provided. Twenty action sheets are proposed, first in synthetic and general way, and then in terms of projects. These actions deal with transport and mobility, with building and development, with agriculture, forest and nature, with consumption and wastes, and with the mobilisation of actors. A document proposes sheets which describe good practices performed by Le Mans region 'syndicat mixte', by the city of Le Mans and its metropolitan body. Appendices contain some organisational information

  20. Proposed Revisions to MIL-F-8785C Related to Flight Safety of Augmented Aircraft. Volume 2. Appendices A through F, References

    Science.gov (United States)

    1982-04-01

    matrices described in Section F.l.2, Equation F7 . These were derived from the aerodynamic coefficients, see Section C.4.4. They are in stability-body...actuator and 6 e is the elevator output. The time histories used the state models of Table C-8, corres- ponding to Equation F7 given in Section F.1.2...40 a c o 0Oa - a ~ ~ 4 -9c -C -9mu * 0 #b4 C 000 0 00, 0a-a-- a~~a.c cc * a -ic* . anlalugaus LAOlla umsila 0 4iO ’ an am am om .a -m , M ~ - . acca

  1. Empirical Model Development for Predicting Shock Response on Composite Materials Subjected to Pyroshock Loading. Volume 2, Part 1; Appendices

    Science.gov (United States)

    Gentz, Steven J.; Ordway, David O.; Parsons, David S.; Garrison, Craig M.; Rodgers, C. Steven; Collins, Brian W.

    2015-01-01

    The NASA Engineering and Safety Center (NESC) received a request to develop an analysis model based on both frequency response and wave propagation analyses for predicting shock response spectrum (SRS) on composite materials subjected to pyroshock loading. The model would account for near-field environment (approximately 9 inches from the source) dominated by direct wave propagation, mid-field environment (approximately 2 feet from the source) characterized by wave propagation and structural resonances, and far-field environment dominated by lower frequency bending waves in the structure. This document contains appendices to the Volume I report.

  2. Research reactor core conversion guidebook. V. 3: Analytical verification (Appendices G and H)

    International Nuclear Information System (INIS)

    1992-04-01

    Volume 3 consists of Appendix G which contains detailed results of a safety-related benchmark problem for an idealized reactor and Appendix H which contains detailed comparisons of calculated and measured data for actual cores with moderately enriched uranium and low enriched uranium fuels. The results of the benchmark calculations in Appendix G are summarized in Chapter 7 of Volume 1 and the results of the comparisons between calculations and measurements are summarized in Chapter 8 of Volume 1. Both the approaches described in these appendices are very useful in ensuring that the calculational methods employed in the preparation of a Safety Report are accurate. As a first step, it is recommended that reactor operators/physicists use their own methods and codes to first calculate the benchmark problem, and then compare the results of calculations with measurements in their own reactor or in one of the reactors for which measured data is available in Appendix H. (author). Refs, figs and tabs

  3. The potential for using disused coastal mineshafts to exploit wave energy : Vol. 1: Main report; Vol. 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Scholes, H.; Millar, D.L.; Eyre, J.M.; Dibley, R.; Davey, G.; Haywood, M.

    2004-07-01

    This report summarises the findings of a project investigating the potential use of abandoned mine shafts in Cornwall as oscillating water column wave power generation devices, and assesses the Waveshaft concept in phase 1 prior to further examination of selected sites in phase 2. Details are given of the criteria for the mine shafts, identification of candidate shafts, remediation/enhancement requirements, and wave climate along with power conversion issues, overall estimated waveshaft resource in Cornwall, environmental impacts and legal protection, and an economic appraisal. Inspection and safety protocols, mine location maps, and wave power data are presented in appendices.

  4. Department of Defense Materiel Distribution System Study. Volume 3, Book 2. Appendices A, B and C

    Science.gov (United States)

    1978-07-01

    DODMDS Product Group Generic Commodity Group/ Number Product Group Description Weapons and Fire Control 101 ana 11 Arras 102 Guns Over 75 mm...Major Components 104 Arms and Fire Control-Parts 121 Fire Control-Reparables Federal Supply Groups or Classes 1005R, 1010R 1015-1095R 1005-1095C...Floor Tow- Conveyor Overheac Monorail Document Conveyoi Pallet Loader Auto- mated Storage Jetrleval Ele- Syeteml vator Guided Elec

  5. Stirling Space Engine Program. Volume 2; Appendixes A, B, C and D

    Science.gov (United States)

    Dhar, Manmohan

    1999-01-01

    The objective of this program was to develop the technology necessary for operating Stirling power converters in a space environment and to demonstrate this technology in full-scale engine tests. Volume 2 of the report includes the following appendices: Appendix A: Heater Head Development (Starfish Heater Head Program, 1/10th Segment and Full-Scale Heat Pipes, and Sodium Filling and Processing); Appendix B: Component Test Power Converter (CTPC) Component Development (High-temperature Organic Materials, Heat Exchanger Fabrication, Beryllium Issues, Sodium Issues, Wear Couple Tests, Pressure Boundary Penetrations, Heating System Heaters, and Cooler Flow Test); Appendix C: Udimet Testing (Selection of the Reference Material for the Space Stirling Engine Heater Head, Udimet 720LI Creep Test Result Update, Final Summary of Space Stirling Endurance Engine Udimet 720L1 Fatigue Testing Results, Udimet 720l1 Weld Development Summary, and Udimet 720L1 Creep Test Final Results Summary), and Appendix D: CTPC Component Development Photos.

  6. Analysis of potential combustion source impacts on acid deposition using an independently derived inventory. Volume II, appendices

    Energy Technology Data Exchange (ETDEWEB)

    1983-12-01

    This document contains 2 appendices. The first documents the methodologies used to calculate production, unit energy consumption, fuel type and emission estimates for 16 industries and 35 types of facilities utilizing direct-fired industrial combustion processes, located in 26 states (and the District of Columbia) east of the Mississippi River. As discussed in the text of this report, a U.S. total of 16 industries and 45 types of facilities utilizing direct-fired combustion processes were identified by an elimination type method that was developed based on evaluation of fuel use in industrial SIC codes 20-39 to identify pollutant sources contributing to acid rain. The final population included only plants that have direct-fired fuel consumption greater than or equal to 100 x 10/sup 9/ Btu/yr of equivalent energy consumption. The goal for this analysis was to provide at least a 1980 base year for the data. This was achieved for all of the industries and in fact, 1981 data were used for a number of the industries evaluated. The second contains an analysis of all consumption of major fossil fuels to: (1) identify all fuel usage categories, and (2) identify the kinds of combustion equipment used within each category. This analysis provides a frame of reference for the balance of the study and permits using an energy accounting methodology to quantify the degree to which the inventoried sources in individual consuming sectors are complete and representative of the total population for the sector.

  7. Supplemental site inspection for Air Force Plant 59, Johnson City, New York, Volume 3: Appendices F-Q

    Energy Technology Data Exchange (ETDEWEB)

    Nashold, B.; Rosenblatt, D.; Hau, J. [and others

    1995-08-01

    This summary describes a Supplemental Site Inspection (SSI) conducted by Argonne National Laboratory (ANL) at Air Force Plant 59 (AFP 59) in Johnson City, New York. All required data pertaining to this project were entered by ANL into the Air Force-wide Installation Restoration Program Information System (IRPIMS) computer format and submitted to an appropriate authority. The work was sponsored by the United States Air Force as part of its Installation Restoration Program (IRP). Previous studies had revealed the presence of contaminants at the site and identified several potential contaminant sources. Argonne`s study was conducted to answer questions raised by earlier investigations. This volume consists of appendices F-Q, which contain the analytical data from the site characterization.

  8. Report on demonstrative research on photovoltaic power generation system in Myanmar. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    With an objective of installation and demonstrative operation in Myanmar of a power generation system combining a small-scale photovoltaic power generation system, a wind power generation system, and a diesel generator, research and development is being made under a six year plan starting in 1999 and ending in 2004. This paper compiles the appendices related thereto. Collected for the climatic observation are the insolation data and wind velocity data in Chaungthar, and the insolation graph in both of Chaungthar and Lethokekone. Furthermore, materials for selection and decision on the installation location, and design materials for a hybrid power generation system were collected. Collected for procurement, construction, and installation of devices and facilities include test data for the diesel generator, drawings for the power generation control panel, test operation report, bill of lading for the diesel generator, a completion certificate of the diesel generator building, photographs of the building, a certificate of completion of installation of the diesel generator, photographs taken during the installation work, a certificate of completion of power transmission cable installation, photographs of the installation works, and the operation manual for the diesel engine. (NEDO)

  9. Precursors to potential severe core damage accidents: 1994, a status report. Volume 21: Main report and appendices A--H

    International Nuclear Information System (INIS)

    Belles, R.J.; Cletcher, J.W.; Copinger, D.A.; Vanden Heuvel, L.N.; Dolan, B.W.; Minarick, J.W.

    1995-12-01

    Nine operational events that affected eleven commercial light-water reactors (LWRs) during 1994 and that are considered to be precursors to potential severe core damage are described. All these events had conditional probabilities of subsequent severe core damage greater than or equal to 1.0 x 10 -6 . These events were identified by computer-screening the 1994 licensee event reports from commercial LWRs to identify those that could be potential precursors. Candidate precursors were then selected and evaluated in a process similar to that used in previous assessments. Selected events underwent engineering evaluation that identified, analyzed, and documented the precursors. Other events designated by the Nuclear Regulatory Commission (NRC) also underwent a similar evaluation. Finally, documented precursors were submitted for review by licensees and NRC headquarters and regional offices to ensure that the plant design and its response to the precursor were correctly characterized. This study is a continuation of earlier work, which evaluated 1969--1981 and 1984--1993 events. The report discusses the general rationale for this study, the selection and documentation of events as precursors, and the estimation of conditional probabilities of subsequent severe core damage for events. This document is bound in two volumes: Vol. 21 contains the main report and Appendices A--H; Vol. 22 contains Appendix 1

  10. Refinery siting workbook: appendices C to O

    Energy Technology Data Exchange (ETDEWEB)

    1980-07-01

    Applicable laws and permits available for the selection and building of petroleum refineries are enclosed. A glossary of pertinent terms is also included. References related to the National Environmental Policy Act, the Clean Air Act, the Federal Water Pollution Control Act, Resource Conservation and Recovery Act, Toxic Substance Control Act, and Wetlands and Coastal Zone are included. Permit information is also presented. (DC)

  11. Documentation of TRU biological transport model (BIOTRAN)

    Energy Technology Data Exchange (ETDEWEB)

    Gallegos, A.F.; Garcia, B.J.; Sutton, C.M.

    1980-01-01

    Inclusive of Appendices, this document describes the purpose, rationale, construction, and operation of a biological transport model (BIOTRAN). This model is used to predict the flow of transuranic elements (TRU) through specified plant and animal environments using biomass as a vector. The appendices are: (A) Flows of moisture, biomass, and TRU; (B) Intermediate variables affecting flows; (C) Mnemonic equivalents (code) for variables; (D) Variable library (code); (E) BIOTRAN code (Fortran); (F) Plants simulated; (G) BIOTRAN code documentation; (H) Operating instructions for BIOTRAN code. The main text is presented with a specific format which uses a minimum of space, yet is adequate for tracking most relationships from their first appearance to their formulation in the code. Because relationships are treated individually in this manner, and rely heavily on Appendix material for understanding, it is advised that the reader familiarize himself with these materials before proceeding with the main text.

  12. Documentation of TRU biological transport model (BIOTRAN)

    International Nuclear Information System (INIS)

    Gallegos, A.F.; Garcia, B.J.; Sutton, C.M.

    1980-01-01

    Inclusive of Appendices, this document describes the purpose, rationale, construction, and operation of a biological transport model (BIOTRAN). This model is used to predict the flow of transuranic elements (TRU) through specified plant and animal environments using biomass as a vector. The appendices are: (A) Flows of moisture, biomass, and TRU; (B) Intermediate variables affecting flows; (C) Mnemonic equivalents (code) for variables; (D) Variable library (code); (E) BIOTRAN code (Fortran); (F) Plants simulated; (G) BIOTRAN code documentation; (H) Operating instructions for BIOTRAN code. The main text is presented with a specific format which uses a minimum of space, yet is adequate for tracking most relationships from their first appearance to their formulation in the code. Because relationships are treated individually in this manner, and rely heavily on Appendix material for understanding, it is advised that the reader familiarize himself with these materials before proceeding with the main text

  13. Probabilistic accident consequence uncertainty analysis -- Late health effects uncertain assessment. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Little, M.P.; Muirhead, C.R. [National Radiological Protection Board (United Kingdom); Goossens, L.H.J.; Kraan, B.C.P.; Cooke, R.M. [Delft Univ. of Technology (Netherlands); Harper, F.T. [Sandia National Labs., Albuquerque, NM (United States); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    1997-12-01

    The development of two new probabilistic accident consequence codes, MACCS and COSYMA, was completed in 1990. These codes estimate the consequence from the accidental releases of radiological material from hypothesized accidents at nuclear installations. In 1991, the US Nuclear Regulatory Commission and the Commission of the European Communities began cosponsoring a joint uncertainty analysis of the two codes. The ultimate objective of this joint effort was to systematically develop credible and traceable uncertainty distributions for the respective code input variables. A formal expert judgment elicitation and evaluation process was identified as the best technology available for developing a library of uncertainty distributions for these consequence parameters. This report focuses on the results of the study to develop distribution for variables related to the MACCS and COSYMA late health effects models. This volume contains appendices that include (1) a summary of the MACCS and COSYMA consequence codes, (2) the elicitation questionnaires and case structures, (3) the rationales and results for the expert panel on late health effects, (4) short biographies of the experts, and (5) the aggregated results of their responses.

  14. Probabilistic accident consequence uncertainty analysis -- Early health effects uncertainty assessment. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Haskin, F.E. [Univ. of New Mexico, Albuquerque, NM (United States); Harper, F.T. [Sandia National Labs., Albuquerque, NM (United States); Goossens, L.H.J.; Kraan, B.C.P. [Delft Univ. of Technology (Netherlands)

    1997-12-01

    The development of two new probabilistic accident consequence codes, MACCS and COSYMA, was completed in 1990. These codes estimate the consequence from the accidental releases of radiological material from hypothesized accidents at nuclear installations. In 1991, the US Nuclear Regulatory Commission and the Commission of the European Communities began cosponsoring a joint uncertainty analysis of the two codes. The ultimate objective of this joint effort was to systematically develop credible and traceable uncertainty distributions for the respective code input variables. A formal expert judgment elicitation and evaluation process was identified as the best technology available for developing a library of uncertainty distributions for these consequence parameters. This report focuses on the results of the study to develop distribution for variables related to the MACCS and COSYMA early health effects models. This volume contains appendices that include (1) a summary of the MACCS and COSYMA consequence codes, (2) the elicitation questionnaires and case structures, (3) the rationales and results for the panel on early health effects, (4) short biographies of the experts, and (5) the aggregated results of their responses.

  15. Probabilistic accident consequence uncertainty analysis -- Uncertainty assessment for internal dosimetry. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Goossens, L.H.J.; Kraan, B.C.P.; Cooke, R.M. [Delft Univ. of Technology (Netherlands); Harrison, J.D. [National Radiological Protection Board (United Kingdom); Harper, F.T. [Sandia National Labs., Albuquerque, NM (United States); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    1998-04-01

    The development of two new probabilistic accident consequence codes, MACCS and COSYMA, was completed in 1990. These codes estimate the consequence from the accidental releases of radiological material from hypothesized accidents at nuclear installations. In 1991, the US Nuclear Regulatory Commission and the Commission of the European Communities began cosponsoring a joint uncertainty analysis of the two codes. The ultimate objective of this joint effort was to systematically develop credible and traceable uncertainty distributions for the respective code input variables. A formal expert judgment elicitation and evaluation process was identified as the best technology available for developing a library of uncertainty distributions for these consequence parameters. This report focuses on the results of the study to develop distribution for variables related to the MACCS and COSYMA internal dosimetry models. This volume contains appendices that include (1) a summary of the MACCS and COSYMA consequence codes, (2) the elicitation questionnaires and case structures, (3) the rationales and results for the panel on internal dosimetry, (4) short biographies of the experts, and (5) the aggregated results of their responses.

  16. Demonstration, testing, and evaluation of in situ heating of soil. Final report, Volume 2, Appendices A to E

    International Nuclear Information System (INIS)

    Dev, H.; Enk, J.; Jones, D.; Sabato, W.

    1996-01-01

    This is a final report presented in two volumes. Volume I contains the technical report and Volume II contains appendices with background information and data. In this project approximately 300 cubic yards of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. It was demonstrated that the mass flow rate of the volatile organic chemicals was enhanced in the recovered soil gas as a result of heating. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOC's and other organic chemicals. Although it may be applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by air flow

  17. Demonstration, testing, and evaluation of in situ heating of soil. Final report, Volume 2, Appendices A to E

    Energy Technology Data Exchange (ETDEWEB)

    Dev, H.; Enk, J.; Jones, D.; Sabato, W.

    1996-04-05

    This is a final report presented in two volumes. Volume I contains the technical report and Volume II contains appendices with background information and data. In this project approximately 300 cubic yards of clayey soil containing a low concentration plume of volatile organic chemicals was heated in situ by the application of electrical energy. It was shown that as a result of heating the effective permeability of soil to air flow was increased such that in situ soil vapor extraction could be performed. The initial permeability of soil was so low that the soil gas flow rate was immeasurably small even at high vacuum levels. It was demonstrated that the mass flow rate of the volatile organic chemicals was enhanced in the recovered soil gas as a result of heating. When scaled up, this process can be used for the environmental clean up and restoration of DOE sites contaminated with VOC`s and other organic chemicals. Although it may be applied to many types of soil formations, it is particularly attractive for low permeability clayey soil where conventional in situ venting techniques are limited by air flow.

  18. Urihi A: A Terra-Floresta Yanomami

    Directory of Open Access Journals (Sweden)

    James R. Welch

    2010-08-01

    Full Text Available Review of Urihi A: A Terra-Floresta Yanomami. Bruce Albert and William Milliken with Gale Goodwin Gomez. São Paulo: Instituto Socioambiental, 2009. 207 pp., illustrations, tables, bibliography, appendices, index. Paperback ISBN: 978‐85 85994‐72‐3.

  19. Mucocele of Appendix Secondary to Cystadenoma a Diagnostic Challenge

    Directory of Open Access Journals (Sweden)

    Prasad K. Shetty

    2010-07-01

    Full Text Available Mucocele of appendix is uncommon cystic lesion characterized by distension of the appendiceal lumen with mucus. Most of them are caused by mucinous cystadenomas and rarely cystadenocarcinomas. Clinical presentation is varied with more than half being asymptomatic. We report such a case where initial clinical findings and investigations suggested an ovarian cyst, and the diagnosis was only made at the time of surgery. In women presenting with a right iliac fossa mass and clinical features not indicative of gynaecological pathology, an appendiceal origin should be considered in the differential diagnosis.

  20. Measurement of quarkonium production at forward rapidity in [Formula: see text] collisions at [Formula: see text]TeV.

    Science.gov (United States)

    Abelev, B; Adam, J; Adamová, D; Aggarwal, M M; Agnello, M; Agostinelli, A; Agrawal, N; Ahammed, Z; Ahmad, N; Ahmad Masoodi, A; Ahmed, I; Ahn, S U; Ahn, S A; Aimo, I; Aiola, S; Ajaz, M; Akindinov, A; Aleksandrov, D; Alessandro, B; Alexandre, D; Alici, A; Alkin, A; Alme, J; Alt, T; Altini, V; Altinpinar, S; Altsybeev, I; Alves Garcia Prado, C; Andrei, C; Andronic, A; Anguelov, V; Anielski, J; Antičić, T; Antinori, F; Antonioli, P; Aphecetche, L; Appelshäuser, H; Arbor, N; Arcelli, S; Armesto, N; Arnaldi, R; Aronsson, T; Arsene, I C; Arslandok, M; Augustinus, A; Averbeck, R; Awes, T C; Azmi, M D; Bach, M; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Baldisseri, A; Baltasar Dos Santos Pedrosa, F; Baral, R C; Barbera, R; Barile, F; Barnaföldi, G G; Barnby, L S; Barret, V; Bartke, J; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Batyunya, B; Batzing, P C; Baumann, C; Bearden, I G; Beck, H; Bedda, C; Behera, N K; Belikov, I; Bellini, F; Bellwied, R; Belmont-Moreno, E; Bencedi, G; Beole, S; Berceanu, I; Bercuci, A; Berdnikov, Y; Berenyi, D; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhat, I R; Bhati, A K; Bhattacharjee, B; Bhom, J; Bianchi, L; Bianchi, N; Bianchin, C; Bielčík, J; Bielčíková, J; Bilandzic, A; Bjelogrlic, S; Blanco, F; Blau, D; Blume, C; Bock, F; Bogdanov, A; Bøggild, H; Bogolyubsky, M; Boldizsár, L; Bombara, M; Book, J; Borel, H; Borissov, A; Bossú, F; Botje, M; Botta, E; Böttger, S; Braun-Munzinger, P; Bregant, M; Breitner, T; Broker, T A; Browning, T A; Broz, M; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buncic, P; Busch, O; Buthelezi, Z; Caffarri, D; Cai, X; Caines, H; Caliva, A; Calvo Villar, E; Camerini, P; Carena, F; Carena, W; Castillo Castellanos, J; Casula, E A R; Catanescu, V; Cavicchioli, C; Ceballos Sanchez, C; Cepila, J; Cerello, P; Chang, B; Chapeland, S; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Chelnokov, V; Cherney, M; Cheshkov, C; Cheynis, B; Chibante Barroso, V; Chinellato, D D; Chochula, P; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Conesa Balbastre, G; Conesa Del Valle, Z; Connors, M E; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortese, P; Cortés Maldonado, I; Cosentino, M R; Costa, F; Crochet, P; Cruz Albino, R; Cuautle, E; Cunqueiro, L; Dainese, A; Dang, R; Danu, A; Das, D; Das, I; Das, K; Das, S; Dash, A; Dash, S; De, S; Delagrange, H; Deloff, A; Dénes, E; D'Erasmo, G; De Caro, A; de Cataldo, G; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; de Rooij, R; Diaz Corchero, M A; Dietel, T; Divià, R; Di Bari, D; Di Liberto, S; Di Mauro, A; Di Nezza, P; Djuvsland, Ø; Dobrin, A; Dobrowolski, T; Domenicis Gimenez, D; Dönigus, B; Dordic, O; Dubey, A K; Dubla, A; Ducroux, L; Dupieux, P; Dutta Majumdar, A K; Ehlers, R J; Elia, D; Engel, H; Erazmus, B; Erdal, H A; Eschweiler, D; Espagnon, B; Esposito, M; Estienne, M; Esumi, S; Evans, D; Evdokimov, S; Fabris, D; Faivre, J; Falchieri, D; Fantoni, A; Fasel, M; Fehlker, D; Feldkamp, L; Felea, D; Feliciello, A; Feofilov, G; Ferencei, J; Fernández Téllez, A; Ferreiro, E G; Ferretti, A; Festanti, A; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Floratos, E; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Frankenfeld, U; Fuchs, U; Furget, C; Fusco Girard, M; Gaardhøje, J J; Gagliardi, M; Gago, A M; Gallio, M; Gangadharan, D R; Ganoti, P; Garabatos, C; Garcia-Solis, E; Gargiulo, C; Garishvili, I; Gerhard, J; Germain, M; Gheata, A; Gheata, M; Ghidini, B; Ghosh, P; Ghosh, S K; Gianotti, P; Giubellino, P; Gladysz-Dziadus, E; Glässel, P; Gomez Ramirez, A; González-Zamora, P; Gorbunov, S; Görlich, L; Gotovac, S; Graczykowski, L K; Grelli, A; Grigoras, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grinyov, B; Grion, N; Grosse-Oetringhaus, J F; Grossiord, J-Y; Grosso, R; Guber, F; Guernane, R; Guerzoni, B; Guilbaud, M; Gulbrandsen, K; Gulkanyan, H; Gunji, T; Gupta, A; Gupta, R; Khan, K H; Haake, R; Haaland, Ø; Hadjidakis, C; Haiduc, M; Hamagaki, H; Hamar, G; Hanratty, L D; Hansen, A; Harris, J W; Hartmann, H; Harton, A; Hatzifotiadou, D; Hayashi, S; Heckel, S T; Heide, M; Helstrup, H; Herghelegiu, A; Herrera Corral, G; Hess, B A; Hetland, K F; Hicks, B; Hippolyte, B; Hladky, J; Hristov, P; Huang, M; Humanic, T J; Hutter, D; Hwang, D S; Ilkaev, R; Ilkiv, I; Inaba, M; Innocenti, G M; Ionita, C; Ippolitov, M; Irfan, M; Ivanov, M; Ivanov, V; Ivanytskyi, O; Jachołkowski, A; Jacobs, P M; Jahnke, C; Jang, H J; Janik, M A; Jayarathna, P H S Y; Jena, S; Jimenez Bustamante, R T; Jones, P G; Jung, H; Jusko, A; Kadyshevskiy, V; Kalcher, S; Kalinak, P; Kalweit, A; Kamin, J; Kang, J H; Kaplin, V; Kar, S; Karasu Uysal, A; Karavichev, O; Karavicheva, T; Karpechev, E; Kebschull, U; Keidel, R; Khan, M M; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Kileng, B; Kim, B; Kim, D W; Kim, D J; Kim, J S; Kim, M; Kim, M; Kim, S; Kim, T; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, J; Klein-Bösing, C; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Köhler, M K; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Konevskikh, A; Kovalenko, V; Kowalski, M; Kox, S; Koyithatta Meethaleveedu, G; Kral, J; Králik, I; Kramer, F; Kravčáková, A; Krelina, M; Kretz, M; Krivda, M; Krizek, F; Krus, M; Kryshen, E; Krzewicki, M; Kučera, V; Kucheriaev, Y; Kugathasan, T; Kuhn, C; Kuijer, P G; Kulakov, I; Kumar, J; Kurashvili, P; Kurepin, A; Kurepin, A B; Kuryakin, A; Kushpil, S; Kweon, M J; Kwon, Y; Ladron de Guevara, P; Lagana Fernandes, C; Lakomov, I; Langoy, R; Lara, C; Lardeux, A; Lattuca, A; La Pointe, S L; La Rocca, P; Lea, R; Lee, G R; Legrand, I; Lehnert, J; Lemmon, R C; Lenti, V; Leogrande, E; Leoncino, M; León Monzón, I; Lévai, P; Li, S; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Ljunggren, H M; Lodato, D F; Loenne, P I; Loggins, V R; Loginov, V; Lohner, D; Loizides, C; Lopez, X; López Torres, E; Lu, X-G; Luettig, P; Lunardon, M; Luo, J; Luparello, G; Luzzi, C; Ma, R; Maevskaya, A; Mager, M; Mahapatra, D P; Maire, A; Majka, R D; Malaev, M; Maldonado Cervantes, I; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manceau, L; Manko, V; Manso, F; Manzari, V; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Marín, A; Markert, C; Marquard, M; Martashvili, I; Martin, N A; Martinengo, P; Martínez, M I; Martínez García, G; Martin Blanco, J; Martynov, Y; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Massacrier, L; Mastroserio, A; Matyja, A; Mayer, C; Mazer, J; Mazzoni, M A; Meddi, F; Menchaca-Rocha, A; Mercado Pérez, J; Meres, M; Miake, Y; Mikhaylov, K; Milano, L; Milosevic, J; Mischke, A; Mishra, A N; Miśkowiec, D; Mitu, C M; Mlynarz, J; Mohanty, B; Molnar, L; Montaño Zetina, L; Montes, E; Morando, M; Moreira De Godoy, D A; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Muhuri, S; Mukherjee, M; Müller, H; Munhoz, M G; Murray, S; Musa, L; Musinsky, J; Nandi, B K; Nania, R; Nappi, E; Nattrass, C; Nayak, T K; Nazarenko, S; Nedosekin, A; Nicassio, M; Niculescu, M; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Nilsen, B S; Noferini, F; Nomokonov, P; Nooren, G; Nyanin, A; Nystrand, J; Oeschler, H; Oh, S; Oh, S K; Okatan, A; Olah, L; Oleniacz, J; Oliveira Da Silva, A C; Onderwaater, J; Oppedisano, C; Ortiz Velasquez, A; Oskarsson, A; Otwinowski, J; Oyama, K; Sahoo, P; Pachmayer, Y; Pachr, M; Pagano, P; Paić, G; Painke, F; Pajares, C; Pal, S K; Palmeri, A; Pant, D; Papikyan, V; Pappalardo, G S; Pareek, P; Park, W J; Parmar, S; Passfeld, A; Patalakha, D I; Paticchio, V; Paul, B; Pawlak, T; Peitzmann, T; Pereira Da Costa, H; Pereira De Oliveira Filho, E; Peresunko, D; Pérez Lara, C E; Pesci, A; Peskov, V; Pestov, Y; Petráček, V; Petran, M; Petris, M; Petrovici, M; Petta, C; Piano, S; Pikna, M; Pillot, P; Pinazza, O; Pinsky, L; Piyarathna, D B; Płoskoń, M; Planinic, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Pohjoisaho, E H O; Polichtchouk, B; Poljak, N; Pop, A; Porteboeuf-Houssais, S; Porter, J; Pospisil, V; Potukuchi, B; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puddu, G; Pujahari, P; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Raha, S; Rak, J; Rakotozafindrabe, A; Ramello, L; Raniwala, R; Raniwala, S; Räsänen, S S; Rascanu, B T; Rathee, D; Rauf, A W; Razazi, V; Read, K F; Real, J S; Redlich, K; Reed, R J; Rehman, A; Reichelt, P; Reicher, M; Reidt, F; Renfordt, R; Reolon, A R; Reshetin, A; Rettig, F; Revol, J-P; Reygers, K; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Rivetti, A; Rocco, E; Rodríguez Cahuantzi, M; Rodriguez Manso, A; Røed, K; Rogochaya, E; Rohni, S; Rohr, D; Röhrich, D; Romita, R; Ronchetti, F; Rosnet, P; Rossegger, S; Rossi, A; Roukoutakis, F; Roy, A; Roy, C; Roy, P; Rubio Montero, A J; Rui, R; Russo, R; Ryabinkin, E; Rybicki, A; Sadovsky, S; Šafařík, K; Sahlmuller, B; Sahoo, R; Sahu, P K; Saini, J; Salgado, C A; Salzwedel, J; Sambyal, S; Samsonov, V; Sanchez Castro, X; Sánchez Rodríguez, F J; Šándor, L; Sandoval, A; Sano, M; Santagati, G; Sarkar, D; Scapparone, E; Scarlassara, F; Scharenberg, R P; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schuchmann, S; Schukraft, J; Schulc, M; Schuster, T; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Segato, G; Seger, J E; Sekiguchi, Y; Selyuzhenkov, I; Seo, J; Serradilla, E; Sevcenco, A; Shabetai, A; Shabratova, G; Shahoyan, R; Shangaraev, A; Sharma, N; Sharma, S; Shigaki, K; Shtejer, K; Sibiriak, Y; Siddhanta, S; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Singaraju, R; Singh, R; Singha, S; Singhal, V; Sinha, B C; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Skjerdal, K; Smakal, R; Smirnov, N; Snellings, R J M; Søgaard, C; Soltz, R; Song, J; Song, M; Soramel, F; Sorensen, S; Spacek, M; Sputowska, I; Spyropoulou-Stassinaki, M; Srivastava, B K; Stachel, J; Stan, I; Stefanek, G; Steinpreis, M; Stenlund, E; Steyn, G; Stiller, J H; Stocco, D; Stolpovskiy, M; Strmen, P; Suaide, A A P; Sugitate, T; Suire, C; Suleymanov, M; Sultanov, R; Šumbera, M; Susa, T; Symons, T J M; Szanto de Toledo, A; Szarka, I; Szczepankiewicz, A; Szymanski, M; Takahashi, J; Tangaro, M A; Tapia Takaki, J D; Tarantola Peloni, A; Tarazona Martinez, A; Tauro, A; Tejeda Muñoz, G; Telesca, A; Terrevoli, C; Thäder, J; Thomas, D; Tieulent, R; Timmins, A R; Toia, A; Torii, H; Trubnikov, V; Trzaska, W H; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ulery, J; Ullaland, K; Uras, A; Usai, G L; Vajzer, M; Vala, M; Valencia Palomo, L; Vallero, S; Vande Vyvre, P; Vannucci, L; Van Hoorne, J W; van Leeuwen, M; Vargas, A; Varma, R; Vasileiou, M; Vasiliev, A; Vechernin, V; Veldhoen, M; Velure, A; Venaruzzo, M; Vercellin, E; Vergara Limón, S; Vernet, R; Verweij, M; Vickovic, L; Viesti, G; Viinikainen, J; Vilakazi, Z; Villalobos Baillie, O; Vinogradov, A; Vinogradov, L; Vinogradov, Y; Virgili, T; Viyogi, Y P; Vodopyanov, A; Völkl, M A; Voloshin, K; Voloshin, S A; Volpe, G; von Haller, B; Vorobyev, I; Vranic, D; Vrláková, J; Vulpescu, B; Vyushin, A; Wagner, B; Wagner, J; Wagner, V; Wang, M; Wang, Y; Watanabe, D; Weber, M; Wessels, J P; Westerhoff, U; Wiechula, J; Wikne, J; Wilde, M; Wilk, G; Wilkinson, J; Williams, M C S; Windelband, B; Winn, M; Xiang, C; Yaldo, C G; Yamaguchi, Y; Yang, H; Yang, P; Yang, S; Yano, S; Yasnopolskiy, S; Yi, J; Yin, Z; Yoo, I-K; Yushmanov, I; Zaccolo, V; Zach, C; Zaman, A; Zampolli, C; Zaporozhets, S; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zgura, I S; Zhalov, M; Zhang, H; Zhang, X; Zhang, Y; Zhao, C; Zhigareva, N; Zhou, D; Zhou, F; Zhou, Y; Zhu, H; Zhu, J; Zhu, X; Zichichi, A; Zimmermann, A; Zimmermann, M B; Zinovjev, G; Zoccarato, Y; Zynovyev, M; Zyzak, M

    The inclusive production cross sections at forward rapidity of [Formula: see text], [Formula: see text], [Formula: see text](1S) and [Formula: see text](2S) are measured in [Formula: see text] collisions at [Formula: see text] with the ALICE detector at the LHC. The analysis is based on a data sample corresponding to an integrated luminosity of 1.35 pb[Formula: see text]. Quarkonia are reconstructed in the dimuon-decay channel and the signal yields are evaluated by fitting the [Formula: see text] invariant mass distributions. The differential production cross sections are measured as a function of the transverse momentum [Formula: see text] and rapidity [Formula: see text], over the ranges [Formula: see text] GeV/c for [Formula: see text], [Formula: see text] GeV/c for all other resonances and for [Formula: see text]. The measured cross sections integrated over [Formula: see text] and [Formula: see text], and assuming unpolarized quarkonia, are: [Formula: see text] [Formula: see text]b, [Formula: see text] [Formula: see text]b, [Formula: see text] nb and [Formula: see text] nb, where the first uncertainty is statistical and the second one is systematic. The results are compared to measurements performed by other LHC experiments and to theoretical models.

  1. Remedial actions at the former Vanadium Corporation of America uranium mill site, Durango, La Plata County, Colorado. Volume II. Appendices. Final Environmental Impact Statement

    International Nuclear Information System (INIS)

    1985-10-01

    Volume 2 contains the following: addendums to Appendices A - Conceptual Designs and Engineering Evaluations for Remedial Action Alternative 3b, D - Meteorological and Air-Quality Information, F - Water Resources Information, H - Radiological Information, I - Information on Populations, Socioeconomics, and Land Use; Appendix K - List of Agencies, Organizations, and Persons Receiving Copies of this Statement; Appendix L - Wildlife Mitigation Plan; Appendix M - Seismic Evaluation; Appendix N - Tourism Evaluation; and Appendix O - Permits, Licenses, and Approvals

  2. Survey of strong motion earthquake effects on thermal power plants in California with emphasis on piping systems. Volume 2, Appendices

    International Nuclear Information System (INIS)

    Stevenson, J.D.

    1995-11-01

    Volume 2 of the ''Survey of Strong Motion Earthquake Effects on Thermal Power Plants in California with Emphasis on Piping Systems'' contains Appendices which detail the detail design and seismic response of several power plants subjected to strong motion earthquakes. The particular plants considered include the Ormond Beach, Long Beach and Seal Beach, Burbank, El Centro, Glendale, Humboldt Bay, Kem Valley, Pasadena and Valley power plants. Included is a typical power plant piping specification and photographs of typical power plant piping specification and photographs of typical piping and support installations for the plants surveyed. Detailed piping support spacing data are also included

  3. A Novel Technique for Laparoscopic Salvage of CAPD Catheter Malfunction and Migration: The Santosh-PGI Hanging Loop Technique

    Directory of Open Access Journals (Sweden)

    Santosh Kumar

    2015-01-01

    Full Text Available CAPD catheter malfunction is a common problem. Obstruction due to wrapping by appendices epiploicae of sigmoid colon has been rarely reported in literature. We report a case of CAPD catheter malfunction caused by catheter tip migration and obstruction by appendices epiploicae that was successfully managed by laparoscopic hanging loop technique. This case report highlights the ease with which epiplopexy can be performed and catheter tip migration can be prevented by this innovative laparoscopic procedure.

  4. Probabilistic accident consequence uncertainty analysis: Dispersion and deposition uncertainty assessment, appendices A and B

    International Nuclear Information System (INIS)

    Harper, F.T.; Young, M.L.; Miller, L.A.; Hora, S.C.; Lui, C.H.; Goossens, L.H.J.; Cooke, R.M.; Paesler-Sauer, J.; Helton, J.C.

    1995-01-01

    The development of two new probabilistic accident consequence codes, MACCS and COSYMA, completed in 1990, estimate the risks presented by nuclear installations based on postulated frequencies and magnitudes of potential accidents. In 1991, the US Nuclear Regulatory Commission (NRC) and the Commission of the European Communities (CEC) began a joint uncertainty analysis of the two codes. The objective was to develop credible and traceable uncertainty distributions for the input variables of the codes. Expert elicitation, developed independently, was identified as the best technology available for developing a library of uncertainty distributions for the selected consequence parameters. The study was formulated jointly and was limited to the current code models and to physical quantities that could be measured in experiments. To validate the distributions generated for the wet deposition input variables, samples were taken from these distributions and propagated through the wet deposition code model along with the Gaussian plume model (GPM) implemented in the MACCS and COSYMA codes. Resulting distributions closely replicated the aggregated elicited wet deposition distributions. Project teams from the NRC and CEC cooperated successfully to develop and implement a unified process for the elaboration of uncertainty distributions on consequence code input parameters. Formal expert judgment elicitation proved valuable for synthesizing the best available information. Distributions on measurable atmospheric dispersion and deposition parameters were successfully elicited from experts involved in the many phenomenological areas of consequence analysis. This volume is the second of a three-volume document describing the project and contains two appendices describing the rationales for the dispersion and deposition data along with short biographies of the 16 experts who participated in the project

  5. Probabilistic accident consequence uncertainty analysis: Dispersion and deposition uncertainty assessment, appendices A and B

    Energy Technology Data Exchange (ETDEWEB)

    Harper, F.T.; Young, M.L.; Miller, L.A. [Sandia National Labs., Albuquerque, NM (United States); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States); Lui, C.H. [Nuclear Regulatory Commission, Washington, DC (United States); Goossens, L.H.J.; Cooke, R.M. [Delft Univ. of Technology (Netherlands); Paesler-Sauer, J. [Research Center, Karlsruhe (Germany); Helton, J.C. [and others

    1995-01-01

    The development of two new probabilistic accident consequence codes, MACCS and COSYMA, completed in 1990, estimate the risks presented by nuclear installations based on postulated frequencies and magnitudes of potential accidents. In 1991, the US Nuclear Regulatory Commission (NRC) and the Commission of the European Communities (CEC) began a joint uncertainty analysis of the two codes. The objective was to develop credible and traceable uncertainty distributions for the input variables of the codes. Expert elicitation, developed independently, was identified as the best technology available for developing a library of uncertainty distributions for the selected consequence parameters. The study was formulated jointly and was limited to the current code models and to physical quantities that could be measured in experiments. To validate the distributions generated for the wet deposition input variables, samples were taken from these distributions and propagated through the wet deposition code model along with the Gaussian plume model (GPM) implemented in the MACCS and COSYMA codes. Resulting distributions closely replicated the aggregated elicited wet deposition distributions. Project teams from the NRC and CEC cooperated successfully to develop and implement a unified process for the elaboration of uncertainty distributions on consequence code input parameters. Formal expert judgment elicitation proved valuable for synthesizing the best available information. Distributions on measurable atmospheric dispersion and deposition parameters were successfully elicited from experts involved in the many phenomenological areas of consequence analysis. This volume is the second of a three-volume document describing the project and contains two appendices describing the rationales for the dispersion and deposition data along with short biographies of the 16 experts who participated in the project.

  6. Invasive Mucinous Adenocarcinoma Associated with Adjacent Sessile Serrated Lesion of the Appendix Vermiform: A Case Report

    Directory of Open Access Journals (Sweden)

    Osamu Kinoshita

    2014-01-01

    Full Text Available Although the definition of sessile serrated lesion (SSL of colon is controversial and the risk of progression to malignancy is also under investigation at present, SSL is generally described as a polyp characterized by a serrated architecture. It is estimated to represent a feature of a new cancerization pathway, coined “serrated neoplasia pathway,” particularly in right-sided colon adenocarcinomas. On the other hand, in appendix, the role of this pathway remains uncertain, probably because very few cases of appendiceal adenocarcinoma associated with SSL were reported, and furthermore, immunohistochemical examination was rarely carried out. We herein report an interesting case of invasive appendiceal mucinous adenocarcinoma exhibiting SSL, which was pathologically estimated as a potential precursor lesion, and performed representative immunohistochemistry for both the mucinous adenocarcinoma and SSL in the same specimen. To further elucidate the progression of the appendiceal carcinoma from SSL, both an adequate sectioning of the lesion and systematic immunohistochemical examination of a large number of appendiceal carcinoma cases containing adjacent SSL would be required.

  7. Probing Aircraft Flight Test Hazard Mitigation for the Alternative Fuel Effects on Contrails and Cruise Emissions (ACCESS) Research Team . Volume 2; Appendices

    Science.gov (United States)

    Kelly, Michael J.

    2013-01-01

    The Alternative Fuel Effects on Contrails and Cruise Emissions (ACCESS) Project Integration Manager requested in July 2012 that the NASA Engineering and Safety Center (NESC) form a team to independently assess aircraft structural failure hazards associated with the ACCESS experiment and to identify potential flight test hazard mitigations to ensure flight safety. The ACCESS Project Integration Manager subsequently requested that the assessment scope be focused predominantly on structural failure risks to the aircraft empennage (horizontal and vertical tail). This report contains the Appendices to Volume I.

  8. In situ radionuclide migration studies in a shallow sand aquifer. Part. 1. Part. 2: appendices

    International Nuclear Information System (INIS)

    Williams, G.M.; Alexander, L.S.; Hitchman, S.P.; Hooker, P.J.; Noy, D.J.; Ross, C.A.M.; Stuart, A.; West, J.M.

    1986-01-01

    As a result of a study of the geology of the British Nuclear Fuels premises at Drigg, Cumbria, the British Geological Survey identified a shallow glacial sand deposit approximately 1.5m thick, interbedded between two clay horizons. An array of boreholes has been constructed in this sand in order to study the migration of radionuclides introduced into the formation under controlled conditions of groundwater flow. Conservative tracers used in the field test include chloride (as NaCl) and iodine-131 (as NaI). Strontium-85 (as the chloride) has been used as a chemically reactive tracer in conjunction with 131 I. The principal research objectives of the programme are as follows: (1) To undertake laboratory batch sorption experiments using core material from the field site in order to choose those nuclides of radiological interest that would migrate sufficiently quickly for their behaviour to be studied in a field experiment within a reasonable time period. (2) To identify and quantify the mechanisms for nuclide/sediment interaction by determination of the geochemical distribution of 85 Sr in contaminated cores using a sequential leaching procedure. (3) To obtain appropriate data on the hydraulic characteristics of the sand formation in order to construct a mathematical model to describe groundwater flow and reactive mass transport. Part 2 of this report contains the following appendices: (1) Calculation of sorption parameters. (2) A low-cost manifold system for use with multi-level samplers. (3) Radioactivity curves for 131 I and 85 Sr. (4) Results of particle size analysis for sand aquifers

  9. Archaelogical Excavations of the Gardens and Interior Areas of Houses B and C of the Southeast Row Houses Fort Michilimackinac, Michigan.

    Science.gov (United States)

    1981-08-01

    porcelain fragments recovered were Group I, Chinese Export Porcelain . No evidence of Group II, English Porcelain , was present. There were 40 fragments...earthenware, stoneware and porcelain . Distribution of colonial ceramics by unit and level appears in Appendices 2 31 and 3. Therefore, only classes and...unidentifiable fragments of stoneware. Similar to the earthenware, they were not identified because of being burned or too small. Class C Porcelain All

  10. Development and demonstration of surveillance and diagnostics of rotating machinery for reducing radiation exposure to nuclear power plant personnel: Appendices: Final report

    International Nuclear Information System (INIS)

    Allen, J.W.; Bohanick, J.S.

    1988-01-01

    This program was designed to reduce radiation exposure to power plant personnel resulting from inspection, maintenance, and repair of rotating equipment. The new rotating machinery monitoring system for this program was installed at GGNS during August 1983. The following nine appendices are presented: signals monitored at GGNS; definition of characterized spectral values; instructions for alignment and balance programs; machine diagrams; FFT program; software module descriptions; sample radiation survey forms used for exposure study; radiation exposure compared to other plants; and a technical section instruction for the vibration monitoring program at GGNS

  11. Text mining a self-report back-translation.

    Science.gov (United States)

    Blanch, Angel; Aluja, Anton

    2016-06-01

    There are several recommendations about the routine to undertake when back translating self-report instruments in cross-cultural research. However, text mining methods have been generally ignored within this field. This work describes a text mining innovative application useful to adapt a personality questionnaire to 12 different languages. The method is divided in 3 different stages, a descriptive analysis of the available back-translated instrument versions, a dissimilarity assessment between the source language instrument and the 12 back-translations, and an item assessment of item meaning equivalence. The suggested method contributes to improve the back-translation process of self-report instruments for cross-cultural research in 2 significant intertwined ways. First, it defines a systematic approach to the back translation issue, allowing for a more orderly and informed evaluation concerning the equivalence of different versions of the same instrument in different languages. Second, it provides more accurate instrument back-translations, which has direct implications for the reliability and validity of the instrument's test scores when used in different cultures/languages. In addition, this procedure can be extended to the back-translation of self-reports measuring psychological constructs in clinical assessment. Future research works could refine the suggested methodology and use additional available text mining tools. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  12. Environmental Assessment for the Tula Peak Road Intersection

    Science.gov (United States)

    2009-07-01

    Track. The result was a SABER project to modify the existing intersection. The proposed project (see map pg 3 and EPF 20080004 in appendices) was to...environmental clearance under 32 CFR 989.13. A second SABER project (see map on pg 3 and appendices EPF 20080433) took a more aggressive approach to...Outlook White Sands Missile Range Appendices A- Memo For Record from phone conversation RE: stop action of construction with NMDGF B- EPF 20080004 C

  13. A Response to Welch's Review of "Urihi A: A Terra‐Floresta Yanomami"

    Directory of Open Access Journals (Sweden)

    Hein van der Voort

    2010-12-01

    Full Text Available A Response to Welch's Review of Urihi A: A Terra‐Floresta Yanomami. Bruce Albert and William Milliken with Gale Goodwin Gomez. São Paulo: Instituto Socioambiental, 2009. 207 pp., illustrations, tables, bibliography, appendices, index. Paperback ISBN: 978‐85‐85994‐72‐3.

  14. Predictors of appendiceal perforation in an equal access system.

    Science.gov (United States)

    Walker, Avery; Hatch, Quinton; Drake, Thurston; Nelson, Daniel W; Fitzpatrick, Emilie; Bingham, Jason; Black, George; Maykel, Justin A; Steele, Scott R

    2014-07-01

    Discrepancies in socioeconomic factors have been associated with higher rates of perforated appendicitis. As an equal-access health care system theoretically removes these barriers, we aimed to determine if remaining differences in demographics, education, and pay result in disparate outcomes in the rate of perforated appendicitis. All patients undergoing appendectomy for acute appendicitis (November 2004-October 2009) at a tertiary care equal access institution were categorized by demographics and perioperative data. Rank of the sponsor was used as a surrogate for economic status. A multivariate logistic regression model was performed to determine patient and clinical characteristics associated with perforated appendicitis. A total of 680 patients (mean age 30±16 y; 37% female) were included. The majority were Caucasian (56.4% [n=384]; African Americans 5.6% [n=38]; Asians 1.9% [n=13]; and other 48.9% [n=245]) and enlisted (87.2%). Overall, 6.4% presented with perforation, with rates of 6.6%, 5.8%, and 6.7% (P=0.96) for officers, enlisted soldiers, and contractors, respectively. There was no difference in perforation when stratified by junior or senior status for either officers or enlisted (9.3% junior versus 4.40% senior officers, P=0.273; 6.60% junior versus 5.50% senior enlisted, P=0.369). On multivariate analysis, parameters such as leukocytosis and temperature, as well as race and rank were not associated with perforation (P=0.7). Only age had a correlation, with individuals aged 66-75 y having higher perforation rates (odds ratio, 1.04; 95% confidence interval, 1.02-1.05; P<0.001). In an equal-access health care system, older age, not socioeconomic factors, correlated with increased appendiceal perforation rates. Published by Elsevier Inc.

  15. Information needs for characterization of high-level waste repository sites in six geologic media. Volume 2. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1985-05-01

    Volume II contains appendices for the following: (1) remote sensing and surface mapping techniques; (2) subsurface mapping methods for site characterization; (3) gravity technique; (4) audio-frequency magnetotelluric technique; (5) seismic refraction technique; (6) direct-current electrical resistivity method; (7) magnetic technique; (8) seismic reflection technique; (9) seismic crosshole method; (10) mechanical downhole seismic velocity survey method; (11) borehole geophysical logging techniques; (12) drilling and coring methods for precharacterization studies; (13) subsurface drilling methods for site characterization; (14) geomechanical/thermomechanical techniques for precharacterization studies; (15)geomechanical/thermal techniques for site characterization studies; (16) exploratory geochemical techniques for precharacterization studies; (17) geochemical techniques for site characterization; (18) hydrologic techniques for precharacterization studies; (19) hydrologic techniques for site characterization; and (20) seismological techniques.

  16. Information needs for characterization of high-level waste repository sites in six geologic media. Volume 2. Appendices

    International Nuclear Information System (INIS)

    1985-05-01

    Volume II contains appendices for the following: (1) remote sensing and surface mapping techniques; (2) subsurface mapping methods for site characterization; (3) gravity technique; (4) audio-frequency magnetotelluric technique; (5) seismic refraction technique; (6) direct-current electrical resistivity method; (7) magnetic technique; (8) seismic reflection technique; (9) seismic crosshole method; (10) mechanical downhole seismic velocity survey method; (11) borehole geophysical logging techniques; (12) drilling and coring methods for precharacterization studies; (13) subsurface drilling methods for site characterization; (14) geomechanical/thermomechanical techniques for precharacterization studies; (15)geomechanical/thermal techniques for site characterization studies; (16) exploratory geochemical techniques for precharacterization studies; (17) geochemical techniques for site characterization; (18) hydrologic techniques for precharacterization studies; (19) hydrologic techniques for site characterization; and (20) seismological techniques

  17. Status report on the geology of the Lawrence Livermore National Laboratory site and adjacent areas. Volume I. Text and appendices A-E

    International Nuclear Information System (INIS)

    Carpenter, D.W.; Puchlik, K.P.; Ramirez, A.L.; Wagoner, J.L.; Knauss, K.G.; Kasameyer, P.W.

    1980-10-01

    In April, 1979, geoscience personnel at Lawrence Livermore National Laboratory (LLNL) initiated comprehensive geologic, seismologic, and hydrologic investigations of the LLNL site and nearby areas. These investigations have two objectives: 1. to obtain data for use in preparing a Final Environmental Impact Report for LLNL, pursuant to the National Environmental Policy Act; 2. to obtain data for use in improving the determination of a design basis earthquake for structural analysis of LLNL facilities. The first phases of these investigations have been completed. Work completed to date includes a comprehensive literature review, analyses of three sets of aerial photographs, reconnaissance geophysical surveys, examination of existing LLNL site borehole data, and the logging of seven exploratory trenches, segments of two sewer trenches, a deep building foundation excavation, a road cut, and an enlarged creek bank exposure. One absolute age date has been obtained by the 14 C method and several dates of pedogenic carbonate formation have been obtained by the 230 Th/ 234 U method. A seismic monitoring network has been established, and planning for a site hydrologic monitoring program and strong motion instrument network has been completed. The seismologic and hydrologic investigations are beyond the scope of this report and will be discussed separately in future documents

  18. Resource Conservation and Recovery Act: Part B Permit application. Volume 2, Chapter C, Appendix C1-Appendix C8

    International Nuclear Information System (INIS)

    1995-01-01

    Volume 2 contains appendices for the following: chemical compatibility analysis of waste forms and container materials; data accumulated from headspace-gas analyses; totals analysis versus toxicity characteristic leaching procedure; waste characterization sampling methods; applicability of real-time radiography; quality assurance objectives for waste characterization sampling and analytical methods; quality assurance project plan requirements; and Waste Isolation Pilot Plant generator/storage site waste screening and acceptance audit program

  19. Evolution of bayesian-related research over time: a temporal text mining task

    CSIR Research Space (South Africa)

    de Waal, A

    2006-06-01

    Full Text Available Ronald Reagan’s Radio Addresses? Bayesian Analysis 2006, Volume 1, Number 2, pp. 189-383. 2. Mei Q and Zhai C, 2005. Discovering Evolutionary Theme Patterns from Text – An Exploration of Temporal Text Mining. KDD’05, August 21-24, 2005. Chicago...

  20. SunLine Transit Agency Advanced Technology Fuel Cell Bus Evaluation: Second Results Report and Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Eudy, L.; Chandler, K.

    2011-10-01

    This report describes operations at SunLine Transit Agency for their newest prototype fuel cell bus and five compressed natural gas (CNG) buses. In May 2010, SunLine began operating its sixth-generation hydrogen fueled bus, an Advanced Technology (AT) fuel cell bus that incorporates the latest design improvements to reduce weight and increase reliability and performance. The agency is collaborating with the U.S. Department of Energy's (DOE) National Renewable Energy Laboratory (NREL) to evaluate the bus in revenue service. This is the second results report for the AT fuel cell bus since it was placed in service, and it focuses on the newest data analysis and lessons learned since the previous report. The appendices, referenced in the main report, provide the full background for the evaluation. They will be updated as new information is collected but will contain the original background material from the first report.

  1. Texts of joint USA-USSR statements following the summit meeting in Washington, D.C., 31 May - 3 June 1990

    International Nuclear Information System (INIS)

    1990-07-01

    The texts of joint USA-USSR statements following the summit meeting in Washington, D.C., 31 May - 3 June 1990 are reproduced. One is a joint statement on non-proliferation of nuclear weapons, missile and missile technology and chemical weapons, another one is a joint statement on the International Thermonuclear Experimental Reactor and the last one is a joint statement on Cooperation in Peaceful Uses of Atomic Energy

  2. Analysis of core damage frequency, Surry, Unit 1 internal events appendices

    International Nuclear Information System (INIS)

    Bertucio, R.C.; Julius, J.A.; Cramond, W.R.

    1990-04-01

    This document contains the appendices for the accident sequence analyses of internally initiated events for the Surry Nuclear Station, Unit 1. This is one of the five plant analyses conducted as part of the NUREG-1150 effort by the Nuclear Regulatory Commission. NUREG-1150 documents the risk of a selected group of nuclear power plants. The work performed is an extensive reanalysis of that published in November 1986 as NUREG/CR-4450, Volume 3. It addresses comments from numerous reviewers and significant changes to the plant systems and procedures made since the first report. The uncertainty analysis and presentation of results are also much improved. The context and detail of this report are directed toward PRA practitioners who need to know how the work was performed and the details for use in further studies. The mean core damage frequency at Surry was calculated to be 4.0E-5 per year, with a 95% upper bound of 1.3E-4 and 5% lower bound of 6.8E-6 per year. Station blackout type accidents (loss of all AC power) were the largest contributors to the core damage frequency, accounting for approximately 68% of the total. The next type of dominant contributors were Loss of Coolant Accidents (LOCAs). These sequences account for 15% of core damage frequency. No other type of sequence accounts for more than 10% of core damage frequency

  3. Associated production of $H(b\\bar b, c\\bar c)$ with a W or a Z in ATLAS

    CERN Document Server

    Nielsen, Jason; The ATLAS collaboration

    2018-01-01

    Results are presented from the ATLAS searches for Standard Model Higgs bosons decaying to a $b\\bar b$ or $c\\bar c$ pair, produced in association with a $W$ or $Z$ boson. The analyzed data correspond to $36.1\\,\\text{fb}^{-1}$ of $13\\,\\text{TeV}$ proton-proton collision data collected in Run 2 of the Large Hadron Collider. The combination of Run 1 and Run 2 data in the $b\\bar b$ channel yields a ratio of the measured production rate to the SM prediction equal to $0.90 \\pm 0.18\\ \\text{(stat.)}^{+0.21}_{-0.19}\\ \\text{(syst.)}$. The observed significance of $3.6\\sigma$ provides evidence for the direct $Hbb$ Yukawa coupling. A similar search for $c\\bar c$ decays results in an upper limit on the production cross section times branching ratio of $2.7\\,\\text{pb}$.

  4. State of the Art Report on Fracture Mechanics (Fracture in the Creep Range). Volume 3: Appendices H - M

    International Nuclear Information System (INIS)

    Ellison, E.G.; Musicco, G.G.; Pineau, A.

    1988-01-01

    A CEC State of the Art Report on Fracture Mechanics for Fast Breeder Reactors (Fracture below the Creep Range) has recently been published by Bhandari and coworkers (1984). There has also been a compilation of Creep Crack Growth Data from Germany, France and the U.K. for 304 and 316 stainles steel by Lloyd et al (1984). The present Report provides considerably more data and analytical techniques taken from Worldwide sources on creep crack initiation and propagation. Since the subject is moving quickly there is an emphasis on the most recent work; indeed research studies as yet unpublished are also included. The total Report is in 3 volumes. Volume 3 contains the most important and up-to-date information in some detail in Appendices H to M; this provides a sound base for the Report and for future workers

  5. Extension of the commercial agreement on water dispensers: appendices 1-4; Erweiterung der Branchenvereinbarung Wasserdispenser. Anhaenge 1-4

    Energy Technology Data Exchange (ETDEWEB)

    Grieder, T.; Huser, A.

    2006-07-01

    These appendices to a final report for the Swiss Federal Office of Energy (SFOE) present the results of work done within the framework of a voluntary agreement between the Federal Office of Energy and the four most important suppliers of bottled water dispensers in Switzerland. The first appendix lists water dispensers with water-mains connections and quotes figures on the number of units and their energy use. Two prognoses are presented for the year 2015, one with and one without any action being taken. The second appendix presents the German Gas and Water association's suggestion for standards, while the third appendix presents the hygiene regulations of the Swiss Department of Home Affairs. The fourth appendix presents the answer sent by the U.S.A's Environmental Protection Agency to an e-mail on the subject.

  6. Control of a resonant d.c.-link converter for a.c. motor drives

    Directory of Open Access Journals (Sweden)

    Astrid Petterteig

    1992-10-01

    Full Text Available This paper presents the control of the resonant d.c.-link converter for a.c. motor drives. This is a low loss converter with higher efficiency than a conventional PWM converter, but it requires complex control. It needs a special control of the resonant d.c.-link voltage in addition to the discrete control of the a.c. side currents. Simulations show how the control of the a.c. currents, the modulation principle, influences the overall performance of the converter.

  7. NASA Aerospace Flight Battery Program: Wet Life of Nickel-Hydrogen (Ni-H2) Batteries. Volume 2, Part 3; Appendices

    Science.gov (United States)

    Jung, David S,; Lee, Leonine S.; Manzo, Michelle A.

    2010-01-01

    This NASA Aerospace Flight Battery Systems Working Group was chartered within the NASA Engineering and Safety Center (NESC). The Battery Working Group was tasked to complete tasks and to propose proactive work to address battery related, agency-wide issues on an annual basis. In its first year of operation, this proactive program addressed various aspects of the validation and verification of aerospace battery systems for NASA missions. Studies were performed, issues were discussed and in many cases, test programs were executed to generate recommendations and guidelines to reduce risk associated with various aspects of implementing battery technology in the aerospace industry. This document contains Part 3 - Volume II Appendices to Part 3 - Volume I.

  8. VisualUrText: A Text Analytics Tool for Unstructured Textual Data

    Science.gov (United States)

    Zainol, Zuraini; Jaymes, Mohd T. H.; Nohuddin, Puteri N. E.

    2018-05-01

    The growing amount of unstructured text over Internet is tremendous. Text repositories come from Web 2.0, business intelligence and social networking applications. It is also believed that 80-90% of future growth data is available in the form of unstructured text databases that may potentially contain interesting patterns and trends. Text Mining is well known technique for discovering interesting patterns and trends which are non-trivial knowledge from massive unstructured text data. Text Mining covers multidisciplinary fields involving information retrieval (IR), text analysis, natural language processing (NLP), data mining, machine learning statistics and computational linguistics. This paper discusses the development of text analytics tool that is proficient in extracting, processing, analyzing the unstructured text data and visualizing cleaned text data into multiple forms such as Document Term Matrix (DTM), Frequency Graph, Network Analysis Graph, Word Cloud and Dendogram. This tool, VisualUrText, is developed to assist students and researchers for extracting interesting patterns and trends in document analyses.

  9. A Text Messaging Intervention to Support Option B+ in Kenya: A Qualitative Study.

    Science.gov (United States)

    Musoke, Pamela; Gakumo, C Ann; Abuogi, Lisa L; Akama, Eliud; Bukusi, Elizabeth; Helova, Anna; Nalwa, Wafula Z; Onono, Mariciannah; Spangler, Sydney A; Wanga, Iris; Turan, Janet M

    Key challenges in providing lifelong antiretroviral therapy (ART) to pregnant and breastfeeding women (Option B+) in sub-Saharan Africa include achieving long-term adherence and retention in care. One intervention that may help address these challenges is mobile text messaging. We evaluated the acceptability of a text messaging intervention to support women's ART adherence and retention in care in rural western Kenya. Forty in-depth interviews with 20 pregnant/postpartum women infected with HIV, their male partners, and four focus groups with 30 health care providers were conducted during September-November 2014. Data were coded and analyzed using thematic analysis. Findings revealed the following themes: (a) overall acceptability of the text messaging intervention; (b) proposed content of text messages; (c) format, timing, and language of text messages; and (d) potential challenges of the text messaging intervention. Findings were used to refine a text messaging intervention being evaluated at Kenyan study sites rolling out Option B+. Copyright © 2017 Association of Nurses in AIDS Care. Published by Elsevier Inc. All rights reserved.

  10. Text Mining in Organizational Research.

    Science.gov (United States)

    Kobayashi, Vladimer B; Mol, Stefan T; Berkers, Hannah A; Kismihók, Gábor; Den Hartog, Deanne N

    2018-07-01

    Despite the ubiquity of textual data, so far few researchers have applied text mining to answer organizational research questions. Text mining, which essentially entails a quantitative approach to the analysis of (usually) voluminous textual data, helps accelerate knowledge discovery by radically increasing the amount data that can be analyzed. This article aims to acquaint organizational researchers with the fundamental logic underpinning text mining, the analytical stages involved, and contemporary techniques that may be used to achieve different types of objectives. The specific analytical techniques reviewed are (a) dimensionality reduction, (b) distance and similarity computing, (c) clustering, (d) topic modeling, and (e) classification. We describe how text mining may extend contemporary organizational research by allowing the testing of existing or new research questions with data that are likely to be rich, contextualized, and ecologically valid. After an exploration of how evidence for the validity of text mining output may be generated, we conclude the article by illustrating the text mining process in a job analysis setting using a dataset composed of job vacancies.

  11. Data and methods for the assessment of the risks associated with the maritime transport of radioactive materials. Results of the SeaRAM program studies. Volume 2: Appendices

    International Nuclear Information System (INIS)

    Sprung, J.L.; Bespalko, S.J.; Kanipe, F.L.

    1998-05-01

    This report describes ship accident event trees, ship collision and ship fire frequencies, representative ships and shipping practices, a model of ship penetration depths during ship collisions, a ship fire spread model, cask to environment release fractions during ship collisions and fires, and illustrative consequence calculations. This report contains the following appendices: Appendix 1 -- Representative Ships and Shipping Practices; Appendix 2 -- Input Data for Minorsky Calculations; Appendix 3 -- Port Ship Speed Distribution; and Appendix 4 -- Cask-to-Environment Release Fractions

  12. Data and methods for the assessment of the risks associated with the maritime transport of radioactive materials: Results of the SeaRAM program studies. Volume 2 -- Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Sprung, J.L.; Bespalko, S.J.; Kanipe, F.L. [and others

    1998-05-01

    This report describes ship accident event trees, ship collision and ship fire frequencies, representative ships and shipping practices, a model of ship penetration depths during ship collisions, a ship fire spread model, cask to environment release fractions during ship collisions and fires, and illustrative consequence calculations. This report contains the following appendices: Appendix 1 -- Representative Ships and Shipping Practices; Appendix 2 -- Input Data for Minorsky Calculations; Appendix 3 -- Port Ship Speed Distribution; and Appendix 4 -- Cask-to-Environment Release Fractions.

  13. A Reply to van der Voort's Response to Welch's Review of "Urihi A: A Terra‐ Floresta Yanomami"

    Directory of Open Access Journals (Sweden)

    James R. Welch

    2011-02-01

    Full Text Available A Reply to van der Voort's Response to Welch's Review of Urihi A: A Terra‐ Floresta Yanomami. Bruce Albert and William Milliken with Gale Goodwin Gomez. São Paulo: Instituto Socioambiental, 2009. 207 pp., illustrations, tables, bibliography, appendices, index. Paperback ISBN: 978‐85 85994‐72‐3.

  14. Acoustic measurements of a full-scale rotor with four tip shapes. Volume 1: Text, appendices A and B

    Science.gov (United States)

    Mosher, M.

    1984-01-01

    A full-scale helicopter with four different blade-tip geometries was tested in the 40- by 80-foot wind tunnel at Ames Research Center. Performance, loads, and noise were measured. The four tip shapes tested were rectangular, tapered, swept, and swept-tapered. Noise measurements from that test are presented in the form of tables and plots. The noise data include measurements of the sound pressure level in dB, dBA, and tone-corrected PNdB, for all of the conditions tested. Detailed measurements, 1/3-octave spectra and time-histories for some selected data are included as well as plots of dBA as function of test condition. Some performance measurements are given to aid interpretation of the noise data.

  15. Application of SLIM-MAUD: A test of an interactive computer-based method for organizing expert assessment of human performance and reliability: Volume 2, Appendices

    International Nuclear Information System (INIS)

    Spettell, C.M.; Rosa, E.A.; Humphreys, P.C.; Embrey, D.E.

    1986-10-01

    The US Nuclear Regulatory Commission (NRC) has been conducting a multiyear research program to investigate different methods for using expert judgments to estimate human error probabilities (HEPs) in nuclear power plants. One of the methods investigated, derived from multi-attribute utility theory, is the Success Likelihood Index Methodolocy implemented through Multi-Attribute Utility Decomposition (SLIM-MAUD). This report describes a systematic test application of the SLIM-MAUD methodology. The test application is evaluated on the basis of three criteria: practicality, acceptability, and usefulness. Volume I of this report represents an overview of SLIM-MAUD, describes the procedures followed in the test application, and provides a summary of the results obtained. Volume II consists of technical appendices to support in detail the materials contained in Volume I, and the users' package of explicit procedures to be followed in implementing SLIM-MAUD. The results obtained in the test application provide support for the application of SLIM-MAUD to a wide variety of applications requiring estimates of human errors

  16. Probabilistic accident consequence uncertainty analysis -- Uncertainty assessment for deposited material and external doses. Volume 2: Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Goossens, L.H.J.; Kraan, B.C.P.; Cooke, R.M. [Delft Univ. of Technology (Netherlands); Boardman, J. [AEA Technology (United Kingdom); Jones, J.A. [National Radiological Protection Board (United Kingdom); Harper, F.T.; Young, M.L. [Sandia National Labs., Albuquerque, NM (United States); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    1997-12-01

    The development of two new probabilistic accident consequence codes, MACCS and COSYMA, was completed in 1990. These codes estimate the consequence from the accidental releases of radiological material from hypothesized accidents at nuclear installations. In 1991, the US Nuclear Regulatory Commission and the Commission of the European Communities began cosponsoring a joint uncertainty analysis of the two codes. The ultimate objective of this joint effort was to systematically develop credible and traceable uncertainty distributions for the respective code input variables. A formal expert judgment elicitation and evaluation process was identified as the best technology available for developing a library of uncertainty distributions for these consequence parameters. This report focuses on the results of the study to develop distribution for variables related to the MACCS and COSYMA deposited material and external dose models. This volume contains appendices that include (1) a summary of the MACCS and COSYMA consequence codes, (2) the elicitation questionnaires and case structures, (3) the rationales and results for the panel on deposited material and external doses, (4) short biographies of the experts, and (5) the aggregated results of their responses.

  17. PathText: a text mining integrator for biological pathway visualizations

    Science.gov (United States)

    Kemper, Brian; Matsuzaki, Takuya; Matsuoka, Yukiko; Tsuruoka, Yoshimasa; Kitano, Hiroaki; Ananiadou, Sophia; Tsujii, Jun'ichi

    2010-01-01

    Motivation: Metabolic and signaling pathways are an increasingly important part of organizing knowledge in systems biology. They serve to integrate collective interpretations of facts scattered throughout literature. Biologists construct a pathway by reading a large number of articles and interpreting them as a consistent network, but most of the models constructed currently lack direct links to those articles. Biologists who want to check the original articles have to spend substantial amounts of time to collect relevant articles and identify the sections relevant to the pathway. Furthermore, with the scientific literature expanding by several thousand papers per week, keeping a model relevant requires a continuous curation effort. In this article, we present a system designed to integrate a pathway visualizer, text mining systems and annotation tools into a seamless environment. This will enable biologists to freely move between parts of a pathway and relevant sections of articles, as well as identify relevant papers from large text bases. The system, PathText, is developed by Systems Biology Institute, Okinawa Institute of Science and Technology, National Centre for Text Mining (University of Manchester) and the University of Tokyo, and is being used by groups of biologists from these locations. Contact: brian@monrovian.com. PMID:20529930

  18. Design specifications for manufacturability of MCM-C multichip modules

    Energy Technology Data Exchange (ETDEWEB)

    Allen, C.; Blazek, R.; Desch, J.; Elarton, J.; Kautz, D.; Markley, D.; Morgenstern, H.; Stewart, R.; Warner, L.

    1995-06-01

    The scope of this document is to establish design guidelines for electronic circuitry packaged as multichip modules of the ceramic substrate variety, although many of these guidelines are applicable to other types of multichip modules. The guidelines begin with prerequisite information which must be developed between customer and designer of the multichip module. The core of the guidelines focuses on the many considerations that must be addressed during the multichip module design. The guidelines conclude with the resulting deliverables from the design which satisfy customer requirements and/or support the multichip module fabrication and testing processes. Considerable supporting information, checklists, and design constraints are captured in specific appendices and used as reference information in the main body text. Finally some real examples of multichip module design are presented.

  19. 24 CFR 200.925c - Model codes.

    Science.gov (United States)

    2010-04-01

    ... below. (1) Model Building Codes—(i) The BOCA National Building Code, 1993 Edition, The BOCA National..., Administration, for the Building, Plumbing and Mechanical Codes and the references to fire retardant treated wood... number 2 (Chapter 7) of the Building Code, but including the Appendices of the Code. Available from...

  20. Contribution of diffusion-weighted MR imaging in follow-up of inflammatory appendiceal mass: Preliminary results and review of the literature

    International Nuclear Information System (INIS)

    Özdemir, Oğuzhan; Metin, Yavuz; Metin, Nurgül Orhan; Küpeli, Ali; Kalcan, Süleyman; Taşçı, Filiz

    2016-01-01

    We aimed to search the contribution of diffusion-weighted imaging (DWI) in follow-up of patients with acute appendicitis associated inflammatory appendiceal mass (IAM). DWI was used as a monitoring imaging method to assess the response of medical treatment. 19 patients (mean age, 37+–13.1; age range, 19–69; M/F: 10/9), presented with clinical, laboratory and computed tomography (CT) findings suggestive of IAM were enrolled prospectively in this study. CT and DWI images were evaluated by two radiologists in consensus. b values 0, 500 and 1000 s/mm 2 were used, and DWI images were analysed both qualitatively and quantitatively. Laboratory parameters were C-reactive protein value and white blood cell count. During follow-up changes in the diameter of IMA and laboratory parameters were correlated with ADC values. Conservative treatment with interval appendectomy and a total conservative approach without surgery were the treatment options during follow-up. We found statistically significant correlation between the ADC values, maximum IAM diameter and laboratory parameters. During follow-up five surgical procedures were performed: one patient underwent surgery for cecal adenocarcinoma and four underwent interval appendectomy. One patient developed acute relapse of IAM at the sixth month of follow-up. DWI may be used with a significant success for follow-up of patients with IAM. As a monitoring imaging method, DWI may also aid in determining of most appropriate timing for interval appendectomy as well as may help in diagnosing alternative diagnoses (e.g. malignancy and inflammatory bowel disease) that can mimic IAM

  1. Appendiceal goblet cell carcinoids and adenocarcinomas ex-goblet cell carcinoid are genetically distinct from primary colorectal-type adenocarcinoma of the appendix

    DEFF Research Database (Denmark)

    Jesinghaus, Moritz; Konukiewitz, Björn; Foersch, Sebastian

    2018-01-01

    The appendix gives rise to goblet cell carcinoids, which represent special carcinomas with distinct biological and histological features. Their genetic background and molecular relationship to colorectal adenocarcinoma is largely unknown. We therefore performed a next-generation sequencing analysis...... a morphomolecular entity, histologically and genetically distinct from appendiceal colorectal-type adenocarcinomas and its colorectal counterparts. Altered Wnt-signaling associated genes, apart from APC, may act as potential drivers of these neoplasms. The absence of KRAS/NRAS mutations might render some....../adenocarcinoma ex-goblet cell carcinoid (n=2, respectively). Mutations in colorectal cancer-related genes (eg, TP53, KRAS, APC) were rare to absent in both, goblet cell carcinoids and adenocarcinomas ex-goblet cell carcinoid, but frequent in primary colorectal-type adenocarcinomas of the appendix. Additional large...

  2. FMG, RENUM, LINEL, ELLFMG, ELLP and DIMES: Chain of programs for calculating and analyzing fluid flow through two-dimensional fracture networks: Users manuals and listings

    International Nuclear Information System (INIS)

    Billaux, D.; Peterson, J.; Bodea, S.; Long, J.

    1989-01-01

    The purpose of this report is to provide the user with sufficient information to run the programs FMG, RENUM, LINEL, and ELLFMG. A previous report explained the theory and the design of these programs, so that by using the two reports, a thorough understanding of the codes is possible. This report should familiarize the user with program options and modes of operation, input variables, input and output files. Information not strictly needed to run the programs, but useful in understanding their internal structure is provided in appendices. The appendices cover program variables and arrays, subroutine outlines, a short description of each subroutine, and finally listings of codes. The additional information on FMG, RENUM, LINEL, and ELLFMG is in Appendices A, C, E, G respectively, and the listings are in Appendices B, D, F, and H

  3. Barza, a Farm Radio International Initiative Appendices

    International Development Research Centre (IDRC) Digital Library (Canada)

    Below you can fill out your own Barza Post/Resource to be added to the site. Follow the instructions below and the content will be uploaded and you will be redirected to the post after submission. Featured Image. Upload Image. Post Title *. Post Content *. 95 Add Media. Visual. Text. X. B. I y. 4G ADC. = = = = = 2. Path: P.

  4. Greater-than-Class C low-level waste characterization. Appendix G: Evaluation of potential for greater-than-Class C classification of irradiated hardware generated by utility-operated reactors

    International Nuclear Information System (INIS)

    Cline, J.E.

    1991-08-01

    This study compiles and evaluates data from many sources to expand a base of data from which to estimate the activity concentrations and volumes of greater-than-Class C low-level waste that the Department of Energy will receive from the commercial power industry. Sources of these data include measurements of irradiated hardware made by or for the utilities that was classified for disposal in commercial burial sites, measurements of neutron flux in the appropriate regions of the reactor pressure vessel, analyses of elemental constituents of the particular structural material used for the components, and the activation analysis calculations done for hardware. Evaluations include results and assumptions in the activation analyses. Sections of this report and the appendices present interpretation of data and the classification definitions and requirements

  5. Final environmental impact statement. Management of commercially generated radioactive waste. Volume 2. Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1980-10-01

    This EIS analyzes the significant environmental impacts that could occur if various technologies for management and disposal of high-level and transuranic wastes from commercial nuclear power reactors were to be developed and implemented. This EIS will serve as the environmental input for the decision on which technology, or technologies, will be emphasized in further research and development activities in the commercial waste management program. The action proposed in this EIS is to (1) adopt a national strategy to develop mined geologic repositories for disposal of commercially generated high-level and transuranic radioactive waste (while continuing to examine subseabed and very deep hole disposal as potential backup technologies) and (2) conduct a R and D program to develop such facilities and the necessary technology to ensure the safe long-term containment and isolation of these wastes. The Department has considered in this statement: development of conventionally mined deep geologic repositories for disposal of spent fuel from nuclear power reactors and/or radioactive fuel reprocessing wastes; balanced development of several alternative disposal methods; and no waste disposal action. This volume contains appendices of supplementary data on waste management systems, geologic disposal, radiological standards, radiation dose calculation models, related health effects, baseline ecology, socio-economic conditions, hazard indices, comparison of defense and commercial wastes, design considerations, and wastes from thorium-based fuel cycle alternatives. (DMC)

  6. Final environmental impact statement. Management of commercially generated radioactive waste. Volume 2. Appendices

    International Nuclear Information System (INIS)

    1980-10-01

    This EIS analyzes the significant environmental impacts that could occur if various technologies for management and disposal of high-level and transuranic wastes from commercial nuclear power reactors were to be developed and implemented. This EIS will serve as the environmental input for the decision on which technology, or technologies, will be emphasized in further research and development activities in the commercial waste management program. The action proposed in this EIS is to (1) adopt a national strategy to develop mined geologic repositories for disposal of commercially generated high-level and transuranic radioactive waste (while continuing to examine subseabed and very deep hole disposal as potential backup technologies) and (2) conduct a R and D program to develop such facilities and the necessary technology to ensure the safe long-term containment and isolation of these wastes. The Department has considered in this statement: development of conventionally mined deep geologic repositories for disposal of spent fuel from nuclear power reactors and/or radioactive fuel reprocessing wastes; balanced development of several alternative disposal methods; and no waste disposal action. This volume contains appendices of supplementary data on waste management systems, geologic disposal, radiological standards, radiation dose calculation models, related health effects, baseline ecology, socio-economic conditions, hazard indices, comparison of defense and commercial wastes, design considerations, and wastes from thorium-based fuel cycle alternatives

  7. Inventory of clayey and marly formations in France and update of knowledge on the Albian in Aube. Final report. Volume 1: Report. Volume 2: Appendices

    International Nuclear Information System (INIS)

    2008-01-01

    In the context of searching a site for a storage centre for low level and long life radioactive wastes, this voluminous document reports geological studies on soils presenting the most favourable geological and hydro-geological criteria to retain radionuclides. The locations, characteristics, variability, geology, hydro-geology, and environmental constraints of various and precisely identified clayey or marly formations of the Paris basin and of the Aquitaine basin are analysed and reported in detail. Some additional results of investigations of the Albian site in the Aube district are also reported. The appendices contain information, data and analysis concerning the different French regions

  8. Analysis of core damage frequency: Peach Bottom, Unit 2 internal events appendices

    International Nuclear Information System (INIS)

    Kolaczkowski, A.M.; Cramond, W.R.; Sype, T.T.; Maloney, K.J.; Wheeler, T.A.; Daniel, S.L.

    1989-08-01

    This document contains the appendices for the accident sequence analysis of internally initiated events for the Peach Bottom, Unit 2 Nuclear Power Plant. This is one of the five plant analyses conducted as part of the NUREG-1150 effort for the Nuclear Regulatory Commission. The work performed and described here is an extensive reanalysis of that published in October 1986 as NUREG/CR-4550, Volume 4. It addresses comments from numerous reviewers and significant changes to the plant systems and procedures made since the first report. The uncertainty analysis and presentation of results are also much improved, and considerable effort was expended on an improved analysis of loss of offsite power. The content and detail of this report is directed toward PRA practitioners who need to know how the work was done and the details for use in further studies. The mean core damage frequency is 4.5E-6 with 5% and 95% uncertainty bounds of 3.5E-7 and 1.3E-5, respectively. Station blackout type accidents (loss of all ac power) contributed about 46% of the core damage frequency with Anticipated Transient Without Scram (ATWS) accidents contributing another 42%. The numerical results are driven by loss of offsite power, transients with the power conversion system initially available operator errors, and mechanical failure to scram. 13 refs., 345 figs., 171 tabs

  9. Joint Peru/United States report on Peru/United States cooperative energy assessment. Volume 1. Executive summary, main report and appendices

    Energy Technology Data Exchange (ETDEWEB)

    1979-08-01

    In 1978, the US and Peru conducted a comprehensive assessment of Peru's energy resources, needs, and uses and developed several alternative energy strategies that utilize the available resources to meet their energy requirements. This Volume I reports the findings of the assessment and contains the executive summary, the main report, and five appendices of information that support the integrated energy supply and demand analysis. The following chapters are included: The Energy Situation in Peru (economic context and background, energy resources and production, energy consumption patterns); Reference Supply and Demand Projection (approach, procedures, and assumptions; economic projections; energy demand and supply projections; supply/demand integration; uncertainties); and The Development of Strategies and Options (the analysis of options; strategies; increased use of renewables, hydropower, coal; increased energy efficiency; and financial analysis of strategies).

  10. Design verification and fabrication of active control systems for the DAST ARW-2 high aspect ratio wing. Part 2: Appendices

    Science.gov (United States)

    Mcgehee, C. R.

    1986-01-01

    This is Part 2-Appendices of a study conducted under Drones for Aerodynamic and Structural Testing (DAST) Program to accomplish the final design and hardware fabrication for four active control systems compatible with and ready for installation in the NASA Aeroelastic Research Wing No. 2 (ARW-2) and Firebee II drone flight test vehicle. The wing structure was designed so that Active Control Systems (ACS) are required in the normal flight envelope by integrating control system design with aerodynamics and structure technologies. The DAST ARW-2 configuration uses flutter suppression, relaxed static stability, and gust and maneuver load alleviation ACS systems, and an automatic flight control system. Performance goals and criteria were applied to individual systems and the systems collectively to assure that vehicle stability margins, flutter margins, flying qualities, and load reductions were achieved.

  11. Foothills Parkway Section 8B Final Environmental Report, Volume 4, Appendices E-I

    Energy Technology Data Exchange (ETDEWEB)

    Blasing, T.J.; Cada, G.F.; Carer, M.; Chin, S.M.; Dickerman, J.A.; Etnier, D.A.; Gibson, R.; Harvey, M.; Hatcher, B.; Lietzske, D.; Mann, L.K.; Mulholland, P.J.; Petrich, C.H.; Pounds, L.; Ranney, J.; Reed, R.M.; Ryan, P.F.; Schweitzer, M.; Smith, D.; Thomason, P.; Wade, M.C.

    1999-07-01

    In 1994, Oak Ridge National Laboratory (ORNL) was tasked by the National Park Service (NPS) to prepare an Environmental Report (ER) for Section 8B of the Foothills Parkway in the Great Smoky Mountains National Park (GSMNP). Section 8B represents 27.7 km (14.2 miles) of a total of 115 km (72 miles) of the planned Foothills Parkway and would connect the Cosby community on the east to the incorporated town of Pittman Center to the west. The major deliverables for the project are listed. From August 1995 through October 1996, NPS, GSMNP, and ORNL staff interacted with Federal Highway Administration staff to develop a conceptual design plan for Section 8B with the intent of protecting critical, resources identified during the ER process to the extent possible. In addition, ORNL arranged for bioengineering experts to discuss techniques that might be employed on Section 8B with NPS, GSMNP, and ORNL staff during September 1996. For the purposes of this ER, there are two basic alternatives under consideration: (1) a build alternative and (2) a no-build alternative. Within the build alternative are a number of options including constructing Section 8B with no interchanges, constructing Section 8B with an interchange at SR 416 or U.S. 321, constructing Section 8B with a spur road on Webb Mountain, and considering operation of Section 8B both before and after the operation of Section 8C. The no-build alternative is considered the no-action alternative and is not to construct Section 8B. This volume of the ER consists of Appendices E through I (all ecological survey reports), which are summarized individually in the sections that follow. The following conclusions result from the completion of these surveys and the ER impact analysis: (1) Forest clearing should be limited as much as possible; (2) Disturbed areas should be replanted with native trees; (3) Drainages should be bridged rather than leveled with cut and fill; (4) For areas of steep slopes and potential erosion

  12. Tumor do apêndice vermiforme

    Directory of Open Access Journals (Sweden)

    Ascêncio Garcia Lopes Júnior

    Full Text Available Appendiceal tumors are rare and usually presented as acute appendicitis. They are incidentally discovered at an emergency surgery, in which case the decision-making is very difficult. The purpose of this report is discuss to the most appropriate management for appendiceal tumors. A retrospective analysis of one case treated at HU-UEL was undertaken and the literature was reviewed. The conclusion is that frozen section should be done whenever the appendiceal findings are atypical. For appendiceal carcinoids greater than 2 cm and adenocarcinomas, a right hemicolectomy is recommended. Appendectomy is apropriate for patients whose carcinoid tumors are 1 cm in diameter or less and for carcinoid tumors between 1 cm and 2 cm without extensive lymphatic permeation and mesenteric invasion. Every case should be searched for synchronous tumors.

  13. Draft Programmatic Environmental Impact Statement for alternative strategies for the long-term management and use of depleted uranium hexafluoride. Volume 2: Appendices

    International Nuclear Information System (INIS)

    1997-12-01

    This PEIS assesses the potential impacts of alternative management of alternative management strategies for depleted uranium hexafluoride (UF 6 ) currently stored at three DOE sites: Paducah site near Paducah, Kentucky; Portsmouth site near Portsmouth, Ohio; and K-25 site on the Oak Ridge Reservation, Oak Ridge, Tennessee. The alternatives analyzed in the PEIS include no action, long-term storage as UF 6 , long-term storage as uranium oxide, use as uranium oxide, use as uranium metal, and disposal. The preferred alternative for the long-term management of depleted UF 6 is to use the entire inventory of material. This volume contains the appendices to volume I

  14. Interim report on task 1.2: near equilibrium processing requirements part 2 of 2 appendices to Lawrence Livermore National Laboratory for contract b345772

    International Nuclear Information System (INIS)

    Stewart, M W A; Vance, E R; Day, R A; Brownscombe, A

    1999-01-01

    Ten appendices are included: Appendix A - Copies of fabrication work instructions, consisting mostly of micrographs; Appendix B - X-ray diffraction results of the samples from task 2, which contains a list of the raw data files; Appendix C - Scanning electron micrographs and energy dispersive x-ray spectrometry results for samples of composition B1-2 - Th/U-doped baseline ceramic; Appendix D - Scanning electron micrographs and energy dispersive x-ray spectrometry results for samples of composition B1-4 - TH/U-doped baseline + impurities ceramic; Appendix E - Scanning electron micrographs and energy dispersive x-ray spectrometry results for samples of composition B1-10 - Th/U-doped zirconolite-rich ceramic; Appendix F - Scanning electron micrographs and energy dispersive x-ray spectrometry results for samples of composition B1-12 - Th/U-doped brannerite-rich ceramic; Appendix G - Scanning electron micrographs and energy dispersive x-ray spectrometry results for samples of composition B1-14 - Th/U-doped, nominally ∼ 10 % perovskite ceramic; Appendix H - Scanning eleCtron micrographs and energy dispersive x-ray spectrometry results for samples of composition B1-16 - Th/U-doped, nominally ∼ 10 % phosphate ceramic; Appendix I - Scanning electron micrographs and energy dispersive x-ray spectrometry results for the plutonium-doped samples; and Appendix J - Scanning electron micrographs and energy dispersive x-ray spectrometry results of samples sintered in 3.7 % hydrogen in argon

  15. Primary Adenocarcinoma of the Vermiform Appendix. A Case Report

    Directory of Open Access Journals (Sweden)

    Luis Antonio Revuelta Pérez

    2014-11-01

    Full Text Available Primary adenocarcinoma of the vermiform appendix is the least common carcinoma of this organ; its exact frequency is unknown. Primary malignant tumors of the appendix are rare; they are generally found in 1 to 2% of all appendices examined. Most appendiceal malignancies arise from a primary tumor in the adjacent organs, and in some cases, may be metastases from distant tumors. The case of a 43-year-old patient with a history of emergency surgery who was presumptively diagnosed with acute appendicitis is presented. The presence of an adenocarcinoma at the base of the appendix was reported by the pathology department. Because of the rarity of the condition, the publication of this case is considered scientifically important.

  16. Final programmatic environmental impact statement for alternative strategies for the long-term management and use of depleted uranium hexafluoride. Volume 2: Appendices

    International Nuclear Information System (INIS)

    1999-04-01

    This PEIS assesses the potential impacts of alternative management strategies for depleted uranium hexafluoride (UF 6 ) currently stored at three DOE sites: Paducah site near Paducah, Kentucky, Portsmouth site near Portsmouth, Ohio; and K-25 site on the Oak Ridge Reservation, Oak Ridge, Tennessee. The alternatives analyzed in the PEIS include no action, long-term storage as UF 6 , long-term storage as uranium oxide, use as uranium oxide, use as uranium metal, and disposal. DOE's preferred alternative is to begin conversion of the depleted UF 6 inventory as soon as possible, either to uranium oxide, uranium metal, or a combination of both, while allowing for use of as much of this inventory as possible. This volume contains Appendices A--O

  17. Radioprotection and radiotherapy: new regulatory texts

    International Nuclear Information System (INIS)

    Cosset, J.M.

    1998-01-01

    This article reviews about radiation protection of the workers in the radiotherapy centers. The different texts are explained. These texts (international and european ones) have to aim to reinforce the protection of personnel working in radiotherapy services, to reduce as it is possible the determinists an stochastic effects to organs out of the irradiated volumes, to avoid severe accidents. The radiotherapists have to keep in their mind that treatments must be justified in a clear way and optimized as reasonably achievable. (N.C.)

  18. Resource Conservation and Recovery Act, Part B Permit Application [for the Waste Isolation Pilot Plant (WIPP)]. Volume 2, Chapter C, Appendix C1--Chapter C, Appendix C3 (beginning), Revision 3

    Energy Technology Data Exchange (ETDEWEB)

    1993-03-01

    This volume contains appendices for the following: Rocky Flats Plant and Idaho National Engineering Laboratory waste process information; TRUPACT-II content codes (TRUCON); TRUPACT-II chemical list; chemical compatibility analysis for Rocky Flats Plant waste forms; chemical compatibility analysis for waste forms across all sites; TRU mixed waste characterization database; hazardous constituents of Rocky Flats Transuranic waste; summary of waste components in TRU waste sampling program at INEL; TRU waste sampling program; and waste analysis data.

  19. Review guidelines for software languages for use in nuclear power plant safety systems: Final report. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, M.; Decker, D.; Graff, S.; Green, W.; Lin, D.; Dinsmore, G.; Koch, S. [SoHaR, Inc., Beverly Hills, CA (United States)

    1997-10-01

    Guidelines for the programming and auditing of software written in high level languages for safety systems are presented. The guidelines are derived from a framework of issues significant to software safety which was gathered from relevant standards and research literature. Language-specific adaptations of these guidelines are provided for the following high level languages: Ada83 and Ada95; C and C++; International Electrochemical Commission (IEC) Standard 1131-3 Ladder Logic, Sequential Function Charts, Structured Text, and Function Block Diagrams; Pascal; and PL/M. Appendices to the report include a tabular summary of the guidelines and additional information on selected languages.

  20. Review guidelines for software languages for use in nuclear power plant safety systems: Final report. Revision 1

    International Nuclear Information System (INIS)

    Hecht, M.; Decker, D.; Graff, S.; Green, W.; Lin, D.; Dinsmore, G.; Koch, S.

    1997-10-01

    Guidelines for the programming and auditing of software written in high level languages for safety systems are presented. The guidelines are derived from a framework of issues significant to software safety which was gathered from relevant standards and research literature. Language-specific adaptations of these guidelines are provided for the following high level languages: Ada83 and Ada95; C and C++; International Electrochemical Commission (IEC) Standard 1131-3 Ladder Logic, Sequential Function Charts, Structured Text, and Function Block Diagrams; Pascal; and PL/M. Appendices to the report include a tabular summary of the guidelines and additional information on selected languages

  1. Production of [Formula: see text] and [Formula: see text] mesons up to high transverse momentum in pp collisions at 2.76 TeV.

    Science.gov (United States)

    Acharya, S; Adamová, D; Aggarwal, M M; Rinella, G Aglieri; Agnello, M; Agrawal, N; Ahammed, Z; Ahmad, N; Ahn, S U; Aiola, S; Akindinov, A; Alam, S N; Albuquerque, D S D; Aleksandrov, D; Alessandro, B; Alexandre, D; Molina, R Alfaro; Alici, A; Alkin, A; Alme, J; Alt, T; Altsybeev, I; Prado, C Alves Garcia; An, M; Andrei, C; Andrews, H A; Andronic, A; Anguelov, V; Anson, C; Antičić, T; Antinori, F; Antonioli, P; Anwar, R; Aphecetche, L; Appelshäuser, H; Arcelli, S; Arnaldi, R; Arnold, O W; Arsene, I C; Arslandok, M; Audurier, B; Augustinus, A; Averbeck, R; Awes, T; Azmi, M D; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Baldisseri, A; Ball, M; Baral, R C; Barbano, A M; Barbera, R; Barile, F; Barioglio, L; Barnaföldi, G G; Barnby, L S; Barret, V; Bartalini, P; Barth, K; Bartke, J; Bartsch, E; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Camejo, A Batista; Batyunya, B; Batzing, P C; Bearden, I G; Beck, H; Bedda, C; Behera, N K; Belikov, I; Bellini, F; Martinez, H Bello; Bellwied, R; Beltran, L G E; Belyaev, V; Bencedi, G; Beole, S; Bercuci, A; Berdnikov, Y; Berenyi, D; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhat, I R; Bhati, A K; Bhattacharjee, B; Bhom, J; Bianchi, L; Bianchi, N; Bianchin, C; Bielčík, J; Bielčíková, J; Bilandzic, A; Biro, G; Biswas, R; Biswas, S; Blair, J T; Blau, D; Blume, C; Boca, G; Bock, F; Bogdanov, A; Boldizsár, L; Bombara, M; Bonomi, G; Bonora, M; Book, J; Borel, H; Borissov, A; Borri, M; Botta, E; Bourjau, C; Braun-Munzinger, P; Bregant, M; Broker, T A; Browning, T A; Broz, M; Brucken, E J; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buhler, P; Buitron, S A I; Buncic, P; Busch, O; Buthelezi, Z; Butt, J B; Buxton, J T; Cabala, J; Caffarri, D; Caines, H; Caliva, A; Villar, E Calvo; Camerini, P; Capon, A A; Carena, F; Carena, W; Carnesecchi, F; Castellanos, J Castillo; Castro, A J; Casula, E A R; Sanchez, C Ceballos; Cerello, P; Chang, B; Chapeland, S; Chartier, M; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Chauvin, A; Cherney, M; Cheshkov, C; Cheynis, B; Barroso, V Chibante; Chinellato, D D; Cho, S; Chochula, P; Choi, K; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Concas, M; Balbastre, G Conesa; Valle, Z Conesa Del; Connors, M E; Contreras, J G; Cormier, T M; Morales, Y Corrales; Maldonado, I Cortés; Cortese, P; Cosentino, M R; Costa, F; Costanza, S; Crkovská, J; Crochet, P; Cuautle, E; Cunqueiro, L; Dahms, T; Dainese, A; Danisch, M C; Danu, A; Das, D; Das, I; Das, S; Dash, A; Dash, S; De, S; De Caro, A; de Cataldo, G; de Conti, C; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; De Souza, R D; Degenhardt, H F; Deisting, A; Deloff, A; Deplano, C; Dhankher, P; Di Bari, D; Di Mauro, A; Di Nezza, P; Di Ruzza, B; Corchero, M A Diaz; Dietel, T; Dillenseger, P; Divià, R; Djuvsland, Ø; Dobrin, A; Gimenez, D Domenicis; Dönigus, B; Dordic, O; Drozhzhova, T; Dubey, A K; Dubla, A; Ducroux, L; Duggal, A K; Dupieux, P; Ehlers, R J; Elia, D; Endress, E; Engel, H; Epple, E; Erazmus, B; Erhardt, F; Espagnon, B; Esumi, S; Eulisse, G; Eum, J; Evans, D; Evdokimov, S; Fabbietti, L; Faivre, J; Fantoni, A; Fasel, M; Feldkamp, L; Feliciello, A; Feofilov, G; Ferencei, J; Téllez, A Fernández; Ferreiro, E G; Ferretti, A; Festanti, A; Feuillard, V J G; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Francisco, A; Frankenfeld, U; Fronze, G G; Fuchs, U; Furget, C; Furs, A; Girard, M Fusco; Gaardhøje, J J; Gagliardi, M; Gago, A M; Gajdosova, K; Gallio, M; Galvan, C D; Ganoti, P; Gao, C; Garabatos, C; Garcia-Solis, E; Garg, K; Garg, P; Gargiulo, C; Gasik, P; Gauger, E F; Ducati, M B Gay; Germain, M; Ghosh, P; Ghosh, S K; Gianotti, P; Giubellino, P; Giubilato, P; Gladysz-Dziadus, E; Glässel, P; Coral, D M Goméz; Ramirez, A Gomez; Gonzalez, A S; Gonzalez, V; González-Zamora, P; Gorbunov, S; Görlich, L; Gotovac, S; Grabski, V; Graczykowski, L K; Graham, K L; Greiner, L; Grelli, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grion, N; Gronefeld, J M; Grosa, F; Grosse-Oetringhaus, J F; Grosso, R; Gruber, L; Grull, F R; Guber, F; Guernane, R; Guerzoni, B; Gulbrandsen, K; Gunji, T; Gupta, A; Gupta, R; Guzman, I B; Haake, R; Hadjidakis, C; Hamagaki, H; Hamar, G; Hamon, J C; Harris, J W; Harton, A; Hatzifotiadou, D; Hayashi, S; Heckel, S T; Hellbär, E; Helstrup, H; Herghelegiu, A; Corral, G Herrera; Herrmann, F; Hess, B A; Hetland, K F; Hillemanns, H; Hippolyte, B; Hladky, J; Hohlweger, B; Horak, D; Hornung, S; Hosokawa, R; Hristov, P; Hughes, C; Humanic, T J; Hussain, N; Hussain, T; Hutter, D; Hwang, D S; Ilkaev, R; Inaba, M; Ippolitov, M; Irfan, M; Isakov, V; Ivanov, M; Ivanov, V; Izucheev, V; Jacak, B; Jacazio, N; Jacobs, P M; Jadhav, M B; Jadlovska, S; Jadlovsky, J; Jaelani, S; Jahnke, C; Jakubowska, M J; Janik, M A; Jayarathna, P H S Y; Jena, C; Jena, S; Jercic, M; Bustamante, R T Jimenez; Jones, P G; Jusko, A; Kalinak, P; Kalweit, A; Kamin, J; Kang, J H; Kaplin, V; Kar, S; Uysal, A Karasu; Karavichev, O; Karavicheva, T; Karayan, L; Karpechev, E; Kebschull, U; Keidel, R; Keijdener, D L D; Keil, M; Ketzer, B; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Khatun, A; Khuntia, A; Kielbowicz, M M; Kileng, B; Kim, D; Kim, D W; Kim, D J; Kim, H; Kim, J S; Kim, J; Kim, M; Kim, M; Kim, S; Kim, T; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, C; Klein, J; Klein-Bösing, C; Klewin, S; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Kofarago, M; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Kondratyuk, E; Konevskikh, A; Kopcik, M; Kour, M; Kouzinopoulos, C; Kovalenko, O; Kovalenko, V; Kowalski, M; Meethaleveedu, G Koyithatta; Králik, I; Kravčáková, A; Krivda, M; Krizek, F; Kryshen, E; Krzewicki, M; Kubera, A M; Kučera, V; Kuhn, C; Kuijer, P G; Kumar, A; Kumar, J; Kumar, L; Kumar, S; Kundu, S; Kurashvili, P; Kurepin, A; Kurepin, A B; Kuryakin, A; Kushpil, S; Kweon, M J; Kwon, Y; La Pointe, S L; La Rocca, P; Fernandes, C Lagana; Lakomov, I; Langoy, R; Lapidus, K; Lara, C; Lardeux, A; Lattuca, A; Laudi, E; Lavicka, R; Lazaridis, L; Lea, R; Leardini, L; Lee, S; Lehas, F; Lehner, S; Lehrbach, J; Lemmon, R C; Lenti, V; Leogrande, E; Monzón, I León; Lévai, P; Li, S; Li, X; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Litichevskyi, V; Ljunggren, H M; Llope, W J; Lodato, D F; Loenne, P I; Loginov, V; Loizides, C; Loncar, P; Lopez, X; Torres, E López; Lowe, A; Luettig, P; Lunardon, M; Luparello, G; Lupi, M; Lutz, T H; Maevskaya, A; Mager, M; Mahajan, S; Mahmood, S M; Maire, A; Majka, R D; Malaev, M; Cervantes, I Maldonado; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manko, V; Manso, F; Manzari, V; Mao, Y; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Margutti, J; Marín, A; Markert, C; Marquard, M; Martin, N A; Martinengo, P; Martinez, J A L; Martínez, M I; García, G Martínez; Pedreira, M Martinez; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Mastroserio, A; Mathis, A M; Matyja, A; Mayer, C; Mazer, J; Mazzilli, M; Mazzoni, M A; Meddi, F; Melikyan, Y; Menchaca-Rocha, A; Meninno, E; Pérez, J Mercado; Meres, M; Mhlanga, S; Miake, Y; Mieskolainen, M M; Mihaylov, D L; Mikhaylov, K; Milano, L; Milosevic, J; Mischke, A; Mishra, A N; Miśkowiec, D; Mitra, J; Mitu, C M; Mohammadi, N; Mohanty, B; Khan, M Mohisin; Montes, E; De Godoy, D A Moreira; Moreno, L A P; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Mühlheim, D; Muhuri, S; Mukherjee, M; Mulligan, J D; Munhoz, M G; Münning, K; Munzer, R H; Murakami, H; Murray, S; Musa, L; Musinsky, J; Myers, C J; Naik, B; Nair, R; Nandi, B K; Nania, R; Nappi, E; Narayan, A; Naru, M U; da Luz, H Natal; Nattrass, C; Navarro, S R; Nayak, K; Nayak, R; Nayak, T K; Nazarenko, S; Nedosekin, A; De Oliveira, R A Negrao; Nellen, L; Nesbo, S V; Ng, F; Nicassio, M; Niculescu, M; Niedziela, J; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Noferini, F; Nomokonov, P; Nooren, G; Noris, J C C; Norman, J; Nyanin, A; Nystrand, J; Oeschler, H; Oh, S; Ohlson, A; Okubo, T; Olah, L; Oleniacz, J; Da Silva, A C Oliveira; Oliver, M H; Onderwaater, J; Oppedisano, C; Orava, R; Oravec, M; Velasquez, A Ortiz; Oskarsson, A; Otwinowski, J; Oyama, K; Pachmayer, Y; Pacik, V; Pagano, D; Pagano, P; Paić, G; Palni, P; Pan, J; Pandey, A K; Panebianco, S; Papikyan, V; Pappalardo, G S; Pareek, P; Park, J; Park, W J; Parmar, S; Passfeld, A; Pathak, S P; Paticchio, V; Patra, R N; Paul, B; Pei, H; Peitzmann, T; Peng, X; Pereira, L G; Da Costa, H Pereira; Peresunko, D; Lezama, E Perez; Peskov, V; Pestov, Y; Petráček, V; Petrov, V; Petrovici, M; Petta, C; Pezzi, R P; Piano, S; Pikna, M; Pillot, P; Pimentel, L O D L; Pinazza, O; Pinsky, L; Piyarathna, D B; Oskoń, M Pł; Planinic, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Polichtchouk, B; Poljak, N; Poonsawat, W; Pop, A; Poppenborg, H; Porteboeuf-Houssais, S; Porter, J; Pospisil, J; Pozdniakov, V; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puccio, M; Puddu, G; Pujahari, P; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Raha, S; Rajput, S; Rak, J; Rakotozafindrabe, A; Ramello, L; Rami, F; Rana, D B; Raniwala, R; Raniwala, S; Räsänen, S S; Rascanu, B T; Rathee, D; Ratza, V; Ravasenga, I; Read, K F; Redlich, K; Rehman, A; Reichelt, P; Reidt, F; Ren, X; Renfordt, R; Reolon, A R; Reshetin, A; Reygers, K; Riabov, V; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Ristea, C; Cahuantzi, M Rodríguez; Røed, K; Rogochaya, E; Rohr, D; Röhrich, D; Rokita, P S; Ronchetti, F; Ronflette, L; Rosnet, P; Rossi, A; Rotondi, A; Roukoutakis, F; Roy, A; Roy, C; Roy, P; Montero, A J Rubio; Rueda, O V; Rui, R; Russo, R; Rustamov, A; Ryabinkin, E; Ryabov, Y; Rybicki, A; Saarinen, S; Sadhu, S; Sadovsky, S; Šafařík, K; Saha, S K; Sahlmuller, B; Sahoo, B; Sahoo, P; Sahoo, R; Sahoo, S; Sahu, P K; Saini, J; Sakai, S; Saleh, M A; Salzwedel, J; Sambyal, S; Samsonov, V; Sandoval, A; Sarkar, D; Sarkar, N; Sarma, P; Sas, M H P; Scapparone, E; Scarlassara, F; Scharenberg, R P; Scheid, H S; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schmidt, M O; Schmidt, M; Schuchmann, S; Schukraft, J; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Šefčík, M; Seger, J E; Sekiguchi, Y; Sekihata, D; Selyuzhenkov, I; Senosi, K; Senyukov, S; Serradilla, E; Sett, P; Sevcenco, A; Shabanov, A; Shabetai, A; Shadura, O; Shahoyan, R; Shangaraev, A; Sharma, A; Sharma, A; Sharma, M; Sharma, M; Sharma, N; Sheikh, A I; Shigaki, K; Shou, Q; Shtejer, K; Sibiriak, Y; Siddhanta, S; Sielewicz, K M; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Simonetti, G; Singaraju, R; Singh, R; Singhal, V; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Slupecki, M; Smirnov, N; Snellings, R J M; Snellman, T W; Song, J; Song, M; Soramel, F; Sorensen, S; Sozzi, F; Spiriti, E; Sputowska, I; Srivastava, B K; Stachel, J; Stan, I; Stankus, P; Stenlund, E; Stiller, J H; Stocco, D; Strmen, P; Suaide, A A P; Sugitate, T; Suire, C; Suleymanov, M; Suljic, M; Sultanov, R; Šumbera, M; Sumowidagdo, S; Suzuki, K; Swain, S; Szabo, A; Szarka, I; Szczepankiewicz, A; Szymanski, M; Tabassam, U; Takahashi, J; Tambave, G J; Tanaka, N; Tarhini, M; Tariq, M; Tarzila, M G; Tauro, A; Muñoz, G Tejeda; Telesca, A; Terasaki, K; Terrevoli, C; Teyssier, B; Thakur, D; Thakur, S; Thomas, D; Tieulent, R; Tikhonov, A; Timmins, A R; Toia, A; Tripathy, S; Trogolo, S; Trombetta, G; Trubnikov, V; Trzaska, W H; Trzeciak, B A; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ullaland, K; Umaka, E N; Uras, A; Usai, G L; Utrobicic, A; Vala, M; Van Der Maarel, J; Van Hoorne, J W; van Leeuwen, M; Vanat, T; Vyvre, P Vande; Varga, D; Vargas, A; Vargyas, M; Varma, R; Vasileiou, M; Vasiliev, A; Vauthier, A; Doce, O Vázquez; Vechernin, V; Veen, A M; Velure, A; Vercellin, E; Limón, S Vergara; Vernet, R; Vértesi, R; Vickovic, L; Vigolo, S; Viinikainen, J; Vilakazi, Z; Baillie, O Villalobos; Tello, A Villatoro; Vinogradov, A; Vinogradov, L; Virgili, T; Vislavicius, V; Vodopyanov, A; Völkl, M A; Voloshin, K; Voloshin, S A; Volpe, G; von Haller, B; Vorobyev, I; Voscek, D; Vranic, D; Vrláková, J; Wagner, B; Wagner, J; Wang, H; Wang, M; Watanabe, D; Watanabe, Y; Weber, M; Weber, S G; Weiser, D F; Wessels, J P; Westerhoff, U; Whitehead, A M; Wiechula, J; Wikne, J; Wilk, G; Wilkinson, J; Willems, G A; Williams, M C S; Windelband, B; Witt, W E; Yalcin, S; Yang, P; Yano, S; Yin, Z; Yokoyama, H; Yoo, I-K; Yoon, J H; Yurchenko, V; Zaccolo, V; Zaman, A; Zampolli, C; Zanoli, H J C; Zardoshti, N; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zhalov, M; Zhang, H; Zhang, X; Zhang, Y; Zhang, C; Zhang, Z; Zhao, C; Zhigareva, N; Zhou, D; Zhou, Y; Zhou, Z; Zhu, H; Zhu, J; Zhu, X; Zichichi, A; Zimmermann, A; Zimmermann, M B; Zimmermann, S; Zinovjev, G; Zmeskal, J

    2017-01-01

    The invariant differential cross sections for inclusive [Formula: see text] and [Formula: see text] mesons at midrapidity were measured in pp collisions at [Formula: see text] TeV for transverse momenta [Formula: see text] GeV/ c and [Formula: see text] GeV/ c , respectively, using the ALICE detector. This large range in [Formula: see text] was achieved by combining various analysis techniques and different triggers involving the electromagnetic calorimeter (EMCal). In particular, a new single-cluster, shower-shape based method was developed for the identification of high-[Formula: see text] neutral pions, which exploits that the showers originating from their decay photons overlap in the EMCal. Above 4 GeV/[Formula: see text], the measured cross sections are found to exhibit a similar power-law behavior with an exponent of about 6.3. Next-to-leading-order perturbative QCD calculations differ from the measured cross sections by about 30% for the [Formula: see text], and between 30-50% for the [Formula: see text] meson, while generator-level simulations with PYTHIA 8.2 describe the data to better than 10-30%, except at [Formula: see text] GeV/[Formula: see text]. The new data can therefore be used to further improve the theoretical description of [Formula: see text] and [Formula: see text] meson production.

  2. Evaluation of potential severe accidents during low power and shutdown operations at Grand Gulf, Unit 1. Analysis of core damage frequency from internal events for plant operational state 5 during a refueling outage. Internal events appendices K to M

    International Nuclear Information System (INIS)

    Forester, J.; Yakle, J.; Walsh, B.; Darby, J.; Whitehead, D.; Staple, B.; Brown, T.

    1994-07-01

    This report provides supporting documentation for various tasks associated with the performance of the probabilistic risk assessment for Plant Operational State 5 (approximately Cold Shutdown as defined by Grand Gulf Technical Specifications) during a refueling outage at Grand Gulf, Unit 1 as documented in Volume 2, Part 1 of NUREG/CR-6143. The report contains the following appendices: K - HEP Locator Files; L - Supporting Information for the Plant Damage State Analysis; M - Summary of Results from the Coarse Screening Analysis - Phase 1A

  3. Great Lakes Research Review, 1982. Appendices.

    Science.gov (United States)

    1982-11-01

    7D-i53 28 GREAT LAKES RESEARCH REVIEW 1982 PPENDICES (U) / PETROLEUM REFINERY PO INT SOURCE TASK FORCE WINDSOR (ONTARIO) NOV 82UNCLASSIFIED F/G 8...C7 U. 3 X 7 45 1 2 0. ODm C of. C.’ WC.’ L. LI 7 R-Ri53 62B GREAT LKES RESEARCH REVIEW 1982 PPENDICES (U) 2/3 PETROLEUM REFINERY POINT SOURCE TASK...NUMBER ORGANIZATION* TITLE OF PROJECT 001 A** 0300 ERL-D Acute and Early Life Stage Toxicity Testing of Priority Pollutant Chemicals 002 A 0302 ERL-D

  4. Saltwell pumping systems R.A.M. analysis

    International Nuclear Information System (INIS)

    DEFORD, D.K.

    1999-01-01

    This study characterizes the reliability, availability, and maintainability of saltwell pumping systems based on historical data, and identifies recommendations to improve operating efficiency. The report was initially issued as a letter report on September 9, 1999, reference no. NHC-9956343. The text is reproduced here with minor edits and without the appendices

  5. A further note on the force discrepancy for wing theory in Euler flow

    Indian Academy of Sciences (India)

    The Euler equations use the assumption that the fluid does not impart any resistance ... viscosity, the kinetic energy associated with these flow fields is now bounded, ..... Combining all the results together from Appendices B, C and D we get.

  6. Measurements of the branching fractions of [Formula: see text] decays.

    Science.gov (United States)

    Aaij, R; Abellan Beteta, C; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Burducea, I; Bursche, A; Buytaert, J; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cattaneo, M; Cauet, Ch; Charles, M; Charpentier, Ph; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Dogaru, M; Domingo Bonal, F; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Fave, V; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Furcas, S; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gibson, V; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Jacobsson, R; Jaeger, A; Jans, E; Jansen, F; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karbach, T M; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kochebina, O; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Li, Y; Li Gioi, L; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martin, L; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Müller, K; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Otalora Goicochea, J M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; Phan, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; Rouvinet, J; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Sannino, M; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schaack, P; Schiller, M; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Silva Coutinho, R; Skwarnicki, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiechczynski, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, F; Xing, Z; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zvyagin, A

    The branching fractions of the decay [Formula: see text] for different intermediate states are measured using data, corresponding to an integrated luminosity of 1.0 fb -1 , collected by the LHCb experiment. The total branching fraction, its charmless component [Formula: see text] and the branching fractions via the resonant [Formula: see text] states η c (1 S ) and ψ (2 S ) relative to the decay via a J / ψ intermediate state are [Formula: see text] Upper limits on the B + branching fractions into the η c (2 S ) meson and into the charmonium-like states X (3872) and X (3915) are also obtained.

  7. Assessing the Age of Goethe in the Undergraduate Curriculum: A Report.

    Science.gov (United States)

    Larkin, Edward T.

    1991-01-01

    Presents information on how and what is taught in courses on the "Age of Goethe." Two appendices are presented that list the institutions responding to a questionnaire concerning the teaching of this course and the less familiar texts of the period that are treated by some instructors. (GLR)

  8. Christina Isajiw. Negotiating Human Rights: In Defence of Dissidents during the Soviet Era. A Memoir.

    Directory of Open Access Journals (Sweden)

    Barbara Martin

    2015-09-01

    Full Text Available Christina Isajiw. Negotiating Human Rights: In Defence of Dissidents during the Soviet Era. A Memoir. Edmonton and Toronto: Canadian Institute of Ukrainian Studies Press, 2014. xxx, 407 pp. Foreword by Bohdan Nahaylo. Introduction. Illustrations. Appendices on separate CD-Rom. Index. Paper.

  9. Remedial Action Plan and final design for stabilization of the inactive uranium mill tailings at Green River, Utah. Volume 1, Text, Appendices A, B, and C: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, M.L. [USDOE Albuquerque Operations Office, NM (United States). Uranium Mill Tailings Remedial Action Project Office; Alkema, K. [Utah Dept. of Health, Salt Lake City, UT (United States). Environmental Health Div.

    1991-03-01

    This Remedial Action Plan (RAP) has been developed to serve a threefold purpose. It presents the series of activities that are proposed by the US Department of Energy (DOE) to accomplish long-term stabilization and control of radioactive materials at the inactive uranium processing site located near Green River, Utah. It provides a characterization of the present conditions of the site. It also serves to document the concurrence of the state of Utah and the US Nuclear Regulatory Commission (NRC) in the remedial action. This agreement, upon execution by the DOE and the state of Utah, and concurrence by the NRC, becomes Appendix 8 of the Cooperative Agreement.

  10. HANFORD DST THERMAL & SEISMIC PROJECT DYTRAN ANALYSIS OF SEISMICALLY INDUCED FLUID STRUCTURE INTERACTION IN A HANFORD DOUBLE SHELL PRIMARY TANK

    Energy Technology Data Exchange (ETDEWEB)

    MACKEY TC; RINKER MW; ABATT FG

    2007-02-14

    Revision 0A of this document contains new Appendices C and D. Appendix C contains a re-analysis of the rigid and flexible tanks at the 460 in. liquid level and was motivated by recommendations from a Project Review held on March 20-21, 2006 (Rinker et al Appendix E of RPP-RPT-28968 Rev 1). Appendix D contains the benchmark solutions in support of the analyses in Appendix C.

  11. Hanford DST Thermal and Seismic Project - Dytran Analysis Of Seismically Induced Fluid-Structure Interaction In A Hanford Double-Shell Primary Tank

    International Nuclear Information System (INIS)

    Mackey, T.C.; Rinker, M.W.; Abatt, F.G.

    2007-01-01

    Revision 0A of this document contains new Appendices C and D. Appendix C contains a re-analysis of the rigid and flexible tanks at the 460 in. liquid level and was motivated by recommendations from a Project Review held on March 20-21, 2006 (Rinker et al Appendix E of RPP-RPT-28968 Rev 1). Appendix D contains the benchmark solutions in support of the analyses in Appendix C.

  12. Energy dependence of forward-rapidity [Formula: see text] and [Formula: see text] production in pp collisions at the LHC.

    Science.gov (United States)

    Acharya, S; Adamová, D; Aggarwal, M M; Aglieri Rinella, G; Agnello, M; Agrawal, N; Ahammed, Z; Ahmad, N; Ahn, S U; Aiola, S; Akindinov, A; Alam, S N; Albuquerque, D S D; Aleksandrov, D; Alessandro, B; Alexandre, D; Alfaro Molina, R; Alici, A; Alkin, A; Alme, J; Alt, T; Altsybeev, I; Alves Garcia Prado, C; An, M; Andrei, C; Andrews, H A; Andronic, A; Anguelov, V; Anson, C; Antičić, T; Antinori, F; Antonioli, P; Anwar, R; Aphecetche, L; Appelshäuser, H; Arcelli, S; Arnaldi, R; Arnold, O W; Arsene, I C; Arslandok, M; Audurier, B; Augustinus, A; Averbeck, R; Azmi, M D; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Baldisseri, A; Ball, M; Baral, R C; Barbano, A M; Barbera, R; Barile, F; Barioglio, L; Barnaföldi, G G; Barnby, L S; Barret, V; Bartalini, P; Barth, K; Bartke, J; Bartsch, E; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Batista Camejo, A; Batyunya, B; Batzing, P C; Bearden, I G; Beck, H; Bedda, C; Behera, N K; Belikov, I; Bellini, F; Bello Martinez, H; Bellwied, R; Beltran, L G E; Belyaev, V; Bencedi, G; Beole, S; Bercuci, A; Berdnikov, Y; Berenyi, D; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhat, I R; Bhati, A K; Bhattacharjee, B; Bhom, J; Bianchi, L; Bianchi, N; Bianchin, C; Bielčík, J; Bielčíková, J; Bilandzic, A; Biro, G; Biswas, R; Biswas, S; Blair, J T; Blau, D; Blume, C; Boca, G; Bock, F; Bogdanov, A; Boldizsár, L; Bombara, M; Bonomi, G; Bonora, M; Book, J; Borel, H; Borissov, A; Borri, M; Botta, E; Bourjau, C; Braun-Munzinger, P; Bregant, M; Broker, T A; Browning, T A; Broz, M; Brucken, E J; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buhler, P; Buitron, S A I; Buncic, P; Busch, O; Buthelezi, Z; Butt, J B; Buxton, J T; Cabala, J; Caffarri, D; Caines, H; Caliva, A; Calvo Villar, E; Camerini, P; Capon, A A; Carena, F; Carena, W; Carnesecchi, F; Castillo Castellanos, J; Castro, A J; Casula, E A R; Ceballos Sanchez, C; Cerello, P; Chang, B; Chapeland, S; Chartier, M; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Chauvin, A; Cherney, M; Cheshkov, C; Cheynis, B; Chibante Barroso, V; Chinellato, D D; Cho, S; Chochula, P; Choi, K; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Concas, M; Conesa Balbastre, G; Conesa Del Valle, Z; Connors, M E; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortés Maldonado, I; Cortese, P; Cosentino, M R; Costa, F; Costanza, S; Crkovská, J; Crochet, P; Cuautle, E; Cunqueiro, L; Dahms, T; Dainese, A; Danisch, M C; Danu, A; Das, D; Das, I; Das, S; Dash, A; Dash, S; De, S; De Caro, A; de Cataldo, G; de Conti, C; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; De Souza, R D; Degenhardt, H F; Deisting, A; Deloff, A; Deplano, C; Dhankher, P; Di Bari, D; Di Mauro, A; Di Nezza, P; Di Ruzza, B; Diaz Corchero, M A; Dietel, T; Dillenseger, P; Divià, R; Djuvsland, Ø; Dobrin, A; Domenicis Gimenez, D; Dönigus, B; Dordic, O; Drozhzhova, T; Dubey, A K; Dubla, A; Ducroux, L; Duggal, A K; Dupieux, P; Ehlers, R J; Elia, D; Endress, E; Engel, H; Epple, E; Erazmus, B; Erhardt, F; Espagnon, B; Esumi, S; Eulisse, G; Eum, J; Evans, D; Evdokimov, S; Fabbietti, L; Faivre, J; Fantoni, A; Fasel, M; Feldkamp, L; Feliciello, A; Feofilov, G; Ferencei, J; Téllez, A Fernández; Ferreiro, E G; Ferretti, A; Festanti, A; Feuillard, V J G; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Francisco, A; Frankenfeld, U; Fronze, G G; Fuchs, U; Furget, C; Furs, A; Fusco Girard, M; Gaardhøje, J J; Gagliardi, M; Gago, A M; Gajdosova, K; Gallio, M; Galvan, C D; Ganoti, P; Gao, C; Garabatos, C; Garcia-Solis, E; Garg, K; Garg, P; Gargiulo, C; Gasik, P; Gauger, E F; Gay Ducati, M B; Germain, M; Ghosh, P; Ghosh, S K; Gianotti, P; Giubellino, P; Giubilato, P; Gladysz-Dziadus, E; Glässel, P; Goméz Coral, D M; Gomez Ramirez, A; Gonzalez, A S; Gonzalez, V; González-Zamora, P; Gorbunov, S; Görlich, L; Gotovac, S; Grabski, V; Graczykowski, L K; Graham, K L; Greiner, L; Grelli, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grion, N; Gronefeld, J M; Grosa, F; Grosse-Oetringhaus, J F; Grosso, R; Gruber, L; Grull, F R; Guber, F; Guernane, R; Guerzoni, B; Gulbrandsen, K; Gunji, T; Gupta, A; Gupta, R; Guzman, I B; Haake, R; Hadjidakis, C; Hamagaki, H; Hamar, G; Hamon, J C; Harris, J W; Harton, A; Hatzifotiadou, D; Hayashi, S; Heckel, S T; Hellbär, E; Helstrup, H; Herghelegiu, A; Herrera Corral, G; Herrmann, F; Hess, B A; Hetland, K F; Hillemanns, H; Hippolyte, B; Hladky, J; Hohlweger, B; Horak, D; Hosokawa, R; Hristov, P; Hughes, C; Humanic, T J; Hussain, N; Hussain, T; Hutter, D; Hwang, D S; Ilkaev, R; Inaba, M; Ippolitov, M; Irfan, M; Isakov, V; Islam, M S; Ivanov, M; Ivanov, V; Izucheev, V; Jacak, B; Jacazio, N; Jacobs, P M; Jadhav, M B; Jadlovska, S; Jadlovsky, J; Jaelani, S; Jahnke, C; Jakubowska, M J; Janik, M A; Jayarathna, P H S Y; Jena, C; Jena, S; Jercic, M; Jimenez Bustamante, R T; Jones, P G; Jusko, A; Kalinak, P; Kalweit, A; Kang, J H; Kaplin, V; Kar, S; Karasu Uysal, A; Karavichev, O; Karavicheva, T; Karayan, L; Karpechev, E; Kebschull, U; Keidel, R; Keijdener, D L D; Keil, M; Ketzer, B; Mohisin Khan, M; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Khatun, A; Khuntia, A; Kielbowicz, M M; Kileng, B; Kim, D; Kim, D W; Kim, D J; Kim, H; Kim, J S; Kim, J; Kim, M; Kim, M; Kim, S; Kim, T; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, C; Klein, J; Klein-Bösing, C; Klewin, S; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Kofarago, M; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Kondratyuk, E; Konevskikh, A; Kopcik, M; Kour, M; Kouzinopoulos, C; Kovalenko, O; Kovalenko, V; Kowalski, M; Koyithatta Meethaleveedu, G; Králik, I; Kravčáková, A; Krivda, M; Krizek, F; Kryshen, E; Krzewicki, M; Kubera, A M; Kučera, V; Kuhn, C; Kuijer, P G; Kumar, A; Kumar, J; Kumar, L; Kumar, S; Kundu, S; Kurashvili, P; Kurepin, A; Kurepin, A B; Kuryakin, A; Kushpil, S; Kweon, M J; Kwon, Y; La Pointe, S L; La Rocca, P; Lagana Fernandes, C; Lakomov, I; Langoy, R; Lapidus, K; Lara, C; Lardeux, A; Lattuca, A; Laudi, E; Lavicka, R; Lazaridis, L; Lea, R; Leardini, L; Lee, S; Lehas, F; Lehner, S; Lehrbach, J; Lemmon, R C; Lenti, V; Leogrande, E; León Monzón, I; Lévai, P; Li, S; Li, X; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Litichevskyi, V; Ljunggren, H M; Llope, W J; Lodato, D F; Loenne, P I; Loginov, V; Loizides, C; Loncar, P; Lopez, X; López Torres, E; Lowe, A; Luettig, P; Lunardon, M; Luparello, G; Lupi, M; Lutz, T H; Maevskaya, A; Mager, M; Mahajan, S; Mahmood, S M; Maire, A; Majka, R D; Malaev, M; Maldonado Cervantes, I; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manko, V; Manso, F; Manzari, V; Mao, Y; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Margutti, J; Marín, A; Markert, C; Marquard, M; Martin, N A; Martinengo, P; Martinez, J A L; Martínez, M I; Martínez García, G; Martinez Pedreira, M; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Mastroserio, A; Mathis, A M; Matyja, A; Mayer, C; Mazer, J; Mazzilli, M; Mazzoni, M A; Meddi, F; Melikyan, Y; Menchaca-Rocha, A; Meninno, E; Mercado Pérez, J; Meres, M; Mhlanga, S; Miake, Y; Mieskolainen, M M; Mihaylov, D L; Mikhaylov, K; Milano, L; Milosevic, J; Mischke, A; Mishra, A N; Miśkowiec, D; Mitra, J; Mitu, C M; Mohammadi, N; Mohanty, B; Montes, E; Moreira De Godoy, D A; Moreno, L A P; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Mühlheim, D; Muhuri, S; Mukherjee, M; Mulligan, J D; Munhoz, M G; Münning, K; Munzer, R H; Murakami, H; Murray, S; Musa, L; Musinsky, J; Myers, C J; Naik, B; Nair, R; Nandi, B K; Nania, R; Nappi, E; Naru, M U; Natal da Luz, H; Nattrass, C; Navarro, S R; Nayak, K; Nayak, R; Nayak, T K; Nazarenko, S; Nedosekin, A; Negrao De Oliveira, R A; Nellen, L; Nesbo, S V; Ng, F; Nicassio, M; Niculescu, M; Niedziela, J; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Noferini, F; Nomokonov, P; Nooren, G; Noris, J C C; Norman, J; Nyanin, A; Nystrand, J; Oeschler, H; Oh, S; Ohlson, A; Okubo, T; Olah, L; Oleniacz, J; Oliveira Da Silva, A C; Oliver, M H; Onderwaater, J; Oppedisano, C; Orava, R; Oravec, M; Ortiz Velasquez, A; Oskarsson, A; Otwinowski, J; Oyama, K; Pachmayer, Y; Pacik, V; Pagano, D; Pagano, P; Paić, G; Palni, P; Pan, J; Pandey, A K; Panebianco, S; Papikyan, V; Pappalardo, G S; Pareek, P; Park, J; Park, W J; Parmar, S; Passfeld, A; Pathak, S P; Paticchio, V; Patra, R N; Paul, B; Pei, H; Peitzmann, T; Peng, X; Pereira, L G; Pereira Da Costa, H; Peresunko, D; Perez Lezama, E; Peskov, V; Pestov, Y; Petráček, V; Petrov, V; Petrovici, M; Petta, C; Pezzi, R P; Piano, S; Pikna, M; Pillot, P; Pimentel, L O D L; Pinazza, O; Pinsky, L; Piyarathna, D B; Płoskoń, M; Planinic, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Polichtchouk, B; Poljak, N; Poonsawat, W; Pop, A; Poppenborg, H; Porteboeuf-Houssais, S; Porter, J; Pospisil, J; Pozdniakov, V; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puccio, M; Puddu, G; Pujahari, P; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Raha, S; Rajput, S; Rak, J; Rakotozafindrabe, A; Ramello, L; Rami, F; Rana, D B; Raniwala, R; Raniwala, S; Räsänen, S S; Rascanu, B T; Rathee, D; Ratza, V; Ravasenga, I; Read, K F; Redlich, K; Rehman, A; Reichelt, P; Reidt, F; Ren, X; Renfordt, R; Reolon, A R; Reshetin, A; Reygers, K; Riabov, V; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Ristea, C; Rodríguez Cahuantzi, M; Røed, K; Rogochaya, E; Rohr, D; Röhrich, D; Rokita, P S; Ronchetti, F; Ronflette, L; Rosnet, P; Rossi, A; Rotondi, A; Roukoutakis, F; Roy, A; Roy, C; Roy, P; Rubio Montero, A J; Rueda, O V; Rui, R; Russo, R; Rustamov, A; Ryabinkin, E; Ryabov, Y; Rybicki, A; Saarinen, S; Sadhu, S; Sadovsky, S; Šafařík, K; Saha, S K; Sahlmuller, B; Sahoo, B; Sahoo, P; Sahoo, R; Sahoo, S; Sahu, P K; Saini, J; Sakai, S; Saleh, M A; Salzwedel, J; Sambyal, S; Samsonov, V; Sandoval, A; Sarkar, D; Sarkar, N; Sarma, P; Sas, M H P; Scapparone, E; Scarlassara, F; Scharenberg, R P; Scheid, H S; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schmidt, M O; Schmidt, M; Schuchmann, S; Schukraft, J; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Šefčík, M; Seger, J E; Sekiguchi, Y; Sekihata, D; Selyuzhenkov, I; Senosi, K; Senyukov, S; Serradilla, E; Sett, P; Sevcenco, A; Shabanov, A; Shabetai, A; Shadura, O; Shahoyan, R; Shangaraev, A; Sharma, A; Sharma, A; Sharma, M; Sharma, M; Sharma, N; Sheikh, A I; Shigaki, K; Shou, Q; Shtejer, K; Sibiriak, Y; Siddhanta, S; Sielewicz, K M; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Simonetti, G; Singaraju, R; Singh, R; Singhal, V; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Slupecki, M; Smirnov, N; Snellings, R J M; Snellman, T W; Song, J; Song, M; Soramel, F; Sorensen, S; Sozzi, F; Spiriti, E; Sputowska, I; Srivastava, B K; Stachel, J; Stan, I; Stankus, P; Stenlund, E; Stiller, J H; Stocco, D; Strmen, P; Suaide, A A P; Sugitate, T; Suire, C; Suleymanov, M; Suljic, M; Sultanov, R; Šumbera, M; Sumowidagdo, S; Suzuki, K; Swain, S; Szabo, A; Szarka, I; Szczepankiewicz, A; Szymanski, M; Tabassam, U; Takahashi, J; Tambave, G J; Tanaka, N; Tarhini, M; Tariq, M; Tarzila, M G; Tauro, A; Tejeda Muñoz, G; Telesca, A; Terasaki, K; Terrevoli, C; Teyssier, B; Thakur, D; Thakur, S; Thomas, D; Tieulent, R; Tikhonov, A; Timmins, A R; Toia, A; Tripathy, S; Trogolo, S; Trombetta, G; Trubnikov, V; Trzaska, W H; Trzeciak, B A; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ullaland, K; Umaka, E N; Uras, A; Usai, G L; Utrobicic, A; Vala, M; Van Der Maarel, J; Van Hoorne, J W; van Leeuwen, M; Vanat, T; Vande Vyvre, P; Varga, D; Vargas, A; Vargyas, M; Varma, R; Vasileiou, M; Vasiliev, A; Vauthier, A; Vázquez Doce, O; Vechernin, V; Veen, A M; Velure, A; Vercellin, E; Vergara Limón, S; Vernet, R; Vértesi, R; Vickovic, L; Vigolo, S; Viinikainen, J; Vilakazi, Z; Villalobos Baillie, O; Villatoro Tello, A; Vinogradov, A; Vinogradov, L; Virgili, T; Vislavicius, V; Vodopyanov, A; Völkl, M A; Voloshin, K; Voloshin, S A; Volpe, G; von Haller, B; Vorobyev, I; Voscek, D; Vranic, D; Vrláková, J; Wagner, B; Wagner, J; Wang, H; Wang, M; Watanabe, D; Watanabe, Y; Weber, M; Weber, S G; Weiser, D F; Wessels, J P; Westerhoff, U; Whitehead, A M; Wiechula, J; Wikne, J; Wilk, G; Wilkinson, J; Willems, G A; Williams, M C S; Windelband, B; Witt, W E; Yalcin, S; Yang, P; Yano, S; Yin, Z; Yokoyama, H; Yoo, I-K; Yoon, J H; Yurchenko, V; Zaccolo, V; Zaman, A; Zampolli, C; Zanoli, H J C; Zardoshti, N; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zhalov, M; Zhang, H; Zhang, X; Zhang, Y; Zhang, C; Zhang, Z; Zhao, C; Zhigareva, N; Zhou, D; Zhou, Y; Zhou, Z; Zhu, H; Zhu, J; Zhu, X; Zichichi, A; Zimmermann, A; Zimmermann, M B; Zimmermann, S; Zinovjev, G; Zmeskal, J

    2017-01-01

    We present results on transverse momentum ([Formula: see text]) and rapidity ([Formula: see text]) differential production cross sections, mean transverse momentum and mean transverse momentum square of inclusive [Formula: see text] and [Formula: see text] at forward rapidity ([Formula: see text]) as well as [Formula: see text]-to-[Formula: see text] cross section ratios. These quantities are measured in pp collisions at center of mass energies [Formula: see text] and 13 TeV with the ALICE detector. Both charmonium states are reconstructed in the dimuon decay channel, using the muon spectrometer. A comprehensive comparison to inclusive charmonium cross sections measured at [Formula: see text], 7 and 8 TeV is performed. A comparison to non-relativistic quantum chromodynamics and fixed-order next-to-leading logarithm calculations, which describe prompt and non-prompt charmonium production respectively, is also presented. A good description of the data is obtained over the full [Formula: see text] range, provided that both contributions are summed. In particular, it is found that for [Formula: see text] GeV/ c the non-prompt contribution reaches up to 50% of the total charmonium yield.

  13. Headspace vapor characterization of Hanford waste Tank 241-C-201: Results from samples collected on 06/19/96

    International Nuclear Information System (INIS)

    Thomas, B.L.; Evans, J.C.; Pool, K.H.; Olsen, K.B.; Fruchter, J.S.; Silvers, K.L.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-201 (Tank C-201) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, on sample volumes provided by WHC. A summary, of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in a table. Detailed descriptions of the analytical results appear in the appendices

  14. Extended ellipse-line-ellipse trajectory for long-object cone-beam imaging with a mounted C-arm system

    International Nuclear Information System (INIS)

    Yu, Zhicong; Noo, Frédéric; Lauritsch, Günter; Dennerlein, Frank; Mao, Yanfei; Hornegger, Joachim

    2016-01-01

    Recent reports show that three-dimensional cone-beam (CB) imaging with a floor-mounted (or ceiling-mounted) C-arm system has become a valuable tool in interventional radiology. Currently, a circular short scan is used for data acquisition, which inevitably yields CB artifacts and a short coverage in the direction of the patient table. To overcome these two limitations, a more sophisticated data acquisition geometry is needed. This geometry should be complete in terms of Tuy’s condition and should allow continuous scanning, while being compatible with the mechanical constraints of mounted C-arm systems. Additionally, the geometry should allow accurate image reconstruction from truncated data. One way to ensure such a feature is to adopt a trajectory that provides full R-line coverage within the field-of-view (FOV). An R-line is any segment of line that connects two points on a source trajectory, and the R-line coverage is the set of points that belong to an R-line. In this work, we propose a novel geometry called the extended ellipse-line-ellipse (ELE) for long-object imaging with a mounted C-arm system. This trajectory is built from modules consisting of two elliptical arcs connected by a line. We demonstrate that the extended ELE can be configured in many ways so that full R-line coverage is guaranteed. Both tight and relaxed parametric settings are presented. All results are supported by extensive mathematical proofs provided in appendices. Our findings make the extended ELE trajectory attractive for axially-extended FOV imaging in interventional radiology. (paper)

  15. Fort Drum Preliminary Fiscal Impact Analysis: Technical Appendices,

    Science.gov (United States)

    1986-01-01

    the Capital Expenditure table are those normally included in "equipment and capital outlay" by the New York State Department of Audit and Control...19 . - - C a a * -~- -- - - e a aa - - -- - C a c z - =----- -- a X- - - - Z.-.- -- -- - - a - - - I . Ch ... .aCa aC... - "-a C " fl C ana~ acca ...a - I m a - * Sa a - - S a -* ma m aaamn n * a -- a a a * a a C~0aaa~ aCCa -----------,a a 0~ an a a - - - - ma a a . - a * - aa a a a S a - a

  16. Ocean thermal energy conversion (OTEC) power system development. Preliminary design report, Appendices, Part 1 (Final)

    Energy Technology Data Exchange (ETDEWEB)

    1978-12-04

    The objective of this project is the development of a preliminary design for a full-sized, closed cycle, ammonia power system module for the 100 MWe OTEC demonstration plant. In turn, this demonstration plant is to demonstrate, by 1984, the operation and performance of an Ocean Thermal Power Plant having sufficiently advanced heat exchanger design to project economic viability for commercial utilization in the late 1980's and beyond. Included in this power system development are the preliminary designs for a proof-of-concept pilot plant and test article heat exchangers which are scaled in such a manner as to support a logically sequential, relatively low-cost development of the full-scale power system module. The conceptual designs are presented for the demonstration plant power module, the proof-of-concept pilot plant, and for a pair of test article heat exchangers. Costs associated with the design, development, fabrication, checkout, delivery, installation, and operation are included. The accompanying design and producibilty studies on the full-scale power system module project the performance/economics for the commercial plant. This section of the report contains appendices on the developed computer models, water system dynamic studies, miscellaneous performance analysis, materials and processes, detailed equipment lists, turbine design studies, tube cleaner design, ammonia leak detection, and heat exchanger design supporting data. (WHK)

  17. Environmental assessment of remedial action at the Lakeview Uranium Mill Tailings Site, Lakeview, Oregon: Volume 2, Appendices

    International Nuclear Information System (INIS)

    1985-04-01

    This document assesses and compares the environmental impacts of various alternatives for remedial action at the Lakeview uranium mill tailings site located one mile north of Lakeview, Oregon. The site covers 256 acres and contains 30 acres of tailings, 69 acres of evaporation ponds, and 25 acres of windblown materials. Remedial actions must be performed in accordance with standards and with the concurrence of the Nuclear Regulatory Commission. Three alternatives have been addressed in this document. The first alternative (the proposed action) is relocation of all contaminated materials to the Collins Ranch site. The contaminated materials would be consolidated into an embankment constructed partially below grade and covered with radon protection and erosion protection covers. A second alternative would relocate the tailings to the Flynn Ranch site and dispose of the contaminated materials in a slightly below grade embankment. A radon protection and erosion protection cover system would also be installed. The no-action alternative is also assessed. Stabilization in place is not considered due to potential seismic and geothermal hazards associated with the current tailings site, and the inability to meet EPA standards. Volume 2 contains 11 appendices

  18. A Guide Text or Many Texts? "That is the Question”

    Directory of Open Access Journals (Sweden)

    Delgado de Valencia Sonia

    2001-08-01

    Full Text Available The use of supplementary materials in the classroom has always been an essential part of the teaching and learning process. To restrict our teaching to the scope of one single textbook means to stand behind the advances of knowledge, in any area and context. Young learners appreciate any new and varied support that expands their knowledge of the world: diaries, letters, panels, free texts, magazines, short stories, poems or literary excerpts, and articles taken from Internet are materials that will allow learnersto share more and work more collaboratively. In this article we are going to deal with some of these materials, with the criteria to select, adapt, and create them that may be of interest to the learner and that may promote reading and writing processes. Since no text can entirely satisfy the needs of students and teachers, the creativity of both parties will be necessary to improve the quality of teaching through the adequate use and adaptation of supplementary materials.

  19. Texting while driving: is speech-based text entry less risky than handheld text entry?

    Science.gov (United States)

    He, J; Chaparro, A; Nguyen, B; Burge, R J; Crandall, J; Chaparro, B; Ni, R; Cao, S

    2014-11-01

    Research indicates that using a cell phone to talk or text while maneuvering a vehicle impairs driving performance. However, few published studies directly compare the distracting effects of texting using a hands-free (i.e., speech-based interface) versus handheld cell phone, which is an important issue for legislation, automotive interface design and driving safety training. This study compared the effect of speech-based versus handheld text entries on simulated driving performance by asking participants to perform a car following task while controlling the duration of a secondary text-entry task. Results showed that both speech-based and handheld text entries impaired driving performance relative to the drive-only condition by causing more variation in speed and lane position. Handheld text entry also increased the brake response time and increased variation in headway distance. Text entry using a speech-based cell phone was less detrimental to driving performance than handheld text entry. Nevertheless, the speech-based text entry task still significantly impaired driving compared to the drive-only condition. These results suggest that speech-based text entry disrupts driving, but reduces the level of performance interference compared to text entry with a handheld device. In addition, the difference in the distraction effect caused by speech-based and handheld text entry is not simply due to the difference in task duration. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Directed Activities Related to Text: Text Analysis and Text Reconstruction.

    Science.gov (United States)

    Davies, Florence; Greene, Terry

    This paper describes Directed Activities Related to Text (DART), procedures that were developed and are used in the Reading for Learning Project at the University of Nottingham (England) to enhance learning from texts and that fall into two broad categories: (1) text analysis procedures, which require students to engage in some form of analysis of…

  1. Mixed strategies for energy conservation and alternative energy utilization (solar) in buildings. Final report. Volume III. Appendixes. [10 appendices

    Energy Technology Data Exchange (ETDEWEB)

    None

    1977-06-01

    This appendix summarizes building characteristics used to determine heating and cooling loads for each of the five building types in each of the four regions. For the selected five buildings, the following data are attached: new and existing construction characteristics; new and existing construction thermal resistance; floor plan and elevation; people load schedule; lighting load schedule; appliance load schedule; ventilation schedule; and hot water use schedule. For the five building types (single family, apartment buildings, commercial buildings, office buildings, and schools), data are compiled in 10 appendices. These are Building Characteristics; Alternate Energy Sources and Energy Conservation Techniques Description, Costs, Fuel Price Scenarios; Life Cycle Cost Model; Simulation Models; Solar Heating/Cooling System; Condensed Weather; Single and Multi-Family Dwelling Characteristics and Energy Conservation Techniques; Mixed Strategies for Energy Conservation and Alternative Energy Utilization in Buildings. An extensive bibliography is given in the final appendix. (MCW)

  2. Einstein in matrix form. Exact derivation of the theory of special and general relativity without tensors

    Energy Technology Data Exchange (ETDEWEB)

    Ludyk, Guenter [Bremen Univ. (Germany). Physics and Electrical Engineering

    2013-11-01

    Derives the fundamental equations of Einstein's theory of special and general relativity using matrix calculus, without the help of tensors. Provides necessary mathematical tools in a user-friendly way, either directly in the text or in the appendices. Appendices contain an introduction to classical dynamics as a refresher of known fundamental physics. Rehearses vector and matrix calculus, differential geometry, and some special solutions of general relativity in the appendices. This book is an introduction to the theories of Special and General Relativity. The target audience are physicists, engineers and applied scientists who are looking for an understandable introduction to the topic - without too much new mathematics. The fundamental equations of Einsteins theory of Special and General Relativity are derived using matrix calculus, without the help of tensors. This feature makes the book special and a valuable tool for scientists and engineers with no experience in the field of tensor calculus. In part I the foundations of Special Relativity are developed, part II describes the structure and principle of General Relativity. Part III explains the Schwarzschild solution of spherical body gravity and examines the ''Black Hole'' phenomenon. Any necessary mathematical tools are user friendly provided, either directly in the text or in the appendices.

  3. Einstein in matrix form. Exact derivation of the theory of special and general relativity without tensors

    International Nuclear Information System (INIS)

    Ludyk, Guenter

    2013-01-01

    Derives the fundamental equations of Einstein's theory of special and general relativity using matrix calculus, without the help of tensors. Provides necessary mathematical tools in a user-friendly way, either directly in the text or in the appendices. Appendices contain an introduction to classical dynamics as a refresher of known fundamental physics. Rehearses vector and matrix calculus, differential geometry, and some special solutions of general relativity in the appendices. This book is an introduction to the theories of Special and General Relativity. The target audience are physicists, engineers and applied scientists who are looking for an understandable introduction to the topic - without too much new mathematics. The fundamental equations of Einsteins theory of Special and General Relativity are derived using matrix calculus, without the help of tensors. This feature makes the book special and a valuable tool for scientists and engineers with no experience in the field of tensor calculus. In part I the foundations of Special Relativity are developed, part II describes the structure and principle of General Relativity. Part III explains the Schwarzschild solution of spherical body gravity and examines the ''Black Hole'' phenomenon. Any necessary mathematical tools are user friendly provided, either directly in the text or in the appendices.

  4. Sentence connexion and global text structures: a case study of a political text, English leader article

    OpenAIRE

    Stein, Dieter; Mattei, Adriana

    1993-01-01

    The paper first gives a brief overview of the history and theoretical status of discourse analysis, or "text linguistics." The main body of the paper consists of a detailed analysis of sentence connexion, i.e. the logical relationship between sentences and larger chunks of text, performed on a newspaper leader article. The results of this local analysis are then related to the global organisation of text structure with components such as macro- and super-structure by way of int...

  5. Appendiceal Goblet Cell Carcinoids: Management Considerations from a Reference Peritoneal Tumour Service Centre and ENETS Centre of Excellence.

    Science.gov (United States)

    Lamarca, Angela; Nonaka, Daisuke; Lopez Escola, Cristina; Hubner, Richard A; O'Dwyer, Sarah; Chakrabarty, Bipasha; Fulford, Paul; Valle, Juan W

    2016-01-01

    Appendix goblet cell carcinoids are known to share histological features of adenocarcinoma and neuroendocrine tumours. Due to their low incidence, quality evidence is lacking for the management of these patients. We performed a single-centre retrospective study of patients with a confirmed diagnosis of appendiceal goblet cell carcinoid (GCC; 1996-2014). Patients were divided into curative intent (CI) and palliative intent (PI) cohorts. Our primary end point was overall survival (OS). Seventy-four patients were eligible; 76% were treated with CI [surgery only (36%), cytoreductive surgery (CRS) and hyperthermic intra-peritoneal chemotherapy (HIPEC; 36%), adjuvant chemotherapy (20%) and a combination of CRS and HIPEC followed by adjuvant chemotherapy (9%)], and 23% had advanced-stage disease amenable to palliative treatment (chemotherapy or supportive care) only. Completion right hemicolectomy, performed in 64% of the CI cohort, did not impact on the relapse rate or disease-free survival. FOLFOX chemotherapy was used in both the adjuvant and palliative settings; safety was as expected, and we observed a high rate (60%) of disease control in the palliative cohort. The estimated median OS (all patients), disease-free survival (CI patients) and progression-free survival (PI patients) were 52.1 (95% CI 29.4-90.3), 75.9 (26.6-not reached) and 5.3 (0.6-5.7) months, respectively. Age and stage were independent factors associated with OS in the multivariable analysis. Tang classification showed a trend for impact on OS. No benefit from specific adjuvant approach was identified; however, selection bias for treatment approach was observed. Prospective trials are needed to define optimal approaches in GCC. All GCC patients should be managed by specialized centres due to their esoteric behaviour; we provide management considerations based on our experience and conclusions. © 2015 S. Karger AG, Basel.

  6. Site characterization plan: Conceptual design report: Volume 4, Appendices F-O: Nevada Nuclear Waste Storage Investigations Project

    Energy Technology Data Exchange (ETDEWEB)

    MacDougall, H R; Scully, L W; Tillerson, J R [comps.

    1987-09-01

    The site for the prospective repository is located at Yucca Mountain in southwestern Nevada, and the waste emplacement area will be constructed in the underlying volcanic tuffs. The target horizon for waste emplacement is a sloping bed of densely welded tuff more than 650 ft below the surface and typically more than 600 ft above the water table. The conceptual design described in this report is unique among repository designs in that it uses ramps in addition to shafts to gain access to the underground facility, the emplacement horizon is located above the water table, and it is possible that 300- to 400-ft-long horizontal waste emplacement boreholes will be used. This report summarizes the design bases, design and performance criteria, and the design analyses performed. The current status of meeting the preclosure performance objectives for licensing and of resolving the repository design and preclosure issues is presented. The repository design presented in this report will be expanded and refined during the advanced conceptual design, the license application design, and the final procurement and construction design phases. Volume 4 contains Appendices F to O.

  7. Site characterization plan: Conceptual design report: Volume 4, Appendices F-O: Nevada Nuclear Waste Storage Investigations Project

    International Nuclear Information System (INIS)

    MacDougall, H.R.; Scully, L.W.; Tillerson, J.R.

    1987-09-01

    The site for the prospective repository is located at Yucca Mountain in southwestern Nevada, and the waste emplacement area will be constructed in the underlying volcanic tuffs. The target horizon for waste emplacement is a sloping bed of densely welded tuff more than 650 ft below the surface and typically more than 600 ft above the water table. The conceptual design described in this report is unique among repository designs in that it uses ramps in addition to shafts to gain access to the underground facility, the emplacement horizon is located above the water table, and it is possible that 300- to 400-ft-long horizontal waste emplacement boreholes will be used. This report summarizes the design bases, design and performance criteria, and the design analyses performed. The current status of meeting the preclosure performance objectives for licensing and of resolving the repository design and preclosure issues is presented. The repository design presented in this report will be expanded and refined during the advanced conceptual design, the license application design, and the final procurement and construction design phases. Volume 4 contains Appendices F to O

  8. Text Messaging Interventions on Cancer Screening Rates: A Systematic Review.

    Science.gov (United States)

    Uy, Catherine; Lopez, Jennifer; Trinh-Shevrin, Chau; Kwon, Simona C; Sherman, Scott E; Liang, Peter S

    2017-08-24

    Despite high-quality evidence demonstrating that screening reduces mortality from breast, cervical, colorectal, and lung cancers, a substantial portion of the population remains inadequately screened. There is a critical need to identify interventions that increase the uptake and adoption of evidence-based screening guidelines for preventable cancers at the community practice level. Text messaging (short message service, SMS) has been effective in promoting behavioral change in various clinical settings, but the overall impact and reach of text messaging interventions on cancer screening are unknown. The objective of this systematic review was to assess the effect of text messaging interventions on screening for breast, cervical, colorectal, and lung cancers. We searched multiple databases for studies published between the years 2000 and 2017, including PubMed, EMBASE, and the Cochrane Library, to identify controlled trials that measured the effect of text messaging on screening for breast, cervical, colorectal, or lung cancers. Study quality was evaluated using the Cochrane risk of bias tool. Our search yielded 2238 citations, of which 31 underwent full review and 9 met inclusion criteria. Five studies examined screening for breast cancer, one for cervical cancer, and three for colorectal cancer. No studies were found for lung cancer screening. Absolute screening rates for individuals who received text message interventions were 0.6% to 15.0% higher than for controls. Unadjusted relative screening rates for text message recipients were 4% to 63% higher compared with controls. Text messaging interventions appear to moderately increase screening rates for breast and cervical cancer and may have a small effect on colorectal cancer screening. Benefit was observed in various countries, including resource-poor and non-English-speaking populations. Given the paucity of data, additional research is needed to better quantify the effectiveness of this promising intervention

  9. Important Text Characteristics for Early-Grades Text Complexity

    Science.gov (United States)

    Fitzgerald, Jill; Elmore, Jeff; Koons, Heather; Hiebert, Elfrieda H.; Bowen, Kimberly; Sanford-Moore, Eleanor E.; Stenner, A. Jackson

    2015-01-01

    The Common Core set a standard for all children to read increasingly complex texts throughout schooling. The purpose of the present study was to explore text characteristics specifically in relation to early-grades text complexity. Three hundred fifty primary-grades texts were selected and digitized. Twenty-two text characteristics were identified…

  10. Wien Automatic System Package (WASP). A computer code for power generating system expansion planning. Version WASP-III Plus. User's manual. Volume 2: Appendices

    International Nuclear Information System (INIS)

    1995-01-01

    With several Member States, the IAEA has completed a new version of the WASP program, which has been called WASP-Ill Plus since it follows quite closely the methodology of the WASP-Ill model. The major enhancements in WASP-Ill Plus with respect to the WASP-Ill version are: increase in the number of thermal fuel types (from 5 to 10); verification of which configurations generated by CONGEN have already been simulated in previous iterations with MERSIM; direct calculation of combined Loading Order of FIXSYS and VARSYS plants; simulation of system operation includes consideration of physical constraints imposed on some fuel types (i.e., fuel availability for electricity generation); extended output of the resimulation of the optimal solution; generation of a file that can be used for graphical representation of the results of the resimulation of the optimal solution and cash flows of the investment costs; calculation of cash flows allows to include the capital costs of plants firmly committed or in construction (FIXSYS plants); user control of the distribution of capital cost expenditures during the construction period (if required to be different from the general 'S' curve distribution used as default). This second volume of the document to support use of the WASP-Ill Plus computer code consists of 5 appendices giving some additional information about the WASP-Ill Plus program. Appendix A is mainly addressed to the WASP-Ill Plus system analyst and supplies some information which could help in the implementation of the program on the user computer facilities. This appendix also includes some aspects about WASP-Ill Plus that could not be treated in detail in Chapters 1 to 11. Appendix B identifies all error and warning messages that may appear in the WASP printouts and advises the user how to overcome the problem. Appendix C presents the flow charts of the programs along with a brief description of the objectives and structure of each module. Appendix D describes the

  11. Text analysis with R for students of literature

    CERN Document Server

    Jockers, Matthew L

    2014-01-01

    Text Analysis with R for Students of Literature is written with students and scholars of literature in mind but will be applicable to other humanists and social scientists wishing to extend their methodological tool kit to include quantitative and computational approaches to the study of text. Computation provides access to information in text that we simply cannot gather using traditional qualitative methods of close reading and human synthesis. Text Analysis with R for Students of Literature provides a practical introduction to computational text analysis using the open source programming language R. R is extremely popular throughout the sciences and because of its accessibility, R is now used increasingly in other research areas. Readers begin working with text right away and each chapter works through a new technique or process such that readers gain a broad exposure to core R procedures and a basic understanding of the possibilities of computational text analysis at both the micro and macro scale. Each c...

  12. Review of regulatory requirements for digital I and C systems

    Energy Technology Data Exchange (ETDEWEB)

    Kwon, Kee Choon; Lee, Cheol Kwon; Lee, Jang Soo [and others

    2001-11-01

    This work analyzed and summarized systematically various regulatory requirements that are necessary to develop digital nuclear instrumentation and control (I and C) systems, especially safety systems. The requirements are categorized into system, hardware, software, and quality assurance aspects. This report provides the explanations of terms and abbreviations to help readers understand. Furthermore, appendices of this report summarize the code and standards corresponding to each principal regulatory requirement. The hierarchical structure of regulatory requirements has Nuclear Energy Laws, Enforcement Regulations of Nuclear Energy Laws, and Notifications of Ministry of Science and Technology as utmost level requirements [In case of the US, 10 CFR 50 Appendix A, 10 CFR 50 Appendix B, 10 CFR 50.55a(h), 10 CFR 50.49, etc.]. The requirements include the Draft Regulatory Guidelines for Digital I and C Systems [In case of the US, Standard Review Plan (NUREG-0800), Regulatory Guide, Branch Technical Position (BTP)], KEPIC as standards [In case of the US, IEEE Standards, IEC Standards, ISA, Military Standard, etc.], and various reports issued by Korea Institute of Nuclear Safety [In case of the US, NUREG reports, EPRI reports, etc.]. This report can be referred for the development of safety grade control equipment, plant protection system, and engineered safety feature actuation system.

  13. Review of regulatory requirements for digital I and C systems

    International Nuclear Information System (INIS)

    Kwon, Kee Choon; Lee, Cheol Kwon; Lee, Jang Soo

    2001-11-01

    This work analyzed and summarized systematically various regulatory requirements that are necessary to develop digital nuclear instrumentation and control (I and C) systems, especially safety systems. The requirements are categorized into system, hardware, software, and quality assurance aspects. This report provides the explanations of terms and abbreviations to help readers understand. Furthermore, appendices of this report summarize the code and standards corresponding to each principal regulatory requirement. The hierarchical structure of regulatory requirements has Nuclear Energy Laws, Enforcement Regulations of Nuclear Energy Laws, and Notifications of Ministry of Science and Technology as utmost level requirements [In case of the US, 10 CFR 50 Appendix A, 10 CFR 50 Appendix B, 10 CFR 50.55a(h), 10 CFR 50.49, etc.]. The requirements include the Draft Regulatory Guidelines for Digital I and C Systems [In case of the US, Standard Review Plan (NUREG-0800), Regulatory Guide, Branch Technical Position (BTP)], KEPIC as standards [In case of the US, IEEE Standards, IEC Standards, ISA, Military Standard, etc.], and various reports issued by Korea Institute of Nuclear Safety [In case of the US, NUREG reports, EPRI reports, etc.]. This report can be referred for the development of safety grade control equipment, plant protection system, and engineered safety feature actuation system

  14. Mucocele of the appendix in a 77-year-old man with calcinosis, Raynaud’s phenomenon, esophageal dysfunction, sclerodactyly and telangiectasias syndrome

    Directory of Open Access Journals (Sweden)

    Hanen Loukil

    2016-08-01

    Full Text Available Mucocele is an uncommon pathology of the vermiform appendix estimated to be seen in 0.2-0.3%. The term mucocele means dilation of the appendix due to mucus, caused either by a benign or a malignant process. Herein, we report the case of a 77-year-old man with Calcinosis, Raynaud’s phenomenon, Esophageal dysfunction, Sclerodactyly and Telangiectasias syndrome, a limited form of Scleroderma, who had presented an abdominal cyclical pain and in which abdominopelvic computed tomography scan concluded to the diagnosis of appendiceal mucocele. Surgery and histopathology confirmed the diagnosis of mucinous cystadenoma. This association appendiceal mucocele and scleoderma has not been previously reported. The clinical and radiological features of this unusual complication are reviewed.

  15. The Potential of Text Mining in Data Integration and Network Biology for Plant Research: A Case Study on Arabidopsis[C][W

    Science.gov (United States)

    Van Landeghem, Sofie; De Bodt, Stefanie; Drebert, Zuzanna J.; Inzé, Dirk; Van de Peer, Yves

    2013-01-01

    Despite the availability of various data repositories for plant research, a wealth of information currently remains hidden within the biomolecular literature. Text mining provides the necessary means to retrieve these data through automated processing of texts. However, only recently has advanced text mining methodology been implemented with sufficient computational power to process texts at a large scale. In this study, we assess the potential of large-scale text mining for plant biology research in general and for network biology in particular using a state-of-the-art text mining system applied to all PubMed abstracts and PubMed Central full texts. We present extensive evaluation of the textual data for Arabidopsis thaliana, assessing the overall accuracy of this new resource for usage in plant network analyses. Furthermore, we combine text mining information with both protein–protein and regulatory interactions from experimental databases. Clusters of tightly connected genes are delineated from the resulting network, illustrating how such an integrative approach is essential to grasp the current knowledge available for Arabidopsis and to uncover gene information through guilt by association. All large-scale data sets, as well as the manually curated textual data, are made publicly available, hereby stimulating the application of text mining data in future plant biology studies. PMID:23532071

  16. Associated production of $H(b\\bar b, c \\bar c)$ with a $W$ or a $Z$ Boson in ATLAS

    CERN Document Server

    Nielsen, Jason; The ATLAS collaboration

    2018-01-01

    Results are presented from the ATLAS search for Standard Model Higgs bosons decaying to a $b\\bar b$ or $c \\bar c$ pair, produced in association with $W$ or $Z$ bosons. The analyzed data correspond to 36.1 fb$^{-1}$ of 13 TeV proton-proton collision data collected in Run 2 of the Large Hadron Collider. The combination of Run 1 and Run 2 data in the $b\\bar b$ channel yields a ratio of the measured production rate to the SM prediction equal to $0.90 \\pm 0.18 \\text{(stat.)} ^{+0.21}_{-0.19} \\text{(syst.)}$. The observed significance of $3.6\\sigma$ provides evidence for the direct $Hbb$ Yukawa coupling. A similar search for $c \\bar c$ decays results in an upper limit on the production cross section times branching ratio.

  17. Texting preferences in a Paediatric residency.

    Science.gov (United States)

    Draper, Lauren; Kuklinski, Cadence; Ladley, Amy; Adamson, Greg; Broom, Matthew

    2017-12-01

    Text messaging is ubiquitous among residents, but remains an underused educational tool. Though feasibility has been demonstrated, evidence of its ability to improve standardised test scores and provide insight on resident texting preferences is lacking. The authors set out to evaluate: (1) satisfaction with a hybrid question-and-answer (Q&A) texting format; and (2) pre-/post-paediatric in-training exam (ITE) performance. A prospective study with paediatrics and internal medicine-paediatrics residents. Residents were divided into subgroups: adolescent medicine (AM) and developmental medicine (DM). Messages were derived from ITE questions and sent Monday-Friday with a 20 per cent variance in messages specific to the sub-group. Residents completed surveys gauging perceptions of the programme, and pre- and post-programme ITE scores were analysed. Forty-one residents enrolled and 32 (78%) completed a post-programme survey. Of those, 21 (66%) preferred a Q&A format with an immediate text response versus information-only texts. The percentage change in ITE scores between 2013 and 2014 was significant. Comparing subgroups, there was no significant difference between the percentage change in ITE scores. Neither group performed significantly better on either the adolescent or developmental sections of the ITE. Text messaging… remains an underused educational tool CONCLUSIONS: Overall, participants improved their ITE scores, but no improvement was seen in the targeted subgroups on the exam. Although Q&A texts are preferred by residents, further assessment is required to assess the effect on educational outcomes. © 2017 John Wiley & Sons Ltd and The Association for the Study of Medical Education.

  18. Plan for studies of subsurface radionuclide migration at the Radioactive Waste Management Complex of the Idaho National Engineering Laboratory. Volume 2 of 2. Appendices

    International Nuclear Information System (INIS)

    1983-11-01

    This document describes planned studies of subsurface radionuclide migration at the Radioactive Waste Management Complex of the Idaho National Engineering Laboratory. A plan is provided for each proposed study. The rational for arriving at the list of proposed studies is also presented. This document consists of two volumes. In the first volume, Sections 1 through 5 contain the introduction, the objectives of the proposed studies, and background information. The discussion is not comprehensive in detail; documents are referenced that discuss the background material in greater detail. Sections 6 through 9 identify and select the group of studies to be performed and discuss the peer review process. The second volume contains Appendices A and B, which present the assignment of responsibilities and the detailed plans, schedules, and costs for the proposed program

  19. Concurrent acute appendicitis and ileocolic intussusception in a 1-year-old child

    Directory of Open Access Journals (Sweden)

    Lauren Marjon, MD

    2018-06-01

    Full Text Available Intussusception and acute appendicitis are part of a differential diagnosis for acute abdominal pain and vomiting in the pediatric population. We describe a unique case combining appendiceal intussusception with concurrent acute appendicitis, or “appendi-sception.” A 1-year-old boy presented with 1 day of fussiness, vomiting, and red, gelatinous stool. Initial diagnosis on ultrasound was a routine ileocolic intussusception with nonvisualization of the appendix. However, after a failed air enema decompression, the patient was taken to the operating room where the appendix was discovered to be inflamed within the intussusceptum. This case is unique as few cases of both conditions occurring simultaneously have been previously described. It is important for radiologists to be aware of this combination of diagnoses as both require urgent evaluation and prompt treatment. Keywords: Intussusception, Appendicitis, Appendiceal intussusception, Pediatric radiology

  20. A study of immunoglobulins and complements (C3 &C4 in alopecia areata

    Directory of Open Access Journals (Sweden)

    Sharma R

    1995-01-01

    Full Text Available Estimation of serum Immunoglobulins (IgG, IgM and IgA and complements (C3 and C4 was carried out in 100 cases of alopecia areata as per method described by Mancini (1965.[1] Clinically patients were divided in two groups, alopecia areata circumscribed (group I and severe alopecia areata (group II. Significant decrease in levels of one or more Immunoglobulins were observed in most of the patients. However, Serum complements (C3 and C4 were within range of normal control values

  1. Poetic prayer as a "text in text" in Ukrainian Cyrillic editions of the Baroque age

    Directory of Open Access Journals (Sweden)

    Kurhanova O.

    2016-01-01

    Full Text Available The article observes a prayer as a meta-genre of Baroque Ukrainian poetry, found at the pages of Ukrainian Cyrillic religious editions of the late 16th - early 18th centuries. Double nature of baroque poetic prayer is underlined. Poetic prayer originates from the tradition of liturgical prayer and contains it as a "text in text", at the same time poetical prayer is inserted as a "text in text" into the editions, in which it is printed. Two types of semantic connections between baroque poetic prayers and the text of their editions are described. The first type is presented by the poetry, which contains an image of a person, who took part in the text creation and in the process of its edition: the author/editor (in the role of the prayer addresser or the patron of art (in the role of a person, about whom the prayer request was made. The topics of prayer appellations in the poetry of this group are requests for earthly and heavenly boons for the author/editor/patron of the edition, for positive reception of the book; thanksgivings for the help in the book writing/publishing etc. The poetry of the second type contains images, which are central for the text of an edition. These are, as a rule, addressees of the prayer text - God, Saint Virgin, Angels and Saints. The content of a prayer appeal in the poetry of this type is a request for salvation and help in spiritual self-perfection of a lyric hero or a church community. It is defined that the content of poetic prayers, printed at pages of Cyrillic editions of the late 16th - early 18th centuries, was influenced both by text elements of the edition (topic, central images, and by non-textual factors (illustration plot, accompanied by a poem, prayer intention of an author/editor, existence of a patron of edition, different circumstances of editorial process etc.

  2. Text-Fabric

    NARCIS (Netherlands)

    Roorda, Dirk

    2016-01-01

    Text-Fabric is a Python3 package for Text plus Annotations. It provides a data model, a text file format, and a binary format for (ancient) text plus (linguistic) annotations. The emphasis of this all is on: data processing; sharing data; and contributing modules. A defining characteristic is that

  3. A text-mining system for extracting metabolic reactions from full-text articles.

    Science.gov (United States)

    Czarnecki, Jan; Nobeli, Irene; Smith, Adrian M; Shepherd, Adrian J

    2012-07-23

    Increasingly biological text mining research is focusing on the extraction of complex relationships relevant to the construction and curation of biological networks and pathways. However, one important category of pathway - metabolic pathways - has been largely neglected.Here we present a relatively simple method for extracting metabolic reaction information from free text that scores different permutations of assigned entities (enzymes and metabolites) within a given sentence based on the presence and location of stemmed keywords. This method extends an approach that has proved effective in the context of the extraction of protein-protein interactions. When evaluated on a set of manually-curated metabolic pathways using standard performance criteria, our method performs surprisingly well. Precision and recall rates are comparable to those previously achieved for the well-known protein-protein interaction extraction task. We conclude that automated metabolic pathway construction is more tractable than has often been assumed, and that (as in the case of protein-protein interaction extraction) relatively simple text-mining approaches can prove surprisingly effective. It is hoped that these results will provide an impetus to further research and act as a useful benchmark for judging the performance of more sophisticated methods that are yet to be developed.

  4. Valx: A System for Extracting and Structuring Numeric Lab Test Comparison Statements from Text.

    Science.gov (United States)

    Hao, Tianyong; Liu, Hongfang; Weng, Chunhua

    2016-05-17

    To develop an automated method for extracting and structuring numeric lab test comparison statements from text and evaluate the method using clinical trial eligibility criteria text. Leveraging semantic knowledge from the Unified Medical Language System (UMLS) and domain knowledge acquired from the Internet, Valx takes seven steps to extract and normalize numeric lab test expressions: 1) text preprocessing, 2) numeric, unit, and comparison operator extraction, 3) variable identification using hybrid knowledge, 4) variable - numeric association, 5) context-based association filtering, 6) measurement unit normalization, and 7) heuristic rule-based comparison statements verification. Our reference standard was the consensus-based annotation among three raters for all comparison statements for two variables, i.e., HbA1c and glucose, identified from all of Type 1 and Type 2 diabetes trials in ClinicalTrials.gov. The precision, recall, and F-measure for structuring HbA1c comparison statements were 99.6%, 98.1%, 98.8% for Type 1 diabetes trials, and 98.8%, 96.9%, 97.8% for Type 2 diabetes trials, respectively. The precision, recall, and F-measure for structuring glucose comparison statements were 97.3%, 94.8%, 96.1% for Type 1 diabetes trials, and 92.3%, 92.3%, 92.3% for Type 2 diabetes trials, respectively. Valx is effective at extracting and structuring free-text lab test comparison statements in clinical trial summaries. Future studies are warranted to test its generalizability beyond eligibility criteria text. The open-source Valx enables its further evaluation and continued improvement among the collaborative scientific community.

  5. Imaging Depression in Adults With ASD

    Science.gov (United States)

    2015-10-30

    system and environmental stressors contribute to emotional symptoms in higher functioning adults with ASD. Hypotheses: (1) Severity of ASD and emotional...approved SOW. Appendices have been included supporting this account and confidently supporting the successful completion of this project (see Appendices B, C...change Nothing to Report. Actual or anticipated problems or delays and actions or plans to resolve them Please see Appendix B for an account of the

  6. Tumor carcinoide apendicular Appendiceal carcinoid tumor

    Directory of Open Access Journals (Sweden)

    Julio Vázquez Palanco

    2008-12-01

    Full Text Available El objetivo de este trabajo fue dar a conocer un interesante caso de tumor carcinoide que se presentó con cuadro clínico de apendicitis aguda. El paciente fue un varón de 8 años de edad, al cual se realizó apendicectomía a causa de una apendicitis aguda. El resultado anatomopatológico confirmó un tumor de células endocrinas (argentafinoma, tumor carcinoide en el tercio distal del órgano, que infiltraba hasta la serosa, y apendicitis aguda supurada. El paciente fue enviado a un servicio de oncohematología para tratamiento oncoespecífico. Por lo inusual de estos tumores en edades tempranas y por lo que puede representar para el niño una conducta no consecuente, decidimos presentar este caso a la comunidad científica nacional e internacional. Es extremadamente importante el seguimiento de los pacientes con apendicitis aguda y de las conclusiones del examen histológico, por lo que puede representar para el niño una conducta inadecuada en una situación como esta.The objective of this paper was to make known an interesting case of carcinoid tumor that presented a clinical picture of acute appendicitis.The patient was an eight-year-old boy that underwent appendectomy due to an acute appendicitis. The anatomopathological report confirmed an endocrine cell tumor (argentaffinoma, carcinoid tumor in the distal third of the organ that infiltrated up to the serosa, and acute suppurative appendicitis. The patient was referred to an oncohematology service for oncospecific treatment. As it is a rare tumor at early ages, and taking into account what a inconsequent behavior may represent for the child, it was decided to present this case to the national and international scientific community. The follow-up of the patients with acute appendicitis and of the conclusions of the histological examination is extremely important considering what an inadequate conduct may represent for the child in a situation like this.

  7. RSE-M: In-Service Inspection Rules for Mechanical Components of PWR Nuclear Islands

    International Nuclear Information System (INIS)

    2016-01-01

    The RSE-M code defines in-service inspection operations. It applies to pressure equipment used in PWR plants, as well as spare parts for such equipment. The RSE-M code does not apply to equipment made from materials other than metal. It is based on the RCC-M code for requirements relating to the design and fabrication of mechanical components. Use: The inspection rules specified in the RSE-M code describe the standard requirements of best practice within the French nuclear industry, based on its own feedback from operating several nuclear units and partly supplemented with requirements stipulated by French regulations. To date, the 58 units in France's nuclear infrastructure enforce the in-service inspection rules of the RSE-M code. Operation of 30 commissioned units in China's nuclear infrastructure, corresponding to the M310, CPR-1000 and CPR-600 reactors, is based on the RSE-M code (since 2007, use of AFCEN codes has been required by NNSA for Generation II+ reactors). Contents of the 2016 Edition: Volume I - Rules: Section A - General rules, Section B - Specific rules for class 1 components, Section C - Specific rules for class 2 or 3 components, Section D - Specific rules for components not assigned to any particular RSE-M class; Volume II - Appendices 1 to 8: Appendices 1.0 to 1.9: supporting appendices for the general requirements, Appendix 2.1: appendix associated with chap. 2000 Requalifications, Hydraulic Proof Tests and Hydraulic Tests, Appendices 4.1 to 4.4: appendices associated with chap. 4000 Examination techniques, Appendices 5.1 to 5.8 and RPP2: appendices associated with chap. 5000 Mechanical and Materials, Appendices 8.1 to 8.2: appendices associated with chap. 8000 Maintenance Operations; Volume III: Appendix 3.1 - Visit tables: main primary and secondary systems, EPR pre-service inspection program, Class 2 or 3 vessels; Appendix 3.2 - Inspection Plans For Non-Nuclear Pressure Equipment

  8. A Proposed Arabic Handwritten Text Normalization Method

    Directory of Open Access Journals (Sweden)

    Tarik Abu-Ain

    2014-11-01

    Full Text Available Text normalization is an important technique in document image analysis and recognition. It consists of many preprocessing stages, which include slope correction, text padding, skew correction, and straight the writing line. In this side, text normalization has an important role in many procedures such as text segmentation, feature extraction and characters recognition. In the present article, a new method for text baseline detection, straightening, and slant correction for Arabic handwritten texts is proposed. The method comprises a set of sequential steps: first components segmentation is done followed by components text thinning; then, the direction features of the skeletons are extracted, and the candidate baseline regions are determined. After that, selection of the correct baseline region is done, and finally, the baselines of all components are aligned with the writing line.  The experiments are conducted on IFN/ENIT benchmark Arabic dataset. The results show that the proposed method has a promising and encouraging performance.

  9. Pharmspresso: a text mining tool for extraction of pharmacogenomic concepts and relationships from full text.

    Science.gov (United States)

    Garten, Yael; Altman, Russ B

    2009-02-05

    Pharmacogenomics studies the relationship between genetic variation and the variation in drug response phenotypes. The field is rapidly gaining importance: it promises drugs targeted to particular subpopulations based on genetic background. The pharmacogenomics literature has expanded rapidly, but is dispersed in many journals. It is challenging, therefore, to identify important associations between drugs and molecular entities--particularly genes and gene variants, and thus these critical connections are often lost. Text mining techniques can allow us to convert the free-style text to a computable, searchable format in which pharmacogenomic concepts (such as genes, drugs, polymorphisms, and diseases) are identified, and important links between these concepts are recorded. Availability of full text articles as input into text mining engines is key, as literature abstracts often do not contain sufficient information to identify these pharmacogenomic associations. Thus, building on a tool called Textpresso, we have created the Pharmspresso tool to assist in identifying important pharmacogenomic facts in full text articles. Pharmspresso parses text to find references to human genes, polymorphisms, drugs and diseases and their relationships. It presents these as a series of marked-up text fragments, in which key concepts are visually highlighted. To evaluate Pharmspresso, we used a gold standard of 45 human-curated articles. Pharmspresso identified 78%, 61%, and 74% of target gene, polymorphism, and drug concepts, respectively. Pharmspresso is a text analysis tool that extracts pharmacogenomic concepts from the literature automatically and thus captures our current understanding of gene-drug interactions in a computable form. We have made Pharmspresso available at http://pharmspresso.stanford.edu.

  10. Text and ideology: text-oriented discourse analysis

    Directory of Open Access Journals (Sweden)

    Maria Eduarda Gonçalves Peixoto

    2018-04-01

    Full Text Available The article aims to contribute to the understanding of the connection between text and ideology articulated by the text-oriented analysis of discourse (ADTO. Based on the reflections of Fairclough (1989, 2001, 2003 and Fairclough and Chouliaraki (1999, the debate presents the social ontology that ADTO uses to base its conception of social life as an open system and textually mediated; the article then explains the chronological-narrative development of the main critical theories of ideology, by virtue of which ADTO organizes the assumptions that underpin the particular use it makes of the term. Finally, the discussion presents the main aspects of the connection between text and ideology, offering a conceptual framework that can contribute to the domain of the theme according to a critical discourse analysis approach.

  11. Synthesis of 2-substituted tryptophans via a C3- to C2-alkyl migration

    Directory of Open Access Journals (Sweden)

    Michele Mari

    2014-08-01

    Full Text Available The reaction of 3-substituted indoles with dehydroalanine (Dha derivatives under Lewis acid-mediated conditions has been investigated. The formation of 2-substituted tryptophans is proposed to occur through a selective alkylative dearomatization–cyclization followed by C3- to C2-alkyl migration and rearomatization.

  12. A noncommutative convexity in C*-bimodules

    Directory of Open Access Journals (Sweden)

    Mohsen Kian

    2017-02-01

    Full Text Available Let A and B be C*-algebras. We consider a noncommutative convexity in Hilbert A-B-bimodules, called A-B-convexity, as a generalization of C*-convexity in C*-algebras. We show that if X is a Hilbert A-B-bimodule, then Mn(X is a Hilbert Mn(A-Mn(B-bimodule and apply it to show that the closed unit ball of every Hilbert A-B-bimodule is A-B-convex. Some properties of this kind of convexity and various examples have been given.

  13. Laccase-catalyzed C-S and C-C coupling for a one-pot synthesis of 1,4-naphthoquinone sulfides and 1,4-naphthoquinone sulfide dimers

    CSIR Research Space (South Africa)

    Wellington, Kevin W

    2013-06-01

    Full Text Available Oxidative C-S and C-C bond formation with aryl and alkyl thiols was catalyzed under mild conditions in a reaction vessel open to air at pH 4.5 in the presence of a commercial laccase (Novozym 51003 or Suberase) and a cosolvent (DMF) to afford 1...

  14. A. C. conduction behaviour in amorphous WO 3 /CEO 2 thin film ...

    African Journals Online (AJOL)

    A. C. conduction behaviour in amorphous WO3/CEO2 thin film. B Yagoubi, C A Hogarth, A Boukorrt. Abstract. No Abstract. Technologies Avancees Vol. 17 2005: pp. 5-8. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/ta.v17i1.18478.

  15. High-Resolution Ultrasonography (US) of Appendiceal Specimens: Differentiation of Acute Non-perforated Appendicitis from Perforated Appendicitis

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Gyo Chang; Kim, Suk; Im, Han Hyeok; Lee, Sang Jin; Yang, Seung Boo; Lee, Seung Woo; Kim, Il Young [Soonchunhyang University Gumi Hospital, Gumi (Korea, Republic of); Lee, Hae Kyung [Soonchunhyang University Bucheon Hospital, Bucheon (Korea, Republic of); Kwon, Kui Hyang; Shin, Hyung Chul [Soonchunhyang University, College of Medicine, Seoul (Korea, Republic of)

    2007-09-15

    To analyze surgical specimens from patients with acute non-perforated and perforated appendicitis using high-resolution ultrasonography (US), and to correlate the US features with the pathologic findings. One hundred and six surgical appendix specimens obtained from patients with suspected acute appendicitis were evaluated. The following US features were evaluated for differentiating acute non-perforated appendicitis from perforated appendicitis: circumferential loss of the echogenic submucosal layer, disruption of the serosal layer, asymmetrical wall thickening, the sum of opposing walls {>=} 9 mm and the presence of appendicoliths. The sensitivity and specificity of the US findings for diagnosing perforated appendicitis were determined. All US features were detected significantly more often in the perforated appendicitis group of specimens. The disruption of the serosal layer was the most significant independent predictor of perforation (p < .001). The sensitivity for circumferential loss of the echogenic submucosal layer, disruption of the serosal layer, asymmetrical wall thickening, wall thickness {>=} 9 mm, and the presence of appendicoliths individually was 84.6%, 69.2%, 61.5%, 73.1% and 46.2%, respectively. The specificity for all of these findings was 86.3%, 98.7%, 95.0%, 85.0% and 85.0%, respectively. High-resolution US of appendiceal specimens was very useful for differentiating acute non-perforated from perforated appendicitis

  16. A text in Romani from 1622

    DEFF Research Database (Denmark)

    Bakker, Peter

    2015-01-01

    this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212.......this is a reprint of a 2012 article: A new old text in Romani: Lord's Prayer, 1622. International Journal of Romani Language and Culture 2 (2011): 193-212....

  17. Low-grade appendiceal mucinous neoplasm (LAMN) - 3-year endoscopic follow-up underlines benign course of LAMN type 1.

    Science.gov (United States)

    Klag, Thomas; Wehkamp, Jan; Bösmüller, Hans; Falch, Claudius; Johannink, Jonas; Malek, Nisar P; Kirschniak, Andreas; Goetz, Martin

    2017-02-01

    Low-grade appendiceal mucinous neoplasms (LAMNs) are neoplastic lesions with potential progression to pseudomyxoma peritonei (PMP). In most cases, diagnosis is made because of suspected acute appendicitis or incidentally by computed tomography (CT). However, incidental diagnosis during colonoscopy is rare. We present the case of a 63-year-old man with a LAMN type 1 lesion, diagnosed at routine colonoscopy for surveillance of ulcerative colitis. Because in earlier surveillance colonoscopies, this lesion was misinterpreted as fecal polution, for the first time, this case describes retrospectively a 3-year endoscopic follow-up of LAMN type 1, underlining the benign course of these kind of lesions compared to type 2 lesions with submucosal infiltration. Even though endoscopy and sonography are not accepted as method of choice to detect LAMN lesions, our case highlights their role regarding diagnosis of small lesions, as CT scan was not able to detect the lesion in our case. Even though LAMNs are rare, awareness of LAMN lesions in routine colonoscopy is favorable as potential progression to PMP can not be ruled out. © Georg Thieme Verlag KG Stuttgart · New York.

  18. Text Analysis: Critical Component of Planning for Text-Based Discussion Focused on Comprehension of Informational Texts

    Science.gov (United States)

    Kucan, Linda; Palincsar, Annemarie Sullivan

    2018-01-01

    This investigation focuses on a tool used in a reading methods course to introduce reading specialist candidates to text analysis as a critical component of planning for text-based discussions. Unlike planning that focuses mainly on important text content or information, a text analysis approach focuses both on content and how that content is…

  19. A Novel Approach for Arabic Text Steganography Based on the “BloodGroup” Text Hiding Method

    Directory of Open Access Journals (Sweden)

    S. Malalla,

    2017-04-01

    Full Text Available Steganography is the science of hiding certain messages (data in groups of irrelevant data possibly of other form. The purpose of steganography is covert communication to hide the existence of a message from an intermediary. Text Steganography is the process of embedding secret message (text in another text (cover text so that the existence of secret message cannot be detected by a third party. This paper presents a novel approach for text steganography using the Blood Group (BG method based on the behavior of blood group. Experimentally it is found that the proposed method got good results in capacity, hiding capacity, time complexity, robustness, visibility, and similarity which shows its superiority as compared to most several existing methods.

  20. Non-Federal participation in AC Intertie: Final environmental impact statement

    International Nuclear Information System (INIS)

    1994-01-01

    This document contains the appendices for the Non-Federal Participation in AC Intertie Final Environmental Impact Statement. It contains all the supporting materials, documents and data for the EIS in nine appendices: A. Life-of-facilities capacity ownership proposal; B. Long-term Intertie access policy; C. Glossary; D. Biological assessment and supporting materials; E. Environmental impacts of generic resource types; F. Technical information on analysis methods and results; G. Affected environment supporting documentation; H. Public involvement activities; and I. Bibliography

  1. Monitoring interaction and collective text production through text mining

    Directory of Open Access Journals (Sweden)

    Macedo, Alexandra Lorandi

    2014-04-01

    Full Text Available This article presents the Concepts Network tool, developed using text mining technology. The main objective of this tool is to extract and relate terms of greatest incidence from a text and exhibit the results in the form of a graph. The Network was implemented in the Collective Text Editor (CTE which is an online tool that allows the production of texts in synchronized or non-synchronized forms. This article describes the application of the Network both in texts produced collectively and texts produced in a forum. The purpose of the tool is to offer support to the teacher in managing the high volume of data generated in the process of interaction amongst students and in the construction of the text. Specifically, the aim is to facilitate the teacher’s job by allowing him/her to process data in a shorter time than is currently demanded. The results suggest that the Concepts Network can aid the teacher, as it provides indicators of the quality of the text produced. Moreover, messages posted in forums can be analyzed without their content necessarily having to be pre-read.

  2. Dicty_cDB: SFC593 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIIIIIXXHXHX A Frame B: ---sssssssssssssssssssssssssssssssssssssssssssssssssssvxixix l Frame C: ---hhhh...hhhhhhhxhxhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhxssssss s Homology vs CSM-cDNA *****

  3. OntoGene web services for biomedical text mining.

    Science.gov (United States)

    Rinaldi, Fabio; Clematide, Simon; Marques, Hernani; Ellendorff, Tilia; Romacker, Martin; Rodriguez-Esteban, Raul

    2014-01-01

    Text mining services are rapidly becoming a crucial component of various knowledge management pipelines, for example in the process of database curation, or for exploration and enrichment of biomedical data within the pharmaceutical industry. Traditional architectures, based on monolithic applications, do not offer sufficient flexibility for a wide range of use case scenarios, and therefore open architectures, as provided by web services, are attracting increased interest. We present an approach towards providing advanced text mining capabilities through web services, using a recently proposed standard for textual data interchange (BioC). The web services leverage a state-of-the-art platform for text mining (OntoGene) which has been tested in several community-organized evaluation challenges,with top ranked results in several of them.

  4. A Functional Approximation to the “Main Idea” Notion of a Text

    Directory of Open Access Journals (Sweden)

    Germán Morales Chávez

    2014-04-01

    Full Text Available A study was realized where there were evaluated the effects of training 20 students of the first semester of the master in Psychology of the FES Iztacala, to choosing the principal idea in texts, with base in the different levels of reading adjustment proposed by Carpio (1994. Group divided the participants at random in four different groups Control (Group C Group Ajustividad (Group A, Group Relevancy (Group P and Group Coherence (Group Ch. All the groups were exposed to the evaluation 1 and the 2nd and only the group Control was not exposed to a situation of training. The results show that really in agreement to the trained criterion, the pupils choosing as principal ideas those that were constructed by base in the different types of criterion in the one that they were trained. While the identification of the principal idea can be modified by means of the imposition of different criteria of adjustment, he lacks sense to continue speaking about principal idea, provided that the reading performance in correspondence on the type of criterion of adjustment would meet place to different types of ideas, so many people as criteria imposed on the reader.

  5. Text mining with R a tidy approach

    CERN Document Server

    Silge, Julia

    2017-01-01

    Much of the data available today is unstructured and text-heavy, making it challenging for analysts to apply their usual data wrangling and visualization tools. With this practical book, you'll explore text-mining techniques with tidytext, a package that authors Julia Silge and David Robinson developed using the tidy principles behind R packages like ggraph and dplyr. You'll learn how tidytext and other tidy tools in R can make text analysis easier and more effective. The authors demonstrate how treating text as data frames enables you to manipulate, summarize, and visualize characteristics of text. You'll also learn how to integrate natural language processing (NLP) into effective workflows. Practical code examples and data explorations will help you generate real insights from literature, news, and social media. Learn how to apply the tidy text format to NLP Use sentiment analysis to mine the emotional content of text Identify a document's most important terms with frequency measurements E...

  6. PubMedPortable: A Framework for Supporting the Development of Text Mining Applications.

    Science.gov (United States)

    Döring, Kersten; Grüning, Björn A; Telukunta, Kiran K; Thomas, Philippe; Günther, Stefan

    2016-01-01

    Information extraction from biomedical literature is continuously growing in scope and importance. Many tools exist that perform named entity recognition, e.g. of proteins, chemical compounds, and diseases. Furthermore, several approaches deal with the extraction of relations between identified entities. The BioCreative community supports these developments with yearly open challenges, which led to a standardised XML text annotation format called BioC. PubMed provides access to the largest open biomedical literature repository, but there is no unified way of connecting its data to natural language processing tools. Therefore, an appropriate data environment is needed as a basis to combine different software solutions and to develop customised text mining applications. PubMedPortable builds a relational database and a full text index on PubMed citations. It can be applied either to the complete PubMed data set or an arbitrary subset of downloaded PubMed XML files. The software provides the infrastructure to combine stand-alone applications by exporting different data formats, e.g. BioC. The presented workflows show how to use PubMedPortable to retrieve, store, and analyse a disease-specific data set. The provided use cases are well documented in the PubMedPortable wiki. The open-source software library is small, easy to use, and scalable to the user's system requirements. It is freely available for Linux on the web at https://github.com/KerstenDoering/PubMedPortable and for other operating systems as a virtual container. The approach was tested extensively and applied successfully in several projects.

  7. Secondary Torsion of Vermiform Appendix with Mucinous Cystadenoma

    Directory of Open Access Journals (Sweden)

    Maki Kitagawa

    2007-06-01

    Full Text Available Torsion of the vermiform appendix is a rare disorder, which causes abdominal symptoms indistinguishable from acute appendicitis. We report a case (a 34-year-old male of secondary torsion of the vermiform appendix with mucinous cystadenoma. This case was characterized by mild inflammatory responses, pentazocine-resistant abdominal pain, and appendiceal tumor, which was not enhanced by the contrast medium on computed tomography presumably because of reduced blood flow by the torsion. These findings may be helpful for the preoperative diagnosis of secondary appendiceal torsion.

  8. Text Maps: Helping Students Navigate Informational Texts.

    Science.gov (United States)

    Spencer, Brenda H.

    2003-01-01

    Notes that a text map is an instructional approach designed to help students gain fluency in reading content area materials. Discusses how the goal is to teach students about the important features of the material and how the maps can be used to build new understandings. Presents the procedures for preparing and using a text map. (SG)

  9. E-text

    DEFF Research Database (Denmark)

    Finnemann, Niels Ole

    2018-01-01

    text can be defined by taking as point of departure the digital format in which everything is represented in the binary alphabet. While the notion of text, in most cases, lends itself to be independent of medium and embodiment, it is also often tacitly assumed that it is, in fact, modeled around...... the print medium, rather than written text or speech. In late 20th century, the notion of text was subject to increasing criticism as in the question raised within literary text theory: is there a text in this class? At the same time, the notion was expanded by including extra linguistic sign modalities...

  10. Refinery siting workbook: appendices A and B

    Energy Technology Data Exchange (ETDEWEB)

    1980-07-01

    The objective of this effort is to develop and provide basic refinery-related information for use by state and local government officials as a basis for establishing responsible refinery siting requirements and policies consistent with the federal clean air and water standards and socio-economic concerns. The report will be organized into two volumes. The main text comprises the basic topics of physical concerns, regulatory requirements, and permitting activities, while the second volume includes the detailed appendix materials such as the applicable laws, and the necessary permits, as available and a glossary of pertinent terms. As a means to this objective, three refinery sizes, 200,000, 100,000 and 30,000 barrels per day crude charge will be discussed in technical terms. Process unit configuration will be presented which will maximize either gasoline or heating oil production with either sweet or sour crude oil feedstocks. The major issues affecting the socio-economic impact of siting the refinery in a given locale will be presented. These data will review the factors affecting the human environment and the issues that must be addressed to assess the impact that a refinery will have on a community. The key federal registrations which impact upon a refinery siting decision shall be reviewed. Summaries of these regulations and a simplified decision diagram for the air and water acts shall be presented to assist both government and refinery officials in understanding the scope of regulatory impact. All pertinent procedures required for refinery permitting shall be reviewed under the generalized headings of air, water, health and safety, land use, and miscellaneous permits. This categorization at the federal, state and local levels of government shall be used as a basis for establishing degrees of emphasis.

  11. The Instructional Text like a Textual Genre

    Directory of Open Access Journals (Sweden)

    Adiane Fogali Marinello

    2011-07-01

    Full Text Available This article analyses the instructional text as a textual genre and is part of the research called Reading and text production from the textual genre perspective, done at Universidade de Caxias do Sul, Campus Universitário da Região dos Vinhedos. Firstly, some theoretical assumptions about textual genre are presented, then, the instructional text is characterized. After that an instructional text is analyzed and, finally, some activities related to reading and writing of the mentioned genre directed to High School and University students are suggested.

  12. SU-C-BRD-03: Analysis of Accelerator Generated Text Logs for Preemptive Maintenance

    International Nuclear Information System (INIS)

    Able, CM; Baydush, AH; Nguyen, C; Munley, MT; Gersh, J; Ndlovu, A; Rebo, I; Booth, J; Perez, M; Sintay, B

    2014-01-01

    Purpose: To develop a model to analyze medical accelerator generated parameter and performance data that will provide an early warning of performance degradation and impending component failure. Methods: A robust 6 MV VMAT quality assurance treatment delivery was used to test the constancy of accelerator performance. The generated text log files were decoded and analyzed using statistical process control (SPC) methodology. The text file data is a single snapshot of energy specific and overall systems parameters. A total of 36 system parameters were monitored which include RF generation, electron gun control, energy control, beam uniformity control, DC voltage generation, and cooling systems. The parameters were analyzed using Individual and Moving Range (I/MR) charts. The chart limits were calculated using a hybrid technique that included the use of the standard 3σ limits and the parameter/system specification. Synthetic errors/changes were introduced to determine the initial effectiveness of I/MR charts in detecting relevant changes in operating parameters. The magnitude of the synthetic errors/changes was based on: the value of 1 standard deviation from the mean operating parameter of 483 TB systems, a small fraction (≤ 5%) of the operating range, or a fraction of the minor fault deviation. Results: There were 34 parameters in which synthetic errors were introduced. There were 2 parameters (radial position steering coil, and positive 24V DC) in which the errors did not exceed the limit of the I/MR chart. The I chart limit was exceeded for all of the remaining parameters (94.2%). The MR chart limit was exceeded in 29 of the 32 parameters (85.3%) in which the I chart limit was exceeded. Conclusion: Statistical process control I/MR evaluation of text log file parameters may be effective in providing an early warning of performance degradation or component failure for digital medical accelerator systems. Research is Supported by Varian Medical Systems, Inc

  13. SU-C-BRD-03: Analysis of Accelerator Generated Text Logs for Preemptive Maintenance

    Energy Technology Data Exchange (ETDEWEB)

    Able, CM; Baydush, AH; Nguyen, C; Munley, MT [Wake Forest School of Medicine, Department of Radiation Oncology, Winston Salem, NC (United States); Gersh, J [Gibbs Cancer Center and Research Institute, Spartenburg Regional Medical Ce, Spartenburg, SC (United States); Ndlovu, A; Rebo, I [John Theuer Cancer Center, Hackensack University Medical Center, Hackensack, NJ (United States); Booth, J; Perez, M [North Sydney Cancer Center, Royal North Shore Hospital, Sydney, St Leonards (Australia); Sintay, B [Cone Health Cancer Center, Greensboro, NC (United States)

    2014-06-15

    Purpose: To develop a model to analyze medical accelerator generated parameter and performance data that will provide an early warning of performance degradation and impending component failure. Methods: A robust 6 MV VMAT quality assurance treatment delivery was used to test the constancy of accelerator performance. The generated text log files were decoded and analyzed using statistical process control (SPC) methodology. The text file data is a single snapshot of energy specific and overall systems parameters. A total of 36 system parameters were monitored which include RF generation, electron gun control, energy control, beam uniformity control, DC voltage generation, and cooling systems. The parameters were analyzed using Individual and Moving Range (I/MR) charts. The chart limits were calculated using a hybrid technique that included the use of the standard 3σ limits and the parameter/system specification. Synthetic errors/changes were introduced to determine the initial effectiveness of I/MR charts in detecting relevant changes in operating parameters. The magnitude of the synthetic errors/changes was based on: the value of 1 standard deviation from the mean operating parameter of 483 TB systems, a small fraction (≤ 5%) of the operating range, or a fraction of the minor fault deviation. Results: There were 34 parameters in which synthetic errors were introduced. There were 2 parameters (radial position steering coil, and positive 24V DC) in which the errors did not exceed the limit of the I/MR chart. The I chart limit was exceeded for all of the remaining parameters (94.2%). The MR chart limit was exceeded in 29 of the 32 parameters (85.3%) in which the I chart limit was exceeded. Conclusion: Statistical process control I/MR evaluation of text log file parameters may be effective in providing an early warning of performance degradation or component failure for digital medical accelerator systems. Research is Supported by Varian Medical Systems, Inc.

  14. A Low Cost C8051F006 SoC-Based Quasi-Static C-V Meter for Characterizing Semiconductor Devices

    Directory of Open Access Journals (Sweden)

    Khairurrijal Khairurrijal

    2012-12-01

    Full Text Available Based on a C8051F006 SoC (system on-a-chip, a simple and low cost quasi-static capacitance-voltage (C-V meter was designed and developed to obtain C-V characteristics of semiconductor devices. The developed C-V meter consists of a capacitance meter, a programmable voltage source, a C8051F006 SoC-based slave controller, and a personal computer (PC as a master controller. The communication between the master and slave controllers is facilitated by the RS 232 serial communication. The accuracy of the C-V meter was guaranteed by the calibration functions, which are employed by the program in the PC and obtained through the calibration processes of analog to digital converter (ADC, digital to analog converters (DACs of the C8051F006 SoC, and the programmable voltage source. Examining 33-pF and 1000-pF capacitors as well three different p-n junction diodes, it was found that the capacitances of common capacitors are in the range of specified values and typical C-V curves of p-n junction diodes are achieved.

  15. X-ray astronomy

    International Nuclear Information System (INIS)

    Giacconi, R.; Gursky, H.

    1974-01-01

    This text contains ten chapters and three appendices. Following an introduction, chapters two through five deal with observational techniques, mechanisms for the production of x rays in a cosmic setting, the x-ray sky and solar x-ray emission. Chapters six through ten include compact x-ray sources, supernova remnants, the interstellar medium, extragalactic x-ray sources and the cosmic x-ray background. Interactions of x rays with matter, units and conversion factors and a catalog of x-ray sources comprise the three appendices. (U.S.)

  16. C3a Enhances the Formation of Intestinal Organoids through C3aR1

    Directory of Open Access Journals (Sweden)

    Naoya Matsumoto

    2017-09-01

    Full Text Available C3a is important in the regulation of the immune response as well as in the development of organ inflammation and injury. Furthermore, C3a contributes to liver regeneration but its role in intestinal stem cell function has not been studied. We hypothesized that C3a is important for intestinal repair and regeneration. Intestinal organoid formation, a measure of stem cell capacity, was significantly limited in C3-deficient and C3a receptor (C3aR 1-deficient mice while C3a promoted the growth of organoids from normal mice by supporting Wnt-signaling but not from C3aR1-deficient mice. Similarly, the presence of C3a in media enhanced the expression of the intestinal stem cell marker leucine-rich repeat G-protein-coupled receptor 5 (Lgr5 and of the cell proliferation marker Ki67 in organoids formed from C3-deficient but not from C3aR1-deficient mice. Using Lgr5.egfp mice we showed significant expression of C3 in Lgr5+ intestinal stem cells whereas C3aR1 was expressed on the surface of various intestinal cells. C3 and C3aR1 expression was induced in intestinal crypts in response to ischemia/reperfusion injury. Finally, C3aR1-deficient mice displayed ischemia/reperfusion injury comparable to control mice. These data suggest that C3a through interaction with C3aR1 enhances stem cell expansion and organoid formation and as such may have a role in intestinal regeneration.

  17. Text Mining.

    Science.gov (United States)

    Trybula, Walter J.

    1999-01-01

    Reviews the state of research in text mining, focusing on newer developments. The intent is to describe the disparate investigations currently included under the term text mining and provide a cohesive structure for these efforts. A summary of research identifies key organizations responsible for pushing the development of text mining. A section…

  18. Chapitre 2. Le texte dérivé

    OpenAIRE

    2017-01-01

    Les analyses précédentes indiquent qu’il est difficile de séparer une poétique de l’écriture ou de la réécriture, procès toujours prospectif, de celle du texte. En effet, le texte est aussi le résultat d’une activité poétique. Mais les conceptions de la notion de texte ne sont pas des plus univoques. Appliquées à la réécriture filmique des textes littéraires, elles le sont encore moins. Comment en serait-il autrement ? Le film lui-même, considéré comme production sémiotique, ne semble pas pou...

  19. Teaching Text Structure: Examining the Affordances of Children's Informational Texts

    Science.gov (United States)

    Jones, Cindy D.; Clark, Sarah K.; Reutzel, D. Ray

    2016-01-01

    This study investigated the affordances of informational texts to serve as model texts for teaching text structure to elementary school children. Content analysis of a random sampling of children's informational texts from top publishers was conducted on text structure organization and on the inclusion of text features as signals of text…

  20. The Only Safe SMS Texting Is No SMS Texting.

    Science.gov (United States)

    Toth, Cheryl; Sacopulos, Michael J

    2015-01-01

    Many physicians and practice staff use short messaging service (SMS) text messaging to communicate with patients. But SMS text messaging is unencrypted, insecure, and does not meet HIPAA requirements. In addition, the short and abbreviated nature of text messages creates opportunities for misinterpretation, and can negatively impact patient safety and care. Until recently, asking patients to sign a statement that they understand and accept these risks--as well as having policies, device encryption, and cyber insurance in place--would have been enough to mitigate the risk of using SMS text in a medical practice. But new trends and policies have made SMS text messaging unsafe under any circumstance. This article explains these trends and policies, as well as why only secure texting or secure messaging should be used for physician-patient communication.

  1. Text analysis methods, text analysis apparatuses, and articles of manufacture

    Science.gov (United States)

    Whitney, Paul D; Willse, Alan R; Lopresti, Charles A; White, Amanda M

    2014-10-28

    Text analysis methods, text analysis apparatuses, and articles of manufacture are described according to some aspects. In one aspect, a text analysis method includes accessing information indicative of data content of a collection of text comprising a plurality of different topics, using a computing device, analyzing the information indicative of the data content, and using results of the analysis, identifying a presence of a new topic in the collection of text.

  2. A new perspective on the ICRP's new draft recommendations

    International Nuclear Information System (INIS)

    Clarke, R.

    1990-01-01

    The final text of the new recommendations of the International Commission on Radiation Protection is due to be published in the first quarter of 1991. The recommendations consist of a main text supported by the three major appendices: quantities and units; biological effects of ionising radiation; and criteria for judging the significance of the effects of radiation. Aspects of the report considered here are: risk estimates; radiation detriment including fatal and non-fatal cancers and hereditary defects; the system of protection; dose and risks limits; the concept of a dose constraint; quantities and units. (author)

  3. Mining the Text: 34 Text Features that Can Ease or Obstruct Text Comprehension and Use

    Science.gov (United States)

    White, Sheida

    2012-01-01

    This article presents 34 characteristics of texts and tasks ("text features") that can make continuous (prose), noncontinuous (document), and quantitative texts easier or more difficult for adolescents and adults to comprehend and use. The text features were identified by examining the assessment tasks and associated texts in the national…

  4. SparkText: Biomedical Text Mining on Big Data Framework.

    Directory of Open Access Journals (Sweden)

    Zhan Ye

    Full Text Available Many new biomedical research articles are published every day, accumulating rich information, such as genetic variants, genes, diseases, and treatments. Rapid yet accurate text mining on large-scale scientific literature can discover novel knowledge to better understand human diseases and to improve the quality of disease diagnosis, prevention, and treatment.In this study, we designed and developed an efficient text mining framework called SparkText on a Big Data infrastructure, which is composed of Apache Spark data streaming and machine learning methods, combined with a Cassandra NoSQL database. To demonstrate its performance for classifying cancer types, we extracted information (e.g., breast, prostate, and lung cancers from tens of thousands of articles downloaded from PubMed, and then employed Naïve Bayes, Support Vector Machine (SVM, and Logistic Regression to build prediction models to mine the articles. The accuracy of predicting a cancer type by SVM using the 29,437 full-text articles was 93.81%. While competing text-mining tools took more than 11 hours, SparkText mined the dataset in approximately 6 minutes.This study demonstrates the potential for mining large-scale scientific articles on a Big Data infrastructure, with real-time update from new articles published daily. SparkText can be extended to other areas of biomedical research.

  5. Waste Isolation Pilot Plant disposal phase final supplemental environmental impact statement. Volume 2: Appendices

    International Nuclear Information System (INIS)

    1997-09-01

    The purpose of the Waste Isolation Pilot Plant Disposal Final Supplemental Environmental Impact Statement (SEIS-II) is to provide information on environmental impacts regarding the Department of Energy's (DOE) proposed disposal operations at WIPP. The Proposed Action describes the treatment and disposal of the Basic inventory of TRU waste over a 35-year period. The Action Alternatives proposed the treatment of the Basic Inventory and an Additional Inventory as well as the transportation of the treated waste to WIPP for disposal over a 150- to 190-year period. The three Action Alternatives include the treatment of TRU waste at consolidation sites to meet WIPP planning-basic Waste Acceptance Criteria, the thermal treatment of TRU waste to meet Land Disposal Restrictions, and the treatment of TRU waste by a shred and grout process. SEIS-II evaluates environmental impacts resulting from the various treatment options; the transportation of TRU waste to WIPP using truck, a combination of truck and regular rail service, and a combination of truck and dedicated rail service; and the disposal of this waste in the repository. Evaluated impacts include those to the general environment and to human health. Additional issues associated with the implementation of the alternatives are discussed to provide further understanding of the decisions to be reached and to provide the opportunity for public input on improving DOE's Environmental Management Program. This volume contains the following appendices: Waste inventory; Summary of the waste management programmatic environmental impact statement and its use in determining human health impacts at treatment sites; Air quality; Life-cycle costs and economic impacts; Transportation; Human health; Facility accidents; Long-term consequence analysis for proposed action and action alternatives; Long-term consequence analysis for no action alternative 2; and Updated estimates of the DOE's transuranic waste volumes

  6. Production of [Formula: see text] and [Formula: see text] in p-Pb collisions at [Formula: see text] TeV.

    Science.gov (United States)

    Adamová, D; Aggarwal, M M; Aglieri Rinella, G; Agnello, M; Agrawal, N; Ahammed, Z; Ahmad, S; Ahn, S U; Aiola, S; Akindinov, A; Alam, S N; Albuquerque, D S D; Aleksandrov, D; Alessandro, B; Alexandre, D; Alfaro Molina, R; Alici, A; Alkin, A; Alme, J; Alt, T; Altinpinar, S; Altsybeev, I; Alves Garcia Prado, C; An, M; Andrei, C; Andrews, H A; Andronic, A; Anguelov, V; Anson, C; Antičić, T; Antinori, F; Antonioli, P; Anwar, R; Aphecetche, L; Appelshäuser, H; Arcelli, S; Arnaldi, R; Arnold, O W; Arsene, I C; Arslandok, M; Audurier, B; Augustinus, A; Averbeck, R; Azmi, M D; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Baldisseri, A; Ball, M; Baral, R C; Barbano, A M; Barbera, R; Barile, F; Barioglio, L; Barnaföldi, G G; Barnby, L S; Barret, V; Bartalini, P; Barth, K; Bartke, J; Bartsch, E; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Batista Camejo, A; Batyunya, B; Batzing, P C; Bearden, I G; Beck, H; Bedda, C; Behera, N K; Belikov, I; Bellini, F; Bello Martinez, H; Bellwied, R; Beltran, L G E; Belyaev, V; Bencedi, G; Beole, S; Bercuci, A; Berdnikov, Y; Berenyi, D; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhat, I R; Bhati, A K; Bhattacharjee, B; Bhom, J; Bianchi, L; Bianchi, N; Bianchin, C; Bielčík, J; Bielčíková, J; Bilandzic, A; Biro, G; Biswas, R; Biswas, S; Blair, J T; Blau, D; Blume, C; Boca, G; Bock, F; Bogdanov, A; Boldizsár, L; Bombara, M; Bonomi, G; Bonora, M; Book, J; Borel, H; Borissov, A; Borri, M; Botta, E; Bourjau, C; Braun-Munzinger, P; Bregant, M; Broker, T A; Browning, T A; Broz, M; Brucken, E J; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buhler, P; Buitron, S A I; Buncic, P; Busch, O; Buthelezi, Z; Butt, J B; Buxton, J T; Cabala, J; Caffarri, D; Caines, H; Caliva, A; Calvo Villar, E; Camerini, P; Capon, A A; Carena, F; Carena, W; Carnesecchi, F; Castillo Castellanos, J; Castro, A J; Casula, E A R; Ceballos Sanchez, C; Cerello, P; Chang, B; Chapeland, S; Chartier, M; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Chauvin, A; Cherney, M; Cheshkov, C; Cheynis, B; Chibante Barroso, V; Chinellato, D D; Cho, S; Chochula, P; Choi, K; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Conesa Balbastre, G; Conesa Del Valle, Z; Connors, M E; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortés Maldonado, I; Cortese, P; Cosentino, M R; Costa, F; Costanza, S; Crkovská, J; Crochet, P; Cuautle, E; Cunqueiro, L; Dahms, T; Dainese, A; Danisch, M C; Danu, A; Das, D; Das, I; Das, S; Dash, A; Dash, S; De, S; De Caro, A; de Cataldo, G; de Conti, C; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; De Souza, R D; Degenhardt, H F; Deisting, A; Deloff, A; Deplano, C; Dhankher, P; Di Bari, D; Di Mauro, A; Di Nezza, P; Di Ruzza, B; Diaz Corchero, M A; Dietel, T; Dillenseger, P; Divià, R; Djuvsland, Ø; Dobrin, A; Domenicis Gimenez, D; Dönigus, B; Dordic, O; Drozhzhova, T; Dubey, A K; Dubla, A; Ducroux, L; Duggal, A K; Dupieux, P; Ehlers, R J; Elia, D; Endress, E; Engel, H; Epple, E; Erazmus, B; Erhardt, F; Espagnon, B; Esumi, S; Eulisse, G; Eum, J; Evans, D; Evdokimov, S; Fabbietti, L; Fabris, D; Faivre, J; Fantoni, A; Fasel, M; Feldkamp, L; Feliciello, A; Feofilov, G; Ferencei, J; Fernández Téllez, A; Ferreiro, E G; Ferretti, A; Festanti, A; Feuillard, V J G; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Francisco, A; Frankenfeld, U; Fronze, G G; Fuchs, U; Furget, C; Furs, A; Fusco Girard, M; Gaardhøje, J J; Gagliardi, M; Gago, A M; Gajdosova, K; Gallio, M; Galvan, C D; Gangadharan, D R; Ganoti, P; Gao, C; Garabatos, C; Garcia-Solis, E; Garg, K; Garg, P; Gargiulo, C; Gasik, P; Gauger, E F; Gay Ducati, M B; Germain, M; Ghosh, P; Ghosh, S K; Gianotti, P; Giubellino, P; Giubilato, P; Gladysz-Dziadus, E; Glässel, P; Goméz Coral, D M; Gomez Ramirez, A; Gonzalez, A S; Gonzalez, V; González-Zamora, P; Gorbunov, S; Görlich, L; Gotovac, S; Grabski, V; Graczykowski, L K; Graham, K L; Greiner, L; Grelli, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grion, N; Gronefeld, J M; Grosa, F; Grosse-Oetringhaus, J F; Grosso, R; Gruber, L; Grull, F R; Guber, F; Guernane, R; Guerzoni, B; Gulbrandsen, K; Gunji, T; Gupta, A; Gupta, R; Guzman, I B; Haake, R; Hadjidakis, C; Hamagaki, H; Hamar, G; Hamon, J C; Harris, J W; Harton, A; Hatzifotiadou, D; Hayashi, S; Heckel, S T; Hellbär, E; Helstrup, H; Herghelegiu, A; Herrera Corral, G; Herrmann, F; Hess, B A; Hetland, K F; Hillemanns, H; Hippolyte, B; Hladky, J; Horak, D; Hosokawa, R; Hristov, P; Hughes, C; Humanic, T J; Hussain, N; Hussain, T; Hutter, D; Hwang, D S; Ilkaev, R; Inaba, M; Ippolitov, M; Irfan, M; Isakov, V; Islam, M S; Ivanov, M; Ivanov, V; Izucheev, V; Jacak, B; Jacazio, N; Jacobs, P M; Jadhav, M B; Jadlovska, S; Jadlovsky, J; Jahnke, C; Jakubowska, M J; Janik, M A; Jayarathna, P H S Y; Jena, C; Jena, S; Jercic, M; Jimenez Bustamante, R T; Jones, P G; Jusko, A; Kalinak, P; Kalweit, A; Kang, J H; Kaplin, V; Kar, S; Karasu Uysal, A; Karavichev, O; Karavicheva, T; Karayan, L; Karpechev, E; Kebschull, U; Keidel, R; Keijdener, D L D; Keil, M; Ketzer, B; Mohisin Khan, M; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Khatun, A; Khuntia, A; Kielbowicz, M M; Kileng, B; Kim, D W; Kim, D J; Kim, D; Kim, H; Kim, J S; Kim, J; Kim, M; Kim, M; Kim, S; Kim, T; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, C; Klein, J; Klein-Bösing, C; Klewin, S; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Kofarago, M; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Kondratyuk, E; Konevskikh, A; Kopcik, M; Kour, M; Kouzinopoulos, C; Kovalenko, O; Kovalenko, V; Kowalski, M; Koyithatta Meethaleveedu, G; Králik, I; Kravčáková, A; Krivda, M; Krizek, F; Kryshen, E; Krzewicki, M; Kubera, A M; Kučera, V; Kuhn, C; Kuijer, P G; Kumar, A; Kumar, J; Kumar, L; Kumar, S; Kundu, S; Kurashvili, P; Kurepin, A; Kurepin, A B; Kuryakin, A; Kushpil, S; Kweon, M J; Kwon, Y; La Pointe, S L; La Rocca, P; Lagana Fernandes, C; Lakomov, I; Langoy, R; Lapidus, K; Lara, C; Lardeux, A; Lattuca, A; Laudi, E; Lavicka, R; Lazaridis, L; Lea, R; Leardini, L; Lee, S; Lehas, F; Lehner, S; Lehrbach, J; Lemmon, R C; Lenti, V; Leogrande, E; León Monzón, I; Lévai, P; Li, S; Li, X; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Litichevskyi, V; Ljunggren, H M; Llope, W J; Lodato, D F; Loenne, P I; Loginov, V; Loizides, C; Loncar, P; Lopez, X; López Torres, E; Lowe, A; Luettig, P; Lunardon, M; Luparello, G; Lupi, M; Lutz, T H; Maevskaya, A; Mager, M; Mahajan, S; Mahmood, S M; Maire, A; Majka, R D; Malaev, M; Maldonado Cervantes, I; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manko, V; Manso, F; Manzari, V; Mao, Y; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Margutti, J; Marín, A; Markert, C; Marquard, M; Martin, N A; Martinengo, P; Martinez, J A L; Martínez, M I; Martínez García, G; Martinez Pedreira, M; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Mastroserio, A; Mathis, A M; Matyja, A; Mayer, C; Mazer, J; Mazzilli, M; Mazzoni, M A; Meddi, F; Melikyan, Y; Menchaca-Rocha, A; Meninno, E; Mercado Pérez, J; Meres, M; Mhlanga, S; Miake, Y; Mieskolainen, M M; Mihaylov, D; Mikhaylov, K; Milano, L; Milosevic, J; Mischke, A; Mishra, A N; Miśkowiec, D; Mitra, J; Mitu, C M; Mohammadi, N; Mohanty, B; Montes, E; Moreira De Godoy, D A; Moreno, L A P; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Mühlheim, D; Muhuri, S; Mukherjee, M; Mulligan, J D; Munhoz, M G; Münning, K; Munzer, R H; Murakami, H; Murray, S; Musa, L; Musinsky, J; Myers, C J; Naik, B; Nair, R; Nandi, B K; Nania, R; Nappi, E; Naru, M U; Natal da Luz, H; Nattrass, C; Navarro, S R; Nayak, K; Nayak, R; Nayak, T K; Nazarenko, S; Nedosekin, A; Negrao De Oliveira, R A; Nellen, L; Nesbo, S V; Ng, F; Nicassio, M; Niculescu, M; Niedziela, J; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Noferini, F; Nomokonov, P; Nooren, G; Noris, J C C; Norman, J; Nyanin, A; Nystrand, J; Oeschler, H; Oh, S; Ohlson, A; Okubo, T; Olah, L; Oleniacz, J; Oliveira Da Silva, A C; Oliver, M H; Onderwaater, J; Oppedisano, C; Orava, R; Oravec, M; Ortiz Velasquez, A; Oskarsson, A; Otwinowski, J; Oyama, K; Ozdemir, M; Pachmayer, Y; Pacik, V; Pagano, D; Pagano, P; Paić, G; Pal, S K; Palni, P; Pan, J; Pandey, A K; Panebianco, S; Papikyan, V; Pappalardo, G S; Pareek, P; Park, J; Park, W J; Parmar, S; Passfeld, A; Pathak, S P; Paticchio, V; Patra, R N; Paul, B; Pei, H; Peitzmann, T; Peng, X; Pereira, L G; Pereira Da Costa, H; Peresunko, D; Perez Lezama, E; Peskov, V; Pestov, Y; Petráček, V; Petrov, V; Petrovici, M; Petta, C; Pezzi, R P; Piano, S; Pikna, M; Pillot, P; Pimentel, L O D L; Pinazza, O; Pinsky, L; Piyarathna, D B; Płoskoń, M; Planinic, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Polichtchouk, B; Poljak, N; Poonsawat, W; Pop, A; Poppenborg, H; Porteboeuf-Houssais, S; Porter, J; Pospisil, J; Pozdniakov, V; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puccio, M; Puddu, G; Pujahari, P; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Raha, S; Rajput, S; Rak, J; Rakotozafindrabe, A; Ramello, L; Rami, F; Rana, D B; Raniwala, R; Raniwala, S; Räsänen, S S; Rascanu, B T; Rathee, D; Ratza, V; Ravasenga, I; Read, K F; Redlich, K; Rehman, A; Reichelt, P; Reidt, F; Ren, X; Renfordt, R; Reolon, A R; Reshetin, A; Reygers, K; Riabov, V; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Ristea, C; Rodríguez Cahuantzi, M; Røed, K; Rogochaya, E; Rohr, D; Röhrich, D; Rokita, P S; Ronchetti, F; Ronflette, L; Rosnet, P; Rossi, A; Rotondi, A; Roukoutakis, F; Roy, A; Roy, C; Roy, P; Rubio Montero, A J; Rui, R; Russo, R; Rustamov, A; Ryabinkin, E; Ryabov, Y; Rybicki, A; Saarinen, S; Sadhu, S; Sadovsky, S; Šafařík, K; Saha, S K; Sahlmuller, B; Sahoo, B; Sahoo, P; Sahoo, R; Sahoo, S; Sahu, P K; Saini, J; Sakai, S; Saleh, M A; Salzwedel, J; Sambyal, S; Samsonov, V; Sandoval, A; Sarkar, D; Sarkar, N; Sarma, P; Sas, M H P; Scapparone, E; Scarlassara, F; Scharenberg, R P; Scheid, H S; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schmidt, M O; Schmidt, M; Schukraft, J; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Šefčík, M; Seger, J E; Sekiguchi, Y; Sekihata, D; Selyuzhenkov, I; Senosi, K; Senyukov, S; Serradilla, E; Sett, P; Sevcenco, A; Shabanov, A; Shabetai, A; Shadura, O; Shahoyan, R; Shangaraev, A; Sharma, A; Sharma, A; Sharma, M; Sharma, M; Sharma, N; Sheikh, A I; Shigaki, K; Shou, Q; Shtejer, K; Sibiriak, Y; Siddhanta, S; Sielewicz, K M; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Simonetti, G; Singaraju, R; Singh, R; Singhal, V; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Slupecki, M; Smirnov, N; Snellings, R J M; Snellman, T W; Song, J; Song, M; Soramel, F; Sorensen, S; Sozzi, F; Spiriti, E; Sputowska, I; Srivastava, B K; Stachel, J; Stan, I; Stankus, P; Stenlund, E; Stiller, J H; Stocco, D; Strmen, P; Suaide, A A P; Sugitate, T; Suire, C; Suleymanov, M; Suljic, M; Sultanov, R; Šumbera, M; Sumowidagdo, S; Suzuki, K; Swain, S; Szabo, A; Szarka, I; Szczepankiewicz, A; Szymanski, M; Tabassam, U; Takahashi, J; Tambave, G J; Tanaka, N; Tarhini, M; Tariq, M; Tarzila, M G; Tauro, A; Tejeda Muñoz, G; Telesca, A; Terasaki, K; Terrevoli, C; Teyssier, B; Thakur, D; Thakur, S; Thomas, D; Tieulent, R; Tikhonov, A; Timmins, A R; Toia, A; Tripathy, S; Trogolo, S; Trombetta, G; Trubnikov, V; Trzaska, W H; Trzeciak, B A; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ullaland, K; Umaka, E N; Uras, A; Usai, G L; Utrobicic, A; Vala, M; Van Der Maarel, J; Van Hoorne, J W; van Leeuwen, M; Vanat, T; Vande Vyvre, P; Varga, D; Vargas, A; Vargyas, M; Varma, R; Vasileiou, M; Vasiliev, A; Vauthier, A; Vázquez Doce, O; Vechernin, V; Veen, A M; Velure, A; Vercellin, E; Vergara Limón, S; Vernet, R; Vértesi, R; Vickovic, L; Vigolo, S; Viinikainen, J; Vilakazi, Z; Villalobos Baillie, O; Villatoro Tello, A; Vinogradov, A; Vinogradov, L; Virgili, T; Vislavicius, V; Vodopyanov, A; Völkl, M A; Voloshin, K; Voloshin, S A; Volpe, G; von Haller, B; Vorobyev, I; Voscek, D; Vranic, D; Vrláková, J; Wagner, B; Wagner, J; Wang, H; Wang, M; Watanabe, D; Watanabe, Y; Weber, M; Weber, S G; Weiser, D F; Wessels, J P; Westerhoff, U; Whitehead, A M; Wiechula, J; Wikne, J; Wilk, G; Wilkinson, J; Willems, G A; Williams, M C S; Windelband, B; Witt, W E; Yalcin, S; Yang, P; Yano, S; Yin, Z; Yokoyama, H; Yoo, I-K; Yoon, J H; Yurchenko, V; Zaccolo, V; Zaman, A; Zampolli, C; Zanoli, H J C; Zaporozhets, S; Zardoshti, N; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zhalov, M; Zhang, H; Zhang, X; Zhang, Y; Zhang, C; Zhang, Z; Zhao, C; Zhigareva, N; Zhou, D; Zhou, Y; Zhou, Z; Zhu, H; Zhu, J; Zhu, X; Zichichi, A; Zimmermann, A; Zimmermann, M B; Zimmermann, S; Zinovjev, G; Zmeskal, J

    2017-01-01

    The transverse momentum distributions of the strange and double-strange hyperon resonances ([Formula: see text], [Formula: see text]) produced in p-Pb collisions at [Formula: see text] TeV were measured in the rapidity range [Formula: see text] for event classes corresponding to different charged-particle multiplicity densities, [Formula: see text]d[Formula: see text]/d[Formula: see text]. The mean transverse momentum values are presented as a function of [Formula: see text]d[Formula: see text]/d[Formula: see text], as well as a function of the particle masses and compared with previous results on hyperon production. The integrated yield ratios of excited to ground-state hyperons are constant as a function of [Formula: see text]d[Formula: see text]/d[Formula: see text]. The equivalent ratios to pions exhibit an increase with [Formula: see text]d[Formula: see text]/d[Formula: see text], depending on their strangeness content.

  7. Dynamic Chemical Model for $\\text {H} _2 $/$\\text {O} _2 $ Combustion Developed Through a Community Workflow

    KAUST Repository

    Oreluk, James; Needham, Craig D.; Baskaran, Sathya; Sarathy, Mani; Burke, Michael P.; West, Richard H.; Frenklach, Michael; Westmoreland, Phillip R.

    2018-01-01

    Elementary-reaction models for $\\text{H}_2$/$\\text{O}_2$ combustion were evaluated and optimized through a collaborative workflow, establishing accuracy and characterizing uncertainties. Quantitative findings were the optimized model, the importance of $\\text{H}_2 + \\text{O}_2(1\\Delta) = \\text{H} + \\text{HO}_2$ in high-pressure flames, and the inconsistency of certain low-temperature shock-tube data. The workflow described here is proposed to be even more important because the approach and publicly available cyberinfrastructure allows future community development of evolving improvements. The workflow steps applied here were to develop an initial reaction set using Burke et al. [2012], Burke et al. [2013], Sellevag et al. [2009], and Konnov [2015]; test it for thermodynamic and kinetics consistency and plausibility against other sets in the literature; assign estimated uncertainties where not stated in the sources; select key data targets (

  8. Dynamic Chemical Model for $\\text {H} _2 $/$\\text {O} _2 $ Combustion Developed Through a Community Workflow

    KAUST Repository

    Oreluk, James

    2018-01-30

    Elementary-reaction models for $\\\\text{H}_2$/$\\\\text{O}_2$ combustion were evaluated and optimized through a collaborative workflow, establishing accuracy and characterizing uncertainties. Quantitative findings were the optimized model, the importance of $\\\\text{H}_2 + \\\\text{O}_2(1\\\\Delta) = \\\\text{H} + \\\\text{HO}_2$ in high-pressure flames, and the inconsistency of certain low-temperature shock-tube data. The workflow described here is proposed to be even more important because the approach and publicly available cyberinfrastructure allows future community development of evolving improvements. The workflow steps applied here were to develop an initial reaction set using Burke et al. [2012], Burke et al. [2013], Sellevag et al. [2009], and Konnov [2015]; test it for thermodynamic and kinetics consistency and plausibility against other sets in the literature; assign estimated uncertainties where not stated in the sources; select key data targets (

  9. Philosophy of arithmetic psychological and logical investigations with supplementary texts from 1887–1901

    CERN Document Server

    Husserl, Edmund

    2003-01-01

    In his first book, Philosophy of Arithmetic, Edmund Husserl provides a carefully worked out account of number as a categorial or formal feature of the objective world, and of arithmetic as a symbolic technique for mastering the infinite field of numbers for knowledge. It is a realist account of numbers and number relations that interweaves them into the basic structure of the universe and into our knowledge of reality. It provides an answer to the question of how arithmetic applies to reality, and gives an account of how, in general, formalized systems of symbols work in providing access to the world. The "appendices" to this book provide some of Husserl's subsequent discussions of how formalisms work, involving David Hilbert's program of completeness for arithmetic. "Completeness" is integrated into Husserl's own problematic of the "imaginary", and allows him to move beyond the analysis of "representations" in his understanding of the logic of mathematics. Husserl's work here provides an alternative model of...

  10. SparkText: Biomedical Text Mining on Big Data Framework.

    Science.gov (United States)

    Ye, Zhan; Tafti, Ahmad P; He, Karen Y; Wang, Kai; He, Max M

    Many new biomedical research articles are published every day, accumulating rich information, such as genetic variants, genes, diseases, and treatments. Rapid yet accurate text mining on large-scale scientific literature can discover novel knowledge to better understand human diseases and to improve the quality of disease diagnosis, prevention, and treatment. In this study, we designed and developed an efficient text mining framework called SparkText on a Big Data infrastructure, which is composed of Apache Spark data streaming and machine learning methods, combined with a Cassandra NoSQL database. To demonstrate its performance for classifying cancer types, we extracted information (e.g., breast, prostate, and lung cancers) from tens of thousands of articles downloaded from PubMed, and then employed Naïve Bayes, Support Vector Machine (SVM), and Logistic Regression to build prediction models to mine the articles. The accuracy of predicting a cancer type by SVM using the 29,437 full-text articles was 93.81%. While competing text-mining tools took more than 11 hours, SparkText mined the dataset in approximately 6 minutes. This study demonstrates the potential for mining large-scale scientific articles on a Big Data infrastructure, with real-time update from new articles published daily. SparkText can be extended to other areas of biomedical research.

  11. Tank Vapor Characterization Project: Headspace vapor characterization of Hanford Waste Tank 241-C-204: Results from samples collected on 07/02/96

    International Nuclear Information System (INIS)

    Thomas, B.L.; Evans, J.C.; Pool, K.H.

    1997-01-01

    This report describes the analytical results of vapor samples taken from the headspace of the waste storage tank 241-C-204 (Tank C-204) at the Hanford Site in Washington State. The results described in this report were obtained to characterize the vapors present in the tank headspace and to support safety evaluations and tank farm operations. The results include air concentrations of selected inorganic and organic analytes and grouped compounds from samples obtained by Westinghouse Hanford Company (WHC) and provided for analysis to Pacific Northwest National Laboratory (PNNL). Analyses were performed by the Vapor Analytical Laboratory (VAL) at PNNL. Analyte concentrations were based on analytical results and, where appropriate, sample volumes provided by WHC. A summary of the inorganic analytes, permanent gases, and total non-methane organic compounds is listed in Table S.1. The three highest concentration analytes detected in SUMMA trademark canister and triple sorbent trap samples are also listed in Table S.1. Detailed descriptions of the analytical results appear in the appendices

  12. Dicty_cDB: VFM647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XYMGGVFDFPCGQTLDHGILIVGYGAQ DTIVGKNTPYWIIKNSWGADWGEAGYLKV Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxwxxx...xxxxxhhqkxryxnxsylsixcc*wrm*i*lcxswc*n fifhygstk*nsncflliqqwsisycs*c*rmaixygrcfrfpm...IIKNSWGADWGEAGYLKV Frame C: ---xxxxxxxxxxxxxxvvxxxmxxxtsskxxvxkxklpihtxllmenvnltlxklvlkf hlslwfhkmklkllptyst

  13. Final Remedial Investigation/Baseline Risk Assessment for the Ravines and Beach Area Study of the Surplus Operable Unit, Fort Sheridan, Illinois. Volume 1: RI Text and RI Appendices A-I.

    Science.gov (United States)

    1998-04-13

    ecoCOPCs (laboratory or field studies) for impairment of amphibian reproductive success . • Measurement Endpoint 3— results of site-specific fathead...Date: \\C\\2\\ \\Q^ Jcalculator Used: ’"\\(-Q).Q Form: Lc )ADII IG Ikeas . Dev.: t-e-ica Balance Used: SP I S O Aquatic

  14. Early Site Permit Demonstration Program: Guidelines for determining design basis ground motions. Volume 2, Appendices

    Energy Technology Data Exchange (ETDEWEB)

    1993-03-18

    This report develops and applies a methodology for estimating strong earthquake ground motion. The motivation was to develop a much needed tool for use in developing the seismic requirements for structural designs. An earthquake`s ground motion is a function of the earthquake`s magnitude, and the physical properties of the earth through which the seismic waves travel from the earthquake fault to the site of interest. The emphasis of this study is on ground motion estimation in Eastern North America (east of the Rocky Mountains), with particular emphasis on the Eastern United States and southeastern Canada. Eastern North America is a stable continental region, having sparse earthquake activity with rare occurrences of large earthquakes. While large earthquakes are of interest for assessing seismic hazard, little data exists from the region to empirically quantify their effects. The focus of the report is on the attributes of ground motion in Eastern North America that are of interest for the design of facilities such as nuclear power plants. This document, Volume II, contains Appendices 2, 3, 5, 6, and 7 covering the following topics: Eastern North American Empirical Ground Motion Data; Examination of Variance of Seismographic Network Data; Soil Amplification and Vertical-to-Horizontal Ratios from Analysis of Strong Motion Data From Active Tectonic Regions; Revision and Calibration of Ou and Herrmann Method; Generalized Ray Procedure for Modeling Ground Motion Attenuation; Crustal Models for Velocity Regionalization; Depth Distribution Models; Development of Generic Site Effects Model; Validation and Comparison of One-Dimensional Site Response Methodologies; Plots of Amplification Factors; Assessment of Coupling Between Vertical & Horizontal Motions in Nonlinear Site Response Analysis; and Modeling of Dynamic Soil Properties.

  15. Dicty_cDB: CHJ780 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: iqkcqinkkkkkkn*kkfx*vxkgxsfxkkkkxpxfffxkkxxkxkkkkxkkxxxxxprg lxkkkxxxkkxkkxxkkkkkxkktf*xpxxx...fggxxkxxxxgxxppxxxxxxpxpxkxwx pxkxxpxxxxggtpxxxxxlfxxxxpxfxkkxflkkkkxkktffxxff*kxxxkk-...--- Frame C: skmsnk*kkkkkklkkilxgxkrx*f*xkkkkxpfffx*kkxkxkkkkxkkxxxxxxpga xkkkkxxkkkxkxxkkkkkxkknxlxppxxfwgxxxxkxxggxxpxxxxxx...ppxxkxlxp pxxgpxxxpggnpxxxxxxfxxxkxxfxxkxffkkkkxxknffxxfflkxxxkk--- Homology vs CSM-cDNA Sc

  16. SparkText: Biomedical Text Mining on Big Data Framework

    Science.gov (United States)

    He, Karen Y.; Wang, Kai

    2016-01-01

    Background Many new biomedical research articles are published every day, accumulating rich information, such as genetic variants, genes, diseases, and treatments. Rapid yet accurate text mining on large-scale scientific literature can discover novel knowledge to better understand human diseases and to improve the quality of disease diagnosis, prevention, and treatment. Results In this study, we designed and developed an efficient text mining framework called SparkText on a Big Data infrastructure, which is composed of Apache Spark data streaming and machine learning methods, combined with a Cassandra NoSQL database. To demonstrate its performance for classifying cancer types, we extracted information (e.g., breast, prostate, and lung cancers) from tens of thousands of articles downloaded from PubMed, and then employed Naïve Bayes, Support Vector Machine (SVM), and Logistic Regression to build prediction models to mine the articles. The accuracy of predicting a cancer type by SVM using the 29,437 full-text articles was 93.81%. While competing text-mining tools took more than 11 hours, SparkText mined the dataset in approximately 6 minutes. Conclusions This study demonstrates the potential for mining large-scale scientific articles on a Big Data infrastructure, with real-time update from new articles published daily. SparkText can be extended to other areas of biomedical research. PMID:27685652

  17. Dicty_cDB: CHR636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available p 8. 48 0.50 1 CO165293 |CO165293.1 FLD1_53_C12.g1_A029 Root flooded Pinus taeda cDNA clone FLD1_53_C12_A029... 5', mRNA sequence. 46 2.0 1 CO165215 |CO165215.1 FLD1_53_C12.b1_A029 Root floode

  18. Observation of [Formula: see text] and [Formula: see text] decays.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Ajaltouni, Z; Akar, S; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Andreassi, G; Andreotti, M; Andrews, J E; Appleby, R B; Archilli, F; d'Argent, P; Arnau Romeu, J; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Babuschkin, I; Bachmann, S; Back, J J; Badalov, A; Baesso, C; Baker, S; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Baszczyk, M; Batozskaya, V; Batsukh, B; Battista, V; Bay, A; Beaucourt, L; Beddow, J; Bedeschi, F; Bediaga, I; Bel, L J; Bellee, V; Belloli, N; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bertolin, A; Betancourt, C; Betti, F; Bettler, M-O; van Beuzekom, M; Bezshyiko, Ia; Bifani, S; Billoir, P; Bird, T; Birnkraut, A; Bitadze, A; Bizzeti, A; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Boettcher, T; Bondar, A; Bondar, N; Bonivento, W; Bordyuzhin, I; Borgheresi, A; Borghi, S; Borisyak, M; Borsato, M; Bossu, F; Boubdir, M; Bowcock, T J V; Bowen, E; Bozzi, C; Braun, S; Britsch, M; Britton, T; Brodzicka, J; Buchanan, E; Burr, C; Bursche, A; Buytaert, J; Cadeddu, S; Calabrese, R; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D H; Capriotti, L; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carniti, P; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cavallero, G; Cenci, R; Charles, M; Charpentier, Ph; Chatzikonstantinidis, G; Chefdeville, M; Chen, S; Cheung, S-F; Chobanova, V; Chrzaszcz, M; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coco, V; Cogan, J; Cogneras, E; Cogoni, V; Cojocariu, L; Collazuol, G; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombs, G; Coquereau, S; Corti, G; Corvo, M; Costa Sobral, C M; Couturier, B; Cowan, G A; Craik, D C; Crocombe, A; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Da Cunha Marinho, F; Dall'Occo, E; Dalseno, J; David, P N Y; Davis, A; De Aguiar Francisco, O; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Serio, M; De Simone, P; Dean, C-T; Decamp, D; Deckenhoff, M; Del Buono, L; Demmer, M; Dendek, A; Derkach, D; Deschamps, O; Dettori, F; Dey, B; Di Canto, A; Dijkstra, H; Dordei, F; Dorigo, M; Dosil Suárez, A; Dovbnya, A; Dreimanis, K; Dufour, L; Dujany, G; Dungs, K; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Déléage, N; Easo, S; Ebert, M; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; Ely, S; Esen, S; Evans, H M; Evans, T; Falabella, A; Farley, N; Farry, S; Fay, R; Fazzini, D; Ferguson, D; Fernandez Prieto, A; Ferrari, F; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fini, R A; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fleuret, F; Fohl, K; Fontana, M; Fontanelli, F; Forshaw, D C; Forty, R; Franco Lima, V; Frank, M; Frei, C; Fu, J; Furfaro, E; Färber, C; Gallas Torreira, A; Galli, D; Gallorini, S; Gambetta, S; Gandelman, M; Gandini, P; Gao, Y; Garcia Martin, L M; García Pardiñas, J; Garra Tico, J; Garrido, L; Garsed, P J; Gascon, D; Gaspar, C; Gavardi, L; Gazzoni, G; Gerick, D; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianì, S; Gibson, V; Girard, O G; Giubega, L; Gizdov, K; Gligorov, V V; Golubkov, D; Golutvin, A; Gomes, A; Gorelov, I V; Gotti, C; Govorkova, E; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graverini, E; Graziani, G; Grecu, A; Griffith, P; Grillo, L; Gruberg Cazon, B R; Grünberg, O; Gushchin, E; Guz, Yu; Gys, T; Göbel, C; Hadavizadeh, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hatch, M; He, J; Head, T; Heister, A; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hombach, C; Hopchev, H; Hulsbergen, W; Humair, T; Hushchyn, M; Hussain, N; Hutchcroft, D; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jawahery, A; Jiang, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kandybei, S; Kanso, W; Karacson, M; Kariuki, J M; Karodia, S; Kecke, M; Kelsey, M; Kenyon, I R; Kenzie, M; Ketel, T; Khairullin, E; Khanji, B; Khurewathanakul, C; Kirn, T; Klaver, S; Klimaszewski, K; Koliiev, S; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Kosmyntseva, A; Kozachuk, A; Kozeiha, M; Kravchuk, L; Kreplin, K; Kreps, M; Krokovny, P; Kruse, F; Krzemien, W; Kucewicz, W; Kucharczyk, M; Kudryavtsev, V; Kuonen, A K; Kurek, K; Kvaratskheliya, T; Lacarrere, D; Lafferty, G; Lai, A; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Leflat, A; Lefrançois, J; Lefèvre, R; Lemaitre, F; Lemos Cid, E; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Likhomanenko, T; Lindner, R; Linn, C; Lionetto, F; Liu, B; Liu, X; Loh, D; Longstaff, I; Lopes, J H; Lucchesi, D; Lucio Martinez, M; Luo, H; Lupato, A; Luppi, E; Lupton, O; Lusiani, A; Lyu, X; Machefert, F; Maciuc, F; Maev, O; Maguire, K; Malde, S; Malinin, A; Maltsev, T; Manca, G; Mancinelli, G; Manning, P; Maratas, J; Marchand, J F; Marconi, U; Marin Benito, C; Marino, P; Marks, J; Martellotti, G; Martin, M; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massacrier, L M; Massafferri, A; Matev, R; Mathad, A; Mathe, Z; Matteuzzi, C; Mauri, A; Maurin, B; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; Meadows, B; Meier, F; Meissner, M; Melnychuk, D; Merk, M; Merli, A; Michielin, E; Milanes, D A; Minard, M-N; Mitzel, D S; Mogini, A; Molina Rodriguez, J; Monroy, I A; Monteil, S; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Morris, A B; Mountain, R; Muheim, F; Mulder, M; Mussini, M; Müller, D; Müller, J; Müller, K; Müller, V; Naik, P; Nakada, T; Nandakumar, R; Nandi, A; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nieswand, S; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; O'Hanlon, D P; Oblakowska-Mucha, A; Obraztsov, V; Ogilvy, S; Oldeman, R; Onderwater, C J G; Otalora Goicochea, J M; Otto, A; Owen, P; Oyanguren, A; Pais, P R; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Pappalardo, L L; Parker, W; Parkes, C; Passaleva, G; Pastore, A; Patel, G D; Patel, M; Patrignani, C; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perret, P; Pescatore, L; Petridis, K; Petrolini, A; Petrov, A; Petruzzo, M; Picatoste Olloqui, E; Pietrzyk, B; Pikies, M; Pinci, D; Pistone, A; Piucci, A; Playfer, S; Plo Casasus, M; Poikela, T; Polci, F; Poluektov, A; Polyakov, I; Polycarpo, E; Pomery, G J; Popov, A; Popov, D; Popovici, B; Poslavskii, S; Potterat, C; Price, E; Price, J D; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Quagliani, R; Rachwal, B; Rademacker, J H; Rama, M; Ramos Pernas, M; Rangel, M S; Raniuk, I; Ratnikov, F; Raven, G; Redi, F; Reichert, S; Dos Reis, A C; Remon Alepuz, C; Renaudin, V; Ricciardi, S; Richards, S; Rihl, M; Rinnert, K; Rives Molina, V; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Lopez, J A; Rodriguez Perez, P; Rogozhnikov, A; Roiser, S; Rollings, A; Romanovskiy, V; Romero Vidal, A; Ronayne, J W; Rotondo, M; Rudolph, M S; Ruf, T; Ruiz Valls, P; Saborido Silva, J J; Sadykhov, E; Sagidova, N; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santimaria, M; Santovetti, E; Sarti, A; Satriano, C; Satta, A; Saunders, D M; Savrina, D; Schael, S; Schellenberg, M; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmelzer, T; Schmidt, B; Schneider, O; Schopper, A; Schubert, K; Schubiger, M; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Semennikov, A; Sergi, A; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Siddi, B G; Silva Coutinho, R; Silva de Oliveira, L; Simi, G; Simone, S; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, E; Smith, I T; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Souza De Paula, B; Spaan, B; Spradlin, P; Sridharan, S; Stagni, F; Stahl, M; Stahl, S; Stefko, P; Stefkova, S; Steinkamp, O; Stemmle, S; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Sun, L; Sutcliffe, W; Swientek, K; Syropoulos, V; Szczekowski, M; Szumlak, T; T'Jampens, S; Tayduganov, A; Tekampe, T; Tellarini, G; Teubert, F; Thomas, E; van Tilburg, J; Tilley, M J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Toriello, F; Tournefier, E; Tourneur, S; Trabelsi, K; Traill, M; Tran, M T; Tresch, M; Trisovic, A; Tsaregorodtsev, A; Tsopelas, P; Tully, A; Tuning, N; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vacca, C; Vagnoni, V; Valassi, A; Valat, S; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; van Veghel, M; Velthuis, J J; Veltri, M; Veneziano, G; Venkateswaran, A; Vernet, M; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Viemann, H; Vilasis-Cardona, X; Vitti, M; Volkov, V; Vollhardt, A; Voneki, B; Vorobyev, A; Vorobyev, V; Voß, C; de Vries, J A; Vázquez Sierra, C; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wang, J; Ward, D R; Wark, H M; Watson, N K; Websdale, D; Weiden, A; Whitehead, M; Wicht, J; Wilkinson, G; Wilkinson, M; Williams, M; Williams, M P; Williams, M; Williams, T; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wraight, K; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yin, H; Yu, J; Yuan, X; Yushchenko, O; Zarebski, K A; Zavertyaev, M; Zhang, L; Zhang, Y; Zhang, Y; Zhelezov, A; Zheng, Y; Zhokhov, A; Zhu, X; Zhukov, V; Zucchelli, S

    2017-01-01

    The decays [Formula: see text] and [Formula: see text] are observed for the first time using a data sample corresponding to an integrated luminosity of 3.0 fb[Formula: see text], collected by the LHCb experiment in proton-proton collisions at the centre-of-mass energies of 7 and 8[Formula: see text]. The branching fractions relative to that of [Formula: see text] are measured to be [Formula: see text]where the first uncertainties are statistical and the second are systematic.

  19. Drugs affecting HbA1c levels

    Directory of Open Access Journals (Sweden)

    Ranjit Unnikrishnan

    2012-01-01

    Full Text Available Glycated hemoglobin (HbA1c is an important indicator of glycemic control in diabetes mellitus, based on which important diagnostic and therapeutic decisions are routinely made. However, there are several situations in which the level of HbA1c may not faithfully reflect the glycemic control in a given patient. Important among these is the use of certain non-diabetic medications, which can affect the HbA1c levels in different ways. This review focuses on the non-diabetic medications which can inappropriately raise or lower the HbA1c levels, and the postulated mechanisms for the same.

  20. Working with text tools, techniques and approaches for text mining

    CERN Document Server

    Tourte, Gregory J L

    2016-01-01

    Text mining tools and technologies have long been a part of the repository world, where they have been applied to a variety of purposes, from pragmatic aims to support tools. Research areas as diverse as biology, chemistry, sociology and criminology have seen effective use made of text mining technologies. Working With Text collects a subset of the best contributions from the 'Working with text: Tools, techniques and approaches for text mining' workshop, alongside contributions from experts in the area. Text mining tools and technologies in support of academic research include supporting research on the basis of a large body of documents, facilitating access to and reuse of extant work, and bridging between the formal academic world and areas such as traditional and social media. Jisc have funded a number of projects, including NaCTem (the National Centre for Text Mining) and the ResDis programme. Contents are developed from workshop submissions and invited contributions, including: Legal considerations in te...

  1. Speect: a multilingual text-to-speech system

    CSIR Research Space (South Africa)

    Louw, JA

    2008-11-01

    Full Text Available This paper introduces a new multilingual text-to-speech system, which we call Speect (Speech synthesis with extensible architecture), aiming to address the shortcomings of using Festival as a research sytem and Flite as a deployment system in a...

  2. Text mining from ontology learning to automated text processing applications

    CERN Document Server

    Biemann, Chris

    2014-01-01

    This book comprises a set of articles that specify the methodology of text mining, describe the creation of lexical resources in the framework of text mining and use text mining for various tasks in natural language processing (NLP). The analysis of large amounts of textual data is a prerequisite to build lexical resources such as dictionaries and ontologies and also has direct applications in automated text processing in fields such as history, healthcare and mobile applications, just to name a few. This volume gives an update in terms of the recent gains in text mining methods and reflects

  3. Endometrial Adenocarcinoma and Mucocele of the Appendix: An Unusual Coexistence

    Directory of Open Access Journals (Sweden)

    Ioannis Kalogiannidis

    2013-01-01

    Full Text Available Appendiceal mucocele is a rare clinical entity, which is however quite often associated with mucinous ovarian tumor. The coexistence of mucinous cystadenoma of the appendix and endometrial adenocarcinoma has not been reported before. A 49-year-old woman presented to our clinic with postmenopausal bleeding and no other symptom. Endometrial biopsy revealed endometrial adenocarcinoma of endometrioid type (grade I. Preoperative CT scanning revealed an appendiceal mucocele, and a colonoscopy confirmed the diagnosis. The patient underwent total abdominal hysterectomy with bilateral salpingo-oophorectomy and appendectomy. The final histopathological examination showed a mucinous cystadenoma of the appendix and confirmed the diagnosis of endometrioid endometrial adenocarcinoma. The coexistence of appendiceal mucocele and female genital tract pathology is rare. However, gynecologists should keep a high level of suspicion for such possible coexistence. Both the diagnostic approach and the therapeutic management should be multidisciplinary, most importantly with the involvement of general surgeons.

  4. The nuclear modification of charged particles in Pb-Pb at $\\sqrt{\\text{s}_\\text{NN}} = \\text{5.02}\\,\\text{TeV}$ measured with ALICE

    CERN Document Server

    Gronefeld, Julius

    2016-09-21

    The study of inclusive charged-particle production in heavy-ion collisions provides insights into the density of the medium and the energy-loss mechanisms. The observed suppression of high-$\\textit{p}_\\text{T}$ yield is generally attributed to energy loss of partons as they propagate through a deconfined state of quarks and gluons - Quark-Gluon Plasma (QGP) - predicted by QCD. Such measurements allow the characterization of the QGP by comparison with models. In these proceedings, results on high-$\\textit{p}_\\text{T}$ particle production measured by ALICE in Pb-Pb collisions at $ \\sqrt{\\text{s}_\\text{NN}}\\, = 5.02\\ \\rm{TeV}$ as well as well in pp at $\\sqrt{\\text{s}}\\,=5.02\\ \\rm{TeV}$ are presented for the first time. The nuclear modification factors ($\\text{R}_\\text{AA}$) in Pb-Pb collisions are presented and compared with model calculations.

  5. Measurement of [Formula: see text] polarisation in [Formula: see text] collisions at [Formula: see text] = 7 TeV.

    Science.gov (United States)

    Aaij, R; Adeva, B; Adinolfi, M; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves, A A; Amato, S; Amerio, S; Amhis, Y; An, L; Anderlini, L; Anderson, J; Andreassen, R; Andreotti, M; Andrews, J E; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Baalouch, M; Bachmann, S; Back, J J; Badalov, A; Balagura, V; Baldini, W; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Batozskaya, V; Bauer, Th; Bay, A; Beddow, J; Bedeschi, F; Bediaga, I; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernet, R; Bettler, M-O; van Beuzekom, M; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blouw, J; Blusk, S; Bocci, V; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Borsato, M; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Bursche, A; Busetto, G; Buytaert, J; Cadeddu, S; Calabrese, R; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Campora Perez, D; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casse, G; Cassina, L; Castillo Garcia, L; Cattaneo, M; Cauet, Ch; Cenci, R; Charles, M; Charpentier, Ph; Cheung, S-F; Chiapolini, N; Chrzaszcz, M; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Coquereau, S; Corti, G; Corvo, M; Counts, I; Couturier, B; Cowan, G A; Craik, D C; Cruz Torres, M; Cunliffe, S; Currie, R; D'Ambrosio, C; Dalseno, J; David, P; David, P N Y; Davis, A; De Bruyn, K; De Capua, S; De Cian, M; De Miranda, J M; De Paula, L; De Silva, W; De Simone, P; Decamp, D; Deckenhoff, M; Del Buono, L; Déléage, N; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dijkstra, H; Donleavy, S; Dordei, F; Dorigo, M; Dosil Suárez, A; Dossett, D; Dovbnya, A; Dupertuis, F; Durante, P; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; Eisenhardt, S; Eitschberger, U; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Esen, S; Evans, T; Falabella, A; Färber, C; Farinelli, C; Farry, S; Ferguson, D; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fiore, M; Fiorini, M; Firlej, M; Fitzpatrick, C; Fiutowski, T; Fontana, M; Fontanelli, F; Forty, R; Francisco, O; Frank, M; Frei, C; Frosini, M; Fu, J; Furfaro, E; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garra Tico, J; Garrido, L; Gaspar, C; Gauld, R; Gavardi, L; Gersabeck, E; Gersabeck, M; Gershon, T; Ghez, Ph; Gianelle, A; Giani, S; Gibson, V; Giubega, L; Gligorov, V V; Göbel, C; Golubkov, D; Golutvin, A; Gomes, A; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Griffith, P; Grillo, L; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Gys, T; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hamilton, B; Hampson, T; Han, X; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Hartmann, T; He, J; Head, T; Heijne, V; Hennessy, K; Henrard, P; Henry, L; Hernando Morata, J A; van Herwijnen, E; Heß, M; Hicheur, A; Hill, D; Hoballah, M; Hombach, C; Hulsbergen, W; Hunt, P; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Idzik, M; Ilten, P; Jacobsson, R; Jaeger, A; Jalocha, J; Jans, E; Jaton, P; Jawahery, A; Jezabek, M; Jing, F; John, M; Johnson, D; Jones, C R; Joram, C; Jost, B; Jurik, N; Kaballo, M; Kandybei, S; Kanso, W; Karacson, M; Karbach, T M; Kelsey, M; Kenyon, I R; Ketel, T; Khanji, B; Khurewathanakul, C; Klaver, S; Kochebina, O; Kolpin, M; Komarov, I; Koopman, R F; Koppenburg, P; Korolev, M; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudryavtsev, V; Kurek, K; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Lanfranchi, G; Langenbruch, C; Latham, T; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J-P; Lefèvre, R; Leflat, A; Lefrançois, J; Leo, S; Leroy, O; Lesiak, T; Leverington, B; Li, Y; Liles, M; Lindner, R; Linn, C; Lionetto, F; Liu, B; Liu, G; Lohn, S; Longstaff, I; Longstaff, I; Lopes, J H; Lopez-March, N; Lowdon, P; Lu, H; Lucchesi, D; Luisier, J; Luo, H; Lupato, A; Luppi, E; Lupton, O; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Malde, S; Manca, G; Mancinelli, G; Manzali, M; Maratas, J; Marchand, J F; Marconi, U; Marino, P; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martinez Vidal, F; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Mazurov, A; McCann, M; McCarthy, J; McNab, A; McNulty, R; McSkelly, B; Meadows, B; Meier, F; Meissner, M; Merk, M; Milanes, D A; Minard, M-N; Molina Rodriguez, J; Monteil, S; Moran, D; Morandin, M; Morawski, P; Mordà, A; Morello, M J; Moron, J; Mountain, R; Muheim, F; Müller, K; Muresan, R; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Needham, M; Neri, N; Neubert, S; Neufeld, N; Neuner, M; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Niet, R; Nikitin, N; Nikodem, T; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Onderwater, G; Orlandea, M; Otalora Goicochea, J M; Owen, P; Oyanguren, A; Pal, B K; Palano, A; Palombo, F; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrignani, C; Pazos Alvarez, A; Pearce, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perez Trigo, E; Perret, P; Perrin-Terrin, M; Pescatore, L; Pesen, E; Petridis, K; Petrolini, A; Picatoste Olloqui, E; Pietrzyk, B; Pilař, T; Pinci, D; Pistone, A; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, A; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pritchard, A; Prouve, C; Pugatch, V; Puig Navarro, A; Punzi, G; Qian, W; Rachwal, B; Rademacker, J H; Rakotomiaramanana, B; Rama, M; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reichert, S; Reid, M M; Dos Reis, A C; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, A B; Rodrigues, E; Rodriguez Perez, P; Roiser, S; Romanovsky, V; Romero Vidal, A; Rotondo, M; Rouvinet, J; Ruf, T; Ruffini, F; Ruiz, H; Ruiz Valls, P; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salustino Guimaraes, V; Sanchez Mayordomo, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Sapunov, M; Sarti, A; Satriano, C; Satta, A; Savrie, M; Savrina, D; Schiller, M; Schindler, H; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schopper, A; Schune, M-H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Sestini, L; Seyfert, P; Shapkin, M; Shapoval, I; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, V; Shires, A; Silva Coutinho, R; Simi, G; Sirendi, M; Skidmore, N; Skwarnicki, T; Smith, N A; Smith, E; Smith, E; Smith, J; Smith, M; Snoek, H; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spinella, F; Spradlin, P; Stagni, F; Stahl, S; Steinkamp, O; Stenyakin, O; Stevenson, S; Stoica, S; Stone, S; Storaci, B; Stracka, S; Straticiuc, M; Straumann, U; Stroili, R; Subbiah, V K; Sun, L; Sutcliffe, W; Swientek, K; Swientek, S; Syropoulos, V; Szczekowski, M; Szczypka, P; Szilard, D; Szumlak, T; T'Jampens, S; Teklishyn, M; Tellarini, G; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; van Tilburg, J; Tisserand, V; Tobin, M; Tolk, S; Tomassetti, L; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ustyuzhanin, A; Uwer, U; Vagnoni, V; Valenti, G; Vallier, A; Vazquez Gomez, R; Vazquez Regueiro, P; Vázquez Sierra, C; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vieites Diaz, M; Vilasis-Cardona, X; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; de Vries, J A; Waldi, R; Wallace, C; Wallace, R; Walsh, J; Wandernoth, S; Wang, J; Ward, D R; Watson, N K; Webber, A D; Websdale, D; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wimberley, J; Wishahi, J; Wislicki, W; Witek, M; Wormser, G; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Xu, Z; Yang, Z; Yuan, X; Yushchenko, O; Zangoli, M; Zavertyaev, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhokhov, A; Zhong, L; Zvyagin, A

    The polarisation of prompt [Formula: see text] mesons is measured by performing an angular analysis of [Formula: see text] decays using proton-proton collision data, corresponding to an integrated luminosity of 1.0[Formula: see text], collected by the LHCb detector at a centre-of-mass energy of 7 TeV. The polarisation is measured in bins of transverse momentum [Formula: see text] and rapidity [Formula: see text] in the kinematic region [Formula: see text] and [Formula: see text], and is compared to theoretical models. No significant polarisation is observed.

  6. Text against Text: Counterbalancing the Hegemony of Assessment.

    Science.gov (United States)

    Cosgrove, Cornelius

    A study examined whether composition specialists can counterbalance the potential privileging of the assessment perspective, or of self-appointed interpreters of that perspective, through the study of assessment discourse as text. Fourteen assessment texts were examined, most of them journal articles and most of them featuring the common…

  7. A validity study of self-reported daily texting frequency, cell phone characteristics, and texting styles among young adults.

    Science.gov (United States)

    Gold, Judith E; Rauscher, Kimberly J; Zhu, Motao

    2015-04-02

    Texting is associated with adverse health effects including musculoskeletal disorders, sleep disturbances, and traffic crashes. Many studies have relied on self-reported texting frequency, yet the validity of self-reports is unknown. Our objective was to provide some of the first data on the validity of self-reported texting frequency, cell phone characteristics including input device (e.g. touchscreen), key configuration (e.g., QWERTY), and texting styles including phone orientation (e.g., horizontal) and hands holding the phone while texting. Data were collected using a self-administered questionnaire and observation of a texting task among college students ages 18 to 24. To gauge agreement between self-reported and phone bill-derived categorical number of daily text messages sent, we calculated percent of agreement, Spearman correlation coefficient, and a linear weighted kappa statistic. For agreement between self-reported and observed cell phone characteristics and texting styles we calculated percentages of agreement. We used chi-square tests to detect significant differences (α = 0.05) by gender and study protocol. There were 106 participants; 87 of which had complete data for texting frequency analyses. Among these 87, there was 26% (95% CI: 21-31) agreement between self-reported and phone bill-derived number of daily text messages sent with a Spearman's rho of 0.48 and a weighted kappa of 0.17 (95% CI: 0.06-0.27). Among those who did not accurately report the number of daily texts sent, 81% overestimated this number. Among the full sample (n = 106), there was high agreement between self-reported and observed texting input device (96%, 95% CI: 91-99), key configuration (89%, 95% CI: 81-94), and phone orientation while texting (93%, 95% CI: 86-97). No differences were found by gender or study protocol among any items. While young adults correctly reported their cell phone's characteristics and phone orientation while texting, most incorrectly

  8. 9433 Design Pointing Anomaly. Volume II. Appendices

    Science.gov (United States)

    1976-01-30

    A X/A4 r42/ jC Pa4 ,oo/ £’dr/O N/ IV /pal B-87 ONb 1JP4C& PA64K W ’CIO4JL;O UEC- CA6 .rOSIN-A ~ ~VO 45 F ORT NO. PAGE CHECKED MODEL 7-&,td1V Z-/aZo or...BPS 13.12 Lubritation Treatment (Proprietary) BPS 16.1S Stainless Steel Passivation BPS 16.32 Primer Zinc-Chromate BPS 19.01 Packaging and Sealing...e at-orfr7ed mixork. 7--7-V-5O64ai �-SI-30?O, R~~MRGMLRCR COPY 0- /Z𔄁,r REWORK TREATMENT TRW BEARINGS P/N 32708-1 & -3 inse all bearing

  9. Layout-aware text extraction from full-text PDF of scientific articles

    Directory of Open Access Journals (Sweden)

    Ramakrishnan Cartic

    2012-05-01

    Full Text Available Abstract Background The Portable Document Format (PDF is the most commonly used file format for online scientific publications. The absence of effective means to extract text from these PDF files in a layout-aware manner presents a significant challenge for developers of biomedical text mining or biocuration informatics systems that use published literature as an information source. In this paper we introduce the ‘Layout-Aware PDF Text Extraction’ (LA-PDFText system to facilitate accurate extraction of text from PDF files of research articles for use in text mining applications. Results Our paper describes the construction and performance of an open source system that extracts text blocks from PDF-formatted full-text research articles and classifies them into logical units based on rules that characterize specific sections. The LA-PDFText system focuses only on the textual content of the research articles and is meant as a baseline for further experiments into more advanced extraction methods that handle multi-modal content, such as images and graphs. The system works in a three-stage process: (1 Detecting contiguous text blocks using spatial layout processing to locate and identify blocks of contiguous text, (2 Classifying text blocks into rhetorical categories using a rule-based method and (3 Stitching classified text blocks together in the correct order resulting in the extraction of text from section-wise grouped blocks. We show that our system can identify text blocks and classify them into rhetorical categories with Precision1 = 0.96% Recall = 0.89% and F1 = 0.91%. We also present an evaluation of the accuracy of the block detection algorithm used in step 2. Additionally, we have compared the accuracy of the text extracted by LA-PDFText to the text from the Open Access subset of PubMed Central. We then compared this accuracy with that of the text extracted by the PDF2Text system, 2commonly used to extract text from PDF

  10. Layout-aware text extraction from full-text PDF of scientific articles.

    Science.gov (United States)

    Ramakrishnan, Cartic; Patnia, Abhishek; Hovy, Eduard; Burns, Gully Apc

    2012-05-28

    The Portable Document Format (PDF) is the most commonly used file format for online scientific publications. The absence of effective means to extract text from these PDF files in a layout-aware manner presents a significant challenge for developers of biomedical text mining or biocuration informatics systems that use published literature as an information source. In this paper we introduce the 'Layout-Aware PDF Text Extraction' (LA-PDFText) system to facilitate accurate extraction of text from PDF files of research articles for use in text mining applications. Our paper describes the construction and performance of an open source system that extracts text blocks from PDF-formatted full-text research articles and classifies them into logical units based on rules that characterize specific sections. The LA-PDFText system focuses only on the textual content of the research articles and is meant as a baseline for further experiments into more advanced extraction methods that handle multi-modal content, such as images and graphs. The system works in a three-stage process: (1) Detecting contiguous text blocks using spatial layout processing to locate and identify blocks of contiguous text, (2) Classifying text blocks into rhetorical categories using a rule-based method and (3) Stitching classified text blocks together in the correct order resulting in the extraction of text from section-wise grouped blocks. We show that our system can identify text blocks and classify them into rhetorical categories with Precision1 = 0.96% Recall = 0.89% and F1 = 0.91%. We also present an evaluation of the accuracy of the block detection algorithm used in step 2. Additionally, we have compared the accuracy of the text extracted by LA-PDFText to the text from the Open Access subset of PubMed Central. We then compared this accuracy with that of the text extracted by the PDF2Text system, 2commonly used to extract text from PDF. Finally, we discuss preliminary error analysis for

  11. The effects of visual crowding, text size, and positional uncertainty on text legibility at a glance.

    Science.gov (United States)

    Dobres, Jonathan; Wolfe, Benjamin; Chahine, Nadine; Reimer, Bryan

    2018-07-01

    Reading at a glance, once a relatively infrequent mode of reading, is becoming common. Mobile interaction paradigms increasingly dominate the way in which users obtain information about the world, which often requires reading at a glance, whether from a smartphone, wearable device, or in-vehicle interface. Recent research in these areas has shown that a number of factors can affect text legibility when words are briefly presented in isolation. Here we expand upon this work by examining how legibility is affected by more crowded presentations. Word arrays were combined with a lexical decision task, in which the size of the text elements and the inter-line spacing (leading) between individual items were manipulated to gauge their relative impacts on text legibility. In addition, a single-word presentation condition that randomized the location of presentation was compared with previous work that held position constant. Results show that larger text was more legible than smaller text. Wider leading significantly enhanced legibility as well, but contrary to expectations, wider leading did not fully counteract decrements in legibility at smaller text sizes. Single-word stimuli presented with random positioning were more difficult to read than stationary counterparts from earlier studies. Finally, crowded displays required much greater processing time compared to single-word displays. These results have implications for modern interface design, which often present interactions in the form of scrollable and/or selectable lists. The present findings are of practical interest to the wide community of graphic designers and interface engineers responsible for developing our interfaces of daily use. Copyright © 2018 Elsevier Ltd. All rights reserved.

  12. AN ANALYSIS OF TECHNICAL SECURITY CONTROL REQUIREMENTS FOR DIGITAL I&C SYSTEMS IN NUCLEAR POWER PLANTS

    Directory of Open Access Journals (Sweden)

    JAE-GU SONG

    2013-10-01

    Full Text Available Instrumentation and control systems in nuclear power plants have been digitalized for the purpose of maintenance and precise operation. This digitalization, however, brings out issues related to cyber security. In the most recent past, international standard organizations, regulatory institutes, and research institutes have performed a number of studies addressing these systems cyber security. In order to provide information helpful to the system designers in their application of cyber security for the systems, this paper presents methods and considerations to define attack vectors in a target system, to review and select the requirements in the Regulatory Guide 5.71, and to integrate the results to identify applicable technical security control requirements. In this study, attack vectors are analyzed through the vulnerability analyses and penetration tests with a simplified safety system, and the elements of critical digital assets acting as attack vectors are identified. Among the security control requirements listed in Appendices B and C to Regulatory Guide 5.71, those that should be implemented into the systems are selected and classified in groups of technical security control requirements using the results of the attack vector analysis. For the attack vector elements of critical digital assets, all the technical security control requirements are evaluated to determine whether they are applicable and effective, and considerations in this evaluation are also discussed. The technical security control requirements in three important categories of access control, monitoring and logging, and encryption are derived and grouped according to the elements of attack vectors as results for the sample safety system.

  13. A one-way text messaging intervention for obesity.

    Science.gov (United States)

    Ahn, Ahleum; Choi, Jaekyung

    2016-04-01

    Worldwide, there has been a startling increase in the number of people who are obese or overweight. Obesity increases the risk of cardiovascular disease and overall mortality. Mobile phone messaging is an important means of human communication globally. Because the mobile phone can be used anywhere at any time, mobile phone messaging has the potential to manage obesity. We investigated the effectiveness of a one-way text messaging intervention for obesity. Participants' body mass index and waist circumference were measured at the beginning of the programme and again after 12 weeks. The text message group received text messages about exercise, dietary intake, and general information about obesity three times a week, while the control group did not receive any text messages from the study. Of the 80 participants, 25 subjects in the text message group and 29 participants in the control group completed the study. After adjusting for baseline body mass index, the body mass index was significantly lower in the text message group than in the control group (27.9 vs. 28.3; p = 0.02). After adjusting for the baseline waist circumference, the difference of waist circumference between the text message group and control group was not significant (93.4 vs. 94.6; p = 0.13). The one-way text messaging intervention was a simple and effective way to manage obesity. The one-way text messaging intervention may be a useful method for lifestyle modification in obese subjects. © The Author(s) 2015.

  14. Systematic text condensation: a strategy for qualitative analysis.

    Science.gov (United States)

    Malterud, Kirsti

    2012-12-01

    To present background, principles, and procedures for a strategy for qualitative analysis called systematic text condensation and discuss this approach compared with related strategies. Giorgi's psychological phenomenological analysis is the point of departure and inspiration for systematic text condensation. The basic elements of Giorgi's method and the elaboration of these in systematic text condensation are presented, followed by a detailed description of procedures for analysis according to systematic text condensation. Finally, similarities and differences compared with other frequently applied methods for qualitative analysis are identified, as the foundation of a discussion of strengths and limitations of systematic text condensation. Systematic text condensation is a descriptive and explorative method for thematic cross-case analysis of different types of qualitative data, such as interview studies, observational studies, and analysis of written texts. The method represents a pragmatic approach, although inspired by phenomenological ideas, and various theoretical frameworks can be applied. The procedure consists of the following steps: 1) total impression - from chaos to themes; 2) identifying and sorting meaning units - from themes to codes; 3) condensation - from code to meaning; 4) synthesizing - from condensation to descriptions and concepts. Similarities and differences comparing systematic text condensation with other frequently applied qualitative methods regarding thematic analysis, theoretical methodological framework, analysis procedures, and taxonomy are discussed. Systematic text condensation is a strategy for analysis developed from traditions shared by most of the methods for analysis of qualitative data. The method offers the novice researcher a process of intersubjectivity, reflexivity, and feasibility, while maintaining a responsible level of methodological rigour.

  15. Nuclear Dynamics Consequence Analysis (NDCA) for the Disposal of Spent Nuclear Fuel in an Underground Geologic Repository - Volume 3: Appendices

    International Nuclear Information System (INIS)

    Taylor, L.L.; Wilson, J.R.; Sanchez, L.C.; Aguilar, R.; Trellue, H.R.; Cochrane, K.; Rath, J.S.

    1998-01-01

    The United States Department of Energy Office of Environmental Management's (DOE/EM's) National Spent Nuclear Fuel Program (NSNFP), through a collaboration between Sandia National Laboratories (SNL) and Idaho National Engineering and Environmental Laboratory (INEEL), is conducting a systematic Nuclear Dynamics Consequence Analysis (NDCA) of the disposal of SNFs in an underground geologic repository sited in unsaturated tuff. This analysis is intended to provide interim guidance to the DOE for the management of the SNF while they prepare for final compliance evaluation. This report presents results from a Nuclear Dynamics Consequence Analysis (NDCA) that examined the potential consequences and risks of criticality during the long-term disposal of spent nuclear fuel owned by DOE-EM. This analysis investigated the potential of post-closure criticality, the consequences of a criticality excursion, and the probability frequency for post-closure criticality. The results of the NDCA are intended to provide the DOE-EM with a technical basis for measuring risk which can be used for screening arguments to eliminate post-closure criticality FEPs (features, events and processes) from consideration in the compliance assessment because of either low probability or low consequences. This report is composed of an executive summary (Volume 1), the methodology and results of the NDCA (Volume 2), and the applicable appendices (Volume 3)

  16. Affine Fullerene C60 in a GS-Quasigroup

    Directory of Open Access Journals (Sweden)

    Vladimir Volenec

    2014-01-01

    Full Text Available It will be shown that the affine fullerene C60, which is defined as an affine image of buckminsterfullerene C60, can be obtained only by means of the golden section. The concept of the affine fullerene C60 will be constructed in a general GS-quasigroup using the statements about the relationships between affine regular pentagons and affine regular hexagons. The geometrical interpretation of all discovered relations in a general GS-quasigroup will be given in the GS-quasigroup C(1/2(1+5.

  17. Dynamic performance of a C/C composite finger seal in a tilting mode

    Directory of Open Access Journals (Sweden)

    Hailin ZHAO

    2017-08-01

    Full Text Available The complex operating state of aeroengines has an impact on the performance of finger seals. However, little work has been focused on the issue and the dynamic performance of finger seals is also rarely studied. Therefore, a distributed mass equivalent model considering working conditions is proposed in this paper for solving the existing problems. The effects of the fiber bundle density and the preparation direction of the fiber bundle of a C/C composite on the dynamic performance of a finger seal are investigated in rotor tilt based on the proposed model. The difference between the C/C composite finger seal performances under the rotor precession and nutation tilt cases is also investigated. The results show that the fiber bundle density and the preparation direction of the fiber bundle have an influence on the dynamic performance of the finger seal as rotor tilt is considered, and the dynamic performance of the finger seal is different in the two kinds of tilting modes. In addition, a novel method for design of finger seals is presented based on the contact pressure between finger boots and the rotor. Finger seals with good leakage rates and low wear can be acquired in this method.

  18. Learning Strategies Used by High School Students Learning English as a Second Language

    Science.gov (United States)

    1985-02-01

    Discussion 34 REFERENCES 39 APPENDICES Z1 A Teachers Interview Guide 43 B Student Interview Guide 55 C Classroom Observation Guide 67 ix LIST OF TABLES...and teacher interviews were performed individually. There were only 3.7 strategies per classroom observation . Because roughly equal amounts of time...FOR SPEAKING AND UNDERSTANDING ENGLISH Classroom Observation Guide The purpose of this observation guide is to describe an approach for cot- lecting

  19. Dicty_cDB: SLH810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available frhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Translated Amino Acid sequence (Al...rame C: *fncyfrhfsdcriwlfwfcfinshtvsfflrisck*CFSFFFWTSGFSIRYLIYCNHLI ILIILCFVIISLFVTFL Homology vs CSM-cDNA

  20. A checklist of mammals of Kerala, India

    Directory of Open Access Journals (Sweden)

    P. O. Nameer

    2015-11-01

    Full Text Available A checklist of mammals of Kerala State is presented in this paper. Accepted English names, scientific binomen, prevalent vernacular names in Malayalam, IUCN conservation status, endemism, Indian Wildlife (Protection Act schedules, and the appendices in the CITES, pertaining to the mammals of Kerala are also given. The State of Kerala has 118 species of mammals, 15 of which are endemic to Western Ghats, and 29 species fall under the various threatened categories of IUCN.  

  1. Systematic characterizations of text similarity in full text biomedical publications.

    Science.gov (United States)

    Sun, Zhaohui; Errami, Mounir; Long, Tara; Renard, Chris; Choradia, Nishant; Garner, Harold

    2010-09-15

    Computational methods have been used to find duplicate biomedical publications in MEDLINE. Full text articles are becoming increasingly available, yet the similarities among them have not been systematically studied. Here, we quantitatively investigated the full text similarity of biomedical publications in PubMed Central. 72,011 full text articles from PubMed Central (PMC) were parsed to generate three different datasets: full texts, sections, and paragraphs. Text similarity comparisons were performed on these datasets using the text similarity algorithm eTBLAST. We measured the frequency of similar text pairs and compared it among different datasets. We found that high abstract similarity can be used to predict high full text similarity with a specificity of 20.1% (95% CI [17.3%, 23.1%]) and sensitivity of 99.999%. Abstract similarity and full text similarity have a moderate correlation (Pearson correlation coefficient: -0.423) when the similarity ratio is above 0.4. Among pairs of articles in PMC, method sections are found to be the most repetitive (frequency of similar pairs, methods: 0.029, introduction: 0.0076, results: 0.0043). In contrast, among a set of manually verified duplicate articles, results are the most repetitive sections (frequency of similar pairs, results: 0.94, methods: 0.89, introduction: 0.82). Repetition of introduction and methods sections is more likely to be committed by the same authors (odds of a highly similar pair having at least one shared author, introduction: 2.31, methods: 1.83, results: 1.03). There is also significantly more similarity in pairs of review articles than in pairs containing one review and one nonreview paper (frequency of similar pairs: 0.0167 and 0.0023, respectively). While quantifying abstract similarity is an effective approach for finding duplicate citations, a comprehensive full text analysis is necessary to uncover all potential duplicate citations in the scientific literature and is helpful when

  2. From Text to Political Positions: Text analysis across disciplines

    NARCIS (Netherlands)

    Kaal, A.R.; Maks, I.; van Elfrinkhof, A.M.E.

    2014-01-01

    ABSTRACT From Text to Political Positions addresses cross-disciplinary innovation in political text analysis for party positioning. Drawing on political science, computational methods and discourse analysis, it presents a diverse collection of analytical models including pure quantitative and

  3. Text2Floss: the feasibility and acceptability of a text messaging intervention to improve oral health behavior and knowledge.

    Science.gov (United States)

    Hashemian, Tony S; Kritz-Silverstein, Donna; Baker, Ryan

    2015-01-01

    Text messaging is useful for promoting numerous health-related behaviors. The Text2Floss Study examines the feasibility and utility of a 7-day text messaging intervention to improve oral health knowledge and behavior in mothers of young children. Mothers were recruited from a private practice and a community clinic. Of 156 mothers enrolled, 129 randomized into text (n = 60) and control groups (n = 69) completed the trial. Participants in the text group received text messages for 7 days, asking about flossing and presenting oral health information. Oral health behaviors and knowledge were surveyed pre- and post-intervention. At baseline, there were no differences between text and control group mothers in knowledge and behaviors (P > 0.10). Post-intervention, text group mothers flossed more (P = 0.01), had higher total (P = 0.0006) and specific (P Text messages were accepted and perceived as useful. Mothers receiving text messages improved their own oral health behaviors and knowledge as well as their behaviors regarding their children's oral health. Text messaging represents a viable method to improve oral health behaviors and knowledge. Its high acceptance may make it useful for preventing oral disease. © 2014 American Association of Public Health Dentistry.

  4. A multiresolutional approach to fuzzy text meaning: A first attempt

    Energy Technology Data Exchange (ETDEWEB)

    Mehler, A.

    1996-12-31

    The present paper focuses on the connotative meaning aspect of language signs especially above the level of words. In this context the view is taken that texts can be defined as a kind of supersign, to which-in the same way as to other signs-a meaning can be assigned. A text can therefore be described as the result of a sign articulation which connects the material text sign with a corresponding meaning. For the constitution of the structural text meaning a kind of a semiotic composition principle is responsible, which leads to the emergence of interlocked levels of language units, demonstrating different grades of resolution. Starting on the level of words, and going through the level of sentences this principle reaches finally the level of texts by aggregating step by step the meaning of a unit on a higher level out of the meanings of all components one level below, which occur within this unit. Besides, this article will elaborate the hypothesis that the meaning constitution as a two-stage process, corresponding to the syntagmatic and paradigmatic restrictions of language elements among each other, obtains equally on the level of texts. On text level this two-levelledness leads to the constitution of the connotative text meaning, whose constituents are determined on word level by the syntagmatic and paradigmatic relations of the words. The formalization of the text meaning representation occurs with the help of fuzzy set theory.

  5. Weyerhaeuser Export Facility at DuPont. Volume III. Appendices R - T.

    Science.gov (United States)

    1982-05-01

    0 a 0 lo Ř 4 - * a . 4a 44 -1~ a1 .. . 4 4 00. * 4 14 P 14 4 0~~0 6 4 44 14 a 1 4 w 4 Id . - ’U A U44 44 0 U C ’U 4 4 A U4 4 443 4444 %A 4 .41 F6 A...W.4) C) C. 0 -C4JC CCC),)."U! CCA ISC-a~ C" 0 , U 3 C - 4. 0A 00. L .UA.C L O L U CL- C0 .=0 0 0) .-C V C, a 2 0 ) ACCa LC1 LCC0C S C.0 a-. UU~~~ A Cz

  6. A study of preoperative diagnosis using abdominal computed tomography in acute appendicitis

    International Nuclear Information System (INIS)

    Sakai, Takehiro

    2004-01-01

    To evaluate the usefulness of computed tomography (CT) in differential diagnosis and decisions for operative indications in patients with acute appendicitis, CT was done in 45 patients diagnosed with acute appendicitis. CT was retrospectively analyzed for the following findings: enlarged appendix, hazy periappendiceal density, increased enhancement of the appendiceal wall, deficiency of the appendiceal wall, appendiceal stones, abscess, and ascites. Surgery was conducted 28 patients, of whom 25 were pathologically diagnosed with gangrenous or phlegmonous appendicitis. Seventeen improved without surgery, i.e., 9 with acute appendicitis, 7 with diverticulitis of the colon, and 1 with pelvic peritonitis. Except for 3 with severe abscess, enlarged appendix, hazy periappendiceal density, and increased enhancement of the appendiceal wall were observed in 22 with phlegmonous or gangrenous appendicitis. In 25 with phlegmonous or gangrenous appendicitis, appendiceal stones were observed in 32% and abscess or ascites in 60%. Sensitivity, specificity, and accuracy in CT diagnosis images were 100%, 80%, and 96%. CT findings thus provide useful information in differential diagnosis and decisions on operative indication in patients with acute appendicitis. (author)

  7. Dicty_cDB: CHH542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35.1 UCRCS08_0003L02_f Parent Washington Navel Orange Callus cDNA Library UCRCS08...cDNA library - UCR Poncirus trifoliata cDNA clone UCRPT01_02_C04, mRNA sequence. 40 0.002 2 CV714035 |CV7140

  8. LocText

    DEFF Research Database (Denmark)

    Cejuela, Juan Miguel; Vinchurkar, Shrikant; Goldberg, Tatyana

    2018-01-01

    trees and was trained and evaluated on a newly improved LocTextCorpus. Combined with an automatic named-entity recognizer, LocText achieved high precision (P = 86%±4). After completing development, we mined the latest research publications for three organisms: human (Homo sapiens), budding yeast...

  9. Retextualization as a didactic resource for text production

    Directory of Open Access Journals (Sweden)

    Cristiane de Paula Bouzada

    2014-04-01

    Full Text Available Based on the conception of retextualization as a production of a new text from one or more base texts, we report in this article a writing activity in which public high school students retextualized the genre chronicle into other oral and written genres. The activity allowed students to work on linguistic, textual and discursive strategies from the base text and to project them into a new situation of interaction. The results suggest that it is a responsibility of formal education to create conditions for students to understand and take ownership of textual genres to become competent Portuguese Language users.

  10. Appendiceal mucocele: Report of a case and brief review

    International Nuclear Information System (INIS)

    Tzekov, A.; Strateva, D.; Eftimova, Tz.; Georgieva, E.; Bankova, S.

    2013-01-01

    Full text: Introduction: Mucocele of the appendix is a rare lesion characterized by distension of the lumen due to accumulation of mucus substance. This disease is often asymptomatic and preoperative diagnosis is rare. Learning points: If non-treated one of the mucocele types can rupture and cause pseudomyxoma peritonei of the peritoneum . Discussion: We present a case report of a woman , 44 with renal colic and pain in the right lower quadrant of the abdomen . MDCT urography shows ureterolithiasis and a large tubular and cystic formation of calcifications, located below the bottom wall of the cecum. The endovaginal ultrasound also represents an elongated cystic mass with internal echo. An appendectomy was made with histological result - mucocele. Conclusion: A preoperative diagnosis is rare and difficult to made, but possible with the use of appropriate imaging methods - ultrasound, CT and endoscopy. This rare disease with potentially lethal complications is usually treatable surgically if detected in early phase. Therefore, the preoperative detection is necessary for the accurate planning of the resection and removal of the formation

  11. A quick survey of text categorization algorithms

    Directory of Open Access Journals (Sweden)

    Dan MUNTEANU

    2007-12-01

    Full Text Available This paper contains an overview of basic formulations and approaches to text classification. This paper surveys the algorithms used in text categorization: handcrafted rules, decision trees, decision rules, on-line learning, linear classifier, Rocchio’s algorithm, k Nearest Neighbor (kNN, Support Vector Machines (SVM.

  12. Wild dreams in Physics at the end of the millennium

    DEFF Research Database (Denmark)

    Bohr, Henrik; Nielsen, H.B.

    1999-01-01

    The main text is supposed to be very introductory and the wild theory chapters to be explained for lay-men with many pedagogical figures but with all the mathematical eqautions relegated to appendices, each corresponding to a particular chapter. In that way we make the main text available...

  13. Building a Prototype Text to Speech for Sanskrit

    Science.gov (United States)

    Mahananda, Baiju; Raju, C. M. S.; Patil, Ramalinga Reddy; Jha, Narayana; Varakhedi, Shrinivasa; Kishore, Prahallad

    This paper describes about the work done in building a prototype text to speech system for Sanskrit. A basic prototype text-to-speech is built using a simplified Sanskrit phone set, and employing a unit selection technique, where prerecorded sub-word units are concatenated to synthesize a sentence. We also discuss the issues involved in building a full-fledged text-to-speech for Sanskrit.

  14. A Carcinoid Tumor of the Appendix in a Child: A Case Report

    Directory of Open Access Journals (Sweden)

    Laleh Vahedi Larijani

    2018-01-01

    Full Text Available The appendix is one of the most common sites for carcinoid tumors. Most carcinoids are found in appendices removed incidentally at laparotomy for conditions unrelated to acute appendicitis. We describe the case of a 13-year-old female who presented with abdominal pain in the right lower quadrant (RLQ, with nausea and decreased appetite for the previous 2 days. A physical examination favoreda diagnosis of acute appendicitis. A carcinoid tumor was diagnosed based on the histological examination of the removed appendix. The patient underwent an isolated appendectomy due to the small size of the lesion.

  15. Dicty_cDB: AFL805 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frame A: ---rf*vkkkrfffxxgkkxkkxkxxxxxkxxxxxxxxxxxkxkxxxxkxsxxkkknk Frame B: ---GFRXKKKGFFLXXXKKXKNXKXXXXXKX...XXXXXXXXXXKXKXXXXKXPXEKKKIK Frame C: ---vlgxkkkvffxpwxkkxktkxxxxxxkxxxxxxxxxxxxkxxxxxkxxx

  16. Contextual Text Mining

    Science.gov (United States)

    Mei, Qiaozhu

    2009-01-01

    With the dramatic growth of text information, there is an increasing need for powerful text mining systems that can automatically discover useful knowledge from text. Text is generally associated with all kinds of contextual information. Those contexts can be explicit, such as the time and the location where a blog article is written, and the…

  17. Dicty_cDB: VSJ516 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mlhqv ntlvtllspiktmlkspvlmliltckrik*nkik*khtix*iiy Frame C: neiiisplfrscfsfpifhps...kqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---neiiisplfrscfsfpifhpslvklwyccr*ipnyqcsirptnts*rtryhnqciry sr*nr

  18. Dicty_cDB: Contig-U15762-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 Root cold Pinus taeda cDNA c... 46 6.7 1 ( CO166910 ) FLD1_65_A02.g1_A029 Root flood...ed Pinus taeda cDNA... 46 6.7 1 ( CO161061 ) FLD1_26_H12.b1_A029 Root flooded Pinus taeda cDNA... 46 6.

  19. Final safety analysis report for the Galileo mission: Volume 3 (Book 2), Nuclear risk analysis document: Appendices: Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-25

    It is the purpose of the NRAD to provide an analysis of the range of potential consequences of accidents which have been identified that are associated with the launching and deployment of the Galileo mission spacecraft. The specific consequences analyzed are those associated with the possible release of radioactive material (fuel) of the Radioisotope Thermoelectric Generators (RTGs). They are in terms of radiation doses to people and areas of deposition of radioactive material. These consequence analyses can be used in several ways. One way is to identify the potential range of consequences which might have to be dealt with if there were to be an accident with a release of fuel, so as to assure that, given such an accident, the health and safety of the public will be reasonably protected. Another use of the information, in conjunction with accident and release probabilities, is to estimate the risks associated with the mission. That is, most space launches occur without incident. Given an accident, the most probable result relative to the RTGs is complete containment of the radioactive material. Only a small fraction of accidents might result in a release of fuel and subsequent radiological consequences. The combination of probability with consequence is risk, which can be compared to other human and societal risks to assure that no undue risks are implied by undertaking the mission. Book 2 contains eight appendices.

  20. Dicty_cDB: AFG169 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available --LMKNLN*twllihhhc*krnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rf...rnrqryqrkislrrprl*s*nanccliisprkiiritrr sshhhr**tfplprsplptitlrygiswyprnhl*lhhem*c*yp*rfirqcrliwwyny vpryc*s

  1. Dicty_cDB: VFL581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mgc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewl...gc*ccglvnhwflpig*c riy*lanyhlg*nyhynssclvrtiiydlss*kwwlslrclvrfnvmcntssifikiipk dfsft**fnflfky*ygprmve*yewla

  2. A comprehensive and quantitative comparison of text-mining in 15 million full-text articles versus their corresponding abstracts.

    Science.gov (United States)

    Westergaard, David; Stærfeldt, Hans-Henrik; Tønsberg, Christian; Jensen, Lars Juhl; Brunak, Søren

    2018-02-01

    Across academia and industry, text mining has become a popular strategy for keeping up with the rapid growth of the scientific literature. Text mining of the scientific literature has mostly been carried out on collections of abstracts, due to their availability. Here we present an analysis of 15 million English scientific full-text articles published during the period 1823-2016. We describe the development in article length and publication sub-topics during these nearly 250 years. We showcase the potential of text mining by extracting published protein-protein, disease-gene, and protein subcellular associations using a named entity recognition system, and quantitatively report on their accuracy using gold standard benchmark data sets. We subsequently compare the findings to corresponding results obtained on 16.5 million abstracts included in MEDLINE and show that text mining of full-text articles consistently outperforms using abstracts only.

  3. Goblet cell carcinoids: characteristics of a Danish cohort of 83 patients.

    Directory of Open Access Journals (Sweden)

    Ingrid Holst Olsen

    Full Text Available Appendiceal goblet cell carcinoids (GCCs exhibit neuroendocrine and adenocarcinoma features.Analysis of demography, pathology, prognostic markers, treatment and survival in 83 GCC patients (f/m: 56/27 diagnosed 1992-2013.Median age for f/m was 59/58 years, respectively, and similar for localized and disseminated disease. At diagnosis 54 patients had localized appendiceal disease (f/m: 29/25. According to TNM 24% had Stage I, 70% had Stage II and 6% had Stage III. Twenty-nine patients had disseminated disease (f/m: 27/2. Chromogranin A, synaptophysin and p53 were positive in >90%. Serotonin was positive in 70%. Median Ki67 index was 32% (6-75% and higher in Tang group C (50% compared to group A (30%; p<0.0001, and group B (30%; p<0.004. All patients had surgery. Sixty-three (76% had radical resections including all patients with localized disease. Median OS was 83 months. The 1-, 5- and 10-year survival rates were 90%, 58%, and 38%, respectively. For localized disease OS was 164 months and 1-, 5- and 10-year survival rates were 100%, 80%, and 55%, respectively. For disseminated disease OS was 19 months and 1-, 5- and 10-year survival rates were 73%, 18% and 6%, respectively. The 1-, 5- and 10 year-survival rates for f/m were 87%/96%, 49%/76% and 31%/57%, respectively (p = 0.02. According to the Tang classification group A, B, and C OS was 118, 83 and 20 months, respectively (p = 0.0002.The Tang classification was found to be a significant prognostic factor, while the Ki67 index was not. Localized GCCs occurred equally in males and females, while disseminated GCCs were mostly seen in females. Median age of patients with localized disease and disseminated disease was identical. Cox regression analysis found Stage IV, focally positive synaptophysin and non-radical surgery as strongest negative prognostic factors.

  4. Dicty_cDB: CFJ554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Frame A: ---LFPHCSENXLXXXQREXTTXPXRNXPRXGHXSALXXXXRXXXXRPSCTN Frame B: ---sfltvpktxxxxprexxqhxpxexnqdxdtxahxxxxxxxxxx...ghlvq Frame C: ---lsslfrkxaxxxperxxntpx*kxtkxwtlxrtxxxxsxxxxxailyk Hom

  5. J-TEXT-EPICS: An EPICS toolkit attempted to improve productivity

    International Nuclear Information System (INIS)

    Zheng, Wei; Zhang, Ming; Zhang, Jing; Zhuang, Ge

    2013-01-01

    Highlights: • Tokamak control applications can be developed in very short period with J-TEXT-EPICS. • J-TEXT-EPICS enables users to build control applications with device-oriented functions. • J-TEXT-EPICS is fully compatible with EPICS Channel Access protocol. • J-TEXT-EPICS can be easily extended by plug-ins and drivers. -- Abstract: The Joint Texas Experimental Tokamak (J-TEXT) team has developed a new software toolkit for building Experimental Physics and Industrial Control System (EPICS) control applications called J-TEXT-EPICS. It aims to improve the development efficiency of control applications. With device-oriented features, it can be used to set or obtain the configuration or status of a device as well as invoke methods on a device. With its modularized design, its functions can be easily extended. J-TEXT-EPICS is completely compatible with the original EPICS Channel Access protocol and can be integrated into existing EPICS control systems smoothly. It is fully implemented in C number sign, thus it will benefit from abundant resources in.NET Framework. The J-TEXT control system is build with this toolkit. This paper presents the design and implementation of J-TEXT EPICS as well as its application in the J-TEXT control system

  6. CHEMSIMUL - A program package for numerical simulation of chemical reaction systems

    International Nuclear Information System (INIS)

    Lang Rasmussen, O.; Bjergbakke, E.

    1984-01-01

    A description is given of a program package, CHEMSIMUL, for numerical simulation of chemical reaction systems. The main components in the package are a translator of chemical equations to differential equations, a balance equation program, a differential equation solver, EPISODE, and an input/output program. The performance of the program is demonstrated by four examples. A manual for the input file and the complete program text with comments are given in Appendices I and II. (author)

  7. LRPDS Interim Technical Report. Appendices,

    Science.gov (United States)

    1971-06-15

    VJ *-* < r y\\ -I •— •o u. J •r-i N. • X) JJ- n * 4- »«# t- Ul O 7 —w * fLJ •—| »—« • X ./) ~* •T> • • * n jJ AJ uO vO • J j O • > iT...and using eqn (1), eqn (9) can be integrated easily to obtain - 1 • 10" or a sJl TD e6hm/ -6h -6h \\XW Ai / -to -wh \\1 8 [e 8 - e...UJ 111 • u <<<<<-* <<<<< or of • 3 u. » rurxjrvjrvjcviMcxjtxjru’vjoj U» * • uf ’Ji a. x T c/t ooooooooooo td Z 00003 0 00033 rv » (u,*o

  8. Illustrations in Text: A Retentional Role.

    Science.gov (United States)

    Duchastel, Philippe C.

    1981-01-01

    Describes the results of a study of the retentional role of illustrations in a text and their effect on enhancing long-term memory with 15-year-old secondary school students. Seven references are listed. (CHC)

  9. Production of [Formula: see text] and [Formula: see text] in proton-proton collisions at [Formula: see text] 7 TeV.

    Science.gov (United States)

    Abelev, B; Adam, J; Adamová, D; Aggarwal, M M; Rinella, G Aglieri; Agnello, M; Agostinelli, A; Agrawal, N; Ahammed, Z; Ahmad, N; Ahmed, I; Ahn, S U; Ahn, S A; Aimo, I; Aiola, S; Ajaz, M; Akindinov, A; Alam, S N; Aleksandrov, D; Alessandro, B; Alexandre, D; Alici, A; Alkin, A; Alme, J; Alt, T; Altinpinar, S; Altsybeev, I; Alves Garcia Prado, C; Andrei, C; Andronic, A; Anguelov, V; Anielski, J; Antičić, T; Antinori, F; Antonioli, P; Aphecetche, L; Appelshäuser, H; Arcelli, S; Armesto, N; Arnaldi, R; Aronsson, T; Arsene, I C; Arslandok, M; Augustinus, A; Averbeck, R; Awes, T C; Azmi, M D; Bach, M; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Baldisseri, A; Baltasar Dos Santos Pedrosa, F; Baral, R C; Barbera, R; Barile, F; Barnaföldi, G G; Barnby, L S; Barret, V; Bartke, J; Basile, M; Bastid, N; Basu, S; Bathen, B; Batigne, G; Batista Camejo, A; Batyunya, B; Batzing, P C; Baumann, C; Bearden, I G; Beck, H; Bedda, C; Behera, N K; Belikov, I; Bellini, F; Bellwied, R; Belmont-Moreno, E; Belmont, R; Belyaev, V; Bencedi, G; Beole, S; Berceanu, I; Bercuci, A; Berdnikov, Y; Berenyi, D; Berger, M E; Bertens, R A; Berzano, D; Betev, L; Bhasin, A; Bhat, I R; Bhati, A K; Bhattacharjee, B; Bhom, J; Bianchi, L; Bianchi, N; Bianchin, C; Bielčík, J; Bielčíková, J; Bilandzic, A; Bjelogrlic, S; Blanco, F; Blau, D; Blume, C; Bock, F; Bogdanov, A; Bøggild, H; Bogolyubsky, M; Böhmer, F V; Boldizsár, L; Bombara, M; Book, J; Borel, H; Borissov, A; Bossú, F; Botje, M; Botta, E; Böttger, S; Braun-Munzinger, P; Bregant, M; Breitner, T; Broker, T A; Browning, T A; Broz, M; Bruna, E; Bruno, G E; Budnikov, D; Buesching, H; Bufalino, S; Buncic, P; Busch, O; Buthelezi, Z; Caffarri, D; Cai, X; Caines, H; Calero Diaz, L; Caliva, A; Calvo Villar, E; Camerini, P; Carena, F; Carena, W; Castillo Castellanos, J; Casula, E A R; Catanescu, V; Cavicchioli, C; Ceballos Sanchez, C; Cepila, J; Cerello, P; Chang, B; Chapeland, S; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Chelnokov, V; Cherney, M; Cheshkov, C; Cheynis, B; Chibante Barroso, V; Chinellato, D D; Chochula, P; Chojnacki, M; Choudhury, S; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chung, S U; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Colamaria, F; Colella, D; Collu, A; Colocci, M; Conesa Balbastre, G; Conesa Del Valle, Z; Connors, M E; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortese, P; Cortés Maldonado, I; Cosentino, M R; Costa, F; Crochet, P; Cruz Albino, R; Cuautle, E; Cunqueiro, L; Dainese, A; Dang, R; Danu, A; Das, D; Das, I; Das, K; Das, S; Dash, A; Dash, S; De, S; Delagrange, H; Deloff, A; Dénes, E; D'Erasmo, G; De Caro, A; de Cataldo, G; de Cuveland, J; De Falco, A; De Gruttola, D; De Marco, N; De Pasquale, S; de Rooij, R; Diaz Corchero, M A; Dietel, T; Dillenseger, P; Divià, R; Di Bari, D; Di Liberto, S; Di Mauro, A; Di Nezza, P; Djuvsland, Ø; Dobrin, A; Dobrowolski, T; Domenicis Gimenez, D; Dönigus, B; Dordic, O; Dørheim, S; Dubey, A K; Dubla, A; Ducroux, L; Dupieux, P; Dutta Majumdar, A K; Hilden, T E; Ehlers, R J; Elia, D; Engel, H; Erazmus, B; Erdal, H A; Eschweiler, D; Espagnon, B; Esposito, M; Estienne, M; Esumi, S; Evans, D; Evdokimov, S; Fabris, D; Faivre, J; Falchieri, D; Fantoni, A; Fasel, M; Fehlker, D; Feldkamp, L; Felea, D; Feliciello, A; Feofilov, G; Ferencei, J; Fernández Téllez, A; Ferreiro, E G; Ferretti, A; Festanti, A; Figiel, J; Figueredo, M A S; Filchagin, S; Finogeev, D; Fionda, F M; Fiore, E M; Floratos, E; Floris, M; Foertsch, S; Foka, P; Fokin, S; Fragiacomo, E; Francescon, A; Frankenfeld, U; Fuchs, U; Furget, C; Furs, A; Fusco Girard, M; Gaardhøje, J J; Gagliardi, M; Gago, A M; Gallio, M; Gangadharan, D R; Ganoti, P; Gao, C; Garabatos, C; Garcia-Solis, E; Gargiulo, C; Garishvili, I; Gerhard, J; Germain, M; Gheata, A; Gheata, M; Ghidini, B; Ghosh, P; Ghosh, S K; Gianotti, P; Giubellino, P; Gladysz-Dziadus, E; Glässel, P; Gomez Ramirez, A; González-Zamora, P; Gorbunov, S; Görlich, L; Gotovac, S; Graczykowski, L K; Grelli, A; Grigoras, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grinyov, B; Grion, N; Grosse-Oetringhaus, J F; Grossiord, J-Y; Grosso, R; Guber, F; Guernane, R; Guerzoni, B; Guilbaud, M; Gulbrandsen, K; Gulkanyan, H; Gumbo, M; Gunji, T; Gupta, A; Gupta, R; Khan, K H; Haake, R; Haaland, Ø; Hadjidakis, C; Haiduc, M; Hamagaki, H; Hamar, G; Hanratty, L D; Hansen, A; Harris, J W; Hartmann, H; Harton, A; Hatzifotiadou, D; Hayashi, S; Heckel, S T; Heide, M; Helstrup, H; Herghelegiu, A; Herrera Corral, G; Hess, B A; Hetland, K F; Hippolyte, B; Hladky, J; Hristov, P; Huang, M; Humanic, T J; Hussain, N; Hussain, T; Hutter, D; Hwang, D S; Ilkaev, R; Ilkiv, I; Inaba, M; Innocenti, G M; Ionita, C; Ippolitov, M; Irfan, M; Ivanov, M; Ivanov, V; Jachołkowski, A; Jacobs, P M; Jahnke, C; Jang, H J; Janik, M A; Jayarathna, P H S Y; Jena, C; Jena, S; Jimenez Bustamante, R T; Jones, P G; Jung, H; Jusko, A; Kadyshevskiy, V; Kalinak, P; Kalweit, A; Kamin, J; Kang, J H; Kaplin, V; Kar, S; Karasu Uysal, A; Karavichev, O; Karavicheva, T; Karpechev, E; Kebschull, U; Keidel, R; Keijdener, D L D; Svn, M Keil; Khan, M M; Khan, P; Khan, S A; Khanzadeev, A; Kharlov, Y; Kileng, B; Kim, B; Kim, D W; Kim, D J; Kim, J S; Kim, M; Kim, M; Kim, S; Kim, T; Kirsch, S; Kisel, I; Kiselev, S; Kisiel, A; Kiss, G; Klay, J L; Klein, J; Klein-Bösing, C; Kluge, A; Knichel, M L; Knospe, A G; Kobdaj, C; Kofarago, M; Köhler, M K; Kollegger, T; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Konevskikh, A; Kovalenko, V; Kowalski, M; Kox, S; Koyithatta Meethaleveedu, G; Kral, J; Králik, I; Kravčáková, A; Krelina, M; Kretz, M; Krivda, M; Krizek, F; Kryshen, E; Krzewicki, M; Kučera, V; Kucheriaev, Y; Kugathasan, T; Kuhn, C; Kuijer, P G; Kulakov, I; Kumar, J; Kurashvili, P; Kurepin, A; Kurepin, A B; Kuryakin, A; Kushpil, S; Kweon, M J; Kwon, Y; Ladron de Guevara, P; Lagana Fernandes, C; Lakomov, I; Langoy, R; Lara, C; Lardeux, A; Lattuca, A; La Pointe, S L; La Rocca, P; Lea, R; Leardini, L; Lee, G R; Legrand, I; Lehnert, J; Lemmon, R C; Lenti, V; Leogrande, E; Leoncino, M; León Monzón, I; Lévai, P; Li, S; Lien, J; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Ljunggren, H M; Lodato, D F; Loenne, P I; Loggins, V R; Loginov, V; Lohner, D; Loizides, C; Lopez, X; López Torres, E; Lu, X-G; Luettig, P; Lunardon, M; Luparello, G; Ma, R; Maevskaya, A; Mager, M; Mahapatra, D P; Mahmood, S M; Maire, A; Majka, R D; Malaev, M; Maldonado Cervantes, I; Malinina, L; Mal'Kevich, D; Malzacher, P; Mamonov, A; Manceau, L; Manko, V; Manso, F; Manzari, V; Marchisone, M; Mareš, J; Margagliotti, G V; Margotti, A; Marín, A; Markert, C; Marquard, M; Martashvili, I; Martin, N A; Martinengo, P; Martínez, M I; Martínez García, G; Martin Blanco, J; Martynov, Y; Mas, A; Masciocchi, S; Masera, M; Masoni, A; Massacrier, L; Mastroserio, A; Matyja, A; Mayer, C; Mazer, J; Mazzoni, M A; Meddi, F; Menchaca-Rocha, A; Meninno, E; Mercado Pérez, J; Meres, M; Miake, Y; Mikhaylov, K; Milano, L; Milosevic, J; Mischke, A; Mishra, A N; Miśkowiec, D; Mitra, J; Mitu, C M; Mlynarz, J; Mohammadi, N; Mohanty, B; Molnar, L; Montaño Zetina, L; Montes, E; Morando, M; Moreira De Godoy, D A; Moretto, S; Morreale, A; Morsch, A; Muccifora, V; Mudnic, E; Mühlheim, D; Muhuri, S; Mukherjee, M; Müller, H; Munhoz, M G; Murray, S; Musa, L; Musinsky, J; Nandi, B K; Nania, R; Nappi, E; Nattrass, C; Nayak, K; Nayak, T K; Nazarenko, S; Nedosekin, A; Nicassio, M; Niculescu, M; Niedziela, J; Nielsen, B S; Nikolaev, S; Nikulin, S; Nikulin, V; Nilsen, B S; Noferini, F; Nomokonov, P; Nooren, G; Norman, J; Nyanin, A; Nystrand, J; Oeschler, H; Oh, S; Oh, S K; Okatan, A; Okubo, T; Olah, L; Oleniacz, J; Oliveira Da Silva, A C; Onderwaater, J; Oppedisano, C; Ortiz Velasquez, A; Oskarsson, A; Otwinowski, J; Oyama, K; Ozdemir, M; Sahoo, P; Pachmayer, Y; Pachr, M; Pagano, P; Paić, G; Pajares, C; Pal, S K; Palmeri, A; Pant, D; Papikyan, V; Pappalardo, G S; Pareek, P; Park, W J; Parmar, S; Passfeld, A; Patalakha, D I; Paticchio, V; Paul, B; Pawlak, T; Peitzmann, T; Pereira Da Costa, H; Pereira De Oliveira Filho, E; Peresunko, D; Pérez Lara, C E; Pesci, A; Peskov, V; Pestov, Y; Petráček, V; Petran, M; Petris, M; Petrovici, M; Petta, C; Piano, S; Pikna, M; Pillot, P; Pinazza, O; Pinsky, L; Piyarathna, D B; Płoskoń, M; Planinic, M; Pluta, J; Pochybova, S; Podesta-Lerma, P L M; Poghosyan, M G; Pohjoisaho, E H O; Polichtchouk, B; Poljak, N; Pop, A; Porteboeuf-Houssais, S; Porter, J; Potukuchi, B; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puccio, M; Puddu, G; Pujahari, P; Punin, V; Putschke, J; Qvigstad, H; Rachevski, A; Raha, S; Rajput, S; Rak, J; Rakotozafindrabe, A; Ramello, L; Raniwala, R; Raniwala, S; Räsänen, S S; Rascanu, B T; Rathee, D; Rauf, A W; Razazi, V; Read, K F; Real, J S; Redlich, K; Reed, R J; Rehman, A; Reichelt, P; Reicher, M; Reidt, F; Renfordt, R; Reolon, A R; Reshetin, A; Rettig, F; Revol, J-P; Reygers, K; Riabov, V; Ricci, R A; Richert, T; Richter, M; Riedler, P; Riegler, W; Riggi, F; Rivetti, A; Rocco, E; Rodríguez Cahuantzi, M; Rodriguez Manso, A; Røed, K; Rogochaya, E; Rohni, S; Rohr, D; Röhrich, D; Romita, R; Ronchetti, F; Ronflette, L; Rosnet, P; Rossi, A; Roukoutakis, F; Roy, A; Roy, C; Roy, P; Rubio Montero, A J; Rui, R; Russo, R; Ryabinkin, E; Ryabov, Y; Rybicki, A; Sadovsky, S; Šafařík, K; Sahlmuller, B; Sahoo, R; Sahu, P K; Saini, J; Sakai, S; Salgado, C A; Salzwedel, J; Sambyal, S; Samsonov, V; Sanchez Castro, X; Sánchez Rodríguez, F J; Šándor, L; Sandoval, A; Sano, M; Santagati, G; Sarkar, D; Scapparone, E; Scarlassara, F; Scharenberg, R P; Schiaua, C; Schicker, R; Schmidt, C; Schmidt, H R; Schuchmann, S; Schukraft, J; Schulc, M; Schuster, T; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Scott, R; Segato, G; Seger, J E; Sekiguchi, Y; Selyuzhenkov, I; Senosi, K; Seo, J; Serradilla, E; Sevcenco, A; Shabetai, A; Shabratova, G; Shahoyan, R; Shangaraev, A; Sharma, A; Sharma, N; Sharma, S; Shigaki, K; Shtejer, K; Sibiriak, Y; Siddhanta, S; Siemiarczuk, T; Silvermyr, D; Silvestre, C; Simatovic, G; Singaraju, R; Singh, R; Singha, S; Singhal, V; Sinha, B C; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Skjerdal, K; Slupecki, M; Smirnov, N; Snellings, R J M; Søgaard, C; Soltz, R; Song, J; Song, M; Soramel, F; Sorensen, S; Spacek, M; Spiriti, E; Sputowska, I; Spyropoulou-Stassinaki, M; Srivastava, B K; Stachel, J; Stan, I; Stefanek, G; Steinpreis, M; Stenlund, E; Steyn, G; Stiller, J H; Stocco, D; Stolpovskiy, M; Strmen, P; Suaide, A A P; Sugitate, T; Suire, C; Suleymanov, M; Sultanov, R; Šumbera, M; Symons, T J M; Szabo, A; Szanto de Toledo, A; Szarka, I; Szczepankiewicz, A; Szymanski, M; Takahashi, J; Tangaro, M A; Tapia Takaki, J D; Tarantola Peloni, A; Tarazona Martinez, A; Tariq, M; Tarzila, M G; Tauro, A; Tejeda Muñoz, G; Telesca, A; Terasaki, K; Terrevoli, C; Thäder, J; Thomas, D; Tieulent, R; Timmins, A R; Toia, A; Trubnikov, V; Trzaska, W H; Tsuji, T; Tumkin, A; Turrisi, R; Tveter, T S; Ullaland, K; Uras, A; Usai, G L; Vajzer, M; Vala, M; Valencia Palomo, L; Vallero, S; Vande Vyvre, P; Van Der Maarel, J; Van Hoorne, J W; van Leeuwen, M; Vargas, A; Vargyas, M; Varma, R; Vasileiou, M; Vasiliev, A; Vechernin, V; Veldhoen, M; Velure, A; Venaruzzo, M; Vercellin, E; Vergara Limón, S; Vernet, R; Verweij, M; Vickovic, L; Viesti, G; Viinikainen, J; Vilakazi, Z; Villalobos Baillie, O; Vinogradov, A; Vinogradov, L; Vinogradov, Y; Virgili, T; Vislavicius, V; Viyogi, Y P; Vodopyanov, A; Völkl, M A; Voloshin, K; Voloshin, S A; Volpe, G; von Haller, B; Vorobyev, I; Vranic, D; Vrláková, J; Vulpescu, B; Vyushin, A; Wagner, B; Wagner, J; Wagner, V; Wang, M; Wang, Y; Watanabe, D; Weber, M; Weber, S G; Wessels, J P; Westerhoff, U; Wiechula, J; Wikne, J; Wilde, M; Wilk, G; Wilkinson, J; Williams, M C S; Windelband, B; Winn, M; Yaldo, C G; Yamaguchi, Y; Yang, H; Yang, P; Yang, S; Yano, S; Yasnopolskiy, S; Yi, J; Yin, Z; Yoo, I-K; Yushmanov, I; Zaccolo, V; Zach, C; Zaman, A; Zampolli, C; Zaporozhets, S; Zarochentsev, A; Závada, P; Zaviyalov, N; Zbroszczyk, H; Zgura, I S; Zhalov, M; Zhang, H; Zhang, X; Zhang, Y; Zhao, C; Zhigareva, N; Zhou, D; Zhou, F; Zhou, Y; Zhuo, Zhou; Zhu, H; Zhu, J; Zhu, X; Zichichi, A; Zimmermann, A; Zimmermann, M B; Zinovjev, G; Zoccarato, Y; Zyzak, M

    The production of the strange and double-strange baryon resonances ([Formula: see text], [Formula: see text]) has been measured at mid-rapidity ([Formula: see text][Formula: see text]) in proton-proton collisions at [Formula: see text] [Formula: see text] 7 TeV with the ALICE detector at the LHC. Transverse momentum spectra for inelastic collisions are compared to QCD-inspired models, which in general underpredict the data. A search for the [Formula: see text] pentaquark, decaying in the [Formula: see text] channel, has been carried out but no evidence is seen.

  10. Dicty_cDB: VFH554 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RXKXXXXXXXQRXXXXEXXXXXX--- Frame B: eledsklxgxvytkkxn*rxlxxihwxrsxxxrxrkxxx*rgxyxxxiqrxhxxxxkrsn trrxxxrxxxernxxxkgxrxxxaxxxkexxxxx...gxxga--- Frame C: s*ktrnxxgxfiqkkxirgxxhxytgqeaxxagxexaxtkexhxxtxyrxhtxxxxrgat peexxaexxxketgxxkgkggxxxxxtkxxx...ggxxxxxx--- Homology vs CSM-cDNA Score E Sequences produ

  11. Morphometric comparison between hatchery-reared and wild-caught megalopae of the mangrove crab

    Directory of Open Access Journals (Sweden)

    Bárbara Andressa Casagrande Ayres

    2013-08-01

    Full Text Available The objective of this work was to compare the morphometry of hatchery-reared and wild-caught mangrove crab (Ucides cordatus megalopae. Ten U. cordatus megalopae of each group (hatchery-reared and wild-caught were individually analyzed using a stereoscopic microscope equipped with an ocular micrometer. Length, width, and height of all megalopae were measured, and the size of body appendices was determined. The results indicate that the hatchery-reared megalopae are more robust than the wild ones. Furthermore, some significant differences in the size of certain appendices can be cues of the kind of alterations that hatchery-reared individuals experience.

  12. Visualizing the semantic content of large text databases using text maps

    Science.gov (United States)

    Combs, Nathan

    1993-01-01

    A methodology for generating text map representations of the semantic content of text databases is presented. Text maps provide a graphical metaphor for conceptualizing and visualizing the contents and data interrelationships of large text databases. Described are a set of experiments conducted against the TIPSTER corpora of Wall Street Journal articles. These experiments provide an introduction to current work in the representation and visualization of documents by way of their semantic content.

  13. Enhancing L2 Reading Comprehension with Hypermedia Texts: Student Perceptions

    Science.gov (United States)

    Garrett-Rucks, Paula; Howles, Les; Lake, William M.

    2015-01-01

    This study extends current research about L2 hypermedia texts by investigating the combined use of audiovisual features including: (a) Contextualized images, (b) rollover translations, (c) cultural information, (d) audio explanations and (e) comprehension check exercises. Specifically, student perceptions of hypermedia readings compared to…

  14. Enhancing a Teen Pregnancy Prevention Program with text messaging: engaging minority youth to develop TOP ® Plus Text.

    Science.gov (United States)

    Devine, Sharon; Bull, Sheana; Dreisbach, Susan; Shlay, Judith

    2014-03-01

    To develop and pilot a theory-based, mobile phone texting component attractive to minority youth as a supplement to the Teen Outreach Program(®), a youth development program for reducing teen pregnancy and school dropout. We conducted iterative formative research with minority youth in multiple focus groups to explore interest in texting and reaction to text messages. We piloted a month-long version of TOP(®) Plus Text with 96 teens at four sites and conducted a computer-based survey immediately after enrollment and at the end of the pilot that collected information about teens' values, social support, self-efficacy, and behaviors relating to school performance, trouble with the law, and sexual activity. After each of the first three weekly sessions we collected satisfaction measures. Upon completion of the pilot we conducted exit interviews with twelve purposively selected pilot participants. We successfully recruited and enrolled minority youth into the pilot. Teens were enthusiastic about text messages complementing TOP(®). Results also revealed barriers: access to text-capable mobile phones, retention as measured by completion of the post-pilot survey, and a need to be attentive to teen literacy. Piloting helped identify improvements for implementation including offering text messages through multiple platforms so youth without access to a mobile phone could receive messages; rewording texts to allow youth to express opinions without feeling judged; and collecting multiple types of contact information to improve follow-up. Thoughtful attention to social and behavioral theory and investment in iterative formative research with extensive consultation with teens can lead to an engaging texting curriculum that enhances and complements TOP(®). Copyright © 2014 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.

  15. A comprehensive and quantitative comparison of text-mining in 15 million full-text articles versus their corresponding abstracts

    Science.gov (United States)

    Westergaard, David; Stærfeldt, Hans-Henrik

    2018-01-01

    Across academia and industry, text mining has become a popular strategy for keeping up with the rapid growth of the scientific literature. Text mining of the scientific literature has mostly been carried out on collections of abstracts, due to their availability. Here we present an analysis of 15 million English scientific full-text articles published during the period 1823–2016. We describe the development in article length and publication sub-topics during these nearly 250 years. We showcase the potential of text mining by extracting published protein–protein, disease–gene, and protein subcellular associations using a named entity recognition system, and quantitatively report on their accuracy using gold standard benchmark data sets. We subsequently compare the findings to corresponding results obtained on 16.5 million abstracts included in MEDLINE and show that text mining of full-text articles consistently outperforms using abstracts only. PMID:29447159

  16. Dicty_cDB: CHA864 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Frames) Frame A: ---XXXXXXXXXXXXXXXXXXXXXXMXXXIEXXXAAXESXXHGSXXFXYIMRDGXLERXX Frame B: ---xxxxxxxxxxxlxxxxxxxxxxcxvx*rxxx...qqxspxxmdxpfsxil*emvnwkexx Frame C: ---xxxxxxxxxvxxxxxxxxxxxxaxxyre

  17. A Case of Appendicular Tuberculosis mimicking an Acute Appendicitis

    African Journals Online (AJOL)

    Les auteurs rapportent un cas rare de tuberculose de siège apendiculaire mimant un tableau d'appendicite aigue. La littérature sur cette question est revisée. Mots clés : tuberculose, appendice. The author report a rare case of appendiceal tuberculosis clinically presenting as acute appendicitis. The litterature is reviewed.

  18. DNA barcoding in a biodiversity hot spot: potential value for the identification of Malagasy Euphorbia L. listed in CITES Appendices I and II.

    Science.gov (United States)

    Aubriot, Xavier; Lowry, Porter P; Cruaud, Corinne; Couloux, Arnaud; Haevermans, Thomas

    2013-01-01

    The island of Madagascar is a key hot spot for the genus Euphorbia, with at least 170 native species, almost all endemic. Threatened by habitat loss and illegal collection of wild plants, nearly all Malagasy Euphorbia are listed in CITES Appendices I and II. The absence of a reliable taxonomic revision makes it particularly difficult to identify these plants, even when fertile, and thereby compromises the application of CITES regulations. DNA barcoding, which can facilitate species-level identification irrespective of developmental stage and the presence of flowers or fruits, may be a promising tool for monitoring and controlling trade involving threatened species. In this study, we test the potential value of barcoding on 41 Euphorbia species representative of the genus in Madagascar, using the two widely adopted core barcode markers (matK and rbcL), along with two additional DNA regions, nuclear internal transcribed spacer (ITS) and the chloroplastic intergenic spacer psbA-trnH. For each marker and for selected marker combinations, inter- and intraspecific distance estimates and species discrimination rates are calculated. Results using just the 'official' barcoding markers yield overlapping inter- and intraspecific ranges and species discrimination rates below 60%. When ITS is used, whether alone or in combination with the core markers, species discrimination increases to nearly 100%, whereas the addition of psbA-trnH produces less satisfactory results. This study, the first ever to test barcoding on the large, commercially important genus Euphorbia shows that this method could be developed into a powerful identification tool and thereby contribute to more effective application of CITES regulations. © 2012 Blackwell Publishing Ltd.

  19. A General Synthesis of C8-Arylpurine Phosphoramidites

    Directory of Open Access Journals (Sweden)

    Vorasit Vongsutilers

    2009-09-01

    Full Text Available A general scheme for the synthesis of C8-arylpurine phosphoramidites has been developed. C8-Arylation of C8-bromo-2′-deoxyguanosine is the key step and has been achieved through the use of a Suzuki coupling. Since the coupling reaction is conducted under aqueous conditions, it is unnecessary to protect and then deprotect the hydroxyl groups, thus saving several steps and improving overall yields. Once the C8-arylgroup is introduced, the glycosidic bond becomes very sensitive to acid catalyzed cleavage. Protection of the amino groups as the corresponding N,N-dimethylformamidine derivative improves stability of the derivatives. Synthetic C8-arylpurines were successfully used to prepare synthetic oligonucleotides.

  20. Management of C2-C3 fracture subluxation by anterior cervical approach and C2-C3 trans-cortical screw placement

    Directory of Open Access Journals (Sweden)

    Agrawal Amit

    2018-03-01

    Full Text Available Cervical spine injuries are the major cause of morbidity and mortality in trauma victims. Upper cervical spine injuries account for about 24% of acute fractures and dislocations and one third of fractures occur at the level of C2, while one half of injuries occur at the C6 or C7 levels. In contrast to this approach we used the transverse cervical, platysma splitting incision at a lower (C3-C4 disc to expose the upper cervical spine particularly lower border of C3 (entry point for the screw.