WorldWideScience

Sample records for tetraciclina relativamente ao

  1. Resistência do Plasmodium falciparum ao fansidar, quinina e tetraciclina Resistance of Plasmodium falciparum to fansidar, quinine and tetracycline

    Directory of Open Access Journals (Sweden)

    Fernando Hélio Alencar

    1982-10-01

    Full Text Available Descreve-se pela primeira vez uma cêpa amazônica de Plasmodium falciparum resistente ao Fansidar (pirimetamina mais sulfadoxina e quinino mais tetraciclina simultaneamente. O paciente, com 13 anos de idade, residia há cinco anos em Ariquemes, Estado de Rondônia, na Amazônia brasileira. A infecção foi curada com dose elevada de cloroquina administrada em dose única intravenosa (IV. É evidenciado o alto valor da cloroquina na cura da malária falciparum resistente, quando administrada em doses maiores que as usadas nos esquemas convencionais de tratamento.For the first time an Amazonian strain of Plasmodium falciparum resistant to FansidarR (pyrimethamine + sulfadoxine and quinine + tetracycline, taken sequentially is described. This case involves a female patient 13 years old, living for five years in Ariquemes County, State of Rondônia, in the Brazilian Amazon. The infection was cured with a single high dose of chloroquine administered intravenously. The authors point out the high valor of chloroquine in treating falciparum-resistant malaria, especially when given in higher doses than the standard one used for malaria therapy.

  2. Hipertensão intracraniana com manifestações oculares associada ao uso de tetraciclina: relato de caso Intracranial hypertension with ocular manifestation during the use of tetracycline: case report

    Directory of Open Access Journals (Sweden)

    Frederico Xavier dos Santos

    2005-10-01

    Full Text Available Os autores relatam o caso de uma paciente jovem, do sexo feminino, que desenvolveu quadro de hipertensão intracraniana benigna com manifestações oculares em concomitância ao uso de tetraciclina para o tratamento de otite. Esta é uma reação adversa rara deste medicamento, descrito em bula e com alguns relatos de caso em literatura internacional.The authors describe a young female patient with intracranial hypertension associated with ocular manifestations, during treatment with tetracycline. This is a rare adverse effect described in the medication warnings, and in a few reported cases in the scientific literature.

  3. Study of the effect of gamma radiation on the molecule of tetracycline concerning its behavior as complexing and extracting agent; Estudo do efeito da radiacao gama sobre a molecula de tetraciclina relativamente ao seu comportamento como agente complexante e extrator

    Energy Technology Data Exchange (ETDEWEB)

    Andrade e Silva, Leonardo Gondim de

    1982-07-01

    Both solvent extraction and spectrophotometric techniques were used to show the alterations that gamma radiation causes in the behavior of tetracycline molecule as far as its extracting and complexing power are concerned. The effect of gamma radiation on the solid tetracycline molecule, benzyl alcohol and on the solution of both was examined in solvent extraction systems whose aqueous phases were made up by {sup 152} Eu-{sup 154}Eu radioactive tracer solutions and whose organic phases were constituted by tetracycline-benzyl alcohol solutions. Experiments were performed in order to determine whether or not the water used for the pre-saturation of benzyl alcohol would influence the radiolysis of tetracycline. Solvent extraction and spectrophotometry were the techniques used to obtain the necessary data. Absorption spectra of irradiated tetracycline benzyl alcohol solutions submitted to several gamma radiation doses were examined and the alterations shown by these spectra were examined. The effect of gamma radiation on the tetracycline molecule was also studied when tetracycline-benzyl alcohol solutions were irradiated under several gaseous atmospheres, namely: O{sub 2}, N{sub 2}, SF{sub 6} and N{sub 2}O. The variation on the concentration of the tetracycline-benzyl alcohol solution caused by several doses of gamma radiation was determined by using the spectrophotometric technique. (author)

  4. Susceptibilidade de bactérias anaeróbias isoladas de infecções periimplantares e periodontais ao metronidazol, lincosaminas, macrolídeos e tetraciclina = Susceptibility of anaerobic bacteria isolated from periimplantar and periodontal infections to metronidazole, lincosamines, macrolides and tetracyclines

    Directory of Open Access Journals (Sweden)

    Gaetti-Jardim Júnior, Elerson

    2007-01-01

    Full Text Available O objetivo desse estudo foi avaliar a susceptibilidade de microrganismos isolados de infecções periodontais e periimplantares ao metronidazol, lincosaminas, macrolídeos e tetraciclina. Foram testadas as seguintes drogas antimicrobianas: azitromicina, claritromicina, clindamicina, eritromicina, lincomicina, metronidazol e tetraciclina. Empregou-se o método de diluição da droga em ágar, sendo que o meio de cultura utilizado foi o ágar Wilkins-Chalgren. 187 isolados de bactérias anaeróbias obrigatórias e facultativas foram submetidos aos testes de susceptibilidade. O inóculo bacteriano foi padronizado em 105 células/botão, o qual foi transferido para as placas contendo os antimicrobianos e placas controle (sem droga através de um replicador de Steers (Cefar Ltd, São Paulo, Brasil. Os resultados mostraram que a resistência à eritromicina, lincomicina e tetraciclina é mais disseminada entre os microrganismos isolados, sendo que a clindamicina, metronidazol, os novos macrolídeos mostraram maior efetividade

  5. EL RESURGIMIENTO DE LAS TETRACICLINAS

    Directory of Open Access Journals (Sweden)

    Alejandro Canale-Guerrero

    2011-01-01

    Full Text Available Reportes recientes mencionan que las tetraciclinas han vuelto a ser consideradas agentes terapéuticos importantes en el tratamiento de viejas enfermedades como la conjuntivitis gonocócica y contra nuevos padecimientos como la infección de Helicobacter pylori en pacientes dispépticos, en enfermedades causadas por protozoarios patógenos, en la terapia genómica contra el cáncer y como agente anti-reumático. La creación de programas para limitar el uso de antibióticos, junto con la extensión de hábitos y prácticas de higiene, en algunos países y la reciente producción industrial de moléculas de tetraciclina modificadas mediante síntesis química, han sido acciones decisivas para lograr que antibióticosde primera generación, que en su momento fueron útiles pero que generaron resistencia bacteriana, vuelvan a ser efectivos.

  6. Os acontecimentos de vida na adolescência: estudo exploratório acerca do impacto dos acontecimentos de vida na adolescência e as suas consequências na vinculação percebida relativamente aos pais e aos pares

    OpenAIRE

    Marques, Liliana

    2016-01-01

    Dissertação de mestrado em Psicologia Clínica e da Saúde (Psicopatologia e Psicoterapias Dinâmicas), apresentada à Faculdade de Psicologia e de Ciências da Educação da Universidade de Coimbra O presente estudo tem como objetivo perceber se o impacto sentido pelos adolescentes é maior relativamente às transformações da puberdade ou à ocorrência de determinados acontecimentos de vida, e também avaliar de que forma é que a ocorrência dos referidos acontecimentos de vida afeta, ou não, o modo ...

  7. Actualización en tetraciclinas

    Directory of Open Access Journals (Sweden)

    Moisés Morejón García

    2003-12-01

    Full Text Available Teniendo en cuenta su amplia utilización, sobre todo en sepsis comunitaria, y con el objetivo de promover el uso adecuado de las tetraciclinas, se ha realizado una breve reseña histórica de su origen, evolución y desarrollo, incluyendo su clasificación por generaciones, así como elementos concernientes a su estructura química, mecanismo de acción, espectro de acción, resistencia de los microorganismos a ellas, farmacocinética, toxicidad, indicaciones y dosificación.Taking into consideration their wide use, mainly in community sepsis, and in order to promote the adequate use of tetracyclines, a brief historical review on their origin, evolution and development has been made, including their classification by generations, as well as elements concerning their chemical structure, action mechanism, action range, resistance of the microorganisms to them, pharmacokinetics, toxicity, indications and dosage.

  8. Susceptibilidad de aislamientos de Neisseria gonorrhoeae a la penicilina y a la tetraciclina

    Directory of Open Access Journals (Sweden)

    Clara Inés de Vargas

    1996-09-01

    Full Text Available La vigilancia de la susceptibilidad antimicrobiana de los aislamientos de Neisseria qonorrhoeae es necesaria, debido a la capacidad de este patógeno para desarrollar resistencia por varios mecanismos, con las consecuentes fallas en el tratamiento. En un trabajo anterior, realizado en el Laboratorio de Microbiología del lnstituto Nacional de Salud, en el que se empleó la prueba de difusión de disco (Kirby-Bauer, se determinó en 43 aislamientos de N. gonorrhoeae no productores de beta-lactamasa, susceptibilidad intermedia a la penicilina en 42 y resistencia a la tetraciclina en 26. Por tal razón, se decidió establecer en todos los aislamientos de N. gonorrhoeae, remitidos al INS como parte del programa de red de ETS bacterianas, los niveles de resistencia a la penicilina y a la tetraciclina, expresados como la concentración inhibitoria mínima (CIM. De 100 aislamientos estudiados, 49 fueron no productores de beta-lactamasa (NPBL y 51 productores (PBL. La CIM de la penicilina de los aislamientos NPBL fue menor o igual a 0,06 pg/mL (sensible en 3; de 0,12-1 pg/mL (intermedia en 41; y mayor o igual a 2 pg/mL en 5. La CIM de los aislamientos PBL señaló que 4 eran intermedios y 47 resistentes. La CIM de la tetraciclina fue menor o igual a 0,25 pg/mL (sensible en 4, de 0,5 a pg/mL (intermedia en 18 y mayor o igual a 2 pg/mL (resistente en 78. Los datos destacan la importancia de mantener la vigilancia de la resistencia de N. gonorrhoeae a estos antimicrobianos para que, con base en ellos, se replanteen los esquemas de tratamiento.

  9. Estudio experimental de la tinción dental por tetraciclinas en dientes inmaduros

    OpenAIRE

    Bermúdez Semprún, María Esther

    2016-01-01

    Tesis inédita presentada en la Universidad Europea de Madrid. Facultad de Ciencias Biomédicas. Programa de Doctorado en Odontología Avanzada En la presente investigación pretendemos optimizar los resultados, evitando la tinción dentaria, en procedimientos odontológicos donde sea imprescindible el uso de tetraciclinas (la pasta triantibiótica en la revascularización) así como evaluar la disminución de las tinciones dentarias, al aplicar un antioxidante (ácido ascórbico, vitamina E, eugenol,...

  10. Estudo dos mecanismos moleculares de resistencia a claritromicina e tetraciclina em linhagens de Helicobacter pylori

    OpenAIRE

    Marcelo Lima Ribeiro

    2004-01-01

    Resumo: Helicobacter pylori é uma bactéria Gram-negativa e microaerofilica associada a diversas doenças gástricas, como gastrite crônica, úlcera péptica e câncer gástrico. As terapias de erradicação do H. pylori geralmente consistem no uso de dois ou três antimicrobianos combinados com um inibidor de bombas de prótons. Em geral, o metronidazol, a cIaritromicina e a amoxicilina usados na terapia de erradicação, enquanto os tratamentos com tetraciclina são utilizados como uma segunda opção em p...

  11. Estudo sôbre o tratamento de algumas infecções com laurilsulfato de tetraciclina

    Directory of Open Access Journals (Sweden)

    Egomar L. Edelweiss

    1968-04-01

    Full Text Available Os autores tecem considerações gerais sôbre o uso dos derivados das tetraciclinas nas infecções. Descrevem sua experiência com um composto injetável, o laurilsulfato de tetraciclina. Trataram 19 infecções diversas com êste medicamento: 5 anginas agudas, 8 pneumopatias, 2 enterocolites agudas, 1 furunculose, 1 pielonefrite, 1 erisipela, e um panarício. Obtiveram 15 resultados excelentes e 1 bom o que eleva a porcentagem de sucessos a 84 2%. Não observaram fenômenos secundários imputáveis à droga, salvo manifestações alérgicas em um paciente.

  12. Antibacterianos de acción sistémica: Parte III. Sulfonamidas y tetraciclinas

    Directory of Open Access Journals (Sweden)

    Manuel Cué Brugueras

    1999-04-01

    Full Text Available Resumen: Se presenta la tercera parte de una revisión bibliográfica sobre los antibacterianos de elección, en la cual se abordan los grupos sulfonamidas y tetraciclinas; además, se incluye un cuadro resumen con los antibióticos tratados en las tres partes, así como sus vías de administración y nombres comerciales que se utilizan en Cuba. Se hacen algunas consideraciones sobre la manera de enfrentar la gran variedad de antibióticos y el costo de la antibióticoterapia por parte de los países en vías de desarrollo, tomando como referencia algunas recomendaciones hechas por la OPS/OMSSummary: The third part of a bibliographic review on the elective antibacterials in which the groups of sulfonamides and tetracyclines are approached is presented. It is also included a summary picture with the antibiotics dealt with in the three parts, the routes of administration, and the trade names used in Cuba. Some considerations are made on the way to face the wide range of antibiotics and the cost of antibiotic therapy in the developing countries, taking into account some recommendations made by the PAHO/WHO

  13. Furazolidona, tetraciclina e omeprazol: uma alternativa de baixo custo para erradicação de Helicobacter pylori em crianças Furazolidone, tetracycline and omeprazole: a low-cost alternative for Helicobacter pylori eradication in children

    Directory of Open Access Journals (Sweden)

    Rodrigo Strehl Machado

    2008-04-01

    Full Text Available OBJETIVOS: Avaliar furazolidona, tetraciclina e omeprazol como tratamento de primeira linha para Helicobacter pylori em crianças com sintomas digestivos. MÉTODOS: Ensaio clínico aberto, prospectivo e consecutivo. O estudo incluiu pacientes acima de 8 anos com dispepsia funcional, dor abdominal funcional, anormalidades histológicas graves (metaplasia intestinal, atrofia gástrica ou linfoma do tecido linfóide associado às mucosas ou úlcera péptica. A presença de H. pylori foi definida com base em exame histológico e teste da urease. O regime medicamentoso consistiu de um tratamento de 7 dias com omeprazol, tetraciclina (ou doxiciclina e furazolidona duas vezes por dia. A erradicação foi avaliada através de endoscopia digestiva alta 2 meses após o tratamento (exame histológico e teste da urease. Avaliações clínicas posteriores foram realizadas 7 dias e 2 meses após o tratamento. RESULTADOS: Foram incluídos 36 pacientes (21 meninas/15 meninos. A idade variou de 8 a 19 anos (média de 12,94+2,89 anos. Na análise por intenção de tratar (n = 36, a taxa de erradicação foi de 83,3% (IC95% 77,1-89,5, ao passo que na análise por protocolo (n = 29, foi de 89,7% (IC95% 84,6-94,7. A adesão foi melhor quando se utilizou doxiciclina, mas as taxas de sucesso foram semelhantes para as duas tetraciclinas. Não houve nenhuma variável associada à falha no tratamento. Foram relatados efeitos colaterais em 17 pacientes (47,2%, principalmente dor abdominal (11/30,5%, náusea (sete/19,4% e vômitos (cinco/13,9%. CONCLUSÃO: A terapia tripla com furazolidona e tetraciclina é uma alternativa de baixo custo para o tratamento da infecção pelo H. pylori.OBJECTIVE: To evaluate furazolidone, tetracycline and omeprazole as first line therapy for Helicobacter pylori in children with digestive symptoms. METHODS: Prospective and consecutive open trial. The study included patients older than 8 years old with functional dyspepsia, functional

  14. Uso indiscriminado de tetraciclinas en afecciones bucales de origen odontógenas Overuse of tetracycline in oral diseases of odontogenous origin

    OpenAIRE

    Hilda Rodríguez Chala; Odalys Solar Carballo

    2007-01-01

    El uso de los antibióticos en la terapéutica de las enfermedades infecciosas constituyó un avance en la historia de la humanidad. Sin embargo, en la actualidad existe un uso indiscriminado de estos, que trae consigo la resistencia bacteriana y por ende, la no efectividad del mismo. Se realizó un estudio en 40 pacientes que ingerían la tetraciclina debido a afecciones bucales de origen odontógeno, con el objetivo de conocer cuáles eran las enfermedades bucales donde esta se utilizaba indiscrim...

  15. Omeprazole, Furazolidone, and Tetracycline: an eradication treatment for resistant H. pylori in Brazilian patients with peptic ulcer disease Omeprazol, Tetraciclina e Furazolidona, um tratamento para erradicação do H. pylori resistente em pacientes ulcerosos do Brasil

    Directory of Open Access Journals (Sweden)

    Fernando Marcuz Silva

    2002-09-01

    infectados pelo H. pylori confirmado pelo teste da urease e exame histológico, não tratados previamente ou já tratados sem sucesso com macrolídeos e nitroimidazólicos, foram tratados com Omeprazol 20mg em dose única diária, associado à Tetraciclina 500mg e Furazolidona 200mg dadas três vezes ao dia, por três dias. Uma nova endoscopia ou um Teste Respiratório foi realizado 12 semanas após o término do tratamento e foram considerados erradicados da infecção os pacientes que apresentaram o teste da urease e exame histológico negativos ou o Teste Respiratório negativo para a bactéria. RESULTADOS: Sessenta e quatro pacientes foram incluídos no estudo, 26 deles não previamente tratados. As mulheres predominaram (58%, a idade média foi de 46 anos, 33% dos pacientes eram tabagistas e a úlcera duodenal foi identificada em 80% dos pacientes. Nos 59 doentes que realizaram o exame de controle, a erradicação foi constatada em 44 (75%. Por intenção de tratamento o índice foi de 68%. O grupo não tratado previamente não diferiu do grupo previamente tratado. A incidência de efeitos adversos intensos foi de 15%. CONCLUSÃO: O esquema proporciona boa eficácia na erradicação do H. pylori em pacientes já previamente tratados sem sucesso, porém apresenta efeitos adversos intensos, que impediu o uso adequado dos medicamentos em 15% dos pacientes.

  16. Cometas: Das Lendas aos Fatos

    Science.gov (United States)

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  17. Uso indiscriminado de tetraciclinas en afecciones bucales de origen odontógenas Overuse of tetracycline in oral diseases of odontogenous origin

    Directory of Open Access Journals (Sweden)

    Hilda Rodríguez Chala

    2007-03-01

    Full Text Available El uso de los antibióticos en la terapéutica de las enfermedades infecciosas constituyó un avance en la historia de la humanidad. Sin embargo, en la actualidad existe un uso indiscriminado de estos, que trae consigo la resistencia bacteriana y por ende, la no efectividad del mismo. Se realizó un estudio en 40 pacientes que ingerían la tetraciclina debido a afecciones bucales de origen odontógeno, con el objetivo de conocer cuáles eran las enfermedades bucales donde esta se utilizaba indiscriminadamente, así como los mecanismos (automedicación o prescripción. Se obtuvieron comos resultados que las odontalgias por alteraciones pulpares y los abscesos dentoalveolares agudos son las patologías bucales donde se usa irracionalmente la tetraciclina, tanto en el fenómeno de automedicación como en la prescripción por parte de facultativos. La automedicación fue la vía dónde se evidenció mayor uso de la tetraciclina con el 67,5 %, y se observaron varios factores que condicionan este comportamiento. Existió un elevado porcentaje de no efectividad de este ante afecciones bucales debido al uso indiscriminado, ya sea por no ser el antibiótico de elección ante la patología o por ser ingerido innecesariamente.The use of antibiotics in treating infectious diseases was a breakthrough in the history of mankind. However, there is at present an excessive use of these drugs that leads to antimicrobial resistance and ineffectiveness. Forty patients, who took tetracycline for oral diseases of odontogenous origin, were studied to find out the oral diseases where this drug was overused as well as the intake mechanisms (self-medication or prescription. The achieved results showed that odontalgias from pulpar disturbances and acute dentoalveolary abscesses are the oral pathologies where tetracycline is irrationally overused through self-medication and prescription by physicians. Self-medication was the most frequent way of administering tetracycline

  18. Perfil de sensibilidade aos antimicrobianos e eficácia de sanitizantes frente aos isolados de Salmonella spp. oriundos de carcaças suínas no Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Fernanda Lucia Colla

    2014-04-01

    Full Text Available Os objetivos do trabalho foram avaliar o perfil de sensibilidade a antimicrobianos e a eficácia de três sanitizantes frente a isolados de Salmonella spp. oriundos de carcaças na tecnologia de abate de suínos. Avaliaram-se 120 amostras, das quais 39 foram positivas para Salmonella spp. Os princípios ativos testados foram penicilina G 10 U, amoxicilina + ácido clavulânico 30mcg, ampicilina 10mcg, cloranfenicol 30mcg, tetraciclina 30mcg, estreptomicina 10mcg, neomicina 30mcg, gentamicina 10mcg, enrofloxacina 5mcg, sulfazotrim 25mcg, sulfonamida 300mcg e trimetropima 5mcg. Nos testes com sanitizantes utilizaram-se clorexidina, amônia quaternária e ácido peracético com tempos de contato de um, cinco, 10 e 15 minutos. Os índices de resistência aos antimicrobianos foram de 100% para penicilina, 94,9% para tetraciclina, 89,7% para trimetropima e 87,2% para ampicilina. Nenhum dos princípios ativos foi 100% eficaz frente aos isolados testados, observando-se melhor ação para amoxicilina+ácido clavulânico (86,7%, neomicina (86,7% e cloranfenicol (64,1%. Nos testes de eficácia dos sanitizantes, o ácido peracético a 0.5% foi efetivo a partir de 10 minutos (94,6% e 15 minutos (97,3% de contato; amônia quaternária a 1% por 10 minutos (89,2% e 15 minutos (97,3% e clorexidina a 0.5% por 10 minutos (70,3% e 15 minutos de contato (72,8%. Todas as amostras testadas apresentaram multirresistência e seis (15,3% apresentaram resistência à ampicilina, cloranfenicol, estreptomicina, sulfonamida e tetraciclina (denominado grupo ACSSuT, indicando a necessidade de monitorar a propagação da resistência aos antimicrobianos em Salmonella spp. oriundas de suínos. O sanitizante mais efetivo frente aos isolados testados foi o ácido peracético a 0.5% por 15 minutos, reforçando a necessidade de monitorar também a efetividade de produtos sanitizantes frente aos isolados de Salmonella spp.

  19. Detección de tetraciclinas en nueve lotes de alimentos para cerdos, tilapias y pollos producidos en Costa Rica: Incumplimiento de normativas y disconformidades con el etiquetado oficial de garantía

    Directory of Open Access Journals (Sweden)

    Karla Gutiérrez

    2010-01-01

    Full Text Available Sobre criterios de riesgos ambientales y sanitarios asociados al uso de antibióticos en la producción animal, se utilizó un método microbiológico y un método analítico por HPLC para cuantificar tetraciclinas y determinar su identidad, respectivamente, en lotes de alimento para cerdos (n=4, tilapia (n=3 y pollos de engorde (n=2 producidos en Costa Rica. Tres alimentos para consumo de cerdos y 2 alimentos para consumo de tilapias dieron resultados positivos por ambas técnicas. Los alimentos para cerdos positivos contenían clortetraciclina en concentraciones superiores a las permitidas por los reglamentos vigentes en el país y los alimentos de tilapia positivos contenían oxitetraciclina en concentraciones iguales o mayores a las detectadas en los alimentos para cerdos. Los alimentos para pollos, por el contrario, no contenían tetraciclina, ni oxitetraciclina ni clotetraciclina. Se hallaron incongruencias entre las concentraciones de tetraciclinas detectadas y las especificadas en la etiqueta de 4 muestras. Estos resultados justifican una mayor vigilancia por parte de los productores, consumidores y autoridades sanitarias costarricenses.

  20. Terapia com inibidor da ECA com dosagens relativamente altas e risco de agravamento renal na insuficiência cardíaca crônica

    Directory of Open Access Journals (Sweden)

    Renato De Vecchis

    2011-12-01

    Full Text Available FUNDAMENTO: O efeito renoprotetor dos inibidores da ECA vem sendo questionado no caso de diminuição do volume circulante efetivo, como na insuficiência cardíaca crônica direita ou biventricular. Objetivo: Detectar os preditores clínicos de agravamento renal na população de pacientes com ICC, caracterizado por dois tipos de regime de dosagem de inibidores da ECA. MÉTODOS: De acordo com um desenho de coorte retrospectiva, seguimos dois grupos de pacientes com ICC - tanto direita quanto biventricular -, todos na classe III da NYHA, tratados com inibidores da ECA (enalapril ou lisinopril, e com fração de ejeção do ventrículo esquerdo (FEVE 10 mg por dia de enalapril ou lisinopril. A disfunção renal agravada (ARD foi definida pelo aumento de Cr > 30% com relação ao segmento basal. O modelo de risco proporcional de Cox foi utilizado para identificar os preditores da ARD entre as seguintes variáveis: os inibidores da ECA com "alta" dosagem, idade, FEVE basal, histórico de repetidas terapias intensivas com diuréticos de alça por via intravenosa (diurético intravenoso, diabete, Cr basal, histórico de hipertensão, pressão arterial sistólica < 100 mmHg. RESULTADOS: Cinquenta e sete pacientes foram recrutados, dos quais 15 foram tratados com inibidor da ECA com dosagem "alta". Durante um seguimento médio de 718 dias, a ARD ocorreu em 17 pacientes (29,8%. Apenas o inibidor da ECA com "alta" dosagem (RR: 12,4681 IC: 2,1614 - 71,9239 p = 0,0050 e Cr basal (RR:1,2344 IC: 1,0414 - 1,4632 p = 0,0157 foi demonstrado ser preditor da ARD. Além disso, demonstrou-se que o inibidor da ECA com dosagens "altas" não previu ARD em ICC sem diurético intravenoso e ICC com diabete. CONCLUSÃO: Na ICC de classe III da NYHA, o inibidor da ECA com "altas" dosagens e um maior Cr basal foi preditor da ARD. A nefrotoxicidade relacionada com inibidores da ECA em "altas" dosagens foi aumentada com o diurético intravenoso, ao passo que, em pacientes com

  1. Tetracycline and oxytetracycline resistance determinants detected in Bacillus cereus strains isolated from honey samples Detección de determinantes de resistencia a tetraciclina y oxitetraciclina en cepas de Bacillus cereus aisladas de muestras de miel

    Directory of Open Access Journals (Sweden)

    A. C. López

    2008-12-01

    Full Text Available The aim of this study was to investigate the presence of tetracycline and oxytetracycline resistance determinants in Bacillus cereus strains isolated from honey samples. Of a total of 77 isolates analyzed, 30 (39% exhibited resistance to tetracyclines according to the results of a disk diffusion method. Resistant strains (n=30 were screened by PCR for the presence of the resistant determinants tetK, tetL, tetM, tetO, tetW, otrA and otrB and their MIC values for tetracycline, oxytetracycline and minocycline were assessed. According to the PCR results, 23 isolates (77% presented at least one tetracycline or oxytetracycline resistance determinant. The tetK genotype was present in 10 isolates while the tetL, tetM, and otrA genotypes were present in 3, 2, and 5 isolates, respectively. In addition, 2 isolates of the tetK plus tetM genotype, 1 of the tetK plus tetL genotype, and 1 of the tetK plus otrA genotype were found. All isolates were tetW, tetO and otrB negatives. On the other hand, 7 isolates (23% showed a tetracycline-resistant and/or minocyclineresistant phenotype (MIC but did not carry any of the tet or otr determinants investigated in this study. This research has shown that B. cereus isolates from honey samples contain a variety of tetracycline and oxytetracycline resistance genes, including the tetK and tetL determinants which encode for efflux proteins, and tetM and otrA, which encode for ribosomal protection proteins. These findings indicate that strains isolated from honeys could represent a reservoir for tetracycline resistance genes. To our knowledge, this is the first report of tetracycline-resistant and oxytetracyclineresistant B. cereus strains carrying the tetK determinant, and also the first report of oxytetracycline-resistant and tetracycline- resistant Bacillus species carrying the otrA determinant.El objetivo del presente estudio ha sido investigar la presencia de diversos determinantes de resistencia a tetraciclina y

  2. Incentivos ao investimento estrangeiro

    OpenAIRE

    Mendes, Valter Nuno Dias

    2015-01-01

    Dissertação de Mestrado apresentada ao Instituto de Contabilidade e Administração do Porto para a obtenção do grau de Mestre em Contabilidade e Finanças, sob orientação de Doutor José de Campos Amorim O presente estudo tem por tema os Incentivos ao Investimento Estrangeiro ao nível das pessoas singulares: o Regime Fiscal do Residente Não Habitual (RNH) e a Autorização de Residência para Atividade de Investimento (ARI) – Vistos Dourados (Golden Visa), tendo por objetivo a análise mais po...

  3. Determinação de tetraciclina em líquido sinovial de vacas com doença podal Analytical method to the determination of tetracycline in synovial fluid of cows with lameness in foot

    Directory of Open Access Journals (Sweden)

    Cláudia Esteban

    2007-06-01

    Full Text Available As doenças podais em bovinos são, via de regra, acompanhadas de infecções existentes na área lesionada. O sucesso do tratamento relaciona-se com a concentração do fármaco nas sinóvias dos animais, sendo tetraciclina e oxitetraciclina, entre os antibióticos os principais quimioterápicos atualmente utilizados. Assim, o presente trabalho objetivou desenvolver um método analítico que permita a determinação de tetraciclina por Cromatografia a Líquido de Alta Pressão em líquido sinovial de vacas leiteiras portadoras de enfermidades podais pós-tratamento via intravenosa do antibiótico. O método analítico apresentou limite de detecção e quantificação para a tetraciclina em líquido sinovial de 38 ng/mL e 50 ng/mL, respectivamente. A recuperação das concentrações baixa, média e alta foram superiores a 75%. A linearidade foi avaliada na faixa dinâmica de 50 - 15.000 ng/mL. A precisão e a exatidão para as concentrações baixas, médias e altas foram consideradas adequadas para a realização das análises. Os resultados da concentração máxima e tempo para atingir a concentração máxima foram, respectivamente de Tmax= 1,37 h, Cmax=3471,57 ng/mL em líquido sinovial de vacas com doença podal.Lameness in cattle is, as a rule, accompanied by infection in the wounded area. Many antimicrobial agents of wide spectrum are used in this therapy, being the concentration of the active principle of paramount importance in the treatment. One of the most used antibiotics is the tetracycline family, having as main representants oxitetracycline and tetracycline due to their treatment success. Therefore, the present work aims the development of an analytical method which allows the determination of tetracycline by High Pressure Liquid Chromatography in sinovial fluid of dairy cows, with lameness in foot, post-administration of antibiotic by intravenous via. The analytical method presented detection and quantification limits in

  4. Microbiota cérvico-vaginal de ovelhas mestiças e sua susceptibilidade aos antibióticos

    Directory of Open Access Journals (Sweden)

    Valdenice F. Silva

    2011-07-01

    Full Text Available A criação de ovinos tem se desenvolvido nas últimas décadas, entretanto ainda são escassas informações sobre a composição e potencial patogênico da microbiota cérvico-vaginal de ovelhas. O presente estudo teve como objetivo conhecer os microrganismos constituintes da microbiota cérvico-vaginal de ovelhas, bem como sua susceptibilidade aos antimicrobianos. Foram realizadas coletas em 60 animais sadios, pertencentes a rebanhos de Petrolina e região. Foi realizado o isolamento bacteriano em ágar sangue e ágar MacConkey, sendo os microrganismos identificados de acordo com características morfológicas, tintoriais e bioquímicas. As amostras foram submetidas ao teste de difusão em disco para determinar o perfil de sensibilidade aos antimicrobianos: sulfametazina, enrofloxacina, doxiciclina, tetraciclina, penicilina, amoxicilina, cefalotina e lincomicina. Foram obtidos 94 isolados, sendo constatada uma maior frequência de Staphylococcus spp. (32,97%, Escherichia coli e Micrococcus spp., sendo observado ainda, isolados de Acinetobacter spp., Shigella spp., Enterobacter spp., Klebsiella spp. e Streptococcus spp. Os isolados apresentaram alta sensibilidade aos antimicrobianos testados sendo observado o menor percentual de sensibilidade para lincomicina. A presença de microrganismos oportunistas de potencial patogênico, na microbiota, como Staphylococcus spp e Escherichia coli, remete a uma análise criteriosa em relação ao diagnóstico de infecções genitais. Os isolados bacterianos obtidos neste estudo são sensíveis à maioria dos grupos de drogas antimicrobianas testadas, demonstrando o potencial de utilização desses princípios ativos, além da disponibilidade de escolha, visto a ausência de multirresistência.

  5. Carta ao Editor

    OpenAIRE

    Correia, Miguel

    2017-01-01

    Exmos. Senhores Editores-Chefe,Li com muito interesse o artigo de Sousa R e colaboradores, intitulado “Que fatores levam ao abandono de crianças do serviço de urgência antes da observação médica?”.

  6. Infecções do trato urinário (ITU de cães e gatos: etiologia e resistência aos antimicrobianos

    Directory of Open Access Journals (Sweden)

    Vania M. Carvalho

    2014-01-01

    Full Text Available As infecções bacterianas do trato urinário (ITUs são causa comum de doença em cães, gatos e humanos. Embora bactérias Gram positivas como Staphylococcus spp., Streptococcus spp. e Enterococcus spp., possam ocasionar ITUs, as bactérias Gram negativas (Escherichia coli, Proteus spp., Klebsiella spp., Pseudomonas spp. e Enterobacter spp. respondem por 75% dos casos. Este estudo teve como objetivo determinar a frequência de diferentes gêneros de bactérias em ITUs em cães e gatos, bem como a sua sensibilidade aos antimicrobianos utilizados na rotina clínica. Portanto, amostras de urina de 100 cães e gatos com sinais de ITU foram coletadas assepticamente, sofrendo avaliação microbiológica por meio de métodos qualitativos e quantitativos, além de urinálise. Todos os isolados foram submetidos a testes de sensibilidade aos antimicrobianos. ITU foi confirmada em 74% dos animais, não havendo predominância quanto ao sexo. No que diz respeito à idade, 85% dos cães e 87% dos gatos tinham idades superiores a seis anos. Noventa e cinco cepas bacterianas foram isoladas, com maior frequência de Escherichia coli (55% do total dos sorogrupos O6 e O2. Constatou-se níveis elevados de resistência a antimicrobianos nas cepas isoladas. Para as cepas Gram positivas, tetraciclina (46,1%, enrofloxacina, cotrimazol e estreptomicina (42,3% cada foram as drogas com os maiores índices de resistência. Para as Gram negativas, amoxacilina e tetraciclina apresentaram percentuais acima de 50%. Multiresistência foi verificada em mais de 50% dos principais gêneros isolados. Considerando-se que as cepas de E. coli apresentam potencial zoonótico e forte participação na disseminação de resistência aos antimicrobianos, ressalta-se a importância do papel do médico veterinário na prevenção e controle das ITUs animais e sua contribuição para a saúde pública.

  7. AO Group Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, S

    2005-10-04

    The Adaptive Optics (AO) Group in I Division develops and tests a broad range of advanced wavefront control technologies. Current applications focus on: Remote sensing, High power lasers, Astronomy, and Human vision. In the area of remote sensing, the AO Group leads a collaborative effort with LLNL's Nonproliferation, Arms Control & International Security (NAI) Directorate on Enhanced Surveillance Imaging. The ability to detect and identify individual people or vehicles from long-range is an important requirement for proliferation detection and homeland security. High-resolution imaging along horizontal paths through the atmosphere is limited by turbulence, which blurs and distorts the image. For ranges over {approx}one km, visible image resolution can be reduced by over an order of magnitude. We have developed an approach based on speckle imaging that can correct the turbulence-induced blurring and provide high resolution imagery. The system records a series of short exposure images which freeze the atmospheric effects. We can then estimate the image magnitude and phase using a bispectral estimation algorithm which cancels the atmospheric effects while maintaining object information at the diffraction limit of the imaging system.

  8. Análise da interacção entre a lamotrigina e a oxcarbazepina recorrendo ao método isobolográfico

    OpenAIRE

    Machado, Sónia Marisa Rodrigues

    2005-01-01

    Historicamente, o controlo das crises epilépticas envolveu a utilização conjunta de vários fármacos, situação a que se dá o nome de politerapia. O conceito de monoterapia no tratamento da epilepsia é relativamente recente, tendo surgido apenas em meados dos anos 70. Mais recentemente, com o desenvolvimento da fisiopatologia e da farmacologia, bem como o aumento do número de doentes refractários que não respondem à monoterapia (aproximadamente 1/3), chegou-se ao conceito de “...

  9. Otimização e validação de método para determinação de resíduos de oxitetraciclina, tetraciclina e clortetraciclina em leite por cromatografia líquida de alta eficiência

    OpenAIRE

    Ruela,Iara C. A.; Lima,Josefa A.; Souza,Scheilla V. C. de; Junqueira,Roberto G.

    2005-01-01

    Um método para determinação de resíduos de oxitetraciclina, tetraciclina e clortetraciclina em leite por cromatografia líquida de alta eficiência foi otimizado e validado. Ensaios intralaboratoriais empregando soluções padrão, brancos de amostras e amostras adicionadas de soluções padrão dos antimicrobianos foram realizados para avaliação da linearidade, seletividade, exatidão, precisão, limites de detecção e de quantificação do método. As amostras foram homogeneizadas, tratadas com solução t...

  10. Retinosquise juvenil ligada ao X

    Directory of Open Access Journals (Sweden)

    Cesar Gomes da Silveira

    2015-08-01

    Full Text Available RESUMO Relatar o caso de um paciente masculino de 28 anos que foi encaminhado ao Centro de Estudos e Pesquisas Oculistas Associados (RJ para avaliação de retina e apresentou os achados típicos de retinosquise juvenil ligada ao cromossomo X: maculopatia cistóide com formação de cistos na fóvea e retinosquise periférica. Foi realizado o manejo conservador, com atenção para as complicações.

  11. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; hide

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  12. Otimização e validação de método para determinação de resíduos de oxitetraciclina, tetraciclina e clortetraciclina em leite por cromatografia líquida de alta eficiência Optimization and validation of a method for determination of oxytetracycline, tetracycline and chlortetracycline residues in milk by high performance liquid chromatography

    Directory of Open Access Journals (Sweden)

    Iara C. A. Ruela

    2005-03-01

    Full Text Available Um método para determinação de resíduos de oxitetraciclina, tetraciclina e clortetraciclina em leite por cromatografia líquida de alta eficiência foi otimizado e validado. Ensaios intralaboratoriais empregando soluções padrão, brancos de amostras e amostras adicionadas de soluções padrão dos antimicrobianos foram realizados para avaliação da linearidade, seletividade, exatidão, precisão, limites de detecção e de quantificação do método. As amostras foram homogeneizadas, tratadas com solução tampão de succinato de sódio pH 4,0 e centrifugadas, descartando-se o precipitado. As tetraciclinas foram removidas do sobrenadante por quelação com íons cobre reversivelmente ligados à resina quelante e eluídas com tampão McIlvaine-EDTA pH 4,0. As médias de recuperação para as tetraciclinas foram de 76,2 a 104,9% com coeficiente de variação na faixa de 1,4 a 18,9%. Limites de detecção de 10, 15 e 40ng/mL e limites de quantificação de 10, 20 e 50ng/mL foram determinados para oxitetraciclina, tetraciclina e clortetraciclina, respectivamente.A method for determination of oxytetracycline, tetracycline and chlortetracycline residues in milk by high performance liquid chromatography was optimized and validated. Linearity, selectivity, trueness, precision, limits of detection and quantitation were evaluated by in-house validation procedures employing reference materials, sample blanks and spiked samples. Milk samples were homogenized, treated with sodium succinate pH 4.0 buffer and centrifuged, discarding the precipitate. Tetracyclines were removed from the supernatant by chelating with metal ions bound to a chelating resin and eluted with McIlvaine-EDTA pH 4.0 buffer. Mean recoveries for tetracyclines ranged from 76.2 to 104.9% with coefficients of variation from 1.4 to 18.9%. Detection limits of 10, 15 and 40ng/mL and quantitation limits of 10, 20 and 50ng/mL were determined for oxytetracycline, tetracycline and

  13. REALIDADE AUMENTADA APLICADA AO DESIGN

    OpenAIRE

    Fernandes, Bruno Chagas Alves; Sánchez, Joaquín Fernández

    2008-01-01

    Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  14. Realidade aumentada aplicada ao design

    OpenAIRE

    Fernández Sánchez, Joaquín

    2008-01-01

    Este artigo apresenta o estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  15. Cyberbullying – do diagnóstico de necesidades à construçao de um manual de formaçao.

    Directory of Open Access Journals (Sweden)

    Teressa Pessoa

    2011-01-01

    Full Text Available O impacto do cyberbullying na sociedade e junto das crianças e jovens, tão mais complexo quanto mais sofisticadas as ferramentas tecnológicas disponíveis, tem chamado a atenção para a importância, a nível internacional, da definição de estratégias de prevenção e intervenção junto de potenciais agentes educativos, isto é, para o desenvolvimento de uma proposta, com dimensão europeia, de Cyber- Training.Neste trabalho após uma breve apresentação do projectoCyberTraining: A Researchbased Training Manual On Cyberbullying1 dar-se-á a conhecer o processo de desenvolvimento de um manual de formação baseado numa investigação a nível europeu suportada na plataforma Moodle e, nesta, pela ferramenta Fórum. Através de uma análise de necesidades junto de formadores e do estudo, junto de especialistas, do estado de arte no domínio a nível de diferentes países, é mostrado todo um percurso inovador de construção colaborativa de conhecimento relativamente ao conceito cyberbullying assim como relativamente ao desenvolvimento de práticas de formação ou cybertraining.----------------------------------------------------------------The impact of the cyberbullying on society and among children and young people, revealed as ever more complex as more sophisticated technological tools becomeavailable, has called attention to the importance, at the international level, of a definition of strategies for prevention and intervention among potential educational agents, i.e. to develop a proposal for Cyber-Training, with a European dimension.In this paper, after a brief presentation of the European project CyberTraining: A Researchbased Training Manual on Cyberbullying, an account will be given of the process of developing a training manual based on research at European level supported in the Moodle platform, and within this, by the Forum tool. By means of a needs analysis among trainers and analysis by experts of the state of the art in

  16. AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.

    Science.gov (United States)

    Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel

    2017-05-01

    Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.

  17. Ocorrências bicarbonatadas sódicas associadas ao acidente de Gerês - Lobios : diversidade composicional e termalidade

    OpenAIRE

    Lima, Alberto da Silva

    2011-01-01

    O acidente Gerês – Lobios constitui a porção intermédia de uma megaestrutura de orientação N17ºE que recorta o Maciço Ibérico ao longo de uma extensão de cerca de 250 km. A este acidente estão associadas emergências bicarbonatadas sódicas, exóticas em termos regionais, nomeadamente nas localidades de Gerês (Portugal) e Lobios (Espanha), onde ocorrem manifestações de termalidade significativa. São águas de mineralização relativamente baixa, com valores de condutividade de 350...

  18. REALIDADE AUMENTADA APLICADA AO DESIGN

    Directory of Open Access Journals (Sweden)

    Bruno Chagas Alves Fernandes

    2008-07-01

    Full Text Available Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  19. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube.   Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  20. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-06-01

    Full Text Available Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  1. Estudo da imunoexpressão da COX-2 e KI-67 e a sua potencialidade como alvos terapêuticos em sarcomas felinos associados ao local de injeção

    OpenAIRE

    Medeiros, Maria Helena Trindade

    2016-01-01

    Dissertação de Mestrado em Genética Molecular Comparativa e Tecnológica Os sarcomas felinos associados ao local de injeção (SFALI) são tumores que ocorrem em locais onde previamente foi efetuada administração medicamentosa ou vacinal. Esta neoplasia tem um elevado grau de recorrência, e apesar da existência de vários tratamentos, a taxa de sucesso terapêutico é relativamente baixa. Para além disso, os estudos existentes acerca destes tumores são escassos. Assim, torna-se necessário a reali...

  2. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  3. Avaliação do potencial antioxidante da geleia real ao longo do tempo de armazenamento

    Directory of Open Access Journals (Sweden)

    Maria Luisa Teles Marques Florencio Alves

    2012-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n3p257   A geleia real é uma substância com aspecto de pasta gelatinosa, de cor branca, ligeiramente amarelada, secretada pelas glândulas hipofaringeanas e mandibulares das abelhas operárias. O objetivo desta pesquisa foi avaliar o potencial antioxidante da geleia real, ao longo do tempo de armazenamento. Os parâmetros físico-químicos utilizados foram: umidade, teor de ácido ascórbico e de fenólicos totais. As amostras foram submetidas ao processo de extração dando origem ao extrato alcoólico, que foi aplicado ao teste do 1,1-difenil-2-picrilhidrazil (DPPH para avaliação da atividade antioxidante in vitro. A geleia real apresentou baixos teores de ácido ascórbico (de 0,75 a 1,31mg/100g base úmida e de fenólicos totais (de 14,26 a 28,30mg EAG/100g base úmida. As porcentagens de descoloração do DPPH pelo extrato alcoólico das amostras ficaram acima de 50%, exceto aos 90 dias de armazenamento. A partir dos resultados obtidos, considerando-se os reduzidos teores de ácido ascórbico e de fenólicos totais e, ainda, o baixo desempenho do extrato alcoólico das amostras no teste de atividade antioxidante in vitro, conclui-se que a geleia real apresenta potencial antioxidante relativamente baixo. O tempo de armazenamento não foi determinante nas alterações encontradas.

  4. Diagnosis of AOS: definition and criteria.

    Science.gov (United States)

    Croot, Karen

    2002-11-01

    Presented in this article is a discussion of current progress in behavioral, cognitive, and neuroanatomic definitions of apraxia of speech (AOS). A behavioral definition summarizes the speech symptoms that should be considered diagnostic of AOS with or without co-occurring aphasia and dysarthria. AOS is defined in cognitive terms as an impairment in the translation of phonological representations into specifications for articulation. Progress toward a neuroanatomic definition of AOS will rely on mapping the processes described by increasingly sophisticated cognitive models of normal speech production to the brain. The article describes criteria that have been proposed for differentiating apraxic from phonological and dysarthric disorders and suggests that syndrome-based approaches to the diagnosis of AOS may obscure important differences between individual presentations of apraxic disruption as well as similarities between AOS and other speech-language disorders.

  5. Sobre o ódio ao professor Entrevista com Fernando Penna

    Directory of Open Access Journals (Sweden)

    Fernando Penna

    2016-01-01

    Full Text Available Ao tomar a decisão de pautar o tema da violência para compor o dossiê do terceiro número de Movimento – revista eletrônica de educação da Universidade Federal Fluminense –, o Conselho Editorial elencou um grande número de facetas da violência que historicamente se manifestam física e presencialmente no interior e fora do espaço escolar. O fenômeno relativamente recente das redes sociais e o vertiginoso processo de crescimento de trocas de informação, interação e mediação virtual a ele agregado, não apenas ampliou o espectro da violência como contribuiu decisivamente para articular o dentro e o fora da escola. Dentre outros exemplos, talvez o mais comum e antigo é o registro de cenas reais de alunos e alunas brigando nos pátios escolares ou nas redondezas da instituição postadas nas redes sociais, muitas delas viralizadas – para usar o barbarismoda ocasião – por um número sempre crescente de adeptos do bullying escolar. Nos últimos cinco anos, nas redes sociais, o exemplo de articulação da violência dentro-fora da escola que mais chama a atenção é o ódio ao professor, conforme observa o professor Fernando Penna na entrevista que publicamos a seguir. Estudioso da manifestação reivindicatória por uma escola sem ideologia trazida nos últimos anos por setores conservadores e reacionários da sociedade brasileira, Penna busca oferecer na entrevista algumas hipóteses para compreendermos o fenômeno do ódio ao professor, bem como algumas pistas para apreendermos os fundamentos que movem aqueles setores no combate ao que denominam de doutrinação ideológica de esquerda, e, concluindo, observa a urgência da resistência ao assédio moral feito dos conservadores ereacionários, chamando a atenção para a importância da ampliação do conhecimento crítico sobre o tema.

  6. A Etica na formaçao do bibliotecario: uma reflexao a partir da realidade brasileira

    Directory of Open Access Journals (Sweden)

    Jose Augusto Cháves Guimaraes

    2013-11-01

    Full Text Available Partindo-se da definicao de ética o estudos dos juízos de apreciacao que se referem a conduta humana suscetivel de qualificacao do bem e do mal, seja relativamente a uma sociedade, seja de modo absoluto (Ferreira, s.d., p.591, observa-se que a questao da ética, no ámbito mais cotidiano, encontrase ligada ao ideal de "bem fazer" e de "bem agir". Quando se traz essa questao para a esfera educacional, no entato, neceessário se torna, a priori, enfocar as duas maneiras pela qual se dá o processo de formacao de profissional bibliotecário: a formal e informal. No ambito formal, a educacao bibliotecária se dá, em nosso país, por meio do ensino de graduacao e de pós-graduacao (lato e stricto sensu, pautada em um tripé de elementos indissociáveis e interagentes: o ensino, a pesquisa e a extensao. Em assim sendo, para que se possa falar em ética na formacao do bibliotecário, necessário se torna abordá-la no ambito do ensino, da pesquisa e da extensao em Biblioteconomía, aspectos que serao objeto das reflexoes a seguir.

  7. Direito e Risco: do Consumo ao Ambiente

    OpenAIRE

    Marques, Carlos Alexandre Michaello

    2014-01-01

    A presente Dissertação tem como tema de investigação “Direito e Risco: do Consumo ao Ambiente”. Para tanto, essa temática foi delimitada através da investigação sobre a capacidade do Direito a partir de uma leitura Sociológica e Antropológica de compreender e promover aprendizagem nas questões que envolvem o Risco como elemento decorrente do Consumo e que externa suas consequências ao Ambiente. Neste sentido, se direcionou a responder ao problema de saber: em que medida é possível e necessári...

  8. Customer satisfaction and response to AOS

    Science.gov (United States)

    1999-01-01

    Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...

  9. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Science.gov (United States)

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  10. Gorgonids from Curaçao Island

    NARCIS (Netherlands)

    Gordon, Isabella

    1925-01-01

    This report contains an account of a collection of Gorgonids made by Dr. C. J. VAN DER HORST at the island of Curaçao and also of a few specimens collected in the same locality by Ir. G. J. H. MOLENGRAAFF. The Majority of the specimens are taken from Caracas bay at a depth of not more than five

  11. Estados Unidos: do Iraque ao Brasil

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-12-01

    Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.

  12. AoB PLANTS: origins and features.

    Science.gov (United States)

    Jackson, Michael B

    2009-01-01

    AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access helps sidestep library budgets which are struggling to purchase the increasing numbers of journals. Open Access makes research freely available both to the academic community and beyond while publishing online only eliminates the need to reject good manuscripts simply to control the size of the printed journal. Finally, the journal chose to go OA to ensure the widest possible international readership for the growing amount of high-quality plant science research being carried out worldwide in response to problems such as climate change and food shortages. Responses to a wide-ranging online questionnaire indicated strong international support for a journal such as AoB PLANTS. AoB PLANTS strives for fair and rapid peer review followed by fast publication of accepted papers. For an initial period, there will be no OA fees, and fees will remain modest once introduced. AoB PLANTS adopts double-blind peer review using published criteria for acceptability as a basis for decision-making. Accepted papers are published shortly after acceptance together with referees' analyses using Stanford University Libraries High Wire Press H2O platform. Authors retain ownership of the copyright in their papers.

  13. As desigualdades socioespaciais de acesso aos saberes: uma perspectiva de renovação da sociologia das desigualdades escolares?

    Directory of Open Access Journals (Sweden)

    Choukri Ben Ayed

    2012-09-01

    Full Text Available Este artigo dá conta do avanço dos conhecimentos sobre as desigualdades socioespaciais de acesso aos saberes na França. Embora este objeto envolva muitas questões societais, as pesquisas empíricas a ele consagradas continuam embrionárias. A que apresentamos aqui, muito abrangente, constitui um caso relativamente isolado. Depois de descrever a situação global das desigualdades na escolarização nesse país, o texto retoma a gênese da pesquisa. Insiste tanto no que está em jogo, metodologicamente, no estudo das variações do aprendizado escolar em função dos contextos de escolarização, quanto na necessidade de não dissociar, nas análises, o impacto dos fatores sociais e espaciais. De fato, hoje, uma das alavancas de renovação das abordagens na sociologia da educação consiste em levar em conta uma combinação dos dois.

  14. Sensibilidade da rosa 'Osiana' ao etileno

    OpenAIRE

    Delaine Cristina Cordeiro; Fernando Luiz Finger; Joice Simone dos Santos; Juliane Karsten; José Geraldo Barbosa

    2011-01-01

    Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida) à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando expos...

  15. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  16. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    Directory of Open Access Journals (Sweden)

    Jesús Ballesteros

    2008-04-01

    Full Text Available O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  17. Ondaletas aplicadas à análise de variabilidade de baixa frequência em séries de afluência aos reservatórios hidrelétricos brasileiros

    OpenAIRE

    Anjos, Sarah Lopes dos

    2016-01-01

    A análise da variabilidade espaço-temporal de séries históricas de vazão é de suma importância para a gestão dos recursos hídricos, pois leva a um melhor entendimento das flutuações naturais de sistemas hidrológicos e forma a base de conhecimento para construção e aperfeiçoamento de modelos de previsão e simulação de vazões. Neste trabalho, busca-se avaliar, nas séries de afluência aos reservatórios brasileiros, tendências cíclicas que ocorrem com períodos relativamente longos (a partir de...

  18. ROBO-AO M DWARF MULTIPLICITY SURVEY

    Science.gov (United States)

    Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica

    2018-01-01

    We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.

  19. Deformable mirror designs for extreme AO (XAO)

    Science.gov (United States)

    Cavaco, Jeffrey; Wirth, Allan

    2014-08-01

    One of the science missions for the next generation of extremely large ground based telescopes (30-42m apertures) is the imaging and spectroscopy of exoplanets. To achieve that goal an Adaptive Optics (AO) subsystem with a very large number of corrected modes is required. To provide contrast ratios in the range of 10-9 or better for a 42m telescope an AO system with 25,000 to 60,000 channels will be needed. This is approximately an order of magnitude beyond the current state of the art. Adaptive Optics Associates Xinetics has developed the Photonex Module Deformable Mirror (DM) technology specifically to address the needs of extreme AO for high contrast applications. A Photonex Module is a monolithic block of electrostrictive ceramic in which a high density of individually addressable actuators are formed by screen printing of electrodes and partial wire saw cutting of the ceramic. The printed electrode structures also allow all electrical connections to be made at the back surface of the module via flex circuits. Actuator spacings of 1mm or less have been achieved using this approach. The individual modules can be edge butted and bonded to achieve high actuator count. The largest DMs fabricated to date have 4096 actuators in a 64X64mm array. In this paper the engineering challenges in extending this technology by a factor of ten or more in actuator count will be discussed. A conceptual design for a DM suitable for XAO will be presented. Approaches for a support structure that will maintain the low spatial frequency surface figure of this large (~0.6m) DM and for the electrical interface to the tens of thousands of actuators will be discussed. Finally, performance estimates will be presented.

  20. Epidemiologia da tricomoniose e sensibilidade ao metronidazol

    OpenAIRE

    Alves, Maria José Gonçalves

    2006-01-01

    A Trichomonas vaginalis é o agente etiológico da tricomoniose, a doença sexualmente transmissível (DST) não viral mais comum no mundo. Actualmente é sabido que promove a transmissão do vírus do HIV, é causa de baixo peso em bebés, bem como de nascimentos prematuros, predispõe mulheres a doença inflamatória pélvica atípica, neoplasia cervical e infertilidade. Acresce ao problema o facto de serem usadas metodologias de diagnóstico com baixa sensibilidade e ainda o aumento de c...

  1. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  2. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    OpenAIRE

    Mónica Brinquinho; Ana Andresa Sousa; Janine Resende; João Valente

    2017-01-01

    O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores ...

  3. O TEMA DA JUSTIFICAÇÃO NAS CARTAS AOS ROMANOS E AOS GÂLATAS

    Directory of Open Access Journals (Sweden)

    James N. F. Alisson

    1990-01-01

    Full Text Available Uma das dificuldades para entender a doutrina de Paulo sobre a justificação é o fato de esse tema constar em escritos que retomam a exposição anteriormente apresentada em forma oral à comunidade cristã da Galácia e de Roma. Ele escreve aos destinatários com a finalidade de esclarecer assunto anteriormente explicado. É o que se vê nas referências ao quérigma que recordam o primeiro anúncio da salvação em Cristo, já comunicado aos destinatários em outra ocasião. O uso freqüente da fórmula "acaso não sabeis?" é indício do conhecimento que os destinatários têm sobre o assunto.

  4. Fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes

    OpenAIRE

    Morais, Caroline Neves de

    2015-01-01

    O excesso de peso e o ganho ponderal estão associados a um conjunto complexo de fatores que atuam desde a vida fetal. O presente estudo teve como objetivo verificar os fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes. Trata-se de um estudo realizado com dados secundários de uma pesquisa de corte transversal que envolveu 967 mães e lactentes do estado de Pernambuco. Na caracterização do estado nutricional utilizou-se o índice de massa corporal para ...

  5. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  6. Nefrocalcinose associada ao uso de esteroide anabolizante

    Directory of Open Access Journals (Sweden)

    Weverton Machado Luchi

    2015-03-01

    Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.

  7. Escala de valores relativos ao trabalho : EVT

    Directory of Open Access Journals (Sweden)

    Porto Juliana Barreiros

    2003-01-01

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  8. Escala de valores relativos ao trabalho: EVT

    Directory of Open Access Journals (Sweden)

    Juliana Barreiros Porto

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  9. Diferentes Metodologias Aplicadas ao Ensino de Astronomia

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2007-08-01

    Espera-se que o educando ao final da educação básica, adquira uma compreensão atualizada das hipóteses, modelos e formas de investigação sobre a origem e evolução do Universo em que vive. O presente trabalho tem como principal objetivo compreender dentre três práticas pedagógicas adotadas no Ensino de Astronomia, na terceira série do Ensino Médio, da Escola Estadual Colônia dos Pescadores, qual melhor cumpre o papel de formação e aprendizagem para vida. A pesquisa preliminar foi através de um questionário onde o intuito foi diagnosticar o conhecimento já existente acerca do tema em questão. O questionário é composto de vinte questões dissertativas e objetivas, onde os educandos das três turmas envolvidas o responderam. Este trabalho utiliza as seguintes metodologias: a tradicional, onde o professor é um repassador de informações, fazendo uso exclusivo de lousa e giz; a segunda também de forma tradicional, porém com auxílio de multimídia para desenvolvimento das aulas e aterceira sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervenções necessárias. Ao final do trabalho os alunos responderão novamente o questionário inicial para diagnosticar dentre as três metodologias utilizadas qual apresentou melhor resultado. Os resultados preliminares obtidos, já podem ser observados e, dos 119 alunos entrevistados, as respostas obtidas são as mais diversas e evidenciam que a grande maioria nunca teve em sua vida escolar o tema Astronomia. Ao serem questionados se já haviam estudado Astronomia as respostas foram: turma A: sim 43%; turma B: sim: 21%; turma C: sim: 24%. Porém quando questionados a respeito do significado de Astronomia observou-se que: turma A: 100% de acertos; turma B: 64% acertos; turma C: 84% de acertos, demonstrando claramente a aprendizagem em diferentes esferas, não dependendo unicamente da escola. Até o presente momento, verificou-se que há interesse em

  10. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    Directory of Open Access Journals (Sweden)

    Mónica Brinquinho

    2017-06-01

    Full Text Available O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores pretendem chamar a atenção para o consumo destes fármacos, particularmente frequente em indivíduos jovens, praticantes de desporto amador.

  11. Acesso ao aborto e liberdades laicas

    Directory of Open Access Journals (Sweden)

    Roberto Arriada Lorea

    2006-12-01

    Full Text Available Enfrentar o tema do aborto no Brasil requer uma perspectiva laica, na medida em que a liberdade de consciência assegurada na Constituição Federal impõe ao Estado contemplar não apenas as diferentes visões oriundas de distintas religiões, mas, principalmente, assegurar o direito à diversidade existente no seio de uma mesma religião, garantindo o direito de divergir da hierarquia de sua própria igreja. Assim, não havendo obstáculo jurídico à descriminalização do aborto no país, resta aos legisladores reformar a lei vigente, para descriminalizar o aborto, atendendo os compromissos assumidos pelo Brasil perante organismos internacionais de proteção dos direitos humanos e assegurando a eficácia das liberdades laicas.In Brazil, face an issue like abortion requires a lay perspective considering that the freedom of conscience assured by the Federal Constitution lays upon the State the need to look not only at different views from different religions but specially assure the right to the existing diversity within the same religion, as well as, the right to diverge from the hierarchy of his/her own religion. Therefore there is no legal barrier for the decriminalization of abortion in the country. It is up to the legislators to reform the present law to decriminalize abortion, assuming the commitments made by Brazil upon international organizations for the protection of the human rights assuring the efficacy of lay liberties.

  12. Terapia com inibidor da ECA com dosagens relativamente altas e risco de agravamento renal na insuficiência cardíaca crônica ACE-inhibitor therapy at relatively high doses and risk of renal worsening in chronic heart failure

    Directory of Open Access Journals (Sweden)

    Renato De Vecchis

    2011-12-01

    Full Text Available FUNDAMENTO: O efeito renoprotetor dos inibidores da ECA vem sendo questionado no caso de diminuição do volume circulante efetivo, como na insuficiência cardíaca crônica direita ou biventricular. Objetivo: Detectar os preditores clínicos de agravamento renal na população de pacientes com ICC, caracterizado por dois tipos de regime de dosagem de inibidores da ECA. MÉTODOS: De acordo com um desenho de coorte retrospectiva, seguimos dois grupos de pacientes com ICC - tanto direita quanto biventricular -, todos na classe III da NYHA, tratados com inibidores da ECA (enalapril ou lisinopril, e com fração de ejeção do ventrículo esquerdo (FEVE 10 mg por dia de enalapril ou lisinopril. A disfunção renal agravada (ARD foi definida pelo aumento de Cr > 30% com relação ao segmento basal. O modelo de risco proporcional de Cox foi utilizado para identificar os preditores da ARD entre as seguintes variáveis: os inibidores da ECA com "alta" dosagem, idade, FEVE basal, histórico de repetidas terapias intensivas com diuréticos de alça por via intravenosa (diurético intravenoso, diabete, Cr basal, histórico de hipertensão, pressão arterial sistólica BACKGROUND: Renoprotective effect of ACE-inhibitors has been questioned in case of decreased effective circulating volume, like in right or biventricular chronic heart failure. OBJECTIVE: To detect clinical predictors of renal worsening in CHF patient population characterized by two types of ACE-inhibitor dosing regimens. METHODS: According to a retrospective cohort design, we followed 2 groups of patients with CHF - whether right or biventricular -, all in III NYHA class treated with ACE-inhibitors (enalapril or lisinopril, and with left ventricular ejection fraction (LVEF 10 mg per day of enalapril or lisinopril. Worsened renal failure (ARD was defined by Cr increase >30% from baseline. Cox proportional hazards model was used to identify the predictors of ARD among the following variables

  13. Avaliação da suscetibilidade antimicrobiana de bactérias anaeróbias facultativas isoladas de canais radiculares de dentes com insucesso endodôntico frente aos antibióticos de uso sistêmico

    Directory of Open Access Journals (Sweden)

    Bárbara Trindade Di Santi

    Full Text Available ResumoIntroduçãoBactérias associadas ao insucesso do tratamento endodôntico são capazes de adquirir e expressar resistência aos agentes antimicrobianos comumente empregados para tratar infecções, o que torna necessário, em determinadas situações, a realização de testes laboratoriais para detectar a resistência ou a suscetibilidade antimicrobiana desses micro-organismos.Objetivoavaliar a suscetibilidade antimicrobiana das cepas de Enterococcus faecalis, Enterococcus faecium, Actinomyces viscosus e Staphylococcus aureus isoladas de canais radiculares de dentes com insucesso endodôntico.Material e métodoCepas clínicas de Enterococcus faecalis (n=3, Enterococcus faecium (n=3, Actinomyces viscosus (n=3 e Staphylococcus aureus (n=3, coletadas in vivo de canais radiculares com insucesso endodôntico, foram testadas quanto à suscetibilidade antimicrobiana por meio do método E-test em duplicata, utilizando os antibióticos: Amoxicilina (AC, Rifampicina (RI, Moxifloxacina (MX, Vancomicina (VA, Tetraciclina (TC, Ciprofloxacina (CI, Cloranfenicol (CL, Benzilpenicilina (PG, Amoxicilina + ácido clavulânico (XL, Doxiciclina (DC, Eritromicina (EM e Azitromicina (AZ.ResultadoTodas as cepas clínicas testadas foram suscetíveis aos antibióticos AC, XL, PG, DC, MX, TC e VA. Todos os isolados das espécies de S. aureus foram suscetíveis aos 12 antibióticos testados. As cepas de E. faecalis, E. faecium e A. viscosus mostraram padrão de suscetibilidade intermediário contra EM. Algumas cepas de E. faecalis e E. faecium foram resistentes a AZ e RI.ConclusãoAs cepas clínicas isoladas dos canais radiculares de dentes com insucesso endodôntico mostraram perfis diferentes de suscetibilidade antimicrobiana e nenhum isolado de E. faecalis e E. faeciumapresentou-se suscetível a AZ e EM.

  14. Review of AO calibrations, or how to best educate your AO system

    Science.gov (United States)

    Kolb, Johann

    2016-07-01

    If the Real-Time Computer is the heart of an AO system, the Wavefront Sensor (WFS) its eyes, the Deformable Mirror (DM) its hands and the control strategy its nervous system, the sum of all those parts is made into a harmonious entity thanks to calibrations. This paper does not have the ambition to provide an overview of all the currently existing calibration strategies, but rather to focus on a few challenging problems and their recent evolution in the era of adaptive telescopes, mostly based on the experience of ESO's Adaptive Optics Instruments in general and the AO Facility in particular. Single most important calibration in post-focal AO system, the recording of the Interaction Matrix (IM) between WFS and DM has since long evolved to use fast modulation techniques, has shown to be feasible on-sky and is now almost free from measurements thanks to its pseudo-synthetic generation, quasi-mandatory solution in an adaptive telescope. Pseudo- because it requires an unprecedented knowledge of the components' characteristics, especially the WFS, DM and the optical registration between the two. Bigger telescopes and the use of Laser Guide Stars (LGS) also mean that the properties of the system will change in time and thus need to be constantly updated thanks to online diagnosis tools for spot size measurement, atmosphere monitoring, Wavefront Sensing and control optimization. New loops come into play like the one to minimize LGS Jitter and the one taking over the telescope active optics by means of offloading the DM low orders, and they all require calibration. More calibration means more time and one has to carefully balance the calibrations that require precious telescope night time, day time or for the best, no telescope time at all. Their importance sometimes underestimated, calibrations have repeatedly shown to be a vital part in the optimum functioning of present and future AO systems.

  15. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  16. Directly Imaging Planets with SCExAO: First Results

    Science.gov (United States)

    Currie, Thayne M.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kudo, Tomoyuki; Uyama, Taichi; Garcia, Eugenio

    2017-01-01

    We present the first science results from the newly commissioned Subaru Coronagraphic Extreme Adaptive Optics project, an experimental system dedicated to image faint jovian planets around nearby stars. SCExAO is now achieving true extreme AO capability. We describe the typical performance of SCExAO, the first images of benchmark exoplanets and planet-forming disks, and SCExAO’s first science results. Finally, we briefly chart the path forward for SCExAO to achieve its full scientific capability, including imaging mature planets in reflected light.

  17. Photon counting arrays for AO wavefront sensors

    CERN Document Server

    Vallerga, J; McPhate, J; Mikulec, Bettina; Clark, Allan G; Siegmund, O; CERN. Geneva

    2005-01-01

    Future wavefront sensors for AO on large telescopes will require a large number of pixels and must operate at high frame rates. Unfortunately for CCDs, there is a readout noise penalty for operating faster, and this noise can add up rather quickly when considering the number of pixels required for the extended shape of a sodium laser guide star observed with a large telescope. Imaging photon counting detectors have zero readout noise and many pixels, but have suffered in the past with low QE at the longer wavelengths (>500 nm). Recent developments in GaAs photocathode technology, CMOS ASIC readouts and FPGA processing electronics have resulted in noiseless WFS detector designs that are competitive with silicon array detectors, though at ~40% the QE of CCDs. We review noiseless array detectors and compare their centroiding performance with CCDs using the best available characteristics of each. We show that for sub-aperture binning of 6x6 and greater that noiseless detectors have a smaller centroid error at flu...

  18. A VIA DEMOCRÁTICA AO AUTORITARISMO

    Directory of Open Access Journals (Sweden)

    Paulo César Nascimento

    2013-09-01

    Full Text Available Este artigo analisa as teorias de Aristóteles, Tocqueville e Hannah Arendt a respeito de como alguns aspectos da democracia como a busca do igualitarismo e o voto majoritário podem conduzir ao despotismo. Examinando os casos da democratização da Rússia pós-comunista e o sistema político da Venezuela durante a presidencia de Hugo Chavez, o texto procura demonstrar a importância das idéias daqueles pensadores para a compreensão de regimes autoritários legitimados pelo voto popular. --- The democratic route of autoritarism This article reviews the theories of Aristotle, Tocqueville and Hannah Arendt with respect to some elements of democracy such as the pursue of egalitarianism and the reliance on the will of the majority that can lead to despotism. On the basis of post-communist Russia’s transition to democracy and Venezuela’s political system under the presidency of Hugo Chavez, the article shows the importance of those thinker’s insights to understand current authoritarian regimes which rely on popular vote. keywords: democracy, autoritarian regimes, voting.

  19. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  20. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  1. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  2. Hemograma e proteínas de fase aguda de bezerros sadios do nascimento aos 30 dias de idade

    Directory of Open Access Journals (Sweden)

    Thaís G. Rocha

    2013-12-01

    Full Text Available O conhecimento da dinâmica das alterações nos parâmetros hematológicos e na cinética das proteínas de fase aguda em animais saudáveis nas primeiras semanas de vida é essencial para a interpretação correta dessas avaliações em situações de morbidez e para diferenciar animais sadios e enfermos de forma confiável. Com o intuito de avaliar a cinética desses parâmetros no primeiro mês de vida de bezerros de corte sadios, filhos de vacas primíparas ou pluríparas, amostras de sangue foram coletadas antes da ingestão de colostro e 1, 2, 7, 15 e 30 dias após o nascimento. Os parâmetros eritrocitários foram influenciados pelo número de partos das vacas e o leucograma mostrou alterações características de influência do cortisol fetal liberado por ocasião do nascimento. O teor sérico de proteína total aumentou significativamente após a ingestão do colostro. As concentrações de ceruloplasmina, haptoglobina e proteínas de pesos moleculares 33 kDa e 23 kDa aumentaram significativamente no primeiro dia de vida, seja pela resposta ao nascimento ou pela ingestão do colostro, enquanto os teores de transferrina, albumina e α1-glicoproteína ácida mantiveram-se relativamente estáveis nos primeiros dias de vida, aumentando gradualmente até os 30 dias de idade.

  3. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  4. WIYN active optics: a platform for AO

    Science.gov (United States)

    Code, Arthur D.; Claver, Charles F.; Goble, Larry W.; Jacoby, George H.; Sawyer, David G.

    1998-09-01

    The WIYN 3.5 meter telescope is situated on the southwest ridge of Kitt Peak yielding excellent atmosphere seeing conditions. As such, the telescope and enclosure design was directed towards exploiting this feature. The primary mirror was spun cast and figured by the Steward Observatory Mirror Laboratory and the secondary mirror by Contraves. In both cases the performance exceeded the design specifications. The borosilicate primary is actively temperature controlled to within 0.2 C of the desired temperature, typically 0.5 degrees C below the ambient air. The telescope structure is also temperature controlled and the enclosure is opened to the outside ion all sides, which all heat sources are vented to ducts carrying air downwind of the facility. The primary mirror is actively controlled for low order aberrations by 66 axial actuators which are adjusted open loop via force matrix look-up tables and closed loop via real-time wavefront curvature sensing measurements. The active optics also included real-time collimation and focus control. The telescope drive and guider are capable of providing tracking to a few hundredths of a second of arc. By employing active telescope control at this level, it is possible to maintain telescope and local wavefront distortion to a level where atmospheric effects dominate the image quality. Since a significant fraction of the power in the atmospheric disturbances is contained in image motion the first step in adaptive optics control will be simple tip tilt. Studies of higher order AO system are being carried out, as well as additional test characterizing the telescope and site. It is intended to continue such studies in an attempt to establish long term variances.

  5. Efeito "in vitro" de antibióticos e rizobactérias no controle de bactérias fitopatogênicas ao Eucalyptus spp. "In vitro" effect of antibiotics and rhizobacteria on the control of phytopathogenic bacteria in Eucalyptus spp.

    Directory of Open Access Journals (Sweden)

    Jeane de Fátima Cunha

    2006-12-01

    Full Text Available Doenças causadas por bactérias constituem um novo desafio à cultura do Eucalyptus spp., podendo, inclusive, limitar o uso de clones suscetíveis. O presente trabalho objetivou avaliar a eficiência de antibióticos e rizobactérias na inibição do crescimento "in vitro" de isolados de bactérias fitopatogênicas ao Eucalyptus spp. na fase de viveiro e de campo. O antibiótico sulfato de amicacina e a rizobactéria S1 (Bacillus subtillis destacaram-se quanto à inibição do crescimento do isolado fitopatogênico IP1-05 (Pseudomonas chichorii, enquanto a cefoxitina causou maior inibição dos isolados BSV16 e RVV11 (Rhizobium sp.. Os antibióticos de uso comercial na área agronômica, Mycoshield (oxitetraciclina e Agrimicina (estreptomicina e tetraciclina foram pouco efetivos. Este trabalho proporciona embasamento a alternativas para controle biológico de doenças bacterianas em mudas de Eucalyptus spp. na fase de viveiro.Diseases caused by bacteria represent a new challenge for Eucalyptus spp. and may also limit the use of susceptible clones. Our study aimed at an evaluation of the efficiency of antibiotics and rhizobacteria in inhibiting "in vitro" growth of phytopathogenic bacteria isolates in Eucalyptus spp. during the nursery stage and in the field. The antibiotic amicacine sulfate and rhizobacterium S1 (Bacillus subtilis stood out inhibiting the growth of the phytopathogenic isolate IP1-05 (Pseudomonas chichorii, whereas cefoxitin caused a greater inhibition of the isolates BSV16 and RVV11 (Rhizobium sp.. The commercial antibiotics for agricultural use Mycoshield (oxitetracycline and Agrimycin (estreptomycin and tetracycline were little effective. This study offers a base for alternatives of biological control of bacterial diseases in Eucalyptus spp. nursery seedlings.

  6. Homoparentalidade e desafios ao direito: O caso Silva Mouta na justiça portuguesa e no Tribunal Europeu de Direitos Humanos

    Directory of Open Access Journals (Sweden)

    Ana Cristina Santos

    2012-10-01

    Full Text Available O presente artigo examina a mobilização judicial em torno do reconhecimento do direito à homoparentalidade e a reconstrução dos direitos humanos à luz do caso Silva Mouta, iniciado nos tribunais portugueses em 1991 e encaminhado para o Tribunal Europeu de Direitos Humanos (TEDH em 1996. Este caso ilustra uma situação de discriminação por orientação sexual, verificando‑se a posição contraditória dos tribunais portugueses relativamente ao direito de um pai homossexual de exercer a parentalidade. O caso mostra, ainda, o modo como a mobilização judicial transnacional junto do TEDH, mesmo que individual, pode contribuir para a reconstrução dos direitos humanos e sexuais. O artigo reflecte tensões e disjunções entre diferentes escalas da justiça estatal e interestatal, por um lado, e entre o direito e a sociedade, por outro, num caso que trouxe para o campo judicial desafios sociais e jurídico‑políticos decorrentes de reivindicações de minorias sexuais num contexto predominantemente conservador.

  7. Tratamento medicamentoso de 1217 pacientes epilépticos. II: estudo em relação à idade de início, ao tempo de doença e à freqüência das crises

    Directory of Open Access Journals (Sweden)

    Luís Marques-Assis

    1970-03-01

    Full Text Available Foram estudados 1.217 pacientes epilépticos, adultos em sua maioria, sem alterações neurológicas focais e sem sinais de hipertensão intracraniana. Foram utilizados, para o tratamento, apenas os medicamentos mais difundidos em nosso meio. O estudo foi feito em relação à idade de início da doença, ao tempo de doença e à frequência das crises epilépticas. Quanto à evolução dos casos estudados relativamente à idade de início da doença, o autor concluiu que a evolução foi pior nos casos cuja moléstia teve início na primeira década; considerados apenas os casos desse grupo, aqueles cujas crises se instalaram no primeiro ano de vida não tiveram pior evolução; nos casos em que a doença se manifestou após os 10 anos, a idade de início não influiu sobre a evolução. O estudo da evolução relativamente ao tempo de doença permitiu ao autor concluir que quanto maior o tempo de doença, menores os índices de remissão. No que se refere às influências da severidade da epilepsia no seu prognóstico, o autor concluiu ser tanto menor a probabilidade de remissão do quadro quanto mais freqüentes as crises (30,5% de remissão nas formas mais severas contra 47,6% nas formas benignas. Finalmente, levando em conta a má evolução de alguns casos com formas iniciais da doença, atendidos e orientados precocemente, o autor admite a existência de fatores imponderáveis e imprevisíveis que exercem influência negativa no prognóstico das epilepsias.

  8. SCExAO: First Results and On-Sky Performance

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki

    2013-01-01

    We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.

  9. Acesso ao tratamento da diabetes na Bahia: por que se recorre ao judiciário?

    OpenAIRE

    Lisboa, Erick Soares

    2015-01-01

    A judicialização da saúde é um fenômeno importante, que tem motivado a realização de inúmeros estudos no país. A Constituição do país estabelece o direito de todos e o dever do Estado em prover acesso universal as ações e serviços de saúde. Ao longo dos 25 anos do SUS houve uma ampliação do acesso a medicamentos, e a cada ano, novos fármacos vem sendo lançados no Brasil pelas indústrias farmacêuticas. A judicialização do acesso a medicamentos tem causado impactos na estruturação, no financiam...

  10. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Law, Nicholas Michael; Baranec, Christoph; Morton, Timothy; Ziegler, Carl; Atkinson, Dani; Riddle, Reed

    2015-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets.We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys.Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss several KOIs of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are ``coincident multiple'' systems, with several transiting planets shared between the two stars. Finally, we will discuss and update the 98%-confidence evidence from our survey that third bodies in star/planet systems produce an excess of close-in giant planets.

  11. Passagem ao ato e acting-out: duas respostas subjetivas

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2010-08-01

    Full Text Available O presente artigo delimita o conceito de passagem ao ato em relação ao acting-out e distingue as respostas subjetivas que envolvem. A partir das distinções propostas por Lacan entre eles com base no conceito de objeto a, busca-se situar o sujeito em ambas as modalidades de ato, com os objetivos de submeter à discussão clínica as passagens ao ato discretas e de interrogar o papel de suplência que supostamente desempenham. Para tal, são retomados dois fragmentos de casos de anorexia discutidos na literatura psicanalítica; no primeiro, o objeto ao qual o sujeito se identifica é circunscrito, enquanto no segundo, trata-se do objeto posto em cena pelo sujeito.

  12. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF)

    OpenAIRE

    Audigé, L.; Slongo, T; Lutz, N.; Blumenthal, A.; Joeris, A

    2016-01-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more ...

  13. Virulence factors, antimicrobial resistance, and plasmid content of Escherichia coli isolated in swine commercial farms Fatores de virulência, resistência aos antimicrobianos, presença de plasmídeos em Escherichia coli isoladas de amostras clínicas e ambientais de suínos

    Directory of Open Access Journals (Sweden)

    M.M. Costa

    2010-02-01

    Full Text Available Virulence factors and antimicrobial resistance patterns of Escherichia coli isolates were evaluated. A total of 80 E. coli isolates were evaluated, being 64 from clinical samples (intestinal content and fragments of organs from diarrheic piglets, seven from feces of clinically healthy piglets and sows, and nine environmental samples (five from facilities, two from feed, one from insect, and one from waste. Molecular characterization was performed by PCR detection of fimbriae and toxin genes and plasmid content determination. The isolates were also characterized according to their resistance or sensitivity to the following drugs: ampicillin, trimethoprim:sulfamethoxazole, tetracycline, amikacine, colistin, norfloxacin, florfenicol, enrofloxacin, cefalexin, trimethoprim, neomycin, chloramphenicol, and gentamicin. From 80 E. coli isolates, 53.8% were classified as enterotoxigenic E. coli (ETEC, 2.5% were shiga toxin-producing E. coli (STEC, and 43.8% showed a non specific pattern and were unclassified. One fecal isolate from non-diarrheic piglet was classified as ETEC by PCR. Clinical isolates showed resistance mainly for tetracycline and trimethoprim:sulfamethoxazole. Plasmidial DNA was observed in 70 isolates, being 78.5% of clinical isolates, 8.57% of non-diarrheic feces, and 12.8% of environment.Os fatores de virulência e a resistência aos antimicrobianos foram avaliados em Escherichia coli. Um total de 80 isolados de E. coli, sendo 64 de amostras clínicas (conteúdo intestinal e fragmentos de órgãos de leitões diarreicos, sete das fezes de porcas e leitões saudáveis e nove de amostras ambientais (cinco de instalações, dois de alimentos, um de inseto e um de esterqueira. A caracterização molecular feita pela PCR objetivou detectar fimbrias e toxinas, bem como a determinação do conteúdo de plasmídeos. Os isolados foram caracterizados quanto à resistência ou sensibilidade às seguintes drogas: ampicilina, sulfazotrim

  14. Combate ao Panstrongylus megistus com o Malathion concentrado

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1975-12-01

    Full Text Available O Malathion concentrado (0-0 dimetilfosforo ditioato de dietil mercapto - succinato foi usado para combater o Panstrongylus megistus, principal vector da doença de Chagas, numa zona endêmica do Estado da Bahia. A eficácia do malathion no controle desse triatomíneo foi constatada após ter sido aplicado três vezes, no período de um ano e meio, em intervalos senjestrais. A ação letal do inseticida tanto se faz sobre as formas ambulantes, como sobre os ovos de P. megistus. Em vista da eficácia para o controle do triatomíneo, de não terem sido observados efeitos tóxicos colaterais para o homem e do custo operacional ser relativamente baixo, os Autores concluem que o malathion é uma arma valiosa para uso nas campanhas contra os transmissores da doença de Chagas.

  15. A UTILIDADE DA EDUCAÇÃO DE ADULTOS: A APRENDIZAGEM AO LONGO DA VIDA NA UNIÃO EUROPEIA E A POLÍTICA PÚBLICA DE EDUCAÇÃO E FORMAÇÃO DE ADULTOS EM PORTUGAL

    Directory of Open Access Journals (Sweden)

    Paula Guimarães

    2016-02-01

    Full Text Available Neste artigo, procura-se discutir sentidos dominantes nos últimos anos nas políticas públicas de educação de adultos em Portugal. Para tal, num primeiro momento, esclarece-se as finalidades contidas nas orientações da União Europeia para a aprendizagem ao longo da vida. Num segundo, abordam-se as reinterpretações efetuadas nas políticas públicas nacionais de educação de adultos nas últimas duas décadas. Conclui-se destacando a influência da União Europeia nos discursos políticos portugueses, bem como a progressiva importância atribuída ao carácter utilitário da educação de adultos relativamente ao desenvolvimento económico e à gestão de recursos humanos, enquanto se registam cada vez menos sentidos humanistas e de educação crítica. 

  16. Characterizing and mitigating vibrations for SCExAO

    Science.gov (United States)

    Lozi, Julien; Guyon, Olivier; Jovanovic, Nemanja; Singh, Garima; Goebel, Sean; Norris, Barnaby; Okita, Hirofumi

    2016-07-01

    The Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) instrument, under development for the Subaru Telescope, has currently the fastest on-sky wavefront control loop, with a pyramid wavefront sensor running at 3.5 kHz. But even at that speed, we are still limited by low-frequency vibrations. The current main limitation was found to be vibrations attributed mainly to the rotation of the telescope. Using the fast wavefront sensors, cameras and accelerometers, we managed to identify the origin of most of the vibrations degrading our performance. Low-frequency vibrations are coming from the telescope drive in azimuth and elevation, as well as the elevation encoders when the target is at transit. Other vibrations were found at higher frequency coming from the image rotator inside Subaru's adaptive optics facility AO188. Different approaches are being implemented to take care of these issues. The PID control of the image rotator has been tuned to reduce their high-frequency contribution. We are working with the telescope team to tune the motor drives and reduce the impact of the elevation encoder. A Linear Quadratic Gaussian controller (LQG, or Kalman filter) is also being implemented inside SCExAO to control these vibrations. These solutions will not only improve significantly SCExAOs performance, but will also help all the other instruments on the Subaru Telescope, especially the ones behind AO188. Ultimately, this study will also help the development of the TMT, as these two telescopes share very similar drives.

  17. A exposição ao risco das familias

    OpenAIRE

    dos Santos Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  18. Adesão ao tratamento da ambliopia

    OpenAIRE

    Arakaki Mara Regina; Schellini Silvana Artioli; Heimbeck Felipe Jorge; Furuya Margareth Tiemi; Padovani Carlos Roberto

    2004-01-01

    OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...

  19. Violência relacionada ao trabalho: uma proposta conceitual

    OpenAIRE

    Oliveira,Roberval Passos de; Nunes,Mônica de Oliveira

    2008-01-01

    p. 22-34 O aumento de situações de violência no âmbito do trabalho vem se constituindo um importante problema de Saúde Pública, que tem impacto na dignidade e na qualidade de vida dos trabalhadores. Nessa perspectiva, este artigo tem como objetivo propor, a partir da discussão do fenômeno da violência e de sua faceta concernente ao trabalho, o conceito de violência relacionada ao trabalho, como referência para futuros estudos no campo da Saúde do Trabalhador. Trata-se de um artigo conceitu...

  20. High-Performance CCSDS AOS Protocol Implementation in FPGA

    Science.gov (United States)

    Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson

    2010-01-01

    The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.

  1. Do teatro grego ao teatro romano de Lisboa

    OpenAIRE

    Maciel, Manuel Justino

    2006-01-01

    A tipologia do teatro nasceu na Grécia e foi apropriada por Roma, com alterações significativas que constituem instrumento importante da investigação em História da Arte. Assim acontece com o teatro romano de Lisboa que, foi construído “ao modo grego”. Parece evidente que o Teatro foi adaptado para “espectáculos aquáticos”, embora o aprofundamento da reflexão exija a continuação de trabalhos arqueológicos, sob a Rua de São Mamede ao Caldas.

  2. Abuso sexual: um trajeto da fantasia ao real

    OpenAIRE

    Malgarim, Bibiana Godoi

    2015-01-01

    O presente trabalho visou apresentar a Dissertação de Mestrado realizada junto ao Programa de Pós-Graduação de Psicologia da Universidade do Vale do Rio dos Sinos, cujo título é Abuso Sexual: Um trajeto da fantasia ao real. O objetivo desta pesquisa foi compreender e interpretar a dinâmica das representações das relações objetais de duas pré-adolescentes encaminhadas por suspeita de abuso sexual, através de métodos projetivos, como o Rorschach e o HTP.

  3. Combate ao Panstrongylus megistus com o Malathion concentrado

    Directory of Open Access Journals (Sweden)

    Ítalo A. Sherlock

    1975-12-01

    Full Text Available O Malathion concentrado (0-0 dimetilfosforo ditioato de dietil mercapto - succinato foi usado para combater o Panstrongylus megistus, principal vector da doença de Chagas, numa zona endêmica do Estado da Bahia. A eficácia do malathion no controle desse triatomíneo foi constatada após ter sido aplicado três vezes, no período de um ano e meio, em intervalos senjestrais. A ação letal do inseticida tanto se faz sobre as formas ambulantes, como sobre os ovos de P. megistus. Em vista da eficácia para o controle do triatomíneo, de não terem sido observados efeitos tóxicos colaterais para o homem e do custo operacional ser relativamente baixo, os Autores concluem que o malathion é uma arma valiosa para uso nas campanhas contra os transmissores da doença de Chagas.Concentrated Malathion was used against Panstrongylus megistus, the principal local vector of Chagas' Disease, in an endemic area in the State of Bahia, Brasil. The efficacy of malathion in the controle of this triatominae was demonstrated after three applications six months apart. The insecticide is lethal to all stages of vector including the eggs. In view of its effectiveness in the control of the triatomine, the absence of any noticeable signs of intoxication in the personnel applying the insecticide and in residents of the treated houses or domestic animals, and the relatively low operational cost, the Authors conclude that malathion is a valuable weapon in campaigns to control the veçtors of Chagas Disease.

  4. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  5. Reptiles and Amphibians of Curaçao

    NARCIS (Netherlands)

    Rooij, de Nelly

    1922-01-01

    The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles

  6. Variability in olecranon AO fracture fixation: A radiological study ...

    African Journals Online (AJOL)

    Background: Tension Band Wire(TBW) fixation of olecranon fracture is a commonly used technique by orthopaedic surgeons. However surgeons do not strictly adhere to the AO standard. Objectives: To determine the use and variability of this technique by surgeons at the hospital. Design: A hospital based retrospective ...

  7. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  8. The Foraminifera of Piscadera Bay, Curaçao

    NARCIS (Netherlands)

    Hofker, J.

    1971-01-01

    Piscadera Bay is situated 4 km West of Willemstad, Curaçao, between two limestone hills which have a height of about 100 m. It is a drowned river system, the entrance of which is almost completely blocked by a bar of coral debris reaching to about 2 meters above sea level. The following parts may be

  9. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for

  10. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar

    Directory of Open Access Journals (Sweden)

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.

  11. Telescópio de pequeno porte como suporte ao ensino em cidades com intensa poluição luminosa II

    Science.gov (United States)

    Pereira, P. C. R.; Santos-Júnior, J. M.; Cruz, W. S.

    2003-08-01

    Para a maioria dos estudantes, sua passagem pelo ensino formal fundamental envolve a transmissão de fatos que devem ser guardados para um exame, a habilidade para lembrar fórmulas e, eventualmente, a repetição de experimentos que devem produzir resultados exigidos pelo professor. O resultado deste modelo de ensino, ao longo dos anos, é conhecido por todos: desconhecimento e descontentamento, por parte dos estudantes, de temas relativos ao papel e aos processos da ciência. Acreditamos que a Astronomia, pelo seu caráter observacional, é uma das áreas do conhecimento que pode contribuir neste cenário. A Fundação Planetário da Cidade do Rio de Janeiro possui um telescópio Meade LX-200 (25cm) que, juntamente com as câmeras CCD ST-7E e ST8E, tem sido utilizado em projetos voltados aos estudantes do ensino médio desde o ano 2000. Tais projetos envolvem a condução de um projeto de pesquisa observacional num nível apropriado, e possibilitam o contato com técnicas e novas tecnologias: computador, software para manipulação de dados e gráficos, programas de tratamento e redução de dados, uso de equipamentos óptico-eletrônicos (telescópio e CCD), bem como o processo de aquisição de conhecimento. Dentro da proposta dos anos anteriores, priorizamos projetos de uma noite, ou seja, procuramos trabalhar com fenômenos que apresentem variabilidade com intervalo de recorrência relativamente curto. Em todos os casos, optamos pela fotometria diferencial, que tem se mostrado bastante eficiente para o céu luminoso como o da cidade do Rio de Janeiro. Neste painel, apresentamos alguns dos projetos desenvolvidos no último ano, com 25 estudantes. Apresentamos os resultados da observação da variável pulsante AI Vel (V = 6,6) e da variável cataclísmica FO Aqr (V = 13,5), e do monitoramento do trânsito da lua de Júpiter, Europa, ocorrido em 30 de abril de 2003. As curvas de luz produzidas para as primeiras estão concordantes com as da literatura, assim

  12. Relationship between anthropogenic impacts and bleaching-associated tissue mortality of corals in Curaçao (Netherlands Antilles

    Directory of Open Access Journals (Sweden)

    I Nagelkerken

    2006-12-01

    Full Text Available Chronic anthropogenic impacts can have a negative effect on coral health and on coral energy budgets needed for regeneration of lesions. I therefore hypothesise that during massive bleaching events, the degree of corals showing bleaching-related tissue mortality is higher in areas subject to chronic anthropogenic impacts than in relatively pristine areas. In the present study, the degree of bleaching and bleaching-related tissue mortality was estimated for eight abundant coral species in Curaçao, at the onset of a massive Caribbean bleaching event in 1995, and three months afterwards. To study the possible effects of anthropogenic disturbances, the study was done at four unpolluted control sites, two polluted sites (sedimentation, sewage, and four sites at the mouth of lagoons with outflow of nutrient-rich, warm and turbid seawater. No pattern of an overall difference in bleaching between impacted and control sites was found for the degree of bleaching. However, the percentage of corals showing bleaching-related tissue mortality was higher at the impacted sites than at the control sites for the total number of corals and for corals with Los impactos antropogénicos crónicos pueden tener efectos negativos en la salud y en las cantidades de energía necesarias para la regeneración de lesiones en los corales. Mi hipótesis fue que durante los casos de blanqueamiento masivo, el grado en que los corales muestren mortalidades de tejido relacionadas con el blanqueamiento, será mayor en áreas sujetas a impactos antropogénicos crónicos que en áreas relativamente prístinas. Estimé los grados de blanqueamiento y mortalidad tisular en ocho especies de coral abundantes en Curaçao, durante el comienzo de un de blanqueamiento masivo en el Caribe en 1995 y tres meses después. El estudio se realizó en cuatro sitios control no contaminados, dos sitios contaminados (sedimentación, aguas residuales, y cuatro sitios en la boca de lagunas con aguas

  13. Prevenção ao crime e teoria social

    OpenAIRE

    Sento-Sé, João Trajano

    2011-01-01

    O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime ...

  14. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  15. Da esclerodermia ao síndrome de poems

    Directory of Open Access Journals (Sweden)

    Ana Sofia Montez

    2015-12-01

    Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite

  16. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  17. Retração rápida de caninos associada ao levantamento do seio maxilar Rapid canine retraction associated with maxillary sinus lifting

    Directory of Open Access Journals (Sweden)

    Paulo Renato Carvalho Ribeiro

    2007-10-01

    Full Text Available INTRODUÇÃO: a retração rápida de caninos por distração do ligamento periodontal é uma técnica de movimentação dentária que permite o fechamento de espaço da extração de primeiros pré-molares em um intervalo de 2 ou 3 semanas, proporcionando uma redução significativa no tempo do tratamento ortodôntico. A técnica cirúrgica para realização deste procedimento é relativamente simples, entretanto, nos casos onde o seio maxilar apresenta-se próximo ao ápice radicular de caninos e pré-molares, sempre há o risco de perfuração da membrana desta cavidade. OBJETIVO: o objetivo deste artigo é apresentar, através de um caso clínico, uma modificação na técnica original proposta por Liou e Huang, onde o levantamento do seio maxilar, executado de forma bastante simples, imprimiu maior controle e segurança ao ato cirúrgico necessário para a realização da retração rápida de caninos. CONCLUSÃO: a retração rápida de caninos é um procedimento exeqüível e o levantamento de seio maxilar pode auxiliar na execução do movimento dentário.INTRODUCTION: Rapid canine distalization using distraction of the periodontal ligament is a tooth movement technique that allows to close the space of extraction of first premolars in about 2 or 3 weeks, reducing orthodontic treatment time considerably. The surgical technique for this procedure is reasonably simple, however, during surgery in the maxilla, always exists the risk of sinus injury when the sinus membrane is close to the apex of canines and first premolars. AIM: The aim of this study is to present a case report showing a modification of the original technique proposed by Liou and Huang, where the maxillary sinus membrane lifting procedure was undertaken in a simple way, leaving it intact, and permitting a safer and more controlled protocol to start the rapid canine retraction. CONCLUSION: Rapid canine retraction is a viable procedure and maxillary sinus lifting may be

  18. Atitudes dos profissionais de enfermagem relacionadas ao Processo de Enfermagem

    Directory of Open Access Journals (Sweden)

    Erika de Souza Guedes

    2012-10-01

    Full Text Available Os objetivos do estudo foram descrever a disposição sobre o Processo de Enfermagem (PE e a percepção de poder clínico dos profissionais de enfermagem; analisar associações entre atitudes relacionadas ao PE e variáveis selecionadas. Participaram 1.605 auxiliares de enfermagem e enfermeiros (86,9% mulheres, idade média 44,12 anos; DP=9,55. O escore médio no instrumento Posições sobre o Processo de Enfermagem (PPE foi 112,37 (DP=22,28 e no Power as Knowing Participation in Change Tool - versão brasileira (PKPCT foi 281,12 (DP= 38,72. Os escores nos instrumentos foram mais altos para enfermeiros quando comparados aos auxiliares. Houve correlação positiva moderada entre escores do PPE e PKPCT. Para os auxiliares houve associação entre os escores no PPE, sexo e pós-graduação; e entre percepção de poder e sexo. Para os enfermeiros houve associação entre PKPCT e cargo de chefia. Mais estudos devem ser desenvolvidos com vistas a identificar variáveis potencialmente associadas ao uso do Processo de Enfermagem na prática clínica.

  19. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  20. Experiências de discriminação relacionadas aos serviços de saúde: análise exploratória em duas capitais do Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Alexandre Baumgarten

    Full Text Available OBJETIVO: descrever a prevalência de discriminação relacionada aos serviços de saúde, suas motivações e fatores associados. MÉTODOS: análise seccional realizada com bancos de dados oriundos de dois inquéritos realizados no município de Porto Alegre, Rio Grande do Sul, com usuários de serviços de saúde, e no município de Florianópolis, Santa Catarina, com amostra representativa de universitários, entre 2010 e 2012. RESULTADOS: a prevalência de discriminação relacionada aos serviços de saúde foi de 13,6% (IC95%: 10,5-17,2 em Porto Alegre-RS e de 7,4% (IC95%: 5,8-9,1 em Florianópolis-SC; o principal motivo para a discriminação foi ser de baixa posição socioeconômica; em ambas as capitais, observou-se maior prevalência de discriminação entre fumantes, autoclassificados pretos/negros e indivíduos de 31 a 40 anos de idade. CONCLUSÃO: a prevalência de discriminação foi relativamente baixa; reforça-se a necessidade de se investigar a discriminação no âmbito dos serviços de saúde, para a provisão de cuidados adequados à população.

  1. Diversidade genética, tolerância aos fatores de acidez e eficiência simbiótica de rizóbios para cornichão de solos do Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Adriana Ferreira Martins

    2011-12-01

    Full Text Available O cornichão é uma leguminosa forrageira perene hiberno-primaveril de grande importância para o Rio Grande do Sul, destacando-se pela capacidade de se manter em solos relativamente ácidos e pouco férteis. Com este trabalho, objetivou-se a seleção de rizóbios para cornichão tolerantes à acidez e ao Al tóxico e eficientes na fixação biológica de N em solos de baixa fertilidade. Foram avaliados 52 isolados de rizóbios de Lotus spp. obtidos de solos de cinco localidades do Rio Grande do Sul. Os rizóbios foram avaliados quanto à diversidade genética, à tolerância a pH 4,2 e ao Al tóxico. Entre os rizóbios tolerantes a fatores de acidez, sete foram avaliados quanto à eficiência simbiótica com plantas, em casa de vegetação, em vasos com solo não estéril. Observou-se alta diversidade genética entre os rizóbios estudados, dos quais 16 foram tolerantes a pH 4,2 e a 50 µM de Al em meio de cultura, produzindo populações da ordem de 10(7 até 10(8 UFC mL-1. Os sete rizóbios testados em casa de vegetação superaram as estirpes atualmente recomendadas para a produção de inoculantes, o que demonstra a existência, em solos do Rio Grande do Sul, de rizóbios tolerantes à acidez do solo e eficientes como fixadores de N em plantas de cornichão.

  2. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  3. Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

    Science.gov (United States)

    Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

    2017-01-01

    The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

  4. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  5. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  6. Data of evolutionary structure change: 1AO5B-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-2AGEX 1AO5 2AGE B X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  7. Data of evolutionary structure change: 1AO5A-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5A-2AGEX 1AO5 2AGE A X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  8. Probing circumplanetary disks with MagAO and ALMA

    Science.gov (United States)

    Wu, Ya-Lin

    2018-01-01

    The dedication of the Magellan Adaptive Optics (MagAO) on the 6.5 m Clay Telescope has opened a new era in high-contrast imaging. Its unique diffraction-limited wavelengths of 0.6 to 1 micron helps to probe circumplanetary disks by measuring the amount of dust reddening as well as by searching for the strongest gas accretion indicator H-alpha (0.65 micron). Using MagAO, I found that two wide-orbit planetary-mass companions CT Cha B and 1RXS 1609 B have a significant dust extinction of Av ~ 3 to 5 mag likely from their disks. For GQ Lup B, I found that it is actively accreting material from its disk and emitting strong H-alpha emission. My research with MagAO demonstrates that circumplanetary disks could be ubiquitous among young giant planets. I later carried out a survey using ALMA to image accretion disks around several wide planet-mass companions at 1.3 mm continuum and CO (2-1). This is the first systematic study aiming to measure the size, mass, and structure of planetary disks. However, except for FW Tau C (which was shown to actually be a low-mass star from the dynamical mass measurement) no disks around the companions were found in my ALMA survey. This surprising null result implies that circumplanetary disks are much more compact and denser than expected, so they are faint and optically thick in the radio wavelengths. Therefore, mid- to far-infrared may be more favorable to characterize disk properties. The MIRI camera on the JWST can test this compact optically-thick disk hypothesis by probing disk thermal emission between 10 and 25 micron.

  9. Identification of system misregistrations during AO-corrected observations

    Science.gov (United States)

    Béchet, C.; Thiébaut, É.; .; Tallon, M.; Kolb, J.; Madec, P.-Y.

    2011-09-01

    The E-ELT will be equipped with a deformable mirror inside the telescope. The performance of reconstruction and control depends on the calibration of the interaction matrix- or a model of the interaction matrix- , which characterizes the system and the relationship between the commands sent to the deformable mirrors (DM) and the wavefront sensors (WFS) slopes. Such a calibration will be more complex than for the current systems at the VLT since it will have to be at least partly measured on sky and for a much larger number of degrees of freedom (more than 5000). In addition, gravity or temperature variations for instance are likely to introduce slow evolution of the matching between the M4 Deformable mirror and the WFS geometry. This can occur during observations and therefore degrade the adaptive optics (AO) correction. To relax the need of frequent painful calibrations and to prevent a loss of performance due to misregistrations, we investigate how to track the evolution of the interaction matrix errors in closed-loop without introducing any degradation in the observations. This is done thanks to identification methods and optimization theory. First, we formally describe the problem and the difficulties of such an identification in closed-loop configuration. Then, we present 2 solutions, based on the optimization of the error of estimates of the WFS slopes, at the output of the closed-loop AO. The performance of the methods and their limitations are discussed formally and thanks to numerical simulations of a high order AO system. We finally explore to which extent these methods currently studied for the Adaptive Optics Facility (AOF) at the VLT can be applied to the E-ELT.

  10. Anemia e peso ao nascer Anemia and birthweight

    Directory of Open Access Journals (Sweden)

    Taqueco T Uchimura

    2003-08-01

    Full Text Available OBJETIVO: Verificar a influência do baixo peso ao nascer (BPN na anemia e desnutrição da criança, ao longo do primeiro ano de vida. MÉTODOS: A população amostral foi constituída por todas as crianças menores de um ano de idade atendidas nas unidades de saúde do Município de Maringá, PR, em 1998, num total de 587. Considerou-se baixo peso ao nascer, todas as crianças com peso OBJECTIVE: To verify the influence of Low Birthweight (LBW on child anemia and malnutrition during the first year of life. METHODS: Sample population included all children under one year seen at Health Units of the municipality of Maringá, southern Brazil, in 1998. Total sample size was 587 children. LBW was defined as birthweight below 2 500 g. The analysis of growth for the weigh-for-age and height-for-age indicators was based on NationalCenter for HealthSstatiscs standards. For anemia diagnosis, a biochemical hemoglobin concentration dosage, using HemoCue direct colorimetric method was employed. Children with [Hb] <11,0 g/dL were considered as anemic. RESULTS: Fifty-eight percent of the studied population were anemic, and 37 children (6.3% presented LBW. Anemia was more prevalent during the second semester of life (p=0.0093. Undernutrition, as indicated by the height-for-age indicator, was high especially for children aged 0-3 months with LBW. CONCLUSIONS: Although LBW rates among the studied population were similar to those of developed countries, we suggest the implementation of specific antenatal care for high-risk women, aiming at reducing LBW, an event that affects the child, hampering its growth and increasing the risk of anemia and its countless deleterious consequences.

  11. Child abuse: a common problem in Curaçao?

    Science.gov (United States)

    Klein, K; Boersma, A A; Meyboom-de Jong, B; de Bruijn, J

    2013-02-01

    To assess the prevalence of child abuse among high school students in Curacao. A questionnaire survey among high school students up to 17 years of age was conducted. The questionnaire was based on existing literature and validated questionnaires. The questionnaire used was analysed and adapted to the situation in Curaçao by a panel of experts on child abuse. The primary objective was to gain insight into the incidence, prevalence and various forms of child abuse among students in Curaçao. Five forms of child abuse are distinguished in the literature: physical abuse, emotional abuse, sexual abuse, neglect and exploitation. Furthermore, the degree of confidence of the students in general practitioners (GPs) as care providers in the field of child abuse was explored. Questionnaires from 545 of the 628 respondents were included. In total, 43% of the respondents had ever-experienced an event which could be defined as (a form of) child abuse. More than one-third of the respondents reporting child abuse ever had an experience that could be interpreted as physical abuse. More than 15% of the respondents reporting child abuse had experienced sexual abuse. Girls experienced significantly more sexual abuse than boys. Emotional abuse in the last year was experienced by 3% of the respondents. One per cent of the respondents ever-experienced neglect. According to most respondents, GPs were not seen as care providers in cases of child abuse; they believed that GPs were mainly to be consulted for illnesses or physical symptoms and not for forms of child abuse. The prevalence of ever-having-experienced a form of child abuse is estimated at 431 per 1000 students. Child abuse, particularly physical abuse, is common in Curaçao, and is probably comparable to other surrounding countries. General practitioners were not seen as care providers in identifying and reporting cases of child abuse according to most respondents.

  12. Assistência de enfermagem humanizada ao paciente em UTI

    OpenAIRE

    Vieira, Claudir Aparecido; Maia, Luiz Faustino dos Santos

    2013-01-01

    Hoje em dia a humanização é ponto de pauta nos encontros nacionais e internacionais da área da saúde. Assim, cada vez mais enfermeiros nas unidades de terapia intensiva tem se preocupado com a sua prática. O presente estudo foi desenvolvido com o objetivo de compreender, reconhecer e entender como o comportamento humanizado reflete ao paciente e identificar a percepção da equipe de enfermagem sobre o processo de humanização. Trata-se de uma pesquisa de revisão bibliográfica descritiva com aná...

  13. Resistencia ao brometo de etidio em aspergillus nidulans

    OpenAIRE

    Maria Elizabeth Scarazzatti Frau

    1985-01-01

    Resumo: O presente trabalho teve por objetivo isolar e ana-lisar geneticamente mutantes de Aspergillus nidulans resistentes ao Brometo de Etídio (BE), bem como estudar os efeitos da riboflavina em relação a toxicidade do BE. Foram isolados mutantes espontâneos e induzidos. Dos mutantes isolados espontaneamente apenas 3 continuaram a apresentar resistência, sendo 1 da linhagem A e 2 da linhagem biAl methGl. Os outros mutantes (16) foram obtidos por indução com luz ultravioleta. Destes apenas 9...

  14. Stream-Field Interactions in the Magnetic Accretor AO Piscium

    Science.gov (United States)

    Hellier, Coel; van Zyl, Liza

    2005-06-01

    UV spectra of the magnetic accretor AO Psc show absorption features for half the binary orbit. The absorption is unlike the wind-formed features often seen in similar stars. Instead, we attribute it to a fraction of the stream that overflows the impact with the accretion disk. Rapid velocity variations can be explained by changes in the trajectory of the stream depending on the orientation of the white dwarf's magnetic field. Hence, we are directly observing the interaction of an accretion stream with a rotating field. We compare this behavior to that seen in other intermediate polars and in SW Sex stars.

  15. Atenção ao Suicídio

    Directory of Open Access Journals (Sweden)

    Berenice Rheinreimer

    2015-11-01

    Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.

  16. Aspect-Oriented Business Process Modeling with AO4BPMN

    Science.gov (United States)

    Charfi, Anis; Müller, Heiko; Mezini, Mira

    Many crosscutting concerns in business processes need to be addressed already at the business process modeling level such as compliance, auditing, billing, and separation of duties. However, existing business process modeling languages including OMG's Business Process Modeling Notation (BPMN) lack appropriate means for expressing such concerns in a modular way. In this paper, we motivate the need for aspect-oriented concepts in business process modeling languages and propose an aspect-oriented extension to BPMN called AO4BPMN. We also present a graphical editor supporting that extension.

  17. O papel do leite ao longo do ciclo de vida

    OpenAIRE

    Lima, Joana Catarina Dinis

    2012-01-01

    Resumo da tese: A presença do leite nos guias alimentares denota a sua importância na alimentação humana. Contudo, não é consensual que este alimento deva fazer parte da nossa alimentação ao longo de todo o ciclo de vida. Sabe-se que cada espécie produz um tipo de leite diferente, com diversas moléculas bioativas e nutrientes que modulam o seu crescimento e desenvolvimento corporal. Recentemente, uma parte da fração proteica do leite tem sido apontada como tendo um possível efeito estimulante...

  18. Apple fruit copper amine oxidase isoforms: peroxisomal MdAO1 prefers diamines as substrates, whereas extracellular MdAO2 exclusively utilizes monoamines.

    Science.gov (United States)

    Zarei, Adel; Trobacher, Christopher P; Cooke, Alison R; Meyers, Ashley J; Hall, J Christopher; Shelp, Barry J

    2015-01-01

    4-Aminobutyrate (GABA) accumulates in apple fruit during controlled atmosphere storage. A potential source of GABA is the polyamine putrescine, which can be oxidized via copper-containing amine oxidase (CuAO), resulting in the production 4-aminobutanal/Δ(1)-pyrroline, with the consumption of O2 and release of H2O2 and ammonia. Five putative CuAO genes (MdAO genes) were cloned from apple (Malus domestica Borkh. cv. Empire) fruit, and the deduced amino acid sequences found to contain the active sites typically conserved in CuAOs. Genes encoding two of these enzymes, MdAO1 and MdAO2, were highly expressed in apple fruit and selected for further analysis. Amino acid sequence analysis predicted the presence of a C-terminal peroxisomal targeting signal 1 tripeptide in MdAO1 and an N-terminal signal peptide and N-glycosylation site in MdAO2. Transient expression of green fluorescent fusion proteins in Arabidopsis protoplasts or onion epidermal cells revealed a peroxisomal localization for MdAO1 and an extracellular localization for MdAO2. The enzymatic activities of purified recombinant MdAO1 and MdAO2 were measured continuously as H2O2 production using a coupled reaction. MdAO1 did not use monoamines or polyamines and displayed high catalytic efficiency for 1,3-diaminopropane, putrescine and cadaverine, whereas MdAO2 exclusively utilized aliphatic and aromatic monoamines, including 2-phenylethylamine and tyramine. Together, these results indicate that MdAO1 may contribute to GABA production via putrescine oxidation in the peroxisome of apple fruit under controlled atmosphere conditions. MdAO2 seems to be involved in deamination of 2-phenylethylamine, which is a step in the biosynthesis of 2-phenylethanol, a contributor to fruit flavor and flower fragrance. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  19. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  20. Titanium alloys (AoN) and their involvement in osseointegration.

    Science.gov (United States)

    Danza, Matteo; Zollino, Ilaria; Candotto, Valentina; Cura, Francesca; Carinci, Francesco

    2012-12-01

    Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. The expression levels of some bone-related (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analyzed using real time reverse transcription-polymerase chain reaction (real time RT-PCR). Real-time RT-PCR data showed that after 3 days of treatment with TiA4GR, the genes up-regulated were COL3A1, ALPL, SPP1, and RUNX2. Moreover, no difference in gene expression was noticed 4 days later. On the other hand, the genes that overexpressed after 3 days of treatment with AoN5GR were ALPL, SPP1, and RUNX2. In both cases, the expression of COL1A1 and SPARC was negatively regulated. Our data showed that both titanium surfaces led to osteoblasts recruitment, maturation, and differentiation, thus promoting osseointegration at the tissue-implant interface.

  1. Atribuições de significados ao transplante renal

    Directory of Open Access Journals (Sweden)

    Quintana, Alberto M.

    2011-01-01

    Full Text Available Este trabalho teve foco na investigação das atribuições de significados ao transplante renal de pacientes com Insuficiência Renal Crônica (IRC de um Hospital Universitário da Região Sul. Foi utilizado um método qualitativo e participaram doze pessoas na pesquisa. Os instrumentos utilizados foram a entrevista semidirigida e a autofotografia. Para a análise dos dados foi empregada a técnica de análise de conteúdo, o que permitiu que fossem construídas quatro categorias temáticas: a ansiedade da espera, os conflitos ante o doador, as expectativas em relação ao devir e a vida antes e depois do transplante. Constatou-se que a possibilidade deste traz consigo uma série de repercussões psíquicas devido o fato de ser visto como algo que restitui a vida, proporciona bem-estar e sentimento de liberdade, mesmo levando em consideração que ainda persistem os cuidados com o corpo, com a alimentação e com os remédios

  2. New Results from the AO327 Drift Pulsar Survey

    Science.gov (United States)

    Deneva, Julia S.; Stovall, K.; McLaughlin, M.; Bates, S.; Freire, P.; Martinez, J.; Jenet, F.; Bagchi, M.

    2014-01-01

    The Arecibo 327 MHz drift pulsar survey (AO327) has operated since 2010 and aims to cover the entire Arecibo sky (declinations of -1 to 38 degrees). We present details on the progress of the survey and a new set of discoveries over the past year. Phase 1 of AO327 targets declinations of -1 to 28 degrees and is 55% complete; Phase 2 will target declinations of 28 to 38 degrees. The survey is expected to be completed in 2017. Out of a total of 28 new pulsars, 12 were found in 2013, including three millisecond pulsars. PSR J2234+06 has a rotation period of 3.58 ms and is in a 32-day orbit in a binary system with a white dwarf companion. This pulsar is bright and a very stable rotator, making it suitable for inclusion in Pulsar Timing Arrays. The orbit of J2234+06 has an eccentricity of 0.13, which cannot be accounted for by stellar evolution but may be explained by an origin in a subsequently disrupted hierarchical triple, or by an exchange interaction. PSR J0509+08 has a period of 4.06 ms and is in a 4.9-day binary system with a white dwarf companion. This pulsar is also a candidate for inclusion in PTAs.

  3. UMA PROPOSTA DE ABORDAGEM AO PROBLEMA DE FLÁVIO JOSEFO APLICADA AO ENSINO MÉDIO

    OpenAIRE

    Márcia Erondina Dias de Souza

    2013-01-01

    Neste trabalho, apresentamos uma sequência didática de atividades elaboradas para um grupo de alunos do ensino médio, na faixa etária de 15 a 18 anos, tendo como principal objetivo estudar o problema proposto pelo matemático Flávio Josefo, nos meados do ano 64. Conta a lenda que um grupo de rebeldes, dentre eles Flávio Josefo, foi encurralado numa caverna pelo exército inimigo. Preferindo o suicídio à captura, os rebeldes decidiram formar um círculo e, contando ao longo dest...

  4. OBSOLESCÊNCIA PROGRAMADA E TEORIA DO DECRESCIMENTO VERSUS DIREITO AO DESENVOLVIMENTO E AO CONSUMO (SUSTENTÁVEIS)

    OpenAIRE

    Oliveira da Silva, Maria Beatriz Beatriz; UNiversidade Federal de Santa Maria (UFSM)

    2012-01-01

    Inspirado em um documentário intitulado “Prêt à Jeter”, este texto tem como objetivo central colocar em apreciação algumas reflexões acerca da obsolescência programada como uma das estratégias do modelo de desenvolvimento capitalista e ensaiar uma reposta às seguintes questões: para combater a obsolescência programada se faz necessária a defesa de uma “teoria do decrescimento”? Sendo a obsolescência programada uma das estratégias da sociedade de consumo, é possível combatê-la e, ao mesmo temp...

  5. Performance of the Sewage Treatment Plant of S˜ao Jo˜ao de Iracema (Brazil

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    2016-05-01

    Full Text Available Context: Some of the most important parameters measured in the sewage treatment plant –STP- are: organic matter, solids and faecal organisms. The objective of this work was to diagnose the performance of S˜ao Jo˜ao de Iracema STP for those parameters removal. Method: A batimetric survey of the anaerobic and facultative lagoons; the STP influent and effluent monitoring in three different climate seasons of 3-month long each were conducted by dissolved oxygen, pH, temperature, BOD, filtered BOD, COD, solids and coliforms measuring. Results: Sludge accumulations of 1.3 and 6.5% in the anaerobic and facultative lagoons were registered; average BOD removal was of 73.6%, smaller than the 80% recommended by Brazilian legislation; the average faecal coliform number on final effluent was of 9.55*106/100mL, above the per-missible limit of 1000/100mL. Conclusions: The STP needs to set-up a post treatment system that guarantees additional organic matter removal and fecal coliforms in order to adjust the effluent quality to the environmental legislation standards.

  6. Forma musical como um processo: do isomorfismo ao heteromorfismo

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2016-05-01

    Full Text Available Este artigo se propõe a analisar a questão da forma musical a partir do momento em que temos, no início do século XX, uma ruptura com sua predeterminação, passando a se configurar como o resultado de diferentes operações ou processos de composição. Neste contexto, abordamos a noção de forma estatística, ligada ao isomorfismo e à continuidade entre as diferentes escalas temporais presentes numa obra musical (MEYER-EPPLER, 2009 [1954]; STOCKHAUSEN 1959; EIMERT, 1959 e ao princípio do grau de mudança (STOCKHAUSEN, 1989b [1958]; KOENIG, 1963, 1965, bem como a noção da forma como uma emergência, ligada ao heteromorfismo e à descontinuidade entre as diversas escalas temporais (VAGGIONE, 1994, 2010. Para tanto, trazemos como fundamentação teórica o método alagmático e o princípio da individuação das formas de Gilbert Simondon (2005, assim como as características morfológicas perceptivas de saliência (saillance e pregnância (prégnance de René Thom (1988, 1990a, além de sua teoria das catástrofes (THOM, 1985. No contexto proposto, a fusão de timbres é pensada como um processo alagmático gerador de novas formas, sendo analisada a partir de diferentes possibilidades tais como por jitter (DUBNOV; TISHBY; COHEN, 1997, síntese granular, permeabilidade (LIGETI, 2010a [1958], micropolifonia (LIGETI, 2010c [1980] e convolução (ERBE, 1997; JAFFE, 1987; ROADS, 1993; VAGGIONE, 1996. Concluímos a respeito dos processos de fusão analisados não apenas considerando-os isoladamente, mas como operações que propiciam o nascimento da forma musical, afirmando o pensamento da forma como um processo e não como algo definido a priori.

  7. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  8. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  9. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Cenir Gonçalves Tier; Valéria Lerch Lunardi; Silvana Sidney Costa Santos

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar ...

  10. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Tier, Cenir Gonçalves; Lunardi, Valéria Lerch; Santos, Silvana Sidney Costa

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edg...

  11. Empreendedorismo: do ensino básico ao ensino superior

    OpenAIRE

    Gonçalves, Vitor

    2009-01-01

    A Sociedade da Informação exige cada vez mais indivíduos com capacidade e espírito empreendedor. Embora seja visto como uma resposta ao problema do desemprego através da promoção do auto-emprego, o empreendedorismo deve assumir uma semântica mais abrangente. Não basta correr o risco e criar empresas, é necessário procurar fazê-lo com responsabilidade, competência e excelência. Mas, essa atitude empreendedora não é apenas apanágio dos gestores ou empresários, terá de ser também uma necessi...

  12. MODERNIDADE E LIBERTAÇÃO: DOIS DESAFIOS AO CRISTIANISMO

    Directory of Open Access Journals (Sweden)

    . Editorial

    1987-01-01

    Full Text Available A recente Assembléia Geral da Sociedade de Teologia e Ciências da Religião (SOTER, reunida em Belo Horizonte de 6 a 9 de julho passado, dedicou boa parte de seus trabalhos ao "debate em torno da Modernidade em relação com as preocupações da Teologia da Libertação no Brasil". Está mais uma vez relançada a sempre conflitiva questão da relação entre Cristianismo e Modernidade, só que agora percebida num Continente que não simplesmente goza de algumas luzes da Modernidade, como também sofre efeitos perversos deste processo histórico.

  13. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  14. Sophia, Mésseder e um Timor contado aos jovens

    OpenAIRE

    Albuquerque, Pedro; Azevedo, Fernando; Vergopolan, Roseli

    2015-01-01

    Devido a sucessivos e quase ininterruptos períodos bélicos e de ocupação, a fragilidades socioeconómicas e à ausência de um ensino sistematizado numa língua oficial, a produção literária timorense escrita revela-se bastante modesta. Apesar de a literatura timorense ter assistido ao despertar do género romanesco - sendo Luís Cardoso o mais proeminente escritor de Timor -, a invenção literária dedicada a um público mais jovem é praticamente inexistente. Ainda assim, os jovens timorenses, que tê...

  15. HST and Keck AO Images of Vortices on Jupiter

    Science.gov (United States)

    de Pater, Imke; Wong, M.; Luszcz-Cook, S.; Adamkovics, M.; Marcus, P.; Asay-Davis, X.; Conrad, A.; Go, C.

    2009-09-01

    Observations of Jupiter were conducted in April 2006 and May 2008 with both HST (250-890 nm) and the 10-m Keck telescope. On Keck we used the near-infrared camera NIRC2, coupled to the AO system, at 1.2 to 5 micrometers. At 5 um we are sensitive to Jupiter's thermal emission in cloud-free regions of the atmosphere, while at 1.2 um we see reflected sunlight from hazes and clouds in the troposphere-stratosphere. All small ovals (i.e., all except for Oval BA and the GRS) appear to be surrounded by bright rings at 5 mu, with typical brightness temperatures of 225-250 K, and hence probing depths to 2.5-4 bar. We argue that the small vortices are columnar structures, extending down into the water cloud. Air is rising along the center of these vortices, and descending around the outer periphery; the storm systems are likely fueled by the latent heat released from the water cloud. The descending part of the vertical circulation in the larger ovals is within the ovals, likely at the location of the red ring in Oval BA, which may indicate the maximum radial distance where such return flows can take place. On 19 July 2009, amateur observer Anthony Wesley (Australia) reported a dark spot/streak on Jupiter, near a southern latitude of 56 deg, which he attributed to an impact (analogous to the SL9 impact on Jupiter). We are scheduled to observe Jupiter with the Keck AO system on 24 July 2009 UT; if observations are successful, we will report preliminary results.

  16. Comportamento do gramado submetido aos herbicidas clethodim e sethoxydim.

    Directory of Open Access Journals (Sweden)

    Cleber D. de G. Maciel

    2007-06-01

    Full Text Available O principal fator do custo de manutenção de um gramado é o corte na altura adequada. O crescimento vegetativo e reprodutivo do gramado formado com grama-batatais (Paspalum notatum Flügge, submetido às doses de clethodim e sethoxydim foi avaliado em dois experimentos conduzidos no campus urbano da Escola Superior de Agronomia de Paraguaçu Paulista-ESAPP (SP, em gramado já estabelecido. Foi utilizado o delineamento experimental de blocos casualizados com seis tratamentos e quatro repetições, representados por clethodim nas subdoses de 0,0000; 0,0037; 0,0075; 0,0150; 0,0300 e 0,0600 kg i.a. ha-1, assim como pelo sethoxydim a 0,0000; 0,0156; 0,0312; 0,0625; 0,1250 e 0,2500 kg i.a. ha-1. O clethodim e sethoxydim, aos 7 DAA, intoxicaram as plantas a partir das doses de 0,0300 e 0,1250 kg ha-1, respectivamente. Os sintomas de intoxicação, aos 49 DAA, praticamente desapareceram para todos os tratamentos. O teor de clorofila nas folhas não apresentou diferenças significativas entre as subdoses de clethodim e sethoxydim em relação à testemunha, em nenhuma das épocas estudadas. Houve redução progressiva da altura média e no número de inflorescências do gramado em função do incremento das doses de clethodim e sethoxydim. Estes herbicidas apresentam viabilidade na redução vegetativa e reprodutiva da espécie P. notatum, sendo o sethoxydim mais seletivo em relação à preservação das características visuais do gramado

  17. Estilos de Aprendizagem versus Treinamento Vivencial ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Luciano Munck

    2010-04-01

    Full Text Available O objetivo deste estudo foi analisar a relação entre estilos individuais de aprendizagem e o treinamento vivencial ao ar livre. Os treinamentos vivenciais tiveram como técnicas o arvorismo, dinâmicas de grupo e paintball. Para alimentar a análise, foram aplicados dois instrumentos de pesquisa a cento e cinco participantes dos treinamentos: o Learning Style Inventory (LSI e um questionário para identificação da satisfação. A coleta de dados foi realizada nos próprios locais de treinamento, sendo a identificação dos estilos de aprendizagem realizada antes, e a da satisfação, depois dos treinamentos. Os dados evidenciaram que o estilo de aprendizagem predominante entre os participantes da pesquisa foi o estilo acomodador(24,8%. A satisfação foi predominantemente alta, com 100% das respostas variando entre mais ou menos satisfeito e muito satisfeito (arvorismo P=0,006. Os dados da pesquisa demonstraram fraca influência dos estilos individuais de aprendizagem na maior ou menor satisfação para com os treinamentos recebidos. Em suma, concluiu-se que os treinamentos vivenciais ao ar livre possuem características que proporcionam alta satisfação para diferentes habilidades e estilos de aprendizagem. Informação essa que deveria ser levada em consideração por gestores e líderes no momento de planejar e estruturar programas de treinamento e desenvolvimento para seus colaboradores.

  18. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at the university hospitals in Bern and Lausanne (Switzerland). Patient charts were retrospectively reviewed and fractures were classified from standard radiographs. Results - Of 2,292 upper extremity fractures in 2,203 children and adolescents, 26% involved the humerus and 74% involved the forearm. In the humerus, 61%, and in the forearm, 80% of single distal fractures involved the metaphysis. In adolescents, single humerus fractures were more often epiphyseal and diaphyseal fractures, and among adolescents radius fractures were more often epiphyseal fractures than in other age groups. 47% of combined forearm fractures were distal metaphyseal fractures. Only 0.7% of fractures could not be classified within 1 of the child-specific fracture patterns. Of the single epiphyseal fractures, 49% were Salter-Harris type-II (SH II) fractures; of these, 94% occurred in schoolchildren and adolescents. Of the metaphyseal fractures, 58% showed an incomplete fracture pattern. 89% of incomplete fractures affected the distal radius. Of the diaphyseal fractures, 32% were greenstick fractures. 24 Monteggia fractures occurred in pre-school children and schoolchildren, and 2 occurred in adolescents. Interpretation - The pattern of pediatric fractures in the upper extremity can be comprehensively described according to the PCCF. Prospective clinical studies are needed to determine its clinical relevance for treatment decisions and

  19. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the lower extremities of a representative population of children classified according to the PCCF. Patients and methods - We included patients up to the age of 17 who were diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at either of 2 tertiary care university hospitals in Switzerland. Patient charts were retrospectively reviewed. Results - More lower extremity fractures occurred in boys (62%, n = 341). Of 548 fractured long bones in the lower extremity, 25% involved the femur and 75% the lower leg. The older the patients, the more combined fractures of the tibia and fibula were sustained (adolescents: 50%, 61 of 123). Salter-Harris (SH) fracture patterns represented 66% of single epiphyseal fractures (83 of 126). Overall, 74 of the 83 SH patterns occurred in the distal epiphysis. Of all the metaphyseal fractures, 74 of 79 were classified as incomplete or complete. Complete oblique spiral fractures accounted for 57% of diaphyseal fractures (120 of 211). Of all fractures, 7% (40 of 548) were classified in the category "other", including 29 fractures that were identified as toddler's fractures. 5 combined lower leg fractures were reported in the proximal metaphysis, 40 in the diaphysis, 26 in the distal metaphysis, and 8 in the distal epiphysis. Interpretation - The PCCF allows classification of lower extremity fracture patterns in the clinical setting. Re-introduction of a specific code for toddler's fractures in the PCCF should be considered.

  20. Prevalência de câncer colorretal associado ao papilomavírus humano: uma revisão sistemática com metanálise

    Directory of Open Access Journals (Sweden)

    Thaisa Pelizzer

    Full Text Available RESUMO: Introdução: O câncer colorretal é um dos tipos de tumor mais prevalentes na população mundial. A mortalidade causada por esses tumores malignos continua elevada e mantém-se praticamente no mesmo nível nas últimas décadas. Entre os fatores de risco já estabelecidos para o desenvolvimento do câncer estão as infecções por patógenos ou vírus. Entre os vírus, o papilomavírus humano (HPV é o mais prevalente, tendo mais de 180 cepas, das quais 40 estão diretamente relacionadas com infecções anogenitais. Objetivo: Avaliar de forma sistemática, com metanálise, os principais estudos que associam o HPV ao câncer colorretal. Métodos: Como estratégia de busca foi adotada a lógica baseada em descritores específicos (idioma inglês, vinculados aos operadores booleanos (AND/OR. As buscas foram aplicadas nas bases de dados PubMed, ScienceDirect e Scientific Electronic Library Online (SciELO, no período de abril e maio de 2015. Resultados: Foram avaliadas 1.549 amostras, sendo 956 (61,7% do sexo masculino. Foram diagnosticados 630/1.358 casos de câncer colorretal por HPV (51,9%. Destes, 408/767 (51,9% eram do sexo masculino e 404/598 (67,5% foram associados aos HPVs 16 e 18, com prevalência tumoral na região do colo (253/411; 61,3%. Do total de 598 amostras para estimativa das prevalências de HPV-16 e HPV-18, a quantidade de casos com valores muito semelhantes foi de 204 (31,7% e 200 (35,8%, respectivamente. Foram verificados valores relativamente expressivos na região do colo, 253 (61,3%, e na região retal, 158 (38,7%. Conclusão: Após a realização do presente estudo, a associação entre HPV e câncer colorretal ficou evidente, não havendo distinção entre gêneros, com valores muito semelhantes entre o HPV-16 e o HPV-18.

  1. Aplicación de un antioxidante en dientes tratados con tetraciclinas y/o MTA.

    OpenAIRE

    Bermúdez Semprún, María Esther

    2014-01-01

    Una vez que el diente erupciona en la cavidad bucal, lo hace con una formación radicular incompleta, se denomina diente inmaduro o con ápice abierto. La patología pulpar, como secuela de caries o de lesión traumática puede interferir en la vitalidad pulpar, conllevando a una interrupción de la formación normal de la raíz y como consecuencia, una raíz de paredes delgadas y propensas a la fractura. A partir del 2001 se introdujo la revascularización, que tiene la capacidad de formar tejido ...

  2. Duas grandes transformações ao mesmo tempo: atitudes em relação à alimentação e ao corpo em gestantes adolescentes

    OpenAIRE

    Carolina Marques Oliboni

    2014-01-01

    Introdução - Adolescência e gestação são caracterizadas por intensas transformações relacionadas ao corpo, e ocorrendo concomitantemente podem potencializar riscos para o surgimento de problemas com a imagem corporal, atitudes alimentares disfuncionais e comportamentos de risco para transtornos alimentares. Objetivo - Avaliar as atitudes em relação à alimentação, ao peso e ao corpo de um grupo de adolescentes grávidas. Métodos - Uma amostra de adolescentes grávidas (n=67) foi avaliada por mei...

  3. A contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle: um estudo sobre duas empresas de grande porte do setor automotivo

    OpenAIRE

    Quintairos, Paulo César Ribeiro; Andrade, Alequexandre Galvez de; Oliveira, Edson Aparecida de Araújo Querido

    2011-01-01

    A contabilidade gerencial é uma importante ferramenta para o planejamento e controle das organizações, pois integra medidas financeiras e não financeiras. O conjunto dessas informações forma um sistema integrado cuja finalidade é avaliar o alinhamento da produção de uma empresa aos seus objetivos estratégicos. Neste trabalho será apresentado um estudo sobre o uso da contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle de duas empresas de grande porte do setor automob...

  4. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford

    2012-10-01

    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como

  5. NGC 2194: un cúmulo abierto Galáctico relativamente joven y pobre en metales

    Science.gov (United States)

    Piatti, A. E.; Clariá, J. J.; Ahumada, A. V.; Aquilano, R.; Dávoli, D.; Missio, H.; Acero, S.

    We present CCD VIKC photometry down to V ≈ 21 mag in the field of the rich open cluster NGC 2194, which is projected towards the Galactic anticentre direction. We measured V magnitudes and V-I colours for a total of 2515 stars in a field of 13'.6 × 13'.6. These data are supplemented with CCD photometry in the C, M and T1 filters of the Washington system and photoelectric CMT1T2 photometry of 20 red giant candidates. Based on the best fits of isochrones computed by the Geneva and Padova groups to the (V,V-I) colour-magnitude diagram, we derive a colour excess E(V-I) = 0.75, a cluster distance of 3.2 kpc and an age of 400 Myr. Five independent Washington abundance indices yield a mean cluster metallicity of [Fe/H] = -0.27 ± 0.06, which is compatible with the existence of both a radial and Z gradient in the Galactic disc. NGC 2194 is a relatively young open cluster, whose deficiency in metal content can be accounted for by the fact of having been born not only far from the Galactic centre in the outer disc, but also at a relatively high Z value (Piatti, Clariá & Ahumada 2003, MNRAS, 340, 1249).

  6. Robo-AO KP: A new era in robotic adaptive optics

    Science.gov (United States)

    Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy

    2016-01-01

    Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.

  7. Adesão de pessoas com diabetes mellitus tipo 2 ao tratamento medicamentoso

    OpenAIRE

    BOAS, Lilian Cristiane Gomes-Villas; Foss-Freitas, Maria Cristina; Pace, Ana Emilia

    2014-01-01

    Estudo seccional de abordagem quantitativa que objetivou avaliar a adesão ao tratamento medicamentoso entre pessoas com diabetes mellitus, e sua relação com variáveis clínicas, de tratamento e controle metabólico. A amostra constituiu-se de 162 pessoas com diabetes mellitus tipo 2 em seguimento ambulatorial. Para a coleta dos dados, foram utilizadas a Medida de Adesão aos Tratamentos e a consulta aos prontuários dos participantes. Obteve-se elevada adesão ao tratamento medicamentoso. Para um ...

  8. COMO ENTENDER E ATENDER AOS DIREITOS DAS MINORIAS?

    Directory of Open Access Journals (Sweden)

    Maria Cristina Alves Delgado de Ávila

    2014-05-01

    Full Text Available No âmbito do Estado Democrático de Direito, um Governo representa a maioria. Conforme os ditames da Constituição Federal de 1988 – CRFB/88 -, a maioria pode organizar-se e decidir sobre os assuntos públicos de um determinado Estado. Dentro da idéia de maioria, tem-se o grupo que, em certo momento, encontra-se no poder com o direito de liderar os demais indivíduos ocupantes de um território. A minoria é o oposto. Para garantir a harmonia social, a maioria não tem o direito de oprimir a minoria e não deve retirar os direitos e as liberdades fundamentais de um grupo minoritário ou mesmo de um indivíduo. Ao contrário, a maioria deve garantir o pluralismo cultural de um povo dentro de um território. Partindo da hermenêutica dos direitos das minorias, pretende-se responder a pergunta como entender e atender a estes direitos.

  9. Subsunção do trabalho imaterial ao capital

    Directory of Open Access Journals (Sweden)

    Eleutério F. S. Prado

    Full Text Available O presente artigo examina a transformação do modo de produção capitalista que acompanha a expansão do trabalho imaterial como fonte de geração de riqueza efetiva. Essa avaliação é feita no interior da teoria do valor-trabalho e da crítica da economia política. Para tanto, interroga, primeiro, o verdadeiro impacto da informatização na natureza capitalista dos processos produtivos atualmente em andamento, principalmente nos países centrais. Compara, depois, as principais características da indústria taylorista com as características marcantes da indústria pós-taylorista. Ao final, conclui que uma transformação importante do sistema capitalista está em curso: a grande indústria, tal como foi caracterizada por Marx em O Capital, não predomina mais nos países do centro do sistema, pois o que aí prevalece agora é a pós-grande indústria.

  10. Touraine, Burawoy, Gramsci: do social ao político

    Directory of Open Access Journals (Sweden)

    Leonardo Mello e Silva

    Full Text Available O ensaio empreende uma discussão da proposta da sociologia pública de Michael Burawoy, nos anos 2000, a partir da confrontação com a intervenção sociológica de Alain Touraine, formulada nos anos 1970. Pontos de contato são detectados no que diz respeito à relação entre pesquisador e pesquisado, como atores sociais. Problemas e limitações, tanto da intervenção sociológica quanto da sociologia pública, são elencados, trazendo-se como apoio exemplos extraídos de trabalho de campo próprio. O texto vale-se também da inspiração de Antonio Gramsci e sua concepção da relação entre senso comum e intelectuais. Ao invés de um juízo conclusivo, propõe-se um diálogo entre os autores, todos preocupados, à sua maneira, com o destino público ou cívico do conhecimento obtido sobre o mundo social.

  11. ROTEIRO DE VIAGEM AO PAÍS DE LACAN

    Directory of Open Access Journals (Sweden)

    Laéria Fontenele

    2015-12-01

    Full Text Available Grande leitor e crítico da cultura de seu tempo e um dos nomes de maior destaque da psicanálise contemporânea, Slavoj Žižek desfaz a fábula segundo a qual ler Lacan é um trabalho árduo e difícil que seria apenas privilégio dos especialistas em psicanálise e, com isso, brinda o seu leitor com um envolvente passeio pelo país de Lacan. De origem eslovena, e quase eleito presidente de seu país, Slavoj Žižek é autor de diversos livros - dentre os quais os instigantes ensaios “Hegel, o mais sublime dos histéricos” e “Eles não sabem o que dizem” -, a maioria publicada em por volta de trinta idiomas. É ele reconhecido como sendo um profundo conhecedor de Hegel e Karl Marx; apaixonado leitor de Sigmund Freud e de Jacques Lacan; crítico contundente das ideologias totalitárias, espírito cultivado por sua filia às múltiplas artes – sendo, inclusive, especialista na cinematografia de Alfred Hitchcock. Os traços de sua erudição e sensibilidade para com as artes, se refletem e particularizam, também, o seu estilo de escrever, o qual se encontra muito bem representado no modo como urdiu esse seu novo livro. “Como ler Lacan” nos ensina a adotar um método especial para orientar em uma tal empreitada. Žižek advoga que, para lermos Lacan, devemos aplicar o mesmo método empregado pela psicanálise para ler e interpretar o texto que resulta do trabalho inconsciente. Mas há uma condição para esse emprego: abandonar o vício de querer entender, pois, assim como o inconsciente, Lacan não deve ser compreendido e sim lido, pois, conforme ele mesmo já nos advertira, o pior destino a que podemos ser conduzidos é o destino que nos leva à compreensão. Só assim será fácil ler Lacan, mais do que, amiúde, se imagina. Muitas introduções ao seu ensino foram publicadas, algumas delas marcadas por rigor conceitual, outras resultaram em versões grosseiras de sua letra. Sem desmerecer as boas introduções a Lacan

  12. INTRODUÇAO AOS MODELOS ODE PARTICIPAÇÃO DE MERCADO EM SERVIÇOS DE TRANSPORTES

    Directory of Open Access Journals (Sweden)

    Antonio Galvão Novaes

    2010-04-01

    Full Text Available

    Análises de participação de mercado ("market share" são comuns em estudos na área de "marketing", envolvendo produtos e respectivas marcas, de um lado, o perfil da demanda de outro, e o posicionamento das empresas produtoras que competem nesse mercado, num terceiro bloco. No setor de transportes a literatura registra aplicações em ligações aéreas e em serviços intermunicipais de ônibus. Os modelos de participação de mercado se aplicam normalmente a situações em que os operadores oferecem serviços de transportes similares num determinado mercado, com a competição sendo feita não com base em atributos modais intrínsecos, mas sim apoiada em características diferenciadoras intra-modais mais tênues, tais como conforto, atendimento, promoções tarifárias, "marketing" e propaganda, etc. Neste artigo é feita uma introdução aos modelos de "market share" em transportes, com a apresentação de um exemplo de aplicação ao transporte intermunicipal de passageiros em ônibus, sendo discutidos também aspectos ligados a calibração e tais modelos.

    ABSTRACT

    Market share analysis is common in marketing studies involving products and respective brands, on one hand, the demand profile on the other hand, and the competiting industries on a third set. In the transport sector the literature registers a number of applications to air transport problems and to intercity bus services. Market share models are normally applied to situations in which operators offer, in a specific market, transport services that are similar in nature, with competition based not on intrinsic modal attributes, but rather on more tenous intra-mode differentiating characteristics, such as comfort, attendance, tariff promotions, marketing and advertising efforts, etc (sub-modal configurations. It is presented in this paper an introduction to market share modelling in transport, with an example concerning an intercity bus service in

  13. Das portarias aos bloquinhos: arte e apoio institucional ao Projeto Mais Médicos para o Brasil

    Directory of Open Access Journals (Sweden)

    Heloísa Germany

    Full Text Available Este ensaio apresenta experiências vivenciadas por uma artista visual integrante da equipe de Apoio Institucional do Ministério da Educação para o Projeto Mais Médicos para o Brasil (PMMB, uma proposta interministerial que aproxima de forma significativa processos de trabalho e formação relacionados à saúde e à educação. Por meio do que Roland Barthes chama de obtuso e por meio de uma metodologia hifográfica, investe-se na leveza e reinvenção de ações no campo da Saúde Coletiva na interface das artes como processos educativos sensíveis experimentados ao longo de dois anos junto com o PMMB. Por meio de pequenos blocos de anotações produzidos individualmente e por um coletivo de apoiadores, delineia-se um processo singular e sensível, contribuindo na discussão sobre o fortalecimento das coletividades, das redes de Atenção Básica, da formação para o Sistema Único de Saúde e da composição de olhares poético-políticos acerca do PMMB.

  14. Um conceito reinterpretado ao longo do século: do intelectual individualista de Durkheim ao intelectual coletivo de Bourdieu

    Directory of Open Access Journals (Sweden)

    Ione Ribeiro Valle

    2017-10-01

    Full Text Available Para contribuir com o debate sobre os intelectuais recorremos a dois sociólogos, distanciados um do outro cerca de um século: Émile Durkheim (1858-1917 e Pierre Bourdieu (1930-2002. O primeiro preconiza a relação entre uma “moral individualista” e o papel do intelectual. Esta reflexão integra o conjunto de suas apostas na coesão social e na moral laica, indispensáveis à promoção do progresso e da ordem nas sociedades em processo crescente de diferenciação. A perspectiva de Bourdieu volta-se à necessidade de “reinventar uma espécie de intelectual coletivo segundo o modelo do que foram os enciclopedistas”. Segundo ele, um novo desafio se impõe ao intelectual coletivo: mobilizar a ciência, e a sociologia em particular, na luta contra os usos abusivos da própria ciência e da autoridade científica. As ideias destes pensadores oferecem chaves de leitura que inspiram o desenvolvimento de uma sociologia histórica voltada à educação no pensamento social brasileiro.

  15. Da Ruptura ao Acontecimento: Bachelard, Canguilhem e Foucault

    Directory of Open Access Journals (Sweden)

    Gabriela Menezes Jaquet

    2017-02-01

    Full Text Available Este artigo tem por objetivo propor uma problematização da concepção de acontecimento tal como é pensada, em seus contornos gerais, na filosofia francesa contemporânea e, mais especificamente, pela história da ciência. Nosso enfoque será a compreensão das abordagens de Gaston Bachelard, Georges Canguilhem e Michel Foucault principalmente no que tange às noções de ruptura epistemológica e de ideologia científica em sua articulação com as características do acontecimento pensado por Foucault, partimos, portanto, de concepções de história que, apesar das concordâncias, também acabam por se diferenciar: uma, a história descontinuísta das rupturas epistemológicas, outra, a história arqueológica dos acontecimentos. Para explicarmos a diferença deste nível acontecimental, será necessário compreendermos a visada singular de Foucault em relação à ciência, que é questionada (e criticada de forma a atentar para outro nível: o do saber que aqui exploraremos a partir do conceito de limiar. Igualmente quanto ao estatuto de científico, abordaremos o posicionamento crítico de Canguilhem em relação à Bachelard sobre os desdobramentos de uma razão pensada historicamente, através de sua história dos conceitos. Tendo em vista estas considerações poderemos compreender não só a especificidade do trabalho de cada um destes autores, mas visualizar o que a categoria de acontecimento pôde, via Foucault, trazer de novo para a história da ciência.

  16. As hérnias medem-se aos palmos?

    Directory of Open Access Journals (Sweden)

    Cátia Pereira

    2016-06-01

    Full Text Available Apresenta-se o caso de uma doente do sexo feminino com 74 anos, autónoma, com antecedentes patológicos de obesidade, diabetes mellitus tipo 2, hipertensão arterial e doença osteoarticular degenerativa, que recorreu à urgência por infeção respiratória inferior. Negava sintomas gastrointestinais ou antecedentes cirúrgicos. Ao exame objetivo, destacava-se a presença de uma hérnia umbilical volumosa não dolorosa à palpação, mas que condicionava a sua mobilidade, sendo impossível a redução do conteúdo herniário. Após insistência na anamnese, a doente referiu o seu aparecimento na infância, na altura com recusa em efetuar a sua correção cirúrgica, tendo sido perdido o seu seguimento posteriormente. A radiografia e a tomografia computorizada abdominais mostraram um colo herniário de seis centímetros de diâmetro e herniação de praticamente todo o intestino delgado e parte do cólon, sem evidência de encarceramento (Figuras 1 e 2. Apesar de décadas de evolução condicionarem um progressivo e forte impacto nas atividades da vida diária, a doente não procurou os cuidados de saúde por esse motivo, mantendo a sua decisão e sendo encaminhada para a consulta externa. As complicações herniárias abdominais incluem a obstrução intestinal e a temida emergência cirúrgica da hérnia encarcerada, não se desprezando a morbilidade inerente, bem evidente neste caso.1-2

  17. O sindicalismo mineiro frente aos desafios dos anos 90

    Directory of Open Access Journals (Sweden)

    Antônio Carvalho Neto

    2000-12-01

    Full Text Available O que se analisa neste artigo é como os sindicatos dos bancários, metalúrgicos e trabalhadores em telecomunicações têm negociado o (desemprego, a demanda por qualificação e a remuneração variável. Foram tabuladas/analisadas 3.569 cláusulas de acordos coletivos, e realizadas 26 entrevistas com dirigentes sindicais e empresariais em três Estados (RJ, SP e MG. Os resultados indicam que as mudanças organizacionais foram incomparavelmente mais negociadas no setor metalúrgico do ABC. A flexibilização da jornada foi trocada pela redução (da jornada sem redução de salário nos setores metalúrgicos paulistas, mas não em Minas Gerais. No setor bancário, houve poucos resultados nas negociações sobre jornada. As negociações em torno da remuneração variável vinculada às metas das empresas aconteceram nos setores metalúrgicos, e não nos setores de serviços. As entrevistas apontam para um sindicalismo mais propositivo, no sentido de uma intervenção negociada, predisposição que não é correspondida pelos empresários, grosso modo. O Estado, que poderia utilizar seu poder regulador para induzir os empresários a negociarem nessa direção não tem produzido resultados satisfatórios. Conclui-se que não há maturidade empresarial no Brasil que permita ao Estado ausentar-se das relações de trabalho.

  18. Suscetibilidade de Oligonychus yothersi (Acari: Tetranychidae ao fungo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Oliveira Renato Cassol de

    2002-01-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis é uma importante atividade econômica no Sul do Brasil. Com o aumento de consumo nos anos oitenta, cresceram também as áreas de monocultura, gerando condições favoráveis para o aumento populacional de insetos e ácaros fitófagos, entre eles o ácaro vermelho Oligonychus yothersi. Este estudo avaliou a suscetibilidade do ácaro vermelho O. yothersi a vários isolados do fungo Beauveria bassiana. O experimento foi conduzido em Cascavel, PR. Discos foliares de erva-mate (2,2 cm² foram previamente infestados com 20 fêmeas adultas. Alíquotas de 1 mL de cada suspensão de conídios dos diferentes isolados de B. bassiana, ajustadas na concentração de 1,0x10(8 conídios mL-1 foram pulverizadas, separadamente, sobre um conjunto de 5 discos. Os discos foliares foram mantidos flutuando em água destilada, em caixas plásticas (3 cm de diâmetro, sob condições controladas. Diariamente, os ácaros mortos foram transferidos para câmara úmida, para confirmação de mortalidade causada pelo fungo. A mortalidade total variou entre 77 e 98% (6 dias após a aplicação, não permitindo diferenciar os isolados quanto à virulência (P>0,05. Já a mortalidade confirmada variou entre 19 e 75%, permitindo diferenciá-los (P<0,05. O ácaro vermelho O. yothersi foi suscetível, em diferentes níveis, aos isolados de B. bassiana testados.

  19. Patterns of Impairments in AOS and Mechanisms of Interaction between Phonological and Phonetic Encoding

    Science.gov (United States)

    Laganaro, Marina

    2012-01-01

    Purpose: One reason why the diagnosis of apraxia of speech (AOS) and its underlying impairment are often debated may lie in the fact that most patients do not display pure patterns of AOS. Mixed patterns are clearly acknowledged at other levels of impairment (e.g., lexical-semantic and lexical-phonological), and they have contributed to debate…

  20. SCExAO as a precursor to an ELT exoplanet direct imaging instrument

    Science.gov (United States)

    Jovanovic, Nemanja; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; Singh, Garima; Vievard, Sebastien; Kudo, Tomoyuki; Garrel, Vincent; Norris, Barnaby; Tuthill, Peter; Stewart, Paul; Huby, Elsa; Perrin, Guy; Lacour, Sylvestre

    2013-12-01

    The Subaru Coronagraphic Extreme AO (SCExAO) instrument consists of a high performance Phase Induced Amplitude Apodisation (PIAA) coronagraph combined with an extreme Adaptive Optics (AO) system operating in the near-infrared (H band). The extreme AO system driven by the 2000 element deformable mirror will allow for Strehl ratios>90% to be achieved in the H-band when it goes closed loop. This makes the SCExAO instrument a powerful platform for high contrast imaging down to angular separations of the order of 1 lambda/D and an ideal testbed for exploring coronagraphic techniques for ELTs. In this paper we report on the recent progress in regards to the development of the instrument, which includes the addition of a visible bench that makes use of the light at shorter wavelengths not currently utilized by SCExAO and closing the loop on the tip/tilt wavefront sensor. We will also discuss several exciting guest instruments which will expand the capabilities of SCExAO over the next few years; namely CHARIS which is a integral field spectrograph as well as VAMPIRES, a visible aperture masking experiment based on polarimetric analysis of circumstellar disks. In addition we will elucidate the unique role extreme AO systems will play in enabling high precision radial velocity spectroscopy for the detection of small companions.

  1. The nature of ethnic identity among the people of Curaçao

    NARCIS (Netherlands)

    Dijs, N.M. van der

    2011-01-01

    This qualitative research explores the nature of ethnic identity among the people of Curaçao. The questions that are of fundamental interest to this study are: how do the people of Curaçao perceive themselves ethnically, how do they experience their sense of belonging to an ethnic group and what

  2. About the malacological subdivision of Curaçao; a review

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1990-01-01

    Burrington Baker (1924) states that Curaçao can be divided into three distinct faunal areas. Stock (1977) mentions the occurrence of three subspecies of hadziid amphipods almost exclusively confined to different parts of Curaçao. The results of a study of the distribution on this island of various

  3. Use of AO PSF models for the Study of Resolved Stellar Populations

    NARCIS (Netherlands)

    Deep, A.; Fiorentino, G.; Jolissaint, L.; Tolstoy, E.; Clénet, Y.; Conan, J.-M.; Fusco, Th.; Rousset, G.

    2010-01-01

    The full scientific exploitation of AO images to study resolved stellar populations is still in a nascent stage. This requires pushing to the faint limits and carrying out deep and accurate crowded field photometry and astrometry. The main complexity of AO images is that the correction is never

  4. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  5. Propostas de mudanças ao basquete no sertão cearense: dando voz aos praticantes

    Directory of Open Access Journals (Sweden)

    Bérgson Nogueira de Oliveira

    2017-06-01

    Full Text Available Objetivo: o presente artigo tem como objetivo compreender as percepções de mudanças sociais atribuídas pelos praticantes de basquete em um município do sertão cearense, destacando neste contexto, as suas representações sociais acerca do papel social desta prática esportiva. Método: foram entrevistados cinco sujeitos do sexo masculino que praticam a modalidade há mais de dez anos no contexto do sertão cearense e que estudaram em escolas públicas. Para a construção das informações, utilizamos a entrevista semi-estruturada, seguida por um roteiro composto por temas, que foi adaptado de um estudo realizado por Santos (2004. As análises dos dados se deu a partir da Análise de Conteúdo do tipo Análise Temática, em que foram elaboradas categorias, a partir do material das entrevistas. Resultados: as representações de mudança dos sujeitos indicam o incentivo do basquete nas escolas; criação de projetos sociais; investimento na infraestrutura esportiva; bem como o fomento à criação de competições. Conclusão: conclui-se que a falta de apoio, de forma geral, dificulta a inserção de novos praticantes para essa modalidade. Nesse sentido, entende-se que são necessários mais incentivos ao esporte, pois se trata de um pilar na formação humana e possibilita o seu trabalho, não apenas no alto rendimento, mas também em dimensões de lazer, participação, educação, inclusão social entre outros aspectos.

  6. Sobre a domiciliaçao dos triatomineos

    Directory of Open Access Journals (Sweden)

    Mário B. Aragão

    1981-06-01

    Full Text Available Foram reunidos resultados de testes de precipitina feitos com o conteúdo do tubo digestivo de triatomineos. €ssas informações foram discutidas com base nas proporções de sangue de mamíferos e de ave, encontradas e em diversas observações relativas às espécies de vertebrados a que os triatomíneos estão associados na natureza. O estudo englobou as seguintes espécies: Belminus peruvianus, Panstrongylus geniculatus, Panstrongilus herreri, Panstrongylus megistus, Psammolestes tertius, Rhodnius neglectus, Rhodnius prolixus,Triatoma arthurneivai, Triatoma dimidiata,Triatoma infestans, Triatoma protracta, Triatoma rubrovaria e Triatoma sórdida. As seguintes conclusões puderam ser obtidas: 1 - As espécies que, nos biótopos artificiais, se alimentam principalmente de sangue humano, na natureza, são as mais ecléticas. Sugam mamífero, ave e animais de sangue-frio, mas apresentam marcada preferência por sangue de mamífero. 2 - As espécies que, nos biótopos artificiais, são encontradas com maior freqüência associadas a aves, na natureza ou preferem sangue de ave ou não tem predileção nítida por ave ou mamífero. 3 - As espécies associadas a animais de sangue frio ou restritas a um único grupo de mamíferos, podem colonizar nos domicílios desde que eles sejam previamente colonizados pelo hospedeiro. 4 - Não foram encontrados indícios de que alguma espécie esteja se adaptando aos domicílios. Todos os triatomineos ditos domiciliários já possuíam, na natureza, atributos que permitiam a vida em novos biótopos, habitados ou pelo homem ou por animais domésticos.

  7. Um sopro de Luz e Letra em meio ao caos

    Directory of Open Access Journals (Sweden)

    Marcelo Tomazi

    2009-06-01

    Full Text Available Enquanto compreende avanços científicos, o homem busca compreender a si mesmo. Partindo da citação de Carl Sagan, vemos que a Arte é um dos caminhos para a humanização, e os vínculos entre ciência (tecnologia e arte são cada vez mais estreitos. Um dos artistas que melhor trabalham dentro do nicho conhecido como “arte tecnológica” é Eduardo Kac. Sua trajetória inicial é apresentada aqui, dos “holopoemas” à “arte da telepresença”. Vemos o artista-teórico completo, profundo conhecedor da história da arte eletrônica. O livro Luz & letra: ensaios de arte, literatura e comunicação, sua obra de referência, é apresentado em essência, situando-se sua importância. É uma das poucas obras no Brasil a discutir, pela ótica de quem fez parte, eventos ligados ao advento da arte tecnológica nos anos 1980.In our quest to understand scientific advances, we seek to understand ourselves. Employing Carl Sagan's insight as a departure point, we see that art is one of the paths for humanization and that the links between science (technology and art are increasingly narrow. One of the artists who best works within the realm known as “art and technology” is Eduardo Kac. This essay explores Kac's early artworks, starting with “holopoems” and arriving at “telepresence art”, and especially his texts. We see a complete artist-theorist, with an unrivaled knowledge of electronic art and literature, in part because his theorizing emerges from having actively participated in the creation of the events he refers to. Of special interest is Kac's book Light & letter: essays in art, literature, and communication, which collects his writings of the 1980s. This is a fundamental work and mandatory reference for the study of the experimental art and literature of the period.

  8. Aldehyde oxidase (AO) in the root nodules of Lupinus albus and Medicago truncatula: identification of AO in meristematic and infection zones.

    Science.gov (United States)

    Fedorova, Elena; Redondo, Francisco J; Koshiba, Tomokazu; Pueyo, José J; de Felipe, M Rosario; Lucas, M Mercedes

    2005-05-01

    Phytohormones are involved in the organogenesis of legume root nodules. The source of the auxin indole-3-acetic acid (IAA) in nodules has not been clearly determined. We studied the enzyme aldehyde oxidase (AO; EC 1.2.3.1), that catalyzes the last step of IAA biosynthesis in plants, in the nodules of Lupinus albus and Medicago truncatula. Primordia and young lupin nodules and mature M. truncatula nodules showed AO activity bands after native polyacrylamide gel electrophoresis. Gel activity analyses using indole-3-aldehyde as substrate indicated that the nodules of white lupin and M. truncatula have the capability to synthesize IAA via the indole-3-pyruvic acid pathway. Immunolocalization and in situ hybridization experiments revealed that AO is preferentially expressed in the meristematic and the invasion zones in Medicago nodules and in the lateral meristematic zone of Lupinus nodules. High IAA immunolabeling was also detected in the meristematic and invasion zones. Low expression levels and no AO activity were detected in lupin Fix- nodules that displayed restricted growth and early senescence. We propose that local synthesis of IAA in the root nodule meristem and modulation of AO expression and activity are involved in regulation of nodule development.

  9. O direito fundamental ao conteúdo do próprio trabalho: uma reconstrução normativa do direito ao trabalho

    Directory of Open Access Journals (Sweden)

    Leonardo Vieira Wandelli

    2016-12-01

    Full Text Available Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas como necessidade radical, tendente à transformação da institucionalidade vigente, mas também como direito positivado em um amplo leque de normas internacionais e nacionais, que contempla diversas dimensões normativas atualmente exigíveis. Propõe-se que, no centro desse direito, está um direito fundamental ao conteúdo do próprio trabalho, que determina juridicamente as condições da atividade e da organização do trabalho. Recente estudo adotado pelo Alto Comissariado em Direitos Humanos da Organização das Nações Unidas (ONU sobre o direito ao trabalho reforça essa compreensão. Palavras-chave: Direitos humanos. Direitos fundamentais. Direito ao trabalho. Psicodinâmica do trabalho. Direito do trabalho.

  10. Avaliação da qualidade de vida e vulnerabilidade ao estresse no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Fernanda Ottati

    2013-05-01

    Full Text Available O conceito de Qualidade de Vida é usado para medir as condições de vida de um ser humano, já a palavra vulnerabilidade refere-se à chance das pessoas estarem expostas ao adoecer. Objetivou-se analisar possíveis relações entre percepção de qualidade de vida e a vulnerabilidade ao estresse no trabalho em enfermeiros, técnicos e auxiliares de enfermagem que atuam na UTI e no setor de emergência de um hospital público. Utilizou-se o instrumento de qualidade de vida da Organização Mundial da Saúde, WHOQOL-Bref e a Escala de Vulnerabilidade ao Estresse no Trabalho. Encontrou-se, em relação ao setor de trabalho, diferença significativa apenas para Qualidade de vida total. Portanto pode-se afirmar que os profissionais que atuam na UTI possuem maior percepção de qualidade de vida quando comparados aos do SUS. Na correlação entre os dois instrumentos, o domínio meio ambiente do WHOQOL-Bref correlacionou-se negativa e significativamente com todos os fatores da EVENT, indicando que a percepção da pessoa em relação aos diversos aspectos do meio em que vive tem relação com a vulnerabilidade ao estresse.

  11. Potencialidades e espaços ao empreendedorismo

    Directory of Open Access Journals (Sweden)

    Adriano Lago

    2008-01-01

    Full Text Available A criação de negócios é apontada como uma das causas da prosperidade de um local, região, estado ou de um país. É neste sentido que o empreendedorismo tem recebido destaque nos últimos anos, como promotor de novos negócios. Captar, descrever e analisar o fenômeno do empreendedorismo é, portanto, necessário para o desenho de ações de promoção do desenvolvimento. Assim, o presente estudo aborda o empreendedorismo na piscicultura, tomando como base três casos analisados: uma propriedade com rizipiscicultura, uma com piscicultura de ciclo completo inclusive com frigorífico, e outra onde a piscicultura desenvolve-se através de um pesque-pague, com vistas a proporcionar o turismo rural. Para fins de pesquisa, entrevistaram-se os proprietários de cada estabelecimento na busca dos dados necessários para a construção de uma abordagem consistente da temática proposta, ou seja, identificar a presença do empreendedorismo e suas características particulares em cada propriedade analisada. Verificou-se que determinadas características empreendedoras são comuns aos três casos analisados: habilidade para identificar oportunidades; busca de conhecimento de sua área de atuação; senso de organização; disposição para tomar decisões; capacidade de liderança; talento para empreender; otimismo e tino empresarial; ser estrategista, além do dinamismo. Portanto, foi possível observar que o perfil empreendedor dos proprietários de cada negócio tornou possível a transformação de idéias e problemas em oportunidades reais de negócio.Abstract The business opening is indicated as one of the prosperity causes of a country, state, region or local. It’s in this context that the entrepreneurship has received attention along the last years as new business promoter. This way, to study and promote development actions it’s necessary, firstly, to get, to describe and to analyze the entrepreneurship phenomenon by itself. So, this study

  12. Ortorexia em estudantes de nutrição : a hipercorreção incorporada ao habitus profissional?

    OpenAIRE

    Pontes, Jackeline Barcelos

    2012-01-01

    Introdução: O culto do corpo na sociedade moderna, tomado com vetor da individualidade, coloca a beleza e a estética como fatores de felicidade e riqueza. Com os rigorosos e inatingíveis padrões estabelecidos, cresce o número de pessoas acometidas por transtornos relacionados à alimentação, fruto da subjetividade coletiva. A ortorexia nervosa, um transtorno alimentar relativamente novo, descrito pela primeira vez por Bratman (1997), é caracterizada pela obsessão por alimentos normalmente cons...

  13. Previsibilidade do desempenho das restaurações anteriores com resinas compostas. Que condicionantes de risco inerentes aos pacientes?

    OpenAIRE

    Cardoso, Ana Rita Gomes da Silva

    2010-01-01

    Trabalho apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária. Introdução: As restaurações directas com resinas compostas podem assegurar um bom prognóstico no que delas depende o tratamento estruturas dentárias duras. Contudo, e face à evidência da literatura contemporânea, existem lacunas de informação relativamente à influência e magnitude de factores clínicos e da magnitude no desempenho de uma restauração. O paciente...

  14. Contribuição ao estudo da Tripanosomiase Americana

    Directory of Open Access Journals (Sweden)

    Bichat de Almeida Rodrigues

    1942-01-01

    ano (época do estío. 6 Em plena mata, n’uma toca de tamanduá (T. tetradactylus foram encontradas larvas, ninfas e adultos de P. geniculatus. A casa situada mais próximo desse foco, foi a que apresentou maior infestação (22 exemplares e exclusiva para essa espécie. Em uma toca de macaco da noite (P. flavus, foi encontrada uma larva de Triatomídeo. Este foco também ficava próximo à casa acima referida. Em toca de P. flavus foi também achado um exemplar adulto de Panstrongylus refotuberculatus. 7 Amostras de S. cruzi isoladas de animais silvestres, mostraram fraco poder infectante. A amostra isolada do cão, embora infectando facilmente os animais de laboratório, pelos estudos biométricos feito por DIAS e FREITAS, afasta-se das amostras humanas típicas. 8 São discutidos os resultados acima referidos e, pelos hábitos dos transmissores, pela predominância de depositários silvestres do parasito, conclue-se pela natureza silvestre da Tripanosomiase Americana no local estudado. Se bem que não tenham sido verificadas infecções humanas, dado o encontro de um cão parasitado – infecção esta que se pode ter verificado pelo meio normal da transmissão da moléstia – admite-se a possibilidade do aparecimento de casos humanos nessa região. Ressalta-se a confirmação que tais resultados parecem trazer á hipótese de CARLOS CHAGAS, que pensava ser esta doença primitivamente silvestre, com posterior adaptação aos animais domésticos e ao homem.1 The epidemiology of Chagas’ disease was studied for the first time in a systematized work, in a district of the region of the Amazon estuary, whose ecological conditions differ from those encountered in other zones where similar researches have been made. 2 At the place chosen for the studies – Aurá – a locality about 10 kms from Belem (State of Pará, no human infection by S. cruzi has been found, either by blood examination or xenodiagnosis, both having been tried on all the inhabitants (117 people

  15. CLASSICAL AREAS OF PHENOMENOLOGY: Correcting dynamic residual aberrations of conformal optical systems using AO technology

    Science.gov (United States)

    Li, Yan; Li, Lin; Huang, Yi-Fan; Du, Bao-Lin

    2009-07-01

    This paper analyses the dynamic residual aberrations of a conformal optical system and introduces adaptive optics (AO) correction technology to this system. The image sharpening AO system is chosen as the correction scheme. Communication between MATLAB and Code V is established via ActiveX technique in computer simulation. The SPGD algorithm is operated at seven zoom positions to calculate the optimized surface shape of the deformable mirror. After comparison of performance of the corrected system with the baseline system, AO technology is proved to be a good way of correcting the dynamic residual aberration in conformal optical design.

  16. Lesão de mancha branca associada ao tratamento ortodôntico

    OpenAIRE

    Tambelli, Bianca

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária O desenvolvimento de lesões de mancha branca em indivíduos submetidos ao tratamento ortodôntico com aparatologia fixa constitui um problema clínico importante. A inadequada higiene oral cria condições adicionais propícias ao aumento significativo da placa bacteriana ao redor dos suportes dos aparelhos fixos, fator este responsável pe...

  17. Streptococcus agalactiae em gestantes: prevalência de colonização e avaliação da suscetibilidade aos antimicrobianos Streptococcus agalactiae in pregnant women: prevalence of colonization and antimicrobial susceptibility evaluation

    Directory of Open Access Journals (Sweden)

    Irina Lermontov Borger

    2005-10-01

    Full Text Available OBJETIVOS: verificar a ocorrência de colonização por Streptococcus agalactiae em gestantes e avaliar a suscetibilidade das amostras isoladas aos antimicrobianos. MÉTODOS: foram avaliadas 167 grávidas entre a 32ª e a 41ª semana de gestação, independente da presença ou não de fatores de risco, atendidas no ambulatório de pré-natal entre fevereiro de 2003 e fevereiro de 2004. O material vaginal/anal, colhido com um único swab, foi inoculado em caldo Todd-Hewitt acrescido de ácido nalidíxico (15 µg/mL e gentamicina (8 µg/mL, com posterior subcultura no meio de ágar sangue. A identificação foi feita por meio da avaliação da morfologia e tipo de hemólise das colônias no meio de ágar sangue, teste da catalase, teste de cAMP e testes sorológicos. A avaliação da suscetibilidade aos antimicrobianos foi realizada pelos testes de difusão e de diluição em ágar. A análise estatística foi realizada por meio do teste de chi2; valores de p0,05. Todas as 32 amostras isoladas foram sensíveis a penicilina, cefotaxima, ofloxacina, cloranfenicol, vancomicina e meropenem. A resistência a eritromicina e clindamicina foi detectada em 9,4 e 6,2% das amostras, respectivamente. CONCLUSÕES: a incidência relativamente elevada (19,2% de colonização por S. agalactiae entre as gestantes avaliadas e o isolamento de amostras resistentes, especialmente aos antimicrobianos recomendados nos casos de alergia à penicilina, enfatizam a importância de detectar esta colonização no final da gravidez, associada à avaliação da suscetibilidade aos antimicrobianos, para uma prevenção eficaz da infecção neonatal.PURPOSE: to verify the occurrence of colonization by Streptococcus agalactiae in pregnant women attended at the prenatal outpatient clinic of the Teaching Maternity Hospital of Rio de Janeiro University (UFRJ and to evaluate the susceptibility of the isolates to antimicrobial agents. METHODS: a total of 167 pregnant women between the

  18. Percepção do consumidor frente aos riscos associados aos alimentos, sua segurança e rastreabilidade

    Directory of Open Access Journals (Sweden)

    Juliana Cunha de Andrade

    2013-09-01

    mostrou relevante nos três grupos, pois esta deve contribuir para o recolhimento mais eficiente de produtos, caso seja necessário. No entanto, sob a ótica do consumidor, a rastreabilidade leva ao aumento dos preços, embora aumente a confiança em relação à segurança dos alimentos. Muitas das preocupações dos consumidores refletem as informações publicadas em revistas e jornais, como o caso da crença de que hormônios são utilizados na cadeia da carne de frango. Indústria e varejistas devem incrementar a comunicação de informações científicas sobre a segurança dos alimentos, contribuindo, assim, na educação do consumidor.

  19. Reliability and Reproducibility of the OTA/AO Classification for Humeral Shaft Fractures

    NARCIS (Netherlands)

    K.C. Mahabier (Kiran); E.M.M. van Lieshout (Esther); B.C. van der Schaaf (Boyd); G.R. Roukema (Gert); B.J. Punt (Bas); M.H.J. Verhofstad (Michiel); D. den Hartog (Dennis); H.W. Bolhuis (Hugo); P.K. Bos (Koen); M.W.G.A. Bronkhorst (Maarten); M.M.M. Bruijninckx (Milko); P.Th. den Hoed (Pieter); B.J. Dwars (Boudewijn); J.C. Goslings (Carel); R. Haverlag (Robert); M.J. Heetveld (Martin); A.J.H. Kerver (Albert J.H.); K.A. Kolkman (Karel); K. Leenhouts (Kees); R. Onstenk (Ron); H. Poeze; R.W. Poolman (Rudolf); W.H. Roerdink (Herbert); J.B. Sintenie (Jan Bernard); N.M.R. Soesman (Nicolaj); F.H.W.M. van der Heijden (Frank); P. van der Zwaal (Peer); J.P. van Dijk (Johannes); H.P.W. van Jonbergen; E.J.M.M. Verleisdonk (Egbert); J.P.A.M. Vroemen (Jos); M. Waleboer (Marco); W.P. Zuidema (Wietse)

    2017-01-01

    textabstractObjectives: This study aimed to determine interobserver reliability and intraobserver reproducibility of the OTA/AO classification for humeral shaft fractures, and to evaluate differences between fracture types, fracture groups, and surgical specializations. Methods: Thirty observers (25

  20. Additions to the marine algal flora of Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Stegenga, H.; Vroman, M.

    1988-01-01

    Nine species of benthic marine algae are reported from the Caribbean island of Curaçao for the first time: Chlorophyta: Derbesia marina and Trichosolen longipedicellata; Phaeophyta: Ectocarpus rhodochortonoides, Feldmannia elachistaeformis, Hecatonema floridanum, Herponema tortugense and Sphacelaria

  1. Tense, But in the Mood: Diachronic Perspectives on the Representation of Time in Ao

    National Research Council Canada - National Science Library

    Coupe, Alexander R

    2013-01-01

    印度東北部的Ao 語呈現一些從類型學的角度來說很有意思的特徵,我們從這些特徵可以看到Ao 語時標誌歷史發展的一些線索。作者認為Ao 語原來有二元的語氣系統:實然 (realis) 和非實然 (irrealis),前者無標誌,後者有標誌。Ao 語把其中兩個名物化標誌的作用延伸到標記時的不同範疇,而原來的無標誌的實然範疇卻...

  2. Ciberespaço cubano: uma forma de resistência ao poder e à censura

    Directory of Open Access Journals (Sweden)

    Lia Hecker Luz

    2011-01-01

    Full Text Available A entrada do corpo e da vida nos cálculos do poder corresponde ao que Foucault chamou de biopolítica. Entretanto, o próprio Foucault intuiu que aquilo mesmo que o poder investia – a vida – era o que doravante ancoraria a resistência a ele. Assim, ao poder sobre a vida deveria responder a potência da vida, capaz de operar uma resistência possível ao sequestro da vida pelo poder. Apoiando-nos no pensamento de Lévy, levantamos a hipótese, a partir da análise do blog Generación Y, de que a blogosfera cubana é uma expressão micropolítica de resistência ao poder, de biopotência da multidão.

  3. Bicolumnar 90–90 plating of AO 13C type fractures

    National Research Council Canada - National Science Library

    Cemal Kural; Ersin Ercin; Mehmet Erkilinc; Evren Karaali; Mustafa Gokhan Bilgili; Suleyman Altun

    2017-01-01

    Objective: The aim of this study was to evaluate functional results and complication rate of patients who underwent medial-dorsolateral plating for intra-articular distal humeral fracture (Müller AO type 13C). Methods...

  4. Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses

    Directory of Open Access Journals (Sweden)

    Restle João

    2001-01-01

    Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.

  5. Attitude toward contraception and abortion among Curaçao women. Ineffective contraception due to limited sexual education?

    NARCIS (Netherlands)

    Brink, M.J.; Boersma, A.A.; Meyboom-deJong, B; Bruijn, de J.G.M.

    2011-01-01

    Background In Curaçao is a high incidence of unintended pregnancies and induced abortions. Most of the induced abortions in Curaçao are on request of the woman and performed by general practitioners. In Curaçao, induced abortion is strictly prohibited, but since 1999 there has been a policy of

  6. Te Ao Kori as Expressive Movement in Aotearoa New Zealand Physical Education Teacher Education (PETE): A Narrative Account

    Science.gov (United States)

    Legge, Maureen

    2011-01-01

    A unique aspect of Aotearoa/New Zealand physical education is the inclusion of Maori culture in the form of te ao kori. Te ao kori translates to mean the world of movement and is represented by the interpretation of indigenous movement, games and pastimes. Participation in te ao kori means the sports-based normative frame of reference for physical…

  7. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): Genotoxicity and sub-chronic studies

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  8. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): genotoxicity and sub-chronic studies.

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  9. Fatores associados ao baixo peso ao nascimento entre adolescentes no Sudeste do Brasil Factors associated with low birth weight among adolescents in the Brazil Southeast region

    Directory of Open Access Journals (Sweden)

    Fernanda Garanhani Castro Surita

    2011-10-01

    Full Text Available OBJETIVOS: Conhecer a prevalência e alguns fatores associados ao baixo peso ao nascer entre gestantes adolescentes. MÉTODOS: Estudo de corte transversal, realizado entre outubro de 1994 a dezembro de 2009, com os partos ocorridos em uma maternidade de Campinas, utilizando informações coletadas em uma Ficha Obstétrica Informatizada. Foram selecionados os casos de partos entre adolescentes e, posteriormente, separados em dois grupos com e sem baixo peso ao nascer. Foram calculados o risco relativo e o intervalo de confiança (IC de 95% para as variáveis independentes (fatores de risco, e calculou-se o teste do Χ2 para comparação dos resultados perinatais. Assumiu-se nível de significância de 5%. RESULTADOS: No período ocorreram 24.000 partos no Centro de Atenção à Saúde da Mulher (CAISM, com 2.404 em 2.357 adolescentes (10,02%, sendo a frequência de baixo peso ao nascer de 15,1%. A gestação neste grupo foi recorrente em 294 (8,2%. A idade menor que 15 anos, anemia, tabagismo e hipertensão não se associaram ao baixo peso ao nascer. O antecedente de aborto e a associação com lúpus eritematoso sistêmico elevaram o risco de baixo peso ao nascer. A necessidade de cesariana e o Apgar menor que sete também foram mais prevalentes entre as adolescentes com baixo peso ao nascer, e 85% das adolescentes realizaram menos de seis consultas durante o pré-natal. CONCLUSÕES: A prevalência de baixo peso ao nascer é maior entre as adolescentes do que na população geral. Também chamou a atenção o grande número de adolescentes com menos de seis consultas durante o pré-natal. O antecedente de aborto e a presença de lúpus eritematoso sistêmico foram fatores de risco para ocorrência de baixo peso ao nascer em gestantes adolescentes.PURPOSES: To determine the rate of low birth weight and some of the risk factors associated with this event among adolescents. METHODS: A cross-sectional study conducted between October 1994 and

  10. Functional analysis of AoAtg11 in selective autophagy in the filamentous fungus Aspergillus oryzae.

    Science.gov (United States)

    Tadokoro, Takayuki; Kikuma, Takashi; Kitamoto, Katsuhiko

    2015-07-01

    Autophagy is a highly conserved cellular degradation process in eukaryotes and consists of both non-selective and selective types. Selective autophagic processes include pexophagy, mitophagy, and the cytoplasm-to-vacuole targeting (Cvt) pathway of yeast, in which particular vacuolar proteins, such as aminopeptidase I (Ape1), are selectively transported to vacuoles. Although selective autophagy has been mainly studied in the yeasts Saccharomyces cerevisiae and Pichia pastoris, there is evidence for selective autophagy in filamentous fungi; however, the details are poorly understood. In S. cerevisiae, Atg11 is a selective autophagy-specific protein that recognizes and transports substrates to the pre-autophagosomal structure (PAS). Here, we first identified an ATG11 homologue in the filamentous fungus Aspergillus oryzae and analyzed the localization of the corresponding protein, designated AoAtg11, fused to enhanced green fluorescent protein (EGFP). Imaging analysis revealed that AoAtg11-EGFP was localized to PAS-like structures. We next constructed an Aoatg11 disruptant of A. oryzae and showed that AoAtg11 is involved in pexophagy and mitophagy. In addition, AoAtg11 was found to be dispensable for non-selective autophagy and for transporting AoApe1 to vacuoles. Taken together, these results suggest that AoAtg11 is a selective autophagy-specific protein in A. oryzae, and has distinct molecular functions from that of S. cerevisiae Atg11. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  11. History of the AO and its global effect on operative fracture treatment.

    Science.gov (United States)

    Matter, P

    1998-02-01

    In 1958 a group of Swiss general and orthopaedic surgeons established the AO (Arbeitsgemeinschaft für Osteosynthesefragen) or the Association of the Study of Internal Fixation (ASIF) to strive to transform the contemporary treatment of fractures in Switzerland. This association was revolutionary in development of instruments and implants for operative fracture treatment. The first instructional course for teaching the use of these instruments and implants occurred in Davos, Switzerland, in the newly founded Laboratory of Experimental Surgery in 1960. Through a process of internal quality control (AO documentation) the clinical success of these new techniques and implants became evident. Operative fracture treatment gained acceptance throughout Europe and finally worldwide. AO/International (AOI) was founded in 1972 to expand education and the teaching programs for surgeons and operating personnel on an international basis. In 1984, the AO/ASIF Foundation was created with an AO Board of Trustees comprising 90 leading trauma surgeons from throughout the world. Continuous research, implant and instrument development, clinical documentation, and multifaceted educational opportunities are coordinated by the AO/ASIF Foundation to maintain its position as the international authority in the treatment of trauma. The medical community recognizes today the enormous positive global effect that this respected and ever changing organization has had by continually improving operative fracture treatment.

  12. Building a reliable, scalable and affordable RTC for AO instruments on ELTs

    Science.gov (United States)

    Gratadour, Damien; Sevin, Arnaud; Perret, Denis; Brule, Julien

    2013-12-01

    Addressing the unprecedented amount of computing power needed by the ELTs AO instruments real-time controllers (RTC) is one of the key technological developments required for the design of the next generation AO systems. Throughput oriented architectures such as GPUs, providing orders of magnitude greater computational performance than high-end CPUs, have recently appeared as attractive and economically viable candidates since the fast emergence of devices capable of general purpose computing. However, using for real-time applications a I/0 device which cannot be scheduled nor controlled internally by the operating system but is sent commands through a closed source driver comes with a number of challenges. Building on the experience of almost real-time end-to-end simulations using GPUs, and relying on the development of the COMPASS platform, a unified and optimized framework for AO simulations and real-time control, our team has engaged into the development of a scalable, heterogeneous GPU-based prototype for an AO RTC. In this paper, we review the main challenges arising when utilizing GPUs in real-time systems for AO and rank them in terms of impact significance and available solutions. We present our strategy, to mitigate these issues including the general architecture of our prototype, the real-time core and additional dedicated components for data acquisition and distribution. Finally, we discuss the expected performance in terms of latency and jitter on the basis of realistic benchmarks and focusing on the dimensioning of the MICADO AO module RTC.

  13. TRATAMENTO DA CASCA DE QUEIJO CANASTRA COM RESINA E SEUS EFEITOS DURANTE A MATURAÇÃO E NA QUALIDADE COMO FORMA DE MELHORAR O ASPECTO E AGREGAR VALOR AO PRODUTO

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Costa Paiva

    2012-08-01

    aspecto global, cor, textura, consistência e sabor. Quanto às características microbiológicas dos queijos com e sem aplicação de resina na casca, após 15 dias de maturação, a diferença das contagens microbiológicas entre as quatro estações do ano não chegou a um ciclo logarítmico, exceto para mesófilos aeróbios e Staphylococcus aureus. Os coeficientes de variação referentes aos parâmetros microbiológicos dos queijos maturados por 15 dias, em relação às quatro estações do ano, apresentaram-se relativamente baixos, exceto para contagens de Staphylococcus aureus em queijos com e sem aplicação de resina na casca, e para contagem de coliformes totais em queijos sem aplicação de resina na casca. Após 15 dias de maturação, observou-se ausência de Listeria sp. e Salmonella sp. nos queijos com e sem aplicação de resina na casca, nas quatro estações do ano. Nos queijos com aplicação de resina na casca houve menor crescimento de mofos durante a maturação (45 dias em relação àqueles sem aplicação de resina, reduzindo-se as perdas com raspagens ("toalete" dos queijos durante esse período.

  14. Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item

    Directory of Open Access Journals (Sweden)

    Malvina Thais Pacheco Rodrigues

    2013-06-01

    Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.

  15. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited].

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-05-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered.

  16. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-01-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered. PMID:28663890

  17. Trends in antimicrobial resistance among clinical isolates of enterococci in a Brazilian tertiary hospital: a 4-year study Evolução da resistência aos antimicrobianos entre isolados clínicos de enterococos em um hospital terciário brasileiro: um estudo de 4 anos

    Directory of Open Access Journals (Sweden)

    Natália Conceição

    2011-04-01

    Full Text Available INTRODUCTION: In the past two decades members of the genus Enterococcus have emerged as important nosocomial pathogens worldwide. This study prospectively analyzed the distribution of species and trends in antimicrobial resistance among clinical isolates of enterococci in a Brazilian tertiary hospital from 2006-2009. METHODS: Enterococcal species were identified by conventional biochemical tests. The antimicrobial susceptibility profile was performed by disk diffusion in accordance with the Clinical and Laboratory Standards Institute (CLSI. A screening test for vancomycin was also performed. Minimal inhibitory concentration (MIC for vancomycin was determined using the broth dilution method. Molecular assays were used to confirm speciation and genotype of vancomycin-resistant enterococci (VRE. RESULTS: A total of 324 non-repetitive enterococcal isolates were recovered, of which 87% were E. faecalis and 10.8% E. faecium. The incidence of E. faecium per 1,000 admissions increased significantly (p 256µg/ mL and harbored vanA genes. The majority (89.5% of VRE belonged to E. faecium species, which were characteristically resistant to ampicillin and quinolones. Overall, ampicillin resistance rate increased significantly from 2.5% to 21.4% from 2006-2009. Resistance rates for gentamicin, chloramphenicol, tetracycline, and erythromycin significantly decreased over time, although they remained high. Quinolones resistance rates were high and did not change significantly over time. CONCLUSIONS: The data obtained show a significant increasing trend in the incidence of E. faecium resistant to ampicillin and vancomycin.INTRODUÇÃO: Nas últimas duas décadas, os enterococos emergiram como importantes patógenos nosocomiais no mundo inteiro. Neste estudo, foi analisada a distribuição das espécies e a evolução da resistência aos antimicrobianos entre isolados clínicos de enterococos obtidos em um hospital terciário, no período de 2006 a 2009. M

  18. Por que as pessoas recorrem ao Judiciário para obter o acesso aos medicamentos? O caso das insulinas análogas na Bahia

    OpenAIRE

    Lisboa, Erick Soares; Souza, Luis Eugenio Portela Fernandes de

    2017-01-01

    Resumo As insulinas análogas são alvo de controvérsias quanto à sua superioridade terapêutica em relação às humanas. Talvez, em parte, devido a isso, são objetos frequentes de ações judicias. A judicialização da saúde tem sido muito estudada, mas pouco se sabe sobre os motivos que levam as pessoas a recorrerem ao Judiciário para obter acesso a medicamentos no SUS. Sendo assim, o presente estudo tem por objetivo analisar os motivos que levaram as pessoas a recorrerem ao Judiciário para obter o...

  19. Dynamic SPECT of the brain using a lipophilic technetium-99m complex, PnAO

    DEFF Research Database (Denmark)

    Holm, S; Andersen, A R; Vorstrup, S

    1985-01-01

    The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-......AO has a high yet incomplete brain extraction yielding a flow dominated initial distribution with limitations mentioned.......The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-99......m PnAO was injected i.v. as a bolus of 15 to 25 mCi. The distribution was followed over 10-sec intervals using a highly sensitive, rapidly rotating SPECT (Tomomatic 64) and compared to 133Xe flow maps. Upon arrival of the PnAO bolus to the brain, a high uptake was found in brain tissue with high...

  20. Production of Alginate Oligosaccharides (AOS as Prebiotic Ingredients through by Alginate lyase enzyme

    Directory of Open Access Journals (Sweden)

    Fahriza Sri Afni

    2017-04-01

    Full Text Available Prebiotics is indigestible foods that can not be digested but can stimulate the growth and activity of bacteria in the digestive tract effecting human health. Alginate oligosaccharides (AOS can be used as a source of prebiotic. That compounds can be produced enzymatically by cutting long chain alginates using alginate lyase. The aim of this study was to produce alginate lyase enzyme then producing Alginate oligosaccharides (AOS as a prebiotic ingredients. The alginate lyase enzyme can be produced from Bacillus megaterium bacteria using a discontinuous fermentor. The enzyme was  optimum temperature of 45°C and an optimum pH of 7.0. Alginate oligosaccharides production was performed with the addition of different enzyme concentrations 25, 50, 75, and 100 U. The result of the addition of enzyme (25, 50,75 U showed that the value of polymerization degrees (DP were between 4-5. However, the addition of enzyme (100 U was in the range of  DP 3-4. Bacterial probiotic growth test results of Bifidobacteria and Lactobacillus showed that 1% added AOS media were able to increase the growth of probiotic bacteria compared to themedia without addition of AOS. The addition Alginate lyase activity of 50 U in AOS production is the best treatment of both probiotic bacteria.

  1. Morfologia e Crescimento dos 6 aos 10 anos de idade em Viana do Castelo, Portugal

    Directory of Open Access Journals (Sweden)

    Luis Paulo Rodrigues

    2008-09-01

    Full Text Available Ao longo de quatro anos, o Estudo Morfofuncional da Criança Vianense observou 1911 crianças entre os 6e os 10 anos de idade, resultando em 4064 observações individuais(2054 de raparigas, 2006 de rapazes.Os resultados encontrados nos indicadores morfológicos simples(altura, peso, pregas adiposas, diâmetros ósseos e perímetros muscularese no somatótipo, são descritos normativamente (valores percentílicose comparados com outros estudos nacionais e internacionais. As crianças vianenses demonstraram possuir uma estatura média ligeiramente superior às reportadas nos estudos portugueses e um ritmo de crescimento diferente das norte-americanas; peso semelhante ao das congéneres nacionais mas inferior ao das EUA; valores de pregas adiposas geralmente inferiores aos encontrados em Portugal e EUA; perímetros musculares e diâmetros ósseos semelhantes aos seus pares portugueses; e uma tendência para o aumento, com a idade, do ectomorfismo nos rapazes e do endomorfismo em ambos os sexos. Este panorama parece indicar que as crianças vianenses apresentam características de aptidão morfologia que estão longe de espelhar as preocupações internacionais nesta matéria.

  2. Relationship between winter AO/NAO and temperature in China: intraseasonal and interdecadal variations

    Science.gov (United States)

    Ren, Hong-Li; Zuo, Jinqing; Li, Weijing

    2017-04-01

    In this study, we focus on the intraseasonal and interdecadal variations in the relationship between winter AO/NAO (Arctic Oscillation / North Atlantic Oscillation) and surface air temperature (SAT) in China. On one hand, our results show that there is an intraseasonal contrast in impacts of AO/NAO on SAT in the central-southern China between early and mid-late winter. The linkage between AO and central-southern China SAT strongly depends on the AO-associated changes in Middle-East Jet Stream (MEJS) and the AO-MEJS relationship is significantly different between early and mid-late winter. On the other hand, our results also clearly show that inter-decadal changes have occurred in the relationship between the winter NAO and southern China surface air temperature anomalies in the past decades. A weak in-phase relationship occurred before the early 1970s, but a significant out-of-phase relationship dominated during 1979-1998, though it has been clearly weaker from the late 1990s onwards. Observational evidence shows that such interdecadal variations are mainly related to variations in the spatial pattern and amplitude of the NAO. The eastward shift and amplitude intensification of the NAO favored a north-south Asian dipole structure of circulation anomalies, which tended to produce cold SAT anomalies in central-southern China in the positive NAO phase and warm in the negative NAO phase.

  3. Toward an experimental validation of new AO concepts for future E-ELT instrumentation

    Science.gov (United States)

    El Hadi, K.; Fusco, T.; Le Roux, B.

    2012-07-01

    For the last few years, LAM has been carrying out several R&D activities in Adaptive Optics (AO) instrumentation for Extremely Large Telescopes (ELTs). In the European ELT framework, a multi-purpose AO bench is developed to allow the experimental validation of new instrumental concepts dedicated to the next generation of ELTs. It is based on the use of a Shack-Hartmann wave-front sensor in front of a 140 actuators micro-deformable mirror (Boston Micromachines), dedicated to “low orders” modes, while a Pyramid wave-front sensor (PWFS) will be combined to a Liquid Crystal Spatial Light Modulator for “high orders” correction. Both systems could be merged in a two stages AO concept allowing to study the coupling of a telescope pre-correction using a dedicated large M4 deformable mirror and a post focal high order AO system. Analysis and optimisation of the spatial and temporal splits of the AO correction between the two systems is therefore essential. Finally, we will use the world’s fastest and most sensitive camera system OCAM (developed at LAM) coupled with the pyramid , to demonstrate the concept of a fast and hyper-sensitive PWFS (up to 100x100 sub-pupils) dedicated to the first generation instruments for ELTs.

  4. Cantaria em louvação ao dia do Barroco Mineiro e homenagem ao poeta e ensaísta Affonso Ávila

    Directory of Open Access Journals (Sweden)

    Cristina Ávila

    2013-12-01

    Full Text Available É com profunda comoção que, em nome de minha família, agradeço a prestigiosa homenagem concedida pela Pontifícia Universidade Católica de Minas Gerais – PUCMinas e pela Assembleia Legislativa do Estado de Minas Gerais ao reconhecido e saudoso poeta e ensaísta do Barroco Mineiro, Affonso Ávila. O convite para a participação neste debate acadêmico, feito ao próprio homenageado pela Prof. Dra. Melânia da Silva Aguiar, foi recebido por ele com enorme entusiasmo, mas quis o destino que ele se fosse antes da data prevista. Como historiadora da arte e cultura estou presente apenas para contemplar alguns aspectos de sua obra, especialmente no que se refere aos estudos de Barroco, mas não posso substituir o depoimento do ensaísta que seria, com certeza, bem mais interessante.

  5. Práticas educativas maternas e paternas aos 24 e aos 72 meses de vida da criança

    Directory of Open Access Journals (Sweden)

    Angela Helena Marin

    Full Text Available Este estudo investigou as práticas educativas indutivas, coercitivas e de não interferência maternas e paternas aos 24 e 72 meses de vida da criança. Participaram 24 mães e pais de um único filho/a, que responderam uma entrevista para avaliação dessas práticas. Análises estatísticas revelaram que as mães foram significativamente mais indutivas que os pais aos 24 meses, mas aos 72 meses não houve diferenças. Enfatiza-se que as mães tendem a conversar mais com seus filhos/as, expressar sentimentos, opiniões, estabelecer limites e elogiar comportamentos adequados. As mães também apresentaram médias mais elevadas no total de práticas relatadas, o que pode ser explicado pelo papel predominante que ainda exercem na socialização infantil, embora os pais venham participando mais da educação dos filhos/as.

  6. Up-Regulated Expression of AOS-LOXa and Increased Eicosanoid Synthesis in Response to Coral Wounding

    Science.gov (United States)

    Lõhelaid, Helike; Teder, Tarvi; Tõldsepp, Kadri; Ekins, Merrick; Samel, Nigulas

    2014-01-01

    In octocorals, a catalase–like allene oxide synthase (AOS) and an 8R-lipoxygenase (LOX) gene are fused together encoding for a single AOS-LOX fusion protein. Although the AOS-LOX pathway is central to the arachidonate metabolism in corals, its biological function in coral homeostasis is unclear. Using an acute incision wound model in the soft coral Capnella imbricata, we here test whether LOX pathway, similar to its role in plants, can contribute to the coral damage response and regeneration. Analysis of metabolites formed from exogenous arachidonate before and after fixed time intervals following wounding indicated a significant increase in AOS-LOX activity in response to mechanical injury. Two AOS-LOX isoforms, AOS-LOXa and AOS-LOXb, were cloned and expressed in bacterial expression system as active fusion proteins. Transcription levels of corresponding genes were measured in normal and stressed coral by qPCR. After wounding, AOS-LOXa was markedly up-regulated in both, the tissue adjacent to the incision and distal parts of a coral colony (with the maximum reached at 1 h and 6 h post wounding, respectively), while AOS-LOXb was stable. According to mRNA expression analysis, combined with detection of eicosanoid product formation for the first time, the AOS-LOX was identified as an early stress response gene which is induced by mechanical injury in coral. PMID:24551239

  7. Physical properties of the Algol-type eclipsing binary AO Ser

    Science.gov (United States)

    Chehlaeh, N.; Lampens, P.; Mkrtichian, D.; Van Cauteren, P.; Vermeylen, L.; Komonjinda, S.

    2017-09-01

    We present the results of a combined analysis of photometric time series and spectroscopic observations for the semi-detached eclipsing binary AO Ser aimed to study physical parameters of the system. New CCD photometric light curves in the B and V bands and radial velocities of AO Ser are presented. The Wilson-Devinney technique was used to simultaneously analyze the light and radial velocity curves for determining a new set of the system’s parameters. The solution shows that AO Ser is a semi-detached eclipsing binary system with a mass ratio of 0.183 ± 0.003, an inclination of 89.42 ± 0.04 degrees and a secondary star’s temperature of 4900 K.

  8. A Arqueologia do cuidado: da prática ao discurso

    Directory of Open Access Journals (Sweden)

    Sidi Askofare

    2006-06-01

    Full Text Available A noção de cuidado, assimilada há muito tempo ao tratamento e, então, ao conceito de terapêutica, retorna, logo depois, nos estudos, pesquisas e reflexões nas ciências humanas. Mas, daí em diante, está emancipado de suas aderências e conotações médicas por serem demasiadamente redutoras. O presente artigo propõe uma arqueologia (no sentido foucaultiano do cuidado &– de suas origens animais às suas formas culturalmente e historicamente definidas &– e põe em evidência a subversão que produz no campo do cuidado &– das práticas aos discursos &– a emergência e a dominação do discurso da ciência.

  9. O Ocaso da Utopia Telecomunicacional: regular para quem no tocante ao Direito Fundamental à Privacidade?

    Directory of Open Access Journals (Sweden)

    Conselho Editorial

    2014-05-01

    Full Text Available O presente estudo figura como introdução à Revista de Direito, Estado e Telecomunicações do Grupo de Estudos em Direito das Telecomunicações da Universidade de Brasília, abordando sinteticamente a estrutura, conteúdo e política editorial da revista. Em acréscimo, o texto analisa os principais acontecimentos do setor no Brasil, bem como normas e julgados relativos ao ano de 2013, para registro das principais discussões político-jurídicas do setor de telecomunicações brasileiro referentes ao ano anterior ao da publicação.

  10. Sensibilidade de laranjeiras-doces ao deficit hídrico

    OpenAIRE

    Ramos, Yuri Caires; Mourão Filho, Francisco de Assis Alves; Stuchi, Eduardo Sanches; Sentelhas, Paulo Cesar; Fadel, André Luiz

    2016-01-01

    Resumo: O objetivo deste trabalho foi avaliar a sensibilidade ao deficit hídrico de 17 seleções de laranja-doce enxertadas sobre tangerineira 'Sunki', ao longo de cinco safras. Empregou-se um modelo agrometeorológico de penalização da produtividade pelo deficit hídrico, tendo-se avaliado a relação entre os valores estimados e observados. As seleções podem ser classificadas como de alta, média e baixa sensibilidade ao deficit hídrico, classificação que é inédita para as condições brasileiras. ...

  11. ESTUDO DE PROBLEMAS DE ENFERMAGEM REFERENTES AO CABELO E COURO CABELUDO EM PACIENTES HOSPITALIZADOS

    Directory of Open Access Journals (Sweden)

    Maria Romana Friedlander

    Full Text Available A autora procurou identificar os tipos e os problemas de enfermagem referentes ao cabelo e couro cabeludo, apresentados por pacientes internados em clínicas médicas e cirúrgicas gerais de um hospital governamental de ensino. Identificou 4 classes de problemas: estado de limpeza, lesões, infestações e penteação. Cada classe foi subdividida em graus os quais foram denominados tipos de problemas. A proporção de problemas por paciente encontrada foi 0,80 e a proporção de pacientes com problemas foi 58%. Foram também estudadas algumas condições que podem intervir no cuidado ao cabelo e ao couro cabeludo e foram obtidas informações sobre hábitos e costumes apresentados pelos pacientes.

  12. A Exposição ao Risco das Famílias

    OpenAIRE

    Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  13. Obtenção de plantas de feijão-caupi resistentes ao Cowpea severe mosaic virus e ao Cowpea aphid-borne mosaic virus

    Directory of Open Access Journals (Sweden)

    Gislanne Brito Barros

    2013-06-01

    Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.

  14. Fatores associados ao tempo de espera e ao acesso ao transplante renal em Belo Horizonte, Minas Gerais, Brasil Factors associated with waiting time and access to kidney transplants in Belo Horizonte, Minas Gerais State, Brazil'

    Directory of Open Access Journals (Sweden)

    Elaine Leandro Machado

    2012-12-01

    Full Text Available O objetivo deste artigo foi analisar os fatores associados ao acesso ao transplante renal com doador vivo e cadáver em Belo Horizonte, Minas Gerais, Brasil. Foi realizado um estudo de coorte não concorrente com pacientes inscritos na lista de espera por transplante renal, entre 2000 e 2004, os quais foram acompanhados até o transplante, óbito, exclusão ou permanência na fila de espera ao fim do estudo em 31 de dezembro de 2005. Utilizou-se o modelo de Cox para riscos competitivos. Dos 835 pacientes, 22,7% foram transplantados. Apresentaram menor risco de transplante por doador cadáver e vivo os pacientes com maior tempo em diálise e tipo sanguíneo O. Observou-se menor risco de transplante intervivos para residentes em uma área de alto risco à saúde e portadores de diabetes. A maior disparidade de acesso foi para transplante renal intervivos, uma vez que não houve diferenças sociodemográficas significativas para transplante por doador cadáver. Pode-se inferir que o sistema de alocação de órgãos contribuiu para amenizar desigualdades sociodemográficas, sendo as questões clínicas mais relevantes no acesso ao transplante com doador cadáver.The objective of this study was to analyze factors associated with access to kidney transplants from living and cadaver donors in Belo Horizonte, Minas Gerais State, Brazil. The authors conducted a non-concurrent cohort study of patients on the waiting list for kidney transplants from 2000 to 2004 and followed until transplantation, death, exclusion, or continued presence on the line at the end of the study on December 31, 2005. The Cox model was used for competing risks. Of the 835 patients, 22.7% were transplanted. Lower risk of transplantation from living donors and cadavers was observed in patients with more time on dialysis and blood type O. Lower risk of transplantation from living donors was observed in residents in a high health risk area and in recipients with diabetes. The

  15. Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Santos Saldanha

    Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.

  16. Novel algorithm implementations in DARC: the Durham AO real-time controller

    Science.gov (United States)

    Basden, Alastair; Bitenc, Urban; Jenkins, David

    2016-07-01

    The Durham AO Real-time Controller has been used on-sky with the CANARY AO demonstrator instrument since 2010, and is also used to provide control for several AO test-benches, including DRAGON. Over this period, many new real-time algorithms have been developed, implemented and demonstrated, leading to performance improvements for CANARY. Additionally, the computational performance of this real-time system has continued to improve. Here, we provide details about recent updates and changes made to DARC, and the relevance of these updates, including new algorithms, to forthcoming AO systems. We present the computational performance of DARC when used on different hardware platforms, including hardware accelerators, and determine the relevance and potential for ELT scale systems. Recent updates to DARC have included algorithms to handle elongated laser guide star images, including correlation wavefront sensing, with options to automatically update references during AO loop operation. Additionally, sub-aperture masking options have been developed to increase signal to noise ratio when operating with non-symmetrical wavefront sensor images. The development of end-user tools has progressed with new options for configuration and control of the system. New wavefront sensor camera models and DM models have been integrated with the system, increasing the number of possible hardware configurations available, and a fully open-source AO system is now a reality, including drivers necessary for commercial cameras and DMs. The computational performance of DARC makes it suitable for ELT scale systems when implemented on suitable hardware. We present tests made on different hardware platforms, along with the strategies taken to optimise DARC for these systems.

  17. Deep-water sponges (Porifera) from Bonaire and Klein Curaçao, Southern Caribbean.

    Science.gov (United States)

    Van Soest, Rob W M; Meesters, Erik H W G; Becking, Leontine E

    2014-10-29

    Four submersible dives off the coast of Bonaire (Caribbean Netherlands) and Klein Curaçao (Curaçao) to depths of 99.5-242 m, covering lower mesophotic and upper dysphotic zones, yielded 52 sponge specimens belonging to 31 species. Among these we identified 13 species as new to science. These are Plakinastrella stinapa n. sp., Pachastrella pacoi n. sp., Characella pachastrelloides n. sp., Geodia curacaoensis n. sp., Caminus carmabi n. sp., Discodermia adhaerens n. sp., Clathria (Microciona) acarnoides n. sp., Antho (Acarnia) pellita n. sp., Parahigginsia strongylifera n. sp., Calyx magnoculata n. sp., Neopetrosia dutchi n. sp., Neopetrosia ovata n. sp. and Neopetrosia eurystomata n. sp. We also report an euretid hexactinellid, which belongs to the rare genus Verrucocoeloidea, recently described (2014) as V. liberatorii Reiswig & Dohrmann. The remaining 18 already known species are all illustrated by photos of the habit, either in situ or 'on deck', but only briefly characterized in an annotated table to confirm their occurrence in the Southern Caribbean. The habitat investigated-steep limestone rocks, likely representing Pleistocene fossil reefs--is similar to deep-water fossil reefs at Barbados of which the sponges were sampled and studied by Van Soest and Stentoft (1988). A comparison is made between the two localities, showing a high degree of similarity in sponge composition: 53% of the present Bonaire-Klein Curaçao species were also retrieved at Barbados. At the level of higher taxa (genera, families) Bonaire-Klein Curaçao shared approximately 80% of its lower mesophotic and upper dysphotic sponge fauna with Barbados, despite a distance between them of 1000 km, indicating high faunal homogeneity. We also preliminarily compared the shallow-water (euphotic) sponge fauna of Curaçao with the combined data available for the Barbados, Bonaire and Klein Curaçao mesophotic and upper dysphotic sponges, which resulted in the conclusion that the two faunas show only

  18. Adesão ao Tratamento em Gestação de Alto Risco

    Directory of Open Access Journals (Sweden)

    Fabíola Langaro

    Full Text Available No Brasil, aproximadamente 15% das gestações são de alto risco, sendo os diagnósticos de diabetes gestacional e hipertensão as causas mais frequentes dessa condição. Para a efetividade dos tratamentos indicados nesses casos, bem como alcance de desfechos favoráveis, é essencial a adesão da paciente às recomendações fornecidas pelas equipes de saúde, o que torna fundamental a avaliação desse indicador. A pesquisa apresentada avaliou a adesão de participantes de um programa de atendimento interdisciplinar a gestantes de alto risco desenvolvido em um hospital geral privado por meio de três instrumentos: Questionário Morisky-Green de adesão ao uso de medicação, Questionário de Adesão ao Tratamento e Pergunta descritiva de avaliação qualitativa. Durante oito meses, 83 gestantes responderam aos questionários, que possibilitaram identificar níveis de adesão ao longo do tempo de participação no programa, situações de não adesão mais frequentes, bem como variáveis que interferem nas medidas de adesão ao uso de medicação e ao tratamento global. Considera-se que os índices levantados são passíveis de uso como indicadores clínicos e gerenciais, possibilitando a comprovação da efetividade e melhoria constante das rotinas de saúde. Tais mecanismos são úteis para definição de protocolos, discussão de casos clínicos e mesmo para feedbackàs próprias pacientes.

  19. Ressalto no canto posteromedial do joelho relacionado ao músculo sartório

    Directory of Open Access Journals (Sweden)

    Marcello Henrique Nogueira-Barbosa

    2011-06-01

    Full Text Available As causas da síndrome de ressalto no joelho relatadas com maior frequência são relacionadas a anormalidades meniscais, ao tendão do músculo bíceps femoral e aos tendões grácil e semitendíneo. Neste trabalho é descrito um caso de ressalto no canto posteromedial relacionado à junção miotendínea do músculo sartório em um paciente do sexo masculino, de 58 anos de idade, com hiperextensão do joelho.

  20. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  1. The Ashkenazi Jews of Curaçao, a trading minority

    Directory of Open Access Journals (Sweden)

    Eva Abraham-Van der Mark

    2000-07-01

    Full Text Available First describes the early Sephardi presence in Curaçao, the arrival of the Ashkenazi in the 20th c., and the relations between these 2 groups. Author goes on to discuss the Ashkenazis' economic success and the exodus of the 1980s. She asks whether the success and the exodus can be attributed to the characteristics of the group itself or whether conditions and developments in Curaçao account for economic fortune and the departure of the Ashkenazi.

  2. A MEMÕRIA DE JESUS E A MANVFESTAÇAO DO PAI NO QUARTO EVANGELHO

    Directory of Open Access Journals (Sweden)

    Johan Konings

    1988-01-01

    Full Text Available Não somos os primeiros a constatar que as cristologias narrativas pouco se inspiram no Quarto Evangelho (QE, tanto na atual teologia latino-americana como na europeia, de E. Schillebeeckx, por exemplo. Entretanto, as cristologias especulativas usam amplamente pelo menos o prólogo de João como ponto de partida para suas especulações. Será que este tratamento faz jus ao QE, ou repousa num preconceito espiritualista com relação ao evangelho que Clemente de Alexandria chamou de "espiritual"?

  3. [Study on Provenance of Kraak Porcelains from "Nan'ao I" Shipwreck].

    Science.gov (United States)

    Du, Jing-nan; Chen, Yue; Li, Nai-sheng; Ming, Chao-fang; Zhu, Jian; Luo, Wu-gan

    2015-06-01

    The "Kraak Porcelain" was a kind of Blue and White Porcelain which exported from China to Europe in Ming and Qing period. The study of Kraak Porcelain is a focus issue in international field of porcelain research. In 2007, the discovery of "Nan'ao I" Shipwreck of Ming Dynasty and the porcelains loaded in it, provided precious materials for the research on Kraak Porcelain. In this paper, we explored the provenance of 10 Kraak Porcelain samples from Nan'ao I, using both traditional visual method and WDXRF.

  4. Resistência ao Consumo em um Circuito Urbano de Parkour

    Directory of Open Access Journals (Sweden)

    Tatiana Maria Bernardo da Silva

    2011-08-01

    Full Text Available A partir de uma pesquisa alinhada ao método etnográfico, o presente trabalho tem por objetivo investigar os valores e as práticas de resistência ao consumo adotadas pelos membros de um circuito urbano de parkour no Rio de Janeiro. Confiando em uma abordagem indutiva e interpretativa amparada por um estudo empírico de base qualitativa, foram exploradas quatro categorias de análise: (1 a resistência como valor essencial; (2 um percurso de doação; (3 o consumo aprisiona; e (4 mobilização social e resistência.

  5. COMPORTAMENTO ÉTICO E CRÍTICA AO PRECONCEITO BURGUÊS

    OpenAIRE

    Carli, Ranieri

    2014-01-01

    Este artigo procura delinear os componentes mais elementares de uma ética marxista, para então focar na lacuna que há entre o preconceito, que se atém àquilo que existe de particular e imediato no homem, e o comportamento de natureza essencialmente ética, que se eleva à generalidade. A intenção é demonstrar como o preconceito limita-se ao chão raso do cotidiano, ao passo que, no polo oposto, a ética supera-o, purificando o homem singular rumo à universalidade genérica. Enfim, tomaremos alguns...

  6. Posicionamentos skinnerianos quanto ao uso do controle aversivo pelas agências de controle

    OpenAIRE

    Bruna Del Giudice Machado Godinho

    2011-01-01

    O campo de estudo, denominado controle aversivo, é constituído pelas contingências de reforçamento negativo e de punição positiva e negativa. O uso do controle aversivo tem sido alvo de muitas críticas dentro da comunidade científica. As críticas às contingências aversivas, normalmente, são dirigidas aos subprodutos emocionais que se mostram prejudiciais às pessoas controladas e ao poder positivamente reforçador que essas contingências exercem sobre os controladores. Por isso, Skinner normalm...

  7. Perfil das atitudes de formandos em enfermagem frente aos transtornos mentais no Brasil, Chile e Peru

    OpenAIRE

    Luiz Jorge Pedrão; Sueli Aparecida Frari Galera; Maria Concepcion Pezo Silva; Angelica Cazenave Gonzalez; Moacyr Lobo da Costa Júnior; Souza,Maria Conceição Bernardo de Mello e; Gricelda Uceda Senmache

    2005-01-01

    Este estudo teve por objetivo traçar um perfil de atitudes de formandos em enfermagem frente aos transtornos mentais em três culturas diferentes: Brasil, Chile e Peru. Para isso foi utilizada a escala de opiniões sobre a doença mental. Os resultados mostraram diferenças estatisticamente significantes no nível de 5% nos fatores autoritarismo, ideologia de higiene mental, restrição serial e visão minoritária, favoráveis aos estudantes brasileiros. No fator etiologia interpessoal, os resultados ...

  8. Imunidade celular em caninos neonatos - do nascimento ao 45° dia de idade

    Directory of Open Access Journals (Sweden)

    R.P. Klein

    2014-06-01

    Full Text Available O objetivo do presente trabalho foi acompanhar o desenvolvimento imunológico dos neonatos caninos, a fim de avaliar a imunidade celular pela análise dos leucócitos e linfócitos totais e das subpopulações de linfócitos T (CD4+ e CD8+ pela técnica de citometria de fluxo. Foram utilizados 30 cães neonatos de ambos os sexos, sem raça definida, aos três, 10, 17, 24, 31, 38 e 45 dias de idade. A contagem de leucócitos totais aos 45 dias (11.639±3.574 foi significativamente maior que no terceiro dia de idade (8.740±1.812 (P<0,05; não houve diferença entre a contagem total de linfócitos aos 45 dias em relação ao terceiro dia de idade. Quanto às subpopulações de LT CD4+ e LT CD8+, os percentuais de LT CD4+, aos três dias de idade (24,9±16,8%, foram inferiores quando comparados à média entre o 10°, o 24° e o 31°dia (35,5%, e os de CD8+, ao terceiro dia, menores em relação às médias do 10° e do 31° dia de idade. Pode-se concluir que as subpopulações de LT CD4+ e CD8+ sofrem oscilações durante o desenvolvimento pós-natal, sendo estas crescentes em relação aos níveis obtidos aos três dias de idade. A relação CD4+:CD8+ mostrou superioridade para o primeiro tipo celular, sendo que a maior relação entre CD4+ e CD8+ ocorreu no terceiro dia de idade. Com base nos resultados obtidos neste estudo, notaram-se as diferenças semanais nas populações linfocitárias, o que demonstra a dinâmica dessas células durante o período neonatal.

  9. Características individuais e contextuais associadas ao bullying entre escolares no Brasil

    OpenAIRE

    Catarina Machado Azeredo

    2015-01-01

    O bullying escolar é um importante problema de saúde pública que vem sendo extensivamente estudado em países de alta renda. Nos países de baixa e média renda, características individuais e contextuais associadas ao bullying são pouco conhecidas. A presente tese é composta por três estudos. O estudo 1 objetivou realizar revisão sistemática sobre fatores contextuais associados ao bullying escolar. A busca utilizou as bases de dados MEDLINE, PsychInfo, Web of Knowledge e SciELO. Trinta e um estu...

  10. Adesão ao tratamento clínico no transtorno de personalidade borderline

    OpenAIRE

    Tanesi,Patrícia Helena Vaz; Yazigi,Latife; Fiore,Maria Luiza de Mattos; Pitta,José Cássio do Nascimento

    2007-01-01

    Adesão é um comportamento complexo, envolve desde pequenas recusas ao tratamento até o uso inadequado dos serviços de saúde e abandono do tratamento. O presente trabalho é um estudo qualitativo com seis pacientes com transtorno de personalidade borderline sobre adesão ao tratamento, utilizando análise qualitativa em entrevista aberta, questionário psicossocial, classificação diagnóstica pela SCID I e II e acompanhamento clínico. Os resultados mostraram que impulsividade, manipulação, dissocia...

  11. Déjà Vu: tradução assistida ao pormenor.

    Directory of Open Access Journals (Sweden)

    Leonel Morgado

    2004-01-01

    Full Text Available No campo da tradução assistida por computador, apresenta-se aqui o programa Déjà Vu. Entre outras características interessantes, este programa possui uma funcionalidade fundamental e pioneira, que contribui significativamente para a melhoria do desempenho, da coerência e da rapidez do trabalho de tradução: o reaproveitamento automático de partes de expressões, não apenas de expressões inteiras. O tradutor pode, rapidamente, enviar para a memória de tradução pares linguísticos tão simples como uma simples palavra e a respectiva tradução, não apenas frases inteiras. À medida que o programa Déjà Vu recebe os pares, passa a utilizá-los para traduzir pedaços das frases e expressões que vão surgindo, não apenas frases inteiras (se o tradutor preferir, o Déjà Vu pode apenas sugerir as traduções, em vez de as aplicar. Desta forma, o tradutor é apoiado automaticamente, mas não apenas na terminologia e nos casos de repetição de frases, como é mais habitual. Pode passar a ter apoio relativamente às formas que utiliza para expressões ou combinações de palavras que se revelem frequentes num projecto específico, ainda que não sejam suficientemente relevante para integrar glossários ou outras bases de dados terminológicas.

  12. Doença periodontal materna como fator associado ao baixo peso ao nascer Maternal periodontal disease as a factor associated with low birth weight

    Directory of Open Access Journals (Sweden)

    Simone Seixas da Cruz

    2005-10-01

    Full Text Available OBJETIVO: Estudos recentes têm apresentado evidências de que a doença periodontal em gestantes pode ser um dos determinantes do baixo peso ao nascer. Realizou-se estudo para verificar a existência de associação entre doença periodontal materna e baixo peso ao nascer. MÉTODOS: Estudo do tipo caso-controle com 302 mulheres, sendo 102 mães de nascidos vivos de baixo peso (grupo caso e 200 mães de nascidos vivos com peso normal (grupo controle. A existência de associação entre doença periodontal e baixo peso ao nascer foi avaliada mediante modelo multivariado de regressão logística, considerando outros fatores de risco para o baixo peso. RESULTADOS: Ambos os grupos de mães eram comparáveis no que se refere a idade, altura, peso pré-gestacional, tabagismo, alcoolismo, doenças prévias, estado civil, situação socioeconômica, número de escovações e uso de fio dental, número de refeições diárias, e visitas ao dentista. A doença periodontal foi diagnosticada em 57,8% das mães do grupo caso e 39,0% do grupo controle. A análise de regressão logística indicou associação positiva entre doença periodontal e baixo peso ao nascer (ORbruto=2,15; IC 95%: 1,32-3,48, especialmente entre as mães com escolaridade menor ou igual a quatro anos (ORajustada=3,98; IC 95%: 1,58-10,10. CONCLUSÕES: A doença periodontal é um possível fator de risco para o baixo peso ao nascer.OBJECTIVE: Recent studies have presented evidence that periodontal disease in pregnant women may be a determining factor for low birth weight. The present investigation was carried out to verify whether or not there is an association between maternal periodontal disease and low birth weight. METHODS: This was a case-control study on 302 women, of whom 102 were the mothers of live newborns of low weight (case group and 200 were the mothers of live newborns of normal birth weight (control group. The existence of an association between periodontal disease and low

  13. Perfil de clientes colostomizados inscritos em programa de atenção aos estomizados

    National Research Council Canada - National Science Library

    Mara Rúbia Violin; Thais Aidar de Freitas Mathias; Taqueco Teruya Uchimura

    2008-01-01

    ..., exploratório, de natureza quantitativa, foi o de identificar o perfil do paciente colostomizado, inscrito no Programa de Atenção ao Estomizado – PAE, da 15ª Regional de Saúde do Paraná...

  14. Rituais aos Mortos da Tradi��o do Batuque e do Candombl�

    OpenAIRE

    de Oliveira, Ricardo Moreira

    2013-01-01

    Resumo: este artigo se prop�e apresentar os rituais dedicados aos mortos na tradi��o do Batuque afro-riograndense, do Candombl� e os raros templos Egungun do Brasil, bem como os procedimentos de desenlace de iniciados nos cultos de matriz africana referidos. Palavras-chave: Egun. Antepassados. Axex�. Aressum. Morte.

  15. Eu gosto da escola: um estudo sobre o apego ao ambiente escolar

    Directory of Open Access Journals (Sweden)

    Pollyana Verissimo de Araújo

    Full Text Available Resumo O presente artigo teve como objetivo analisar o nível de apego dos alunos ao ambiente escolar. Para tanto, adotou-se a perspectiva da relação pessoa-ambiente que busca contribuir para a vertente institucional da psicopedagogia. Participaram do estudo 200 alunos do ensino médio, com idade média de 15,15 (DP=0,98, igualmente distribuídos entre escolas públicas e privadas de uma capital nordestina. Estes responderam à Escala Apego ao Lugar, além de questões sociodemográficas. As análises indicaram que o nível de apego à escola foi considerável em relação ao esperado, evidenciando uma diferença significativa do nível de apego ao lugar em função do tipo de sistema de ensino (t(191 = -2,205; p≤0,03, com destaque para a escola privada (M= 3,36; DP= 0,603. Com base nesses resultados, foi possível discutir a necessidade de desenvolver estratégias voltadas para promoção de identidade com a escola, percepção da escola como comunidade e atitudes positivas frente à escola.

  16. General cognitive distortions and body satisfaction : Findings from the Netherlands and Curaçao

    NARCIS (Netherlands)

    Dijkstra, Pieternel; Barelds, Dick; Van Brummen-Girigori, Odette

    2017-01-01

    The present study examined ten cognitive distortions, as assessed by the Cognitive Distortions Scale (CDS), and their relations to body satisfaction among young women living in The Netherlands (n = 152) and Curaçao (a former colony of the Netherlands; n = 160). Findings showed that, in general,

  17. High prevalence of dermal parasites among coral reef fishes of Curaçao

    NARCIS (Netherlands)

    Bernal, M.A.; Floeter, S.R.; Gaither, M.R.; Longo, G.O.; Morais, R.; Ferreira, C.E.L.; Vermeij, M.J.A.; Rocha, L.A.

    2016-01-01

    During expeditions to Curaçao in August and October of 2013, a large number of fish infected with dermal parasites was observed. Infected individuals presented black spots and white blemishes on their skin and fins that were easily observed by divers, and which have been associated with infections

  18. On the radulae and spines of some Polyplacophora and Archaeogastropoda from Curaçao

    NARCIS (Netherlands)

    Righi, Gilberto

    1968-01-01

    During her stay at Curaçao from December 1965 to March 1966 Prof. Dr. DIVA DINIZ CORRÊA collected several groups of marine invertebrates. I should like to thank her for having entrusted me with the Polyplacophora and Archaeogastropoda for further study of radulae and spines.

  19. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    2014-12-17

    Dec 17, 2014 ... In this study, the performance of different aluminium hydroxide–based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and ...

  20. Molecular Evidence for Dissemination of Unique Campylobacter jejuni Clones in Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Duim, B.; Godschalk, P.C.R.; Braak, N. van den; Dingle, K.E.; Dijkstra, J.R.; Leyde, E.; Plas, J. van der; Colles, F.M.; Endtz, H.P.; Wagenaar, J.A.; Maiden, M.C.J.; Belkum, A. van

    2003-01-01

    Campylobacter jejuni isolates (n = 234) associated with gastroenteritis and the Guillain-Barré syndrome (GBS) in the island of Curaçao, Netherlands Antilles, and collected from March 1999 to March 2000 were investigated by a range of molecular typing techniques. Data obtained by pulsed-field gel

  1. A new species of the Rodent Baiomys from Aruba and Curaçao

    NARCIS (Netherlands)

    Husson, A.M.

    1960-01-01

    In his paper on the mammals of the islands of Aruba, Curaçao, and Bonaire (situated off the north coast of Venezuela), WAGENAAR HUMMELINCK (1940 a, p. 69) mentioned a juvenile specimen of a cricetine rodent which was identified by Mr. M. A. C. HINTON and Mr. R. W. HAYMAN as probably belonging to the

  2. Exposição ao vivo no tratamento de agorafobia: relato de caso

    Directory of Open Access Journals (Sweden)

    Gustavo J. Fonseca D'El Rey

    Full Text Available Relato de caso, em que a Exposição ao Vivo foi utilizada no tratamento de paciente com diagnóstico de agorafobia. O tratamento foi realizado em doze sessões, apresentando êxito no uso dessa técnica comportamental.

  3. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    In this study, the performance of different aluminium hydroxide.based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and pseudoboehmite (PB).

  4. Long-term functional outcome of mandibular reconstruction with stainless steel AO reconstruction plates

    NARCIS (Netherlands)

    van Minnen, B; Nauta, JM; Vermey, A; Bos, RRM; Roodenburg, JLN

    Mandibular continuity defects are usually reconstructed with bone grafts. However, factors associated with the tumour and the patient can still be reasons to choose reconstruction plates. The aim of this study was to find out the results of mandibular reconstructions with stainless steel AO

  5. The groundwater quality of Aruba, Bonaire and Curaçao: a hydrogeochemical study

    NARCIS (Netherlands)

    Sambeek, M.H.G. van; Eggenkamp, H.G.M.; Vissers, M.J.M.

    2000-01-01

    Groundwater resources on the Caribbean Islands of Aruba, Bonaire and Curaçao are limited and of poor quality. The groundwater of the islands is brackish, due to both seawater mixing and the semi-arid climate of the islands.Two hundred and thirty water samples were collected to relate chemical

  6. Social behavior of the Paguridae and Diogenidae of Curaçao

    NARCIS (Netherlands)

    Hazlett, Brian A.

    1966-01-01

    1. The social behavior patterns of twelve species of hermit crabs found in the waters around Curaçao, N.A. are described. All species showed marked similarity in their aggressive displays, the most common of which are movements of the appendages, called here the ambulatory raise and cheliped

  7. Do afro-americanismo ao caucasianismo: um convertido discute o cristianismo ocidental

    Directory of Open Access Journals (Sweden)

    Edison Minami

    2015-04-01

    Foi a partir dessas ideias de fundo que iniciei a leitura do livro de Alex e Donna Jones, Não tem preço. O livro – na verdade são dois textos, um do marido e outro da esposa – relatos da conversão de dois afro-americanos pentecostais ao catolicismo.

  8. Eutrophication threatens Caribbean seagrasses – An example from Curaçao and Bonaire

    NARCIS (Netherlands)

    Govers, L.L.; Lamers, L.P.M.; Bouma, T.J.; de Brouwer, J.H.F.; van Katwijk, M.M.

    2014-01-01

    Seagrass beds are globally declining due to human activities in coastal areas. We here aimed to identify threats from eutrophication to the valuable seagrass beds of Curaçao and Bonaire in the Caribbean, which function as nursery habitats for commercial fish species. We documented surface- and

  9. The complexity of national identity Construction in Curaçao, Dutch Caribbean

    Directory of Open Access Journals (Sweden)

    Rose Mary Allen

    2010-10-01

    Full Text Available Curaçao, one of the five islands of the Dutch Caribbean federation called the Netherlands Antilles, currently stands at a crossroad of constitutional reform. In the context of these changes at the political level, it is logical that national identities are being redefined and repositioned. The developments in the fashioning of national identities in Curaçao deserve attention locally but also regionally. How do people in Curaçao construct national identities in daily life? How is a national collective constructed on the one hand, and how are differences with other collectivities constructed on the other hand? The historical context of constitutional changes that have occurred over the years is considered as well as an examination of the present discourse on constitutional reform. These identity issues are then placed within a wider Caribbean context.  Resumen: La complejidad de la construcción de la identidad nacional en Curaçao,en el Caribe holandés Curaçao, una de las cinco islas de la federación caribeña neerlandesa llamada Antillas Holandesas, se encuentra hoy en día en una encrucijada de reformas constitucionales. En el contexto de estos cambios a nivel político, es lógico que las identidades nacionales sean redefinidas y reposicionadas. Los desarrollos en la formulación de identidades nacionales en Curaçao merecen atención local, y también regional. ¿Cómo construye la gente en Curaçao identidades nacionales en la vida cotidiana? ¿Cómo, por un lado, se construye el colectivo nacional y, por otro, cómo se construyen las diferencias con otras colectividades? En este análisis se estudia el contexto histórico de los cambios constitucionales que han ocurrido en el curso del tiempo y se realiza igualmente una revisión del actual discurso sobre la reforma constitucional. Estos problemas de identidad son analizados entonces en un contexto caribeño más amplio.

  10. Improved tilt sensing in an LGS-based tomographic AO system based on instantaneous PSF estimation

    Science.gov (United States)

    Veran, Jean-Pierre

    2013-12-01

    Laser guide star (LGS)-based tomographic AO systems, such as Multi-Conjugate AO (MCAO), Multi-Object AO (MOAO) and Laser Tomography AO (LTAO), require natural guide stars (NGSs) to sense tip-tilt (TT) and possibly other low order modes, to get rid of the LGS-tilt indetermination problem. For example, NFIRAOS, the first-light facility MCAO system for the Thirty Meter Telescope requires three NGSs, in addition to six LGSs: two to measure TT and one to measure TT and defocus. In order to improve sky coverage, these NGSs are selected in a so-called technical field (2 arcmin in diameter for NFIRAOS), which is much larger than the on-axis science field (17x17 arcsec for NFIRAOS), on which the AO correction is optimized. Most times, the NGSs are far off-axis and thus poorly corrected by the high-order AO loop, resulting in spots with low contrast and high speckle noise. Accurately finding the position of such spots is difficult, even with advanced methods such as matched-filtering or correlation, because these methods rely on the knowledge of an average spot image, which is quite different from the instantaneous spot image, especially in case of poor correction. This results in poor tilt estimation, which, ultimately, impacts sky coverage. We propose to improve the estimation of the position of the NGS spots by using, for each frame, a current estimate of the instantaneous spot profile instead of an average profile. This estimate can be readily obtained by tracing wavefront errors in the direction of the NGS through the turbulence volume. The latter is already computed by the tomographic process from the LGS measurements as part of the high order AO loop. Computing such a wavefront estimate has actually already been proposed for the purpose of driving a deformable mirror (DM) in each NGS WFS, to optically correct the NGS spot, which does lead to improved centroiding accuracy. Our approach, however, is much simpler, because it does not require the complication of extra DMs

  11. Resistência ao clopidogrel: prevalência e variáveis associadas

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.

  12. CONTRIBUIÇÃO AO ENTENDIMENTO DA SENSIBILIDADE AMBIENTAL AO DERRAMAMENTO DE ÓLEO NO LITORAL DE MARICÁ NO ESTADO DO RIO DE JANEIRO

    Directory of Open Access Journals (Sweden)

    Érika Cardoso da Silva Baptista

    2016-01-01

    Full Text Available Desastres associados ao transporte marinho e terrestre de hidrocarbonetos causam sérios impactos aos ambientes costeiros, afetando a fauna e a flora marinha, além de prejudicar diversas atividades econômicas, inclusive àquelas tradicionais, como é o caso da pesca artesanal. Assim, faz-se necessário conhecer a geologia e a geomorfologia da costa, em especial as praias devido à elevada dinâmica e vulnerabilidade desses ambientes. A construção de megaempreendimentos na zona costeira e o tráfego de navios petroleiros e pequenas embarcações, ou mesmo a implantação de dutos, localizados junto à linha de costa, representam uma ameaça ao equilíbrio dos ecossistemas. Para tal, foram analisados diversos aspectos da geomorfologia costeira de Maricá, para posterior identificação do grau de sensibilidade deste litoral a eventos de derramamento de óleo, a partir do Índice de Sensibilidade Ambiental (ISA proposto pelo Ministério do Meio Ambiente. O litoral de Maricá, ao longo de 34 km de extensão entre Itaipuaçú (no extremo oeste e Ponta Negra (a leste, apresenta quatro áreas distintas quanto à sensibilidade à poluição decorrente de derramamento de óleo, sendo: ISA1, para as áreas de costões rochosos localizados nas extremidades leste e oeste deste litoral; ISA4, para a quase totalidade das praias, formadas por areias quartzosas grossa e média, exceto o extremo-oeste de Itaipuaçú, que possui areia muito grossa e cascalhos sendo, portanto, representada pelo ISA5; e ISA10, para as lagoas costeiras e canais na retaguarda das barreiras arenosas, sujeitas à contaminação por meio dos canais e por transposição por grandes ondas de tempestades. Os índices compreendem os extremos dessa classificação, devido à grande variedade de elementos na paisagem costeira de Maricá e mostra a elevada sensibilidade deste litoral, frente à ameaça de desastres causados por derramamento de óleo.

  13. Controle dos recursos locals através da contabilidade pública: a transformalçao do processo do antigo ao novo regime

    OpenAIRE

    Campos Luceno, María Soledad

    2012-01-01

    Durante muito  tempo, a precariedade firlanceira do Eslado colidia com a prosperidade dos recursos locais. Isto se viu agravado no ultimo périodo do Antigo Regime com a perda das colonias, principal fonte de ingressos do Estado, assim como pelos conflitos bélicos nos que o pais esteve imerso, que aumentaram os gastos. Esta situaçao levou a que os distintos governos que se sueederam na Espallha desde a metade do seculo XVII ate o final do XIX. tivessem um objetivo comun, o comtrole dos recurso...

  14. Relações entre Níveis (Paleo Topográficos e Domínios Morfotectônicos na Região Sul de Minas Gerais: Contribuições aos Estudos de Superfícies Erosivas no Sudeste Brasileiro

    Directory of Open Access Journals (Sweden)

    Antônio Pereira Magalhães Júnior

    2004-12-01

    Full Text Available Apesar das controvérsias quanto à gênese das superfícies de aplainamento, a teoria da pediplanação ganhou atenção no Brasil a partir da síntese clássica de King sobre a região oriental do país, publicada em 1956. Entretanto, os critérios de identificação das superfícies de aplainamento utilizados por King não foram consensualmente aceitos, motivando o emprego de novas técnicas quantitativas e a reavaliação da sua proposta para algumas regiões do Estado de Minas Gerais. Nos últimos anos, o estudo das superfícies de aplainamento tornou-se de grande interesse para a análise da evolução geomorfológica em áreas de reconhecida instabilidade tectônica, áreas sobre as quais surgiram os maiores questionamentos em relação ao emprego de parâmetros altimétricos na definição de superfícies de erosão. Nesta perspectiva, o presente trabalho visou pesquisar a temática das superfícies de aplainamento na “relativamente instável” região sul de Minas Gerais, por meio do estudo das possíveis relações entre níveis topográficos e blocos de comportamento morfotectônico diferencial no Cenozóico. Os resultados podem contribuir para a compreensão da evolução geomorfológica regional.

  15. Resistência de Eleusine indica aos inibidores de ACCase Eleusine indica resistance to ACCase inhibitors

    Directory of Open Access Journals (Sweden)

    R.A. Vidal

    2006-01-01

    Full Text Available Dentre as causas da ineficácia no controle de plantas daninhas destaca-se a resistência delas aos herbicidas. Os objetivos deste trabalho foram avaliar a suspeita de resistência de Eleusine indica a inibidores de acetil-CoA carboxilase (ACCase e investigar a ocorrência de resistência cruzada entre os inibidores de ACCase. Biótipo de Eleusine indica originado do Mato Grosso com suspeita de resistência aos herbicidas inibidores de ACCase foi avaliado em casa de vegetação na sua suscetibilidade para diversos produtos do grupo dos ariloxifenoxipropionatos e cicloexanodionas. Estudos de resposta à dose confirmaram que o biótipo era 18 vezes mais insensível ao sethoxydim do que biótipo suscetível nunca aspergido com herbicidas. Também se constatou resistência cruzada ao fenoxaprop, cyhalofop, propaquizafop e butroxydim. Não se observou resistência cruzada aos produtos fluazifop, haloxyfop, quizalofop e clethodim.Among the causes for weed control inefficacy, the worst one is resistance to herbicides. The objectives of this work were to evaluate an Eleusine indica biotype suspected of resistance to ACCase inhibitors and to investigate the occurrence of cross- resistance to several ACCase inhibitors. One biotype of Eleusine indica originated from Mato Grosso with suspected resistance to ACCase inhibitors was evaluated in a greenhouse in relation to its susceptibility to several products of the ariloxyphenoxypropionate and cyclohexanedione groups. Studies on dose response confirmed that the suspected biotype was 18 times more insensitive to sethoxydim than the susceptible biotype that had never been treated with herbicides. Cross-resistance was confirmed for fenoxaprop, cyhalofop, propaquizafop and butroxydim. No cross-resistance was observed with fluazifop, haloxyfop, quizalofop, and clethodim.

  16. Medo, ansiedade e controle relacionados ao tratamento odontológico

    Directory of Open Access Journals (Sweden)

    SINGH Kira Anayansi

    2000-01-01

    Full Text Available Nosso objetivo foi avaliar medo, ansiedade e controle relacionados ao tratamento odontológico. Os sujeitos foram 364 crianças da faixa etária de 7 a 13 anos. Três questionários com questões de múltipla escolha foram aplicados em grupos de 10 crianças. O primeiro questionário destinou-se à avaliação do medo ao tratamento odontológico e outras situações. Foi traduzido e adaptado do "Child's Fear Survey Schedule"9 e contém 15 itens. O segundo questionário contém 20 itens relacionados as situações potencialmente produtoras de ansiedade. Foi traduzido e adaptado do "State Trait Anxiety Inventory for Children"16. O terceiro questionário contém 40 itens sendo 20 relacionados ao controle percebido e 20 ao controle desejado e foi traduzido e adaptado do "Child Dental Control Assessment"19. Em relação ao medo e ansiedade, a média dos escores foi mais elevada para o sexo feminino do que para o sexo masculino (P < 0,05. Em relação a idade, as crianças da faixa de 11 a 13 anos revelaram-se em média mais temerosas que as de 7 a 9 anos. Quanto ao controle percebido as crianças mais novas percebem mais controle do que as mais velhas. Em geral os dados indicam que valores mais altos de medo relacionam-se com valores mais baixos de controle percebido. As crianças que tinham realizado tratamento odontológico com anestesia mostraram-se mais temerosas do que aquelas que não foram submetidas a anestesia, o que permite inferir que a etiologia de medo pode relacionar-se a esse procedimento que pode envolver a percepção de incontrolabilidade.

  17. Fatores associados aos tratamentos inadequados em grupo de portadores de tuberculose multirresistente

    Directory of Open Access Journals (Sweden)

    Barroso Elizabeth Clara

    2003-01-01

    Full Text Available INTRODUÇÃO: A tuberculose multirresistente é uma ameaça ao controle da tuberculose em todo o mundo. Tratamento inadequado é freqüentemente apontado como fator de risco para tuberculose multirresistente. OBJETIVO: Identificar fatores associados ao tratamento inadequado em portadores de tuberculose multirresistente. MÉTODO: Foram levantados e identificados os testes de sensibilidade para tuberculose, realizados no Laboratório Central do Estado do Ceará de 1990 a 1999. Foi realizado um estudo retrospectivo e prospectivo, em grupo de portadores de tuberculose multirresistente, comparando as características dos pacientes com tratamento adequado com as dos com tratamentos inadequados. Foi considerado multirresistente o bacilo resistente a pelo menos rifampicina + isoniazida e utilizado o método das proporções. RESULTADOS: Dos 1.500 testes de sensibilidade realizados, 266 eram multirresistentes. Destes, identificaram-se apenas 153 pacientes, dos quais 19 foram excluídos, restando, no estudo, 134 pacientes. Pela análise univariada os fatores associados significativamente ao tratamento inadequado foram: não-adesão ao tratamento, pobreza extrema, intolerância medicamentosa, falha no atendimento, falta de medicação, dois ou mais tratamentos anteriores, lesões radiológicas bilaterais e grandes cavidades pulmonares. Foi encontrada ainda associação (p < 0,001 de alcoolismo e/ou tabagismo com a não-adesão. Na análise multivariada, permaneceram associados ao tratamento inadequado: dois ou mais tratamentos anteriores (p < 0,0001, OR = 5,9; IC 95%: 2,5-13,7, grandes cavidades pulmonares (p < 0,0217, OR = 2,7; IC 95%: 1,2-6,1 e lesões radiológicas bilaterais (p < 0,0226, OR = 3,2; IC 95%: 1,4-7,4. CONCLUSÃO: Neste estudo, observou-se que os fatores associados aos tratamentos inadequados são de grande abrangência. Deve existir uma tentativa para controlar melhor a doença, principalmente nos pacientes em retratamento e nos portadores

  18. The Effectiveness of a Mixed-Mode Survey on Domestic Violence in Curaçao: Response and Data Quality

    Science.gov (United States)

    van Wijk, Nikil; de Leeuw, Edith; de Bruijn, Jeanne

    2015-01-01

    To collect reliable statistical data on domestic violence in Curaçao, we conducted a large-scale quantitative study (n = 816). To meet with the special needs of the population and topic, we designed a tailored mixed-mode survey to assess the prevalence of domestic violence in Curaçao and its health consequences. Great care was taken to reduce…

  19. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao

    NARCIS (Netherlands)

    Stock, Jan H.

    1992-01-01

    STOCK, J. H. 1992. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao. Stud. Nat. Hist. Caribbean Region 71, Amsterdam 1992: 69-78. Hemicyclops geminatus n. sp. is described from the upper infralittoral zone of Curaçao

  20. Parâmetros hematológicos e bioquímicos da tilápia-do-Nilo (Oreochromis niloticus L. sob estresse por exposição ao ar Hematological parameters of Nile Tilapia (Oreochromis niloticus L. under air exposure stress

    Directory of Open Access Journals (Sweden)

    Roberta Dias da Silva

    2012-12-01

    Full Text Available No presente trabalho avaliaram-se os parâmetros hematológicos e bioquímicos de exemplares adultos de tilápias (Oreochromis niloticus sob a influência do fator estresse fisiológico em animais submetidos à exposição ao ar durante a engorda em sistema raceway. Foram analisados o eritrograma, teor de hemoglobina, volume globular, o volume corpuscular médio (VCM, a hemoglobina corpuscular média (HCM, a concentração de hemoglobina corpuscular média (CHCM, o leucograma, contagem diferencial de leucócitos, o plaquetograma, a glicose, a proteína total, o colesterol, o triglicerídeo e os eletrólitos (cálcio, cloretos, sódio e potássio. Os resultados revelaram que houve uma homogeneidade de distribuição para hemácias, volume globular, hemoglobina, índices hemantimétricos, proteína total, glicose, colesterol, e íons séricos, indicados pelos valores relativamente baixos do coeficiente de variação. Houve correlação positiva somente para leucócitos totais, células de defesa orgânica (neutrófilos e linfócitos, glicose, colesterol, sódio e cálcio. Quanto ao leucograma, à medida que os animais foram expostos ao ar, o número de leucócitos diminuiu gradativamente (leucopenia, ocorrendo simultaneamente neutrofilia e linfopenia. O índice glicêmico constituiu um bom indicador de estresse fisiológico, devido à hiperglicemia (82,0±20,88mg/dL demonstrada nos tratamentos. A exposição ao ar constituiu um fator de desequilíbrio na homeostase iônica, e na síntese de colesterol endógeno. Entretanto, o tempo de recuperação não ocasionou a completa reabilitação fisiológica frente ao desafio imposto.The present study evaluated the hematological and biochemical parameters of adult tilapia (Oreochromis niloticus under the influence of the physiological stress factor in animals submitted to air exposure during fattening in raceway system. Blood cell count, hemoglobin, hematocrit, mean corpuscular volume (MCV, mean

  1. Truncus arteriosus operado aos 28 anos: importância do diagnóstico diferencial

    Directory of Open Access Journals (Sweden)

    Lilian Maria Lopes

    2011-08-01

    Full Text Available Descrevemos um caso de adulto de 28 anos com suspeita de cardiopatia congênita desde o nascimento, não tratada na infância por opção da família. Aos 27 anos, foi feito diagnóstico de atresia pulmonar com comunicação interventricular e colaterais sistêmico-pulmonares, sendo contraindicada a cirurgia. Uma nova reavaliação em nosso serviço demonstrou tratar-se de um truncus arteriosus atípico. O fato de um tronco arterial comum com shunt esquerda-direita ter sido visualizado ao ecocardiograma foi um dado crucial para a indicação de novo cateterismo, abrindo perspectiva de correção cirúrgica. No momento, o paciente encontra-se bem, com 7 anos de evolução pós-operatória.

  2. As resistências ao poder em Michel Foucault The resistance to power in Michel Foucault

    OpenAIRE

    Guilherme Castelo Branco

    2001-01-01

    Ainda pouco estudada, a última fase do pensamento de Michel Foucault traz contribuições inegáveis ao debate ético e político de nossa época, sobretudo por enfatizar o papel do indivíduo e das coletividades nas lutas de transformação das estruturas de poder ora vigentes. Os modos de ser das lutas de resistência, sua importância no quadro referencial do último Foucault, revelam uma dimensão política antes insuspeitada em sua obra. Essa dimensão, para além da analítica do poder, concede aos pequ...

  3. Escala multidimensional aplicada aos estudos de apreciação musical

    Directory of Open Access Journals (Sweden)

    Raquel Cocenas da Silva

    2009-08-01

    Full Text Available A escala multidimensional (MDS provém de uma família de técnicas de análise de proximidade de dados, obtida por meio do julgamento do participante que compara vários estímulos em vários traços, concomitantemente. A análise dos julgamentos de proximidade produz um espaço em que pontos representam a relação entre os estímulos em um espaço euclidiano. O ordenamento dos estímulos ao longo das dimensões neste espaço permite que inferências possam ser feitas sobre o universo perceptual subjacente ao grupo de pesquisa. A literatura mostra que a MDS vem ampliando o estudo da música e a mensuração de suas propriedades estruturais.

  4. A amizade para Foucault: resistências criativas face ao biopoder

    Directory of Open Access Journals (Sweden)

    Hélio Rebello Cardoso Jr.

    2009-04-01

    Full Text Available O artigo trabalha a noção de amizade em Foucault como um modo de vida que se opõe ao processo de normalização empreendido pelo biopoder. Inicia com uma caracterização acerca do Estado Moderno. Logo após, aborda a historicidade dos processos de subjetivação e de como a atitude frente a estes implica estados de maior autonomia ou sujeição. Em seguida, aborda a amizade como resistência à normalização, situando-a em relação ao prazer e à sexualidade. Por fim, discute o papel da filosofia no processo de constituição da amizade, particularmente quanto à possibilidade de pensá-la por meio de uma teoria das relações.

  5. Evolução da temperatura ambiente em construções sujeitas ao fogo

    OpenAIRE

    Inácio, Pedro Jorge Rita Ledo

    2011-01-01

    Dissertação para a obtenção do Grau de Mestre em Engenharia Civil A perda de bens materiais e de vidas humanas em situações de incêndio tem sido ao longo dos tempos uma preocupação crescente, promovendo assim o conceito de segurança contra incêndio e de diversos mecanismos associados à sua prevenção ou limitação dos danos causados. Um incêndio é algo difícil de prever, assim como a sua consequência nos elementos de construção. Dessa forma, ao longo das ultimas décadas, os elementos d...

  6. Do mundano ao sagrado: o papel da efervescência na teoria moral durkheimiana

    Directory of Open Access Journals (Sweden)

    Raquel Andrade Weiss

    2013-12-01

    Full Text Available Meu objetivo neste artigo é discutir o significado do conceito de efervescência na obra durkheimiana e apontar o papel que esse processo desempenha em relação à sua teoria moral. De modo geral, a argumentação versa em torno da articulação de três pressupostos estruturais da teoria moral durkheimiana, quais sejam, 1 a vinculação entre sagrado e ideal moral, 2 a concepção acerca da natureza humana como sendo essencialmente dual e 3 a proposta normativa de Durkheim de institucionalização de uma moralidade laica. Ao final, proponho ao leitor uma reflexão sobre a pertinência de sua defesa de um "sagrado laico" a partir dos desafios morais que caracterizam o mundo contemporâneo.

  7. Associação entre indicadores de risco ao desenvolvimento infantil e estado emocional materno

    OpenAIRE

    Flores,Mariana Rodrigues; Souza,Ana Paula Ramos de; Moraes,Anaelena Bragança de; Beltrami,Luciane

    2013-01-01

    OBJETIVO: analisar a associação entre os estados emocionais maternos depressivo e ansioso, combinados ou de modo isolado, em relação à presença de risco ao desenvolvimento infantil na faixa etária de 0 a 4 meses. MÉTODO: trata-se de estudo observacional, analítico e de coorte. Para a obtenção dos dados foram utilizados os Inventários de Beck de Depressão e de Ansiedade e analisada a interação mãe-bebê a partir do protocolo de índices de risco ao desenvolvimento infantil em uma amostra de 182 ...

  8. Contribuições ao dimensionamento de torres eólicas de concreto.

    OpenAIRE

    Paulo Vitor Calmon Nogueira da Gama

    2015-01-01

    O trabalho dedica-se ao estudo das torres eólicas protendidas de concreto, com a finalidade de promover a discussão sobre os critérios de dimensionamento, tema de grande relevância na atualidade. Para tal, foi considerada uma torre eólica de 100 m de altura provida de turbina de 5 MW, cujas ações foram obtidas da literatura. O carregamento de vento ao longo da torre foi tratado como estático equivalente de acordo com disposições normativas, através de uma forma simplificada para a adoção de u...

  9. Resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado

    Directory of Open Access Journals (Sweden)

    W. M. Souza

    Full Text Available A resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado sem estribos nas nervuras ainda gera controvérsias quando sua estimativa não considera a contribuição da capa monolítica. Visando contribuir para o melhor entendimento do comportamento destas lajes, foram confeccionados em laboratório 8 painéis de lajes nervuradas unidirecionais de concreto armado onde as principais variáveis foram a distância entre as nervuras e a espessura da capa. Foram avaliadas as recomendações normativas da NBR 6118, ACI 318 e EUROCODE 2 para as resistências últimas destas lajes. Os resultados experimentais mostraram que houve acréscimo de resistência ao cisalhamento com o aumento da espessura da capa, resultando também em maiores deformações nas armaduras e em flechas mais elevadas.

  10. O exercício do estudar nos cursinhos destinados aos concursos públicos

    Directory of Open Access Journals (Sweden)

    Leonardo Del Puppo Luz

    2008-06-01

    Full Text Available O artigo discute o processo de produção da subjetividade contemporânea elaborado sobre o Estudar em alunos de cursinhos destinados aos concursos públicos. Procura-se discutir as tecnologias de poder, sobretudo na relação saber-poder, engendradas nestes "ambientes educacionais", já que tais construções sobre o Estudar produzem e perpetuam a manifestação de conceitos absolutos e verdadeiros de se pensar o estudo por meio de técnicas e procedimentos de funcionamentos ideais e idealizados. Busca-se problematizar este modelo homogêneo baseado no tecnicismo do estudar e nas falas sobre o verdadeiro visando colocar em análise o estereótipo do "fracasso" atrelado aos alunos vinculados a estes locais.

  11. Analyses of Alternatives (AoAs): Toward a More Rigorous Determination of Scope

    Science.gov (United States)

    2014-03-11

    Inappropriate Treatment of Time Constraints ..................................................... 7  Inappropriate Focus on Existing C/CSS and/or...several reasons why AoAs may be improperly scoped. Inappropriate Treatment of Time Constraints In the first section, we noted the recent trend...Type Memorandum DTM 10-017). Washington, DC: Author. Retrieved from http://www.hsdl.org/?view&did=728880 United States Air Force Office of

  12. Subordinate but proud: Curaçao's free blacks and mulattoes in the eighteenth century

    Directory of Open Access Journals (Sweden)

    Wim Klooster

    1994-07-01

    Full Text Available Focuses on the socio-economic position of free non-whites in 18th-c. Curaçao. The manumission rate was relatively high and consequently a large group of free non-whites was created. Blacks and mulattoes enjoyed religious freedom as well as considerable economic freedom. Their growing numbers and social and economic assertiveness alarmed the whites, who gradually admitted the most successful mulattoes in their circles.

  13. Caminhoneiros de rota curta e sua vulnerabilidade ao HIV, Santos, SP

    Directory of Open Access Journals (Sweden)

    Villarinho Luciana

    2002-01-01

    Full Text Available OBJETIVO: Descrever a vulnerabilidade, de caminhoneiros de rota curta, à transmissão sexual do HIV e da Aids. MÉTODOS: Foram entrevistados 279 caminhoneiros com vínculo de trabalho na cidade de Santos, SP, em locais de concentração na área portuária e suas proximidades, sindicatos e associações, recrutados pela amostragem do tipo "bola-de-neve". Foram realizadas entrevistas utilizando perguntas abertas e fechadas sobre questões sociodemográficas, práticas sexuais, uso de drogas, conhecimento sobre o HIV e a Aids, contato prévio com programas de prevenção à Aids em Santos, percepção de sua vulnerabilidade ao HIV e à Aids. Foi realizada análise descritiva da amostra, e apresentados relatos para ilustrar algumas situações de vulnerabilidade. RESULTADOS: Do total de 279 caminhoneiros entrevistados, 93% declararam ter parceira fixa, 40% referiram manter relações sexuais com parceiras casuais, e 19% referiram manter relações sexuais com parceiras freqüentes. A principal situação de vulnerabilidade ao HIV ocorre devido ao uso inconsistente do preservativo, interligado ao vínculo estabelecido com cada parceira. O tempo fora de casa parece não ser o principal fator para situações de vulnerabilidade, conforme demonstram estudos com caminhoneiros de rota longa. CONCLUSÕES: A cultura "machista" e os papéis tradicionais masculinos são emblemáticos entre os caminhoneiros de rota curta. Certamente é necessário investir mais na prevenção nessa categoria profissional. A prevenção em locais de trabalho parece promissora, pois permite entender melhor seu universo, propiciando intervenções educativas adequadas a essa categoria profissional.

  14. Do corpo histérico ao "corpus" teórico

    Directory of Open Access Journals (Sweden)

    Francisco Ramos de Farias

    1992-09-01

    Full Text Available Este estudo aborda a maneira pela qual Freud, de forma original, efetuou uma leitura no corpo-sintoma da histérica e construiu uma clínica inédita destinada ao tratamento das neuroses. Esta clínica, fundada na transferência, é suportada pelo edifício teórico que tem o inconsciente e a sexualidade como paradigmas.

  15. Diversity and spatial heterogeneity of mangrove associated sponges of Curaçao and Aruba

    OpenAIRE

    Hunting, E.R.; van Soest, R.W.M.; Van der Geest, H. G.; Vos, A; Debrot, A.O.

    2008-01-01

    Sponges are major epibionts of mangrove roots in the Caribbean. Mangrove sponge communities in the Caribbean mainly consist of species that are typical to this habitat and community compositions often differ from those found on coral reefs nearby. Heterogeneity in species distributions between locations and within locations between roots is often reported. This study quantifi es the diversity and abundance of mangrove associated sponges in the inner bays of Curaçao and Aruba and correlates va...

  16. Análise de fatores associados ao significado do trabalho

    Directory of Open Access Journals (Sweden)

    Sergio Hideo Kubo

    2012-12-01

    Full Text Available O trabalho tem sido visto não somente como forma de obter a renda, mas também como atividade que proporciona realização pessoal, status social e possibilidade de estabelecer e manter contatos interpessoais, entre outros. Nesta pesquisa, teve-se como objetivo investigar os fatores que influenciam e conferem sentido ao trabalho, como centralidade do trabalho, normas da sociedade e objetivos e resultados valorizados. Na centralidade do trabalho, procurou-se investigar o grau de importância do trabalho dentro do contexto das diversas áreas da vida das pessoas, como família, lazer, religião e vida comunitária. Em normas da sociedade, foram analisados os pontos mais significativos no tocante ao que a sociedade deveria proporcionar ao indivíduo, assim como o que o indivíduo deveria fazer em prol da sociedade. Nos objetivos e resultados valorizados, foi pesquisado o que as pessoas buscam com o trabalho. A partir da pesquisa na literatura, foi elaborado um modelo inicial que, não se mostrando satisfatório segundo critérios estatísticos, foi substituído por outro que apresentou significância estatística e boa aderência aos dados. O modelo escolhido foi o que melhor goodness-of-fit apresentou, quando se utilizou modelagem de equações estruturais pelo método partial least square. O estudo revelou que o significado do trabalho se reflete, na ordem, na centralidade do trabalho, nos objetivos e resultados valorizados e, por último, nas normas sociais.

  17. Perícia contábil: uma ferramenta de combate ao crime organizado

    Directory of Open Access Journals (Sweden)

    IDALBERTO JOSÉ DAS NEVES JÚNIOR

    2011-11-01

    Full Text Available No Brasil e no mundo, devido principalmente à ausência do Estado no cumprimento do seu papel de garantidor da lei e da ordem, as organizações criminosas cresceram significativamente, e as suas ações passaram a ocorrer de formas planejadas e estratégicas. Para combatê-las e reprimi-las, a Perícia Contábil, materializada nos laudos periciais elaborados pelos peritos criminalistas, surge como importante ferramenta de Inteligência. Nesse contexto, o objetivo desta pesquisa foi identificar a relevância da Perícia Contábil como meio de prova para a solução de controvérsias relativas ao crime organizado. Para tanto, houve a realização de pesquisa de campo por meio de questionário aplicado aos Delegados, Escrivães e Agentes de Polícia das divisões da Diretoria de Combate ao Crime organizado – DCOR do Departamento de Polícia Federal. Também, houve a utilização de técnicas de estatística multivariada de análise de cluster para o estudo dos registros (K-Means clusters do software SPSS, que resultou na formação de dois agrupamentos. Considerando a pesquisa de campo e o referencial teórico, verificou-se que a Perícia Contábil, no limite de suas atribuições, é um relevante meio de prova para a solução de controvérsias relativas ao crime organizado.

  18. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Directory of Open Access Journals (Sweden)

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  19. Potencial de fertilizantes e corretivos no aporte de micronutrientes ao solo

    OpenAIRE

    Vinícius Gedeão Bezerra de Carvalho; Clístenes Williams Araújo do Nascimento; Caroline Miranda Biondi

    2012-01-01

    Fertilizantes e corretivos, ao serem aplicados nos solos, fornecem micronutrientes como impurezas residuais da sua fabricação, os quais podem ser importantes fontes para as culturas. Em decorrência disso, o objetivo deste trabalho foi quantificar os teores dos micronutrientes Zn, Cu, Fe, Mn e Ni em fertilizantes e corretivos comercializados no Nordeste brasileiro, visando avaliar o potencial desses insumos no fornecimento indireto de micronutrientes às culturas agrícolas. Os insumos analisado...

  20. Do valor intrínseco e de sua aplicabilidade ao meio ambiente

    Directory of Open Access Journals (Sweden)

    Tânia Ap. Kuhnen

    2004-01-01

    Full Text Available O tema deste estudo é a teoria do valor sagrado da vida e sua aplicabilidade às questões de ética prática, mais especificamente ao meio ambiente. O objetivo geral consiste em apontar os limites da concepção de Dworkin sobre a teoria do sagrado, quando aplicada ao meio ambiente, e a solução que Singer oferece para a atribuição de valor ao mesmo. Justifica-se esse trabalho em decorrência da importância de se discutir, a partir da análise dessas teorias filosóficas, questões vinculadas ao estabelecimento de um princípio ético que, além de englobar, no campo da ação moral, todos os seres sencientes, envolva também o meio ambiente como um todo. Além disso, o tema que aqui se desenvolve é uma contribuição do raciocínio filosófico-teórico para a discussão de problemas relevantes no campo da ética prática. Esse estudo ainda se justifica por abordar a questão da linha moral divisória entre os seres que são ou não incluídos na comunidade moral, o que representa outro problema que concerne à ética. As diferentes formas de classificação não foram capazes de incluir todos os seres vivos no âmbito da comunidade moral. Há sempre exclusões, as quais tendem a diminuir com o surgimento de teorias éticas inovadoras, dentre elas as que serão abordadas a seguir.

  1. Clinical use of AO three-dimensionally preformed titanium mesh plates for orbital fractures

    Directory of Open Access Journals (Sweden)

    Ming Chen

    2015-01-01

    Full Text Available AIM:To evaluate the accuracy and practicability of three-dimensionally preformed Arbeitsgemeinschaft Osteosynthese AO titanium mesh plates for orbital fractures.METHODS:Forty-seven patients with isolated blow-out orbital fractures were included in this study. Fracture locations were as follows: floor/medial wall(n=26, 55%, medial wall(n=12, 26%, and floor(n=9, 19%. The floor fractures were exposed by a standard transconjunctival approach, whereas a combined transcaruncular transconjunctival approach was used in patients with medial wall fractures with temporary dissection of inferior oblique muscle. A three-dimensionally preformed AO titanium mesh plate was selected according to the size of the defect previously measured on the preoperative computed tomographic scan examination and fixed at the inferior orbital rim with 2 screws. The accuracy of plate positioning of the reconstructed orbit was assessed on the postoperative computed tomography(CTscan. The practicability of clinical use of AO three-dimensionally preformed titanium mesh plates was assessed on the preoperative and postoperative clinical data.RESULTS: Postoperative orbital CT scan showed an anatomic three-dimensional placement of the orbital mesh plates in all of the patients. All patients had a successful treatment outcome without clinical complications. 40 patients(87%had a successful enophthalmos correction. 25 patients(86%had a successful recovery from diplopia.CONCLUSION: Three-dimensionally preformed AO titanium mesh plates for orbital fracture reconstruction results in an accurate anatomic restoration of the bony orbital contour with a high rate of success to correctenophthalmos and diplopia.

  2. Software interativo: ecocardiografia na avaliaçao da hipertensao arterial

    Directory of Open Access Journals (Sweden)

    Fábio Abdalla Segamarchi

    Full Text Available A hipertensao arterial é uma doença muito prevalente, evoluindo com lesoes em órgaos-alvo, alta morbidade e mortalidade. A avaliaçao das repercussoes cardíacas pela ecocardiografia tem papel importante na conduçao clínica dos indivíduos hipertensos, e suas imagens podem ser utilizadas como ferramenta para o ensino. OBJETIVOS: Desenvolver e avaliar um software, construído com base em imagens ecocardiográficas, abordando de forma ilustrativa e interativa a estrutura e funçao cardíacas normais,bem como as alteraçoes induzidas pela hipertensao arterial. MÉTODOS: Foram selecionadas imagens ecocardiográficas de indivíduos normais e com comprometimento cardíaco determinado pela hipertensao (hipertrofia ventricular esquerda, miocardiopatia dilatada e infarto do miocárdio. Com estas imagens foi construído um software no programa multimídia Flash, que foi avaliado por estudantes de Medicina (n=38 e Enfermagem (n=18, também submetidos a pré- e pós-teste. RESULTADOS: Os alunos consideraram o software útil, atraente e adequado as atuais metodologias educacionais proativas,promovendo ganho de conhecimento na compreensao do comprometimento cardíaco na hipertensao arterial. Conclusao: O software foi bem avaliado e considerado útil na aquisiçao de conhecimento numa área específica mais prevalente do comprometimento da saúde do adulto.

  3. Fatores associados ao sedentarismo no lazer em idosos, Campinas, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Maria Paula do Amaral Zaitune

    2007-06-01

    Full Text Available O objetivo deste estudo foi conhecer a prevalência de sedentários no lazer (que referem não praticar nenhum exercício físico no lazer ao menos uma vez por semana em idosos de Campinas, São Paulo, Brasil, segundo fatores demográficos e sócio-econômicos, outros comportamentos relacionados à saúde e à presença de morbidades. Trata-se de um estudo transversal, de base populacional, com amostragem em múltiplos estágios. A análise dos dados levou em conta o desenho amostral. A prevalência de sedentários foi 70,9%, sendo que as razões de prevalências foram significativamente maiores que um para os idosos de menor renda (1,31: 1,11-1,55, tabagistas (1,39: 1,23-1,57, com transtorno mental comum (1,20: 1,04-1,39 e do sexo feminino (1,16: 1,00-1,35. A prevalência de caminhada foi 23,5%, seguida por ginástica ou musculação (3,8% e por natação ou hidroginástica (3,6%. Os resultados apontam para a necessidade do desenvolvimento de ações globais com respeito aos comportamentos relacionados à saúde. Atenção especial deve ser dada aos idosos do sexo feminino, àqueles com transtorno mental comum e aos de menor nível sócio-econômico a fim de garantir eqüidade em relação às práticas de promoção da saúde.

  4. Optimal control strategy to reduce the temporal wavefront error in AO systems

    Science.gov (United States)

    Doelman, Niek J.; Hinnen, Karel J. G.; Stoffelen, Freek J. G.; Verhaegen, Michel H.

    2004-10-01

    An Adaptive Optics (AO) system for astronomy is analysed from a control point of view. The focus is put on the temporal error. The AO controller is identified as a feedback regulator system, operating in closed-loop with the aim of rejecting wavefront disturbances. Limitations on the performance of feedback regulator systems are discussed. The concept of optimal control is proposed to minimise the temporal error. The issue of closed-loop feedback controller design is made transparent by using the principle of Internal Model Control. The central issue in reducing the temporal wavefront is the design of a feedforward prediction filter. In three separate tests - a numerical simulation example, measured data from an AO test bench and open-loop telescope data - the advantage of optimal control over the common approach of integral control is demonstrated. Optimal control of the temporal error yields a smaller temporal error, enables a longer integration time in the wavefront sensor, or the use of fainter natural guide stars.

  5. Do modernismo ao alívio pós-moderno

    Directory of Open Access Journals (Sweden)

    Simone Regina Dias

    2003-06-01

    Full Text Available Ao traçar um mapeamento dos elementos fundantes da grande crise mundial que se instaurou desde 1789, no livro Crítica e crise, Reinhart Koselleck sustenta: Pertence à natureza da crise que uma decisão esteja pendente mas ainda não tenha sido tomada. Também reside em sua natureza que a decisão a ser tomada permaneça em aberto. Portanto, a insegurança geral de uma situação crítica é atravessada pela certeza de que, sem que se saiba ao certo quando ou como, o fim do estado crítico se aproxima. A solução possível permanece incerta, mas o próprio fim, a transformação das circunstâncias vigentes — ameaçadora, temida ou desejada —, é certo. A crise invoca a pergunta ao futuro histórico. As constatações de Koselleck apontam para o reconhecimento de um estado de crise permanente do mundo. Isto é, um olhar focado em determinado momento da história poderia extrair, em tempos diversos, um quadro em que se detecta a crise, um estado de incertezas.

  6. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    2013-04-01

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  7. Dificuldades vividas por pessoas trans no acesso ao Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Pablo Cardozo Rocon

    Full Text Available Resumo Objetivou-se discutir as dificuldades de pessoas trans moradoras da região metropolitana da Grande Vitória/ES em acessarem os serviços de saúde no SUS. Utilizou-se uma abordagem qualitativa por meio de entrevistas semiestruturadas com 15 pessoas trans. Os resultados apontaram o desrespeito ao nome social, a discriminação e o diagnóstico no processo transexualizador como principais limitações no acesso ao sistema de saúde. Afirma-se que o diagnóstico contribui para ocultar a responsabilidade da heteronormatividade e do binarismo de gênero pela marginalização social das pessoas trans. Conclui-se que é necessário modificar o diagnóstico em sua função, já que a existência de uma patologia prévia não é requisito para acessar o SUS. Aponta-se, também, a importância de elaborar programas de educação e campanhas permanentes sobre o direito de acesso ao sistema de saúde livre de discriminação e com uso do nome social.

  8. Simulated Guide Stars: Adapting the Robo-AO Telescope Simulator to UH 88”

    Science.gov (United States)

    Ashcraft, Jaren; Baranec, Christoph

    2018-01-01

    Robo-AO is an autonomous adaptive optics system that is in development for the UH 88” Telescope on the Mauna Kea Observatory. This system is capable of achieving near diffraction limited imaging for astronomical telescopes, and has seen successful deployment and use at the Palomar and Kitt Peak Observatories previously. A key component of this system, the telescope simulator, will be adapted from the Palomar Observatory design to fit the UH 88” Telescope. The telescope simulator will simulate the exit pupil of the UH 88” telescope so that the greater Robo-AO system can be calibrated before observing runs. The system was designed in Code V, and then further improved upon in Zemax for later development. Alternate design forms were explored for the potential of adapting the telescope simulator to the NASA Infrared Telescope Facility, where simulating the exit pupil of the telescope proved to be more problematic. A proposed design composed of solely catalog optics was successfully produced for both telescopes, and they await assembly as time comes to construct the new Robo-AO system.

  9. Currículo universitário: do México ao Brasil neoliberais

    Directory of Open Access Journals (Sweden)

    Dostoiewski Mariatt de Oliveira Champangnatte

    2016-03-01

    Full Text Available Resumo O objetivo deste estudo foi discutir e comparar percepções e ações curriculares de professores universitários mexicanos e brasileiros. Contextualizando as realidades socioeconômicas dos dois países e, principalmente, as políticas governamentais voltadas ao ensino superior, observa-se, nas várias falas dos professores, uma abordagem simplista de currículo, significando-o apenas como preocupações de conteúdos administrados em disciplinas e planos de ensino. Aspectos da realidade social, política e econômica são desatrelados do pensamento e prática curriculares, onde o maior objetivo se tornou a adequação ao mercado de trabalho. Nota-se, direta e indiretamente, influências do pensamento e práticas neoliberais no posicionamento desses professores tanto quanto ao currículo como com a própria funcionalidade do ensino superior, refletindo e reproduzindo, em seus discursos e práticas, as políticas governamentais neoliberais vigentes.

  10. Improvement of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens

    Directory of Open Access Journals (Sweden)

    Tao He

    2015-12-01

    Full Text Available AIM:to observe the effect of modified surgery of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens.METHODS:The study included 37 patients(37 eyeswho could not be performed the regular implantation of posterior chamber intraocular lens for the rupture of posterior capsule or for the zonular dialysis caused by trauma, congenital or surgery. Bausch & lomb Akreos Adapt AO fordable intraocular lens, VE22000 implantation device were applied in this study. Regular 2.4mm transparent cornea incision and pocket-like sclera incision were made. The intraocular lens were transscleral sulcus fixed by 10/0 prolene suture and the suture was buried within the scleral incision.RESULTS:The intraocular lenses were all well posited and the postoperative visual acuity(VAwas improved in all patients. Three eyes(8%were≥0.8 while 18 eyes(49%>0.4~≤0.6 and the remaining 16(43%were ≤ 0.4 at 3mo after surgery.Cornea astigmatism was 1.73D±1.22D and 1.62±1.34D before and after surgery, no statistic significance was observed(PCONCLUSION:The modified surgery of 2.4mm small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens has the following advantages such as:good visual results, less postoperative astigmatism, small surgery incision, steady intraocular lens, less manipulation, less complication and more effective.

  11. Atendimento domiciliar ao idoso: problema ou solução?

    Directory of Open Access Journals (Sweden)

    Ciro Augusto Floriani

    Full Text Available O atendimento domiciliar ao idoso tem se tornado um importante instrumento de assistência nos últimos anos, tanto nos países desenvolvidos quanto nos países em desenvolvimento. Vários aspectos éticos, sociais e operacionais têm sido negligenciados e a literatura nacional é escassa em relação a esta temática. A partir de revisão bibliográfica em atendimento domiciliar, este artigo enfoca, do ponto de vista bioético, os potenciais problemas advindos com a implantação dessa crescente e importante modalidade de atendimento. Conclui ser necessário um maior direcionamento ético na implantação do atendimento domiciliar, com políticas de proteção ao paciente, à família e ao cuidador, visando a aperfeiçoar a qualidade dos programas oferecidos.

  12. Escala de atitudes face ao lazer em adolescentes e jovens adultos

    Directory of Open Access Journals (Sweden)

    Teresa Freire

    2007-04-01

    Full Text Available Atualmente, o lazer e as atitudes face ao lazer têm sido alvo de interesse na investigação psicológica, concretamente no domínio da Psicologia Social. O objetivo do presente estudo foi adaptar a escala Leisure Attitude Scale de Raghb e Beard, construída para avaliar as atitudes face ao lazer em função das três componentes de atitude (cognitiva, afetiva e comportamental para a população de estudantes, adolescentes e jovens adultos portugueses. Participaram no estudo 462 sujeitos (57,8% do sexo feminino e 42,2% do sexo masculino, com uma média de idades de 19,97 (desvio padrão de 4,85. Os resultados obtidos confirmam a estrutura e as características psicométricas da versão original, refletindo valores largamente aceitáveis de fidelidade (consistência interna e validade (validade de conteúdo quer para a escala total quer para as várias sub-escalas (cognitiva, afetiva e comportamental. Conclui-se pela adequação da escala na medida das atitudes face ao lazer, no contexto português.

  13. Physical Growth and Nutritional Status among Ao Naga Children of Nagaland, Northeast India

    Directory of Open Access Journals (Sweden)

    Temsumongla Longkumer

    2013-01-01

    Full Text Available The present study was carried out on 571 Ao Naga children including 289 boys and 282 girls aged 8 to 15 years from Mokokchung town, Nagaland. This study tried to find out the physical growth according to the height and weight and nutritional status according to the body mass index (BMI following the classification by Cole et al. Our study revealed that the girls were taller than boys till 13 years and the boys became taller thereafter. As for weight, the girls were heavier during 10 to 14 years. The mean height and weight increased as the age advanced in both boys and girls. The prevalence of underweight was 30.12% and the prevalence of overweight was 2.28% among the Ao Naga children, and the girls were found to have a higher prevalence of overweight and the boys had a higher prevalence of underweight. This revealed that both underweight and overweight coexisted among the Ao Naga children from Mokokchung town, although the prevalence of overweight was not high.

  14. Desempenho escolar da criança vitimizada encaminhada ao fórum judicial

    Directory of Open Access Journals (Sweden)

    Paulo Celso Pereira

    Full Text Available O objetivo do estudo foi caracterizar o desempenho escolar da criança vítima de violência doméstica atendida no Fórum Judicial. Participaram do estudo 20 crianças vitimizadas comparadas com seus pares da mesma sala de aula, mesmo sexo e mesma faixa etária, mas sem histórico de violência doméstica, suas respectivas mães e professoras. As crianças responderam ao Teste de Desempenho Escolar, Inventário de Estilos Parentais e ao Teste de Raven (Escala Especial e apresentaram o caderno escolar. As mães responderam a uma entrevista e a Escala de Táticas de Conflitos Revisada (CTS-2. As professoras apresentaram sua opinião sobre o desempenho acadêmico dos participantes. Os dados obtidos mostraram que a criança vitimizada tem desempenho escolar inferior ao grupo controle. Os resultados da CTS-2 indicaram que a maioria das crianças vitimizadas estava exposta à violência conjugal. O estudo mostrou que, além da violência doméstica direta e indireta, tais crianças estavam expostas a outros fatores de risco, tais como, pobreza, baixa escolaridade materna e uso de álcool e/ou droga por familiares.

  15. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  16. Transtorno afetivo bipolar: perfil farmacoterapêutico e adesão ao medicamento

    Directory of Open Access Journals (Sweden)

    Adriana Inocenti Miasso

    2012-06-01

    Full Text Available Este estudo teve como objetivos verificar a adesão de portadores de transtorno afetivo bipolar (TAB à terapêutica medicamentosa e identificar possíveis causas de adesão e não adesão ao medicamento de acordo com o perfil farmacoterapêutico. Trata-se de estudo transversal, descritivo, realizado em Núcleo de Saúde Mental de um município do interior paulista. Participaram do estudo 101 pacientes com TAB. Para coleta dos dados, utilizou-se a entrevista estruturada e o teste de Morisky-Green e, para a análise dos mesmos, o programa Statistical Package for the Social Science. Os resultados mostraram que a maioria (63% dos sujeitos investigados não adere ao medicamento. Apesar de não ter ocorrido diferenças significativas entre o grupo de aderentes e não aderentes, para as variáveis investigadas, foi possível verificar a utilização de polifarmacoterapia e regimes terapêuticos complexos no tratamento do TAB. Permanece como desafio a implementação de estratégias que possam melhorar, na prática, a adesão de pacientes ao tratamento medicamentoso.

  17. O ser-coronariopata: entree o viver autêntico e as amarras ao cotidiano

    Directory of Open Access Journals (Sweden)

    Lucia de Fatima da Silva

    Full Text Available Estudo fenomenológico, cujo objeto é o sentido atribuído pelos coronariopatas às suas experiências vivenciadas. Das entrevistas foram extraídas as significações: temer a morte e o retorno dos sintomas agudos; perceber a transformação na vida social, profissional e sexual; sentir-se vigiado; conformar-se com a nova condição e sentir tristeza e inconformação. Estas significações subsidiaram a análise compreensiva a qual, respaldada na obra Ser e tempo de Martin Heidegger, permitiu captar o sentido nelas velado. Os coronariopatas desvelaram-se existentes inautênticos ao temerem "algo", prenderem-se à tagarelice e ao vigor de ter sido. Ainda, transcendem ao existir autêntico quando angustiam-se, assumindo a coronariopatia como possibilidade de ser-no-mundo; embora fracassem nesta tarefa e voltem às amarras do cotidiano. O estudo reflete a necessidade de privilegiar a dimensão existencial na assistência à saúde e na formação dos profissionais, além da compreensão do outro como esteio para o cuidar.

  18. Profilaxia das úlceras associadas ao estresse Prophylaxis of ulcers associated with stress

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Pompilio

    2010-06-01

    Full Text Available INTRODUÇÃO: As úlceras da mucosa gastroduodenal que aparecem após graves insultos têm sido chamadas de úlceras associadas ao estresse ou, mais genericamente, de "doença mucosa associada ao estresse" (DMAE. São conhecidas desde a Antiguidade e apesar de relacionarem-se com altos índices de morbidade e mortalidade, esquemas de profilaxia no intuito de minimizar seus riscos, só foram introduzidos recentemente. Os inibidores da bomba de prótons têm desempenhado papel importante nesse cenário. MÉTODOS: O presente artigo é uma breve revisão sobre seu uso dentro do contexto clínico da profilaxia do sangramento gastrointestinal relacionado ao estresse.INTRODUCTION: Gastroduodenal mucosal ulcers that appear after severe insults have been called ulcers associated with stress or, more generally, "mucosal disease associated with stress" (DMAE. Are known since antiquity and although linked with high morbidity and mortality, prevention schemes in order to minimize their risk, were introduced only recently. The proton pump inhibitors have played an important role in this scenario. METHODS: This article is a brief review of its use within the clinical context of prophylaxis of gastrointestinal bleeding due to stress.

  19. Ausência de expectativa de suporte para o cuidado aos idosos da comunidade

    Directory of Open Access Journals (Sweden)

    Déborah Cristina de Oliveira

    2016-06-01

    Full Text Available RESUMO Objetivo: identificar fatores associados à ausência de expectativa de suporte para o cuidado aos idosos da comunidade. Método: foram utilizados parte dos dados do estudo multicêntrico "Fragilidade em Idosos Brasileiros", pesquisa quantitativa, epidemiológica e transversal desenvolvida no período de 2008 a 2009. Foram realizadas análises de comparação e regressão dos dados de 671 idosos. Resultados: a avaliação da expectativa de suporte para o cuidado aos idosos mostrou-se um bom indicador de risco para ausência de expectativa de suporte em mulheres, idosos que residiam sozinhos e com percepção ruim da própria saúde. Conclusão: conclui-se que é preciso refletir sobre o sistema de suporte oferecido aos idosos no Brasil, visto que o perfil destes que estão em risco é cada vez maior na população. Ressalta-se também a importância da inserção de métodos subjetivos para avaliação da percepção dos idosos sobre suporte para o cuidado.

  20. O DUALISMO DO SER ÓRFICO NA EPÍSTOLA DE PAULO AOS ROMANOS

    Directory of Open Access Journals (Sweden)

    Roger Ribeiro da Silva

    2010-01-01

    Full Text Available Este trabalho consiste na comparação de fragmentos de textos encontrados na obra de Platão e na Epístola aos Romanos atribuída à Paulo. Retirados de inúmeros textos atribuídos a Platão, estes fragmentos tiveram confirmados indícios da teologia órfica pelo professor Alberto Bernabé Pajares. E ao aplicar a Metodologia de Analise do Discurso Teológico, desenvolvido especificamente para este trabalho, e comparado os resultados individuais, encontramos pontos de encontro entre as duas teologias, a Órfica e a Paulina, acentuando o que tange a crença no Dualismo do Ser. A problemática levantada neste trabalho se refere a como a representação1 da alma unida ao corpo, encontrada em escritos paulinistas, apresenta indícios de contatos com fundamentos órficos no berço do cristianismo.

  1. O enfermeiro frente ao desmame precoce na consulta de enfermagem à criança

    Directory of Open Access Journals (Sweden)

    Caroline Aparecida Coutinho Monteschio

    2015-10-01

    Full Text Available RESUMOObjetivo:analisar a atuação do enfermeiro frente ao desmame precoce em crianças menores de 6 meses de idade.Método:estudo descritivo de abordagem qualitativa. Participaram do estudo enfermeiros que realizavam consulta de enfermagem à criança de maneira programática em unidades de saúde da família em Cuiabá-MT. Os dados foram coletados nos meses de janeiro e fevereiro de 2012, por meio da observação participante da consulta de enfermagem. Para análise dos dados foi utilizada a análise de conteúdo.Resultados:os enfermeiros, na maioria das vezes, utilizaram estratégias apropriadas para o manejo dos problemas mais comuns na amamentação, apesar de algumas condutas não terem, ainda, evidência científica comprovada, quanto aos benefícios e/ou prejuízos à sua prática.Conclusão:os enfermeiros abordaram aspectos importantes do aleitamento materno durante as consultas e trabalharam em prol da promoção e do resgate ao aleitamento materno exclusivo.

  2. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  3. Jovens no trânsito: do sentido do dirigir ao desenvolvimento de consciência

    Directory of Open Access Journals (Sweden)

    Sonia Chébel Mercado Sparti

    2008-12-01

    Full Text Available Introdução: a complexa situação relativa à circulação humana tem suscitado muitas indagações. O advento do automóvel, ao lado das dimensões positivas, também trouxe consigo um conjunto de graves problemas, destacando-se pela sua magnitude e importância, os acidentes de trânsito. Objetivo: esta pesquisa buscou conhecer como a reflexão sobre o sentido do dirigir possibilita o desenvolvimento de consciência de jovens universitários/as. Metodologia: foram utilizadas duas Entrevistas Reflexivas, realizadas de maneira Coletiva, com dez universitários/as da PUC-São Paulo/campus Sorocaba, seguidas de devolução (com pré-análise dos dados. A opção pela Entrevista Reflexiva deveu-se, dentre outros fatores, ao seu caráter de intervenção, uma vez que a escuta atenta e respeitosa pode ser um momento de ajuda. A Grounded Theory foi utilizada para a organização dos dados. Resultados: este procedimento reflexivo possibilitou a compreensão dos aspectos positivos e negativos relativos à circulação humana e levantou fatores indicativos de prevenção: afirmações categóricas a respeito das próprias habilidades ao volante cederam lugar ao reconhecimento de que ainda há espaço para seu aperfeiçoamento; o olhar relativo ao outro foi se modificando, de maneira a considerá-lo parceiro, e não adversário; a preservação da vida sendo considerada um valor, em direção a um que fazer mais prudente, no espaço compartilhado do trânsito. Conclusão: estes resultados ratificam a proposta de que é possível (e desejável pensar a educação para o trânsito na perspectiva do desenvolvimento de consciência.

  4. Seca da semente de café ao sol Effect of sunlight on coffee seed viability

    Directory of Open Access Journals (Sweden)

    Oswaldo Bacchi

    1955-01-01

    Full Text Available O presente trabalho diz respeito a estudos realizados com o objetivo de observar a influência da luz solar sôbre a capacidade germinativa da semente despolpada de café e verificar, portanto, a possibilidade de se efetuar a seca desta semente exclusivamente ao sol. Além de um ensaio preliminar, foram efetuados mais outros dois, compreendendo, ao todo, duas secas ao sol, duas em um secador a baixa temperatura (±28°C, uma a sombra e uma em um secador a alta temperatura (±40°C. Pelas correlações entre as porcentagens de germinação e de umidade, que foram estabelecidas após diferentes períodos de secagem, foram tiradas as duas seguintes conclusões, que são as principais com relação ao objetivo dêstes ensaios : 1 Os raios solares são prejudiciais à capacidade germinativa da semente de café; sua nocividade acha-se, porém, intimamente ligada ao teor de umidade na semente. 2 À vista da conclusão acima, verifica-se que a semente despolpada de café e, muito provavelmente, também a não despolpada, podem ser perfeitamente sêcas a pleno sol sem que haja prejuízo para sua vitalidade, uma vez que sejam recolhidas antes que o seu teor de umidade caia abaixo do ponto crítico de 8% - 9%.In this paper the author deals with the question related to the coffee seed drying, with special attention to the effect of the sun radiations on seed viability. Based on the results obtained, the following conclusions were drawn : (a The sun rays have no specific influence on the viability of hulled coffee seed ; their effect is indirect and related to loss of moisture by the seed. (b Coffee seed can be dried in the sunlight without loss of viability if the water content does not drop under 8% to 9%. Below this critical level seed germination falls rapidly. (c The moisture content of coffee seed dried „in the sun may fall to about 7% in a short time with the consequent injury to viability. (d Under most conditions in the state of São Paulo

  5. Forma clínica e fatores de risco associados ao estrabismo na binocularidade visual

    Directory of Open Access Journals (Sweden)

    Maria Nice Araujo Moraes Rocha

    2016-02-01

    Full Text Available RESUMO Objetivo: Identificar e analisar fatores de risco associados ao estrabismo, dados oftalmológicos e antecedentes pessoais e familiares. Métodos: Estudo prospectivo, descritivo e analítico realizado com 240 pacientes que consultaram pela primeira vez nos ambulatórios de estrabismo. Foram avaliadas a frequência e associação entre estrabismo, dados de exames oftalmológicos e antecedentes pessoais e familiares para identificação dos fatores de risco. Resultados: Observou-se maior prevalência de estrabismo em mulheres (56,96% em relação aos homens (43,02%. A faixa etária mais atendida no ambulatório de estrabismo foi composta de crianças até 15 anos de idade (83,54%. Encontrou-se mais esotropia (55,27% que exotropia (42,20% e parcela menor de estrabismo vertical isolado (2,53%. A prematuridade foi associada ao estrabismo convergente (p=0,023 e não ao divergente (p=0,086. O diabetes mellitus materno foi associado à esotropia (p=0,024 e exotropia (p=0,036 no filho, mas a hipertensão arterial materna, uso de medicamentos para hipertensão e diabetes durante a gravidez e drogas ilícitas não foram estatisticamente significativos. Pacientes com paralisia cerebral tiveram mais associação com exotropia (p=0,008 que esotropia (p=0,019. Malformações congênitas, consanguinidade entre os pais e traumas oculares não apresentaram associação estatisticamente significativa para o estrabismo. A maioria dos pacientes com estrabismo apresentou boa acuidade visual corrigida e fundoscopia normal. Na análise de proporções a hipermetropia foi mais frequente na esotropia (68,7%. Conclusão: Os fatores de riscos internos e externos podem interferir na formação e desenvolvimento do olho na fase de plasticidade ocular, com prejuízo da binocularidade visual, podendo resultar em estrabismo. Há divergências com relação aos fatores de risco realmente associados e mais estudos são necessários para a identificação.

  6. Alterações reprodutivas em ratos machos expostos perinatalmente aos frutos da Solanum lycocarpum

    Directory of Open Access Journals (Sweden)

    Aline Schwarz

    2009-04-01

    Full Text Available Ratas prenhes foram tratadas do dia 06 da gestação (GD 06 ao dia 07 pós-natal (PND 07 com frutos verdes secos e moídos da Solanum lycocarpum (10% na ração. Após nascimento das ninhadas, foi avaliado na prole masculina adulta aos 60 e 90 dias de vida, o número de espermátides e a produção espermática diária nos testículos e o tempo de trânsito espermático no epidídimo. A exposição não foi capaz de promover alterações na produção espermática diária (DSP e no número de espermátides produzidas pelo testículo dos ratos expostos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação. Não foram observadas alterações no tempo de trânsito espermático na cabeça do epidídimo, porém, foi constatado menor número de espermatozóides no corpo/cauda do epidídimo nos machos experimentais com 90 dias de vida, provavelmente resultante do menor tempo de trânsito espermático observado no corpo/cauda do epidídimo aos PND 90. Estes dados sugerem que a exposição de ratos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação, não foi suficiente para promover alterações na produção mas sim no trânsito espermático, indicando possível alteração no eixo hormônio liberador das gonadotrofinas hipotálamo-hipófise-gônada

  7. Expressao genica associada ao estresse oxidativo no coracao de camundongo apos isquemia intestinal

    Directory of Open Access Journals (Sweden)

    Frederico Somaio Neto

    2014-03-01

    Full Text Available FUNDAMENTO: O fenômeno da isquemia e reperfusão intestinal é um evento frequente na clínica e está associado a repercussões deletérias em órgãos a distância, em especial ao coração. OBJETIVO: Investigar a expressão gênica do estresse oxidativo e defesa antioxidante no coração de camundongos isogênicos, submetidos a isquemia e reperfusão intestinal (IR. MÉTODOS: Doze camundongos (C57BL/6 foram distribuídos em dois grupos: Grupo IR (GIR com 60 min de oclusão da artéria mesentérica superior, seguidos de 60 min de reperfusão. Grupo Controle (GC submetidos a anestesia e a laparotomia sem o procedimento de IR observados por 120 min. As amostras de intestino e coração foram processadas pelo método (RT-qPCR / Reverse transcriptase - quantitative Polymerase Chain Reaction para determinar a expressão gênica de 84 genes relacionados ao estresse oxidativo ("t" de Student, p < 0,05. RESULTADOS: Observou-se no tecido intestinal (GIR uma expressão significantemente aumentada em 65 (74,71% genes em relação ao tecido normal (GC, e 37 (44,04% genes estiveram hiperexpressos (maior que três vezes o limiar permitido pelo algoritmo. No tocante aos efeitos da I/R intestinal a distância no tecido cardíaco verificou-se a expressão significantemente aumentada de 28 genes (33,33%, mas somente oito genes (9,52% se hiperexpressaram três vezes acima do limiar. Quatro (7,14% desses oito genes se expressaram simultaneamente nos tecidos intestinal e cardíaco. No GIR notaram-se cardiomiócitos com núcleos de menor tamanho, picnóticos, ricos em heterocromatina e raros nucléolos, indicando sofrimento cardíaco. CONCLUSÃO: A I/R intestinal promoveu a hiperexpressão estatisticamente significante de oito genes associados ao estresse oxidativo a distância no tecido miocárdico.

  8. Would be the photon a composed particle? / Sobre a possibilidade da quantiza\\c{c}\\~ao dos fluxos de campo na radia\\c{c}\\~ao eletromagn\\'etica

    CERN Document Server

    Duarte, Celso de Araujo

    2013-01-01

    Here it is made a comparative analysis between the classical and the quantum expressions for the energy of electromagnetic radiation (ER). The comparison points to the possibility of the quantization of the magnetic and the electric field fluxes in the ER. ----- Apresenta-se uma an\\'alise comparativa entre as express\\~oes cl\\'assica e qu\\^antica para a energia da radia\\c{c}\\~ao eletromagn\\'etica (RE). A compara\\c{c}\\~ao nos aponta para a possibilidade de haver uma quantiza\\c{c}\\~ao dos fluxos dos campos magn\\'etico e el\\'etrico na RE.

  9. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22

    Directory of Open Access Journals (Sweden)

    Bhave Mrinal

    2009-03-01

    Full Text Available Abstract Background Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22, a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Findings Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. Conclusion TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  10. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22.

    Science.gov (United States)

    Ng, Shee Ping; Davis, Belinda; Palombo, Enzo A; Bhave, Mrinal

    2009-03-07

    Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22), a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA) and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  11. Avaliação da eficácia da terapia fotodinâmica como adjunto ao tratamento periodontal de pacientes com periodontite agressiva

    OpenAIRE

    Flavia Bomfim Garcia

    2010-01-01

    A periodontite agressiva é um processo inflamatório de origem bacteriana mediado pelo sistema imunológico do hospedeiro e é provavelmente a forma mais grave de doença periodontal, apresentando destruição das estruturas tanto de proteção quanto de suporte dentário, num período relativamente rápido, normalmente levando a perda prematura dos elementos dentários e, em alguns casos, terapia antimicrobiana adjunta é necessária em adição à terapia mecânica. O objetivo do presente ensaio clínico rand...

  12. Recarga artificial de aquíferos:aplicação ao sistema aquífero da Campina de Faro

    OpenAIRE

    Roseiro, Catarina Mota dos Santos Diamantino, 1972-

    2009-01-01

    Tese de doutoramento, Geologia (Hidrogeologia), 2009, Universidade de Lisboa, Faculdade de Ciências A investigação realizada nesta Tese de Doutoramento enquadra-se no âmbito do Projecto Comunitário GABARDINE, financiado pelo 6º Programa-Quadro de Investigação da União Europeia, desenvolvido no Núcleo de Águas Subterrâneas (NAS) do Laboratório Nacional de Engenharia Civil (LNEC). O seu objectivo consistiu por um lado, no aprofundar dos conhecimentos relativamente às metodologias de recarga ...

  13. Medicina moderna: rumo à prevenção, à cura, ao bem-estar e à longevidade

    OpenAIRE

    Ajai Singh

    2010-01-01

    A medicina moderna tem realizado muitas coisas nos campos de doenças infecciosas e de emergências para assistir a cura. Na maior parte dos outros campos, ela visa, sobretudo, ao controle, que é outro nome para o tratamento paliativo. A farmacologia, na qual se inclui a psicofarmacologia, é igualmente dirigida ao controle e ao alívio. Está na hora de profissionais da área e pesquisadores voltarem-se decisivamente para a prevenção e para a cura. Ademais, o outro grande desafio da medicina moder...

  14. Trabalho experimental de combate ao acaro rajado Tetranychus urticae Koch, 1836 com formulações aplicadas por "electrodyn"

    OpenAIRE

    Arashiro,F.Y.; Silva, J. M.; Sugamara,C. A.; Motta, R; Raizer,A.J.; MARICONI,F.A.M.

    1987-01-01

    O presente trabalho teve como objetivo o combate experimental ao ácaro rajado Tetranyohus urtioae Koch, 1836 em cultura de algodão. Dois produtos, mediante pulverização eletrodinâmica, foram experimentados: bromopropilato e bifentrina, o primeiro em duas dosagens e o segundo, em três. Aos dias da aplicação, a bifentrina mostra os melhores resultados, embora não se diferencie es tatisticamente do bromopropilato. Aos 09 dias, os melhores são as duas dosagens mais fortes da bifentrina apesar de ...

  15. Relative importance of the AO, NAO and Aleutian Low in predicting regional climate change

    Science.gov (United States)

    Paeth, H.; Rauthe, M.; Hense, A.

    2003-04-01

    In recent years, several observational and climate model studies have drawn a picture of Northern Hemisphere circulation modes which are largely sensitive to the greenhouse forcing with implications for regional climate change. The dominant candidates are the Arctic Oscillation (AO), the North Atlantic Oscillation (NAO) and the Aleutian Low (AL). Here, we consider all these modes equally and try to get insight into their relative importance with respect to temperature and rainfall variability over the Northern Hemisphere. The relative importance of AO, NAO and AL time series is determined by stepwise multiple regression with cross validation at every grid point of the globe. This tool is appropriate to sort the predictors - AO, NAO and AL - by their relative contribution to temperature and rainfall predictability and to evaluate the predictability with respect to an independent control data set. This allows to cut off the number of predictors as soon as the mean square error between the multiple regression model and the control data set is increasing. For better reliability of our results, the procedure is applied many times with 100 permutations. This part is based on the NCEP reanalysis data set. For estimating future temperature and rainfall anomalies, a broad model intercomparison study has been carried out, including most state-of-the-art models of the international modeler community. For each circulation mode superensemble-mean time series under greenhouse-gas (GHG) only and GHG plus sulphate aerosol conditions are determined respectively. Concerning annual-mean temperature, the total explained variance by an optimal number of predictors amounts to 60% over northern Europe, Siberia and North America. At most grid points of the Northern Hemisphere, the AO is the most prominent mode, also in the European-Atlantic sector where the NAO is supposed to be the main player. In the North Pacific sector and in some regions of the low latitudes the AL is dominating. The

  16. A contribution to our knowledge of Leonurus L., i-mu-ts'ao, the Chinese motherwort.

    Science.gov (United States)

    Hu, S

    1976-01-01

    This article deals with the ethnobotanical aspects of the Chinese motherwort. Since time immemorial the Chinese people have used various parts of motherwort to meet different physical needs. By the time a written language was developed and the medical uses were recorded. , motherwort was treated as an article of superior quality. At present, under the name of i-mu-ts'ao, the plant is used for improving bloodflow both by official physicians and herbal practitioners throughout the country as well as by villagers in isolated areas. According to Chinese classical literature on materia medica, the early uses were limited to the parts of the plant which met the most obvious needs of the prehistorical people in their struggle for existence-food and pain reliever. Evidently, in their search for food, the ancient people found that the four nutlets contained in the dry and spinose calyx of the Chinese motherwort resemble the seasame seed in size and oil content. They gathered them and used them for food in similar manner as with the sesame. Consequently, they discovered the good effects to the eyesight, the improvement of strength, and the uplift of spirit. These discoveries led to the use of the seed of the species as an eye medicine for improving the eyesight, and as a tonic for the increase of strength and the elevation of spirit. Contagious skin diseases caused serious problems for the ancient people. The use of the leafy shoot for a bath to release the discomfort of itches and shingles was also recorded in the 42-word first medicinal record of the species in the earliest known Chinese materia medica-the Shen-nung pen-ts'ao-ching. Translators of the Chinese classics have included the records of i-mu-ts'ao. According to my knowledge, these works are all partial translations with the selections of the medicinal properties and the omissions on the methods of preparation. They have the outline and abandon the details. Consequently most of them are not clear. In order to

  17. Ansiedade ao tratamento odontológico em atendimento de urgência

    Directory of Open Access Journals (Sweden)

    Kanegane Kazue

    2003-01-01

    Full Text Available OBJETIVO: Avaliar a freqüência de pacientes com ansiedade ou medo do tratamento odontológico em um setor de urgência. MÉTODOS: Participaram do estudo 252 pacientes, com 18 anos ou mais, que compareceram ao setor de urgência de uma faculdade de odontologia, de São Paulo, SP, entre agosto e novembro de 2001. Para avaliar a ansiedade, foram utilizadas a Modified Dental Anxiety Scale (MDAS, e a Escala de Medo de Gatchel. O grupo estudado respondeu a questões sobre: tempo decorrido desde a última visita ao dentista e desde o início dos sintomas, escolaridade, renda familiar e história prévia de trauma. Os resultados foram analisados pelos testes estatísticos (chi2 e Teste Exato de Fisher. RESULTADOS: Foram identificados 28,2% de indivíduos com algum grau de ansiedade, segundo a MDAS, na qual as mulheres foram consideradas mais ansiosas que os homens (chi2=0,01; e 14,3% de pacientes com alto grau de medo segundo a Escala de Medo de Gatchel. Em 44,4% da amostra a demora para procura de alívio dos sintomas foi > sete dias. Mulheres ansiosas procuraram atendimento mais rapidamente e em maior número. Experiência traumática anterior ocorreu em 46,5% dos pacientes ansiosos. Não foi possível relacionar escolaridade e renda familiar com ansiedade e/ou medo. CONCLUSÕES: Pacientes ansiosos, com destaque para as mulheres, são freqüentes no atendimento odontológico de urgência. Experiência prévia traumática mostrou-se importante para o desenvolvimento da ansiedade em relação ao atendimento odontológico.

  18. Proteinorraquia total: variações relacionadas ao sexo e à idade

    Directory of Open Access Journals (Sweden)

    A. Spina-França

    1963-03-01

    Full Text Available Foi estudada a proteinorraquia total de 1.011 pacientes com LCR normal para investigar a influência da idade e do sexo. O método empregado para a determinação da concentração protêica foi o turbidimétrico do ácido tricloracético. A influência do fator etário foi estudada entre 3 meses e 70 anos de idade. Os resultados permitiram verificar que a concentração protêica do LCR é maior entre 3 e 6 meses de idade. Entre 1 e 40 anos de idade os valores médios são próximos entre si, situando ao redor de 16 e 18 mg por 100 ml. A partir de 40 anos de idade verifica-se tendência para ser progressivamente maior a proteinorraquia total. Essa tendência se acentua com o avançar da idade. Em relação ao sexo, foi verificado que a proteinorraquia total tende a ser maior no homem do que na mulher. A diferença entre as médias encontradas para os homens e mulheres foi estatisticamente significante. Êsses dados confirmam observações anteriores, caracterizando-os em relação ao método empregado para a determinação da concentração protêica do LCR.

  19. Da casa ao hotel: entre a hospitalidade e a economia do turismo

    Directory of Open Access Journals (Sweden)

    Felipe José Comunello

    2015-01-01

    Full Text Available O município de São Joaquim, na região serrana de Santa Catarina, tem sido destacado pela imprensa escrita e televisiva nacional como a cidade mais fria do Brasil, ao longo dos últimos vinte anos. Em pesquisa realizada para tese de doutorado, identifiquei que muitas proprietárias de pousadas, as “pousadeiras” como elas mesmas se chamam, começaram abrigando turistas em dificuldades em dias de frio intenso, quando não há hotéis e pousadas suficientes na cidade. A partir disso, elas acreditaram ser possível transformar suas casas em pousadas, tendo diante de si um problema também compartilhado com os profissionais do turismo, a chamada sazonalidade dos turistas. Tal fato provoca dúvidas sobre a sustentação econômica das pousadas e inquietação aos profissionais quanto ao sucesso econômico do turismo. Nesse artigo, isso é analisado tendo como referência uma proposta de parceria recebida por meus interlocutores por parte da operadora de turismo CVC e da empresa de eventos da RBS, afiliada da Rede Globo em Santa Catarina. A discussão é em torno de questões a partir de uma antropologia da hospitalidade. A análise sugere que essa parceria ameaça uma ordem moral estabelecida com base em determinados valores de hospitalidade para com estranhos, principalmente o aquecimento perante o frio.

  20. AO3D: A Monte Carlo code for modeling of environmental light propagation

    Energy Technology Data Exchange (ETDEWEB)

    Bates, David E. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)], E-mail: bates@higp.hawaii.edu; Porter, John N. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)

    2008-07-15

    A Monte Carlo radiative transfer program (Atmosphere-Ocean 3-Dimensional, AO3D) for modeling the coupled atmosphere-ocean environment has been developed. The code allows for the specification of optical properties for the atmosphere, land and ocean. Light rays are tracked as they pass between the atmosphere and the ocean, reflect off the ocean surface, the ocean floor, and off land, or are absorbed. In this version the polarization of light rays is not considered. The optical properties of each horizontally homogeneous layer within the atmosphere and ocean can be set on a layer-by-layer basis with a choice of phase functions, absorption and scattering coefficients, and index of refraction. A wind-dependent Cox and Munk ocean surface realization (with whitecaps) is implemented to model refraction and reflection from surface waves. Either spherical- or flat-Earth models can be used, and all refraction and reflection are accounted for. The AO3D model has been tested by parts, and as a whole by comparison with single- and total-scattering calculations from other radiative transfer codes. Comparisons with Monte Carlo calculations by Adams and Kattawar (agreement in TOA radiance within the published precision {approx}2%), MODTRAN4 (agreement in spherical-shell atmosphere (SSA) sky radiance within about 2%) and Coupled DIScrete Ordinate Radiative Transfer (COART) (agreement in plane-parallel (PP) sky radiance within 2%) are shown. Sun photometer measurements (including large air mass values) at the Mauna Loa Observatory are compared to AO3D simulations (for a spherical Earth) and suggest that a thin aerosol layer was present above the observatory at the time of the measurements.

  1. Treatment of AO/OTA 31-A3 intertrochanteric femoral fractures with a percutaneous compression plate

    Directory of Open Access Journals (Sweden)

    Fei Luo

    2014-01-01

    Full Text Available OBJECTIVE: AO/OTA 31-A3 intertrochanteric femoral fractures have completely different fracture line directions and biomechanical characteristics compared with other types of intertrochanteric fractures. The choice of the fixation method has been a focus of dispute among orthopedic trauma surgeons. The purpose of this study was to review the outcomes of these fractures treated with a percutaneous compression plate at our institute. METHOD: Seventeen patients with AO/OTA 31-A3 intertrochanteric femoral fractures were treated with a percutaneous compression plate at our institute from January 2010 to December 2011. The clinical data and imaging results were retrospectively analyzed. RESULTS: The medical complication of popliteal vein thrombosis occurred in one patient. Sixteen patients were followed up for 12 to 21 months. Two patients had malunion and mild pain. Fracture collapse occurred in two patients, with one having head penetration. These two patients had moderate pain. There were no occurrences of nonunion or reoperation. The mean Harris hip score obtained during the last follow-up was 84.1 (61-97. Patients with a poor quality of reduction were more likely to have pain results (p = 0.001. A trend existed toward the presence of a poor quality of reduction (p = 0.05 in patients with a collapse of fracture. Patients with poor preoperative mobility were more likely to have a lower Harris hip score (p = 0.000. CONCLUSION: The percutaneous compression plate is an alternative device for the treatment of AO/OTA 31-A3 intertrochanteric femoral fractures. Good fracture reduction and an ideal placement position of the neck screw are important in the success of the device.

  2. Adesão ao tratamento no transtorno bipolar Compliance to treatment in bipolar disorder

    Directory of Open Access Journals (Sweden)

    Aida Santin

    2005-01-01

    Full Text Available O transtorno bipolar (TB é uma doença crônica, recorrente, presente em 1,5% da população, estando associada a altas taxas de mortalidade e prejuízos socioeconômicos. O lítio, a carbamazepina e o ácido valpróico são os estabilizadores de humor mais usados. Em tratamentos prolongados, como é o caso do TB, a má-adesão dos pacientes é uma das maiores dificuldades. Verifica-se que fatores ligados ao paciente, aos medicamentos e aos médicos possam ser responsáveis pela baixa adesão. A psicoeducação, a terapia cognitivo-comportamental e a terapia focada na família são estratégias propostas para o aumento da adesão.Bipolar disorder (BD is a chronic and recurrent illness that occurs in 1,5% of the population. This illness is associated with high rates of mortality and social/economic burden. Lithium, carbamazepine and valproic acid are the most used mood stabilizers. In long term treatments, as in BD, one of the main difficulties is the patient's adherence. It appears that factors associated to the patient, drug and the physician are responsible for the low adherence. The use of psycho-education, cognitive-behavioral therapy and focused family therapy have been put forward as a means to increase adherence.

  3. Desempenho de bezerros aleitados com soro de queijo em associação ao colostro

    Directory of Open Access Journals (Sweden)

    Renata Nayhara de Lima

    2012-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o desempenho de bezerros mestiços, aleitados com soro de queijo em associação ao colostro. Foram utilizados 24 bezerros Holandês x Zebu, distribuídos em delineamento inteiramente casualizado, com três tratamentos e oito repetições. Os tratamentos consistiram de: leite integral, 50% de leite integral + 50% de soro de queijo, e 30% de colostro + 70% de soro de queijo. O desenvolvimento dos bezerros foi avaliado até os 60 dias de idade, por meio de pesagens semanais e mensurações corporais. Para a estimativa de consumo, foram feitas medições diárias de consumo da dieta sólida, pelo método oferta/sobra. O desempenho econômico foi avaliado pelo cálculo de indicadores de custos e receitas, e de medidas de resultados econômicos. Não houve influência da dieta líquida sobre o consumo de matéria seca e sobre as médias de medidas corporais dos bezerros. Foram observadas diferenças significativas no ganho de peso dos animais na segunda e na quarta semanas de vida. A dieta com colostro apresentou o maior lucro adicional em comparação ao tratamento controle. A associação do soro de queijo ao colostro é a opção mais vantajosa economicamente, já que a substituição de 100% do leite por esses subprodutos não prejudicou o desempenho dos animais.

  4. Gastrite hemorrágica por alergia ao leite de vaca: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Machado Rodrigo Strehl

    2003-01-01

    Full Text Available OBJETIVO: descrever dois lactentes com gastrite hemorrágica, devido à alergia ao leite de vaca. DESCRIÇÃO DOS CASOS: ambos os pacientes apresentavam hematêmese, vômitos e desnutrição. Os pacientes apresentavam infiltrado eosinofílico em mucosa gástrica biopsiada e resolução dos sintomas após o início de dieta com exclusão da proteína do leite de vaca. COMENTÁRIOS: gastrite hemorrágica devido à alergia ao leite de vaca é um diagnóstico incomum. Até o momento foram relatados 10 pacientes com gastrite alérgica, e as principais manifestações clínicas são vômitos, desnutrição, anemia e hematêmese. A gastrite por alergia ao leite de vaca pode apresentar-se em diferentes graus de gravidade, e pode ser subdiagnosticada em muitos pacientes. A menos que o tratamento correto seja iniciado, o paciente desenvolverá desnutrição protéico-calórica grave e anemia. Doença alérgica do trato gastrointestinal superior deve ser considerada em todos os lactentes com vômitos recorrentes, particularmente se complicado com hematêmese. O diagnóstico de gastrite alérgica é clínico, auxiliado pela endoscopia e anatomia patológica.

  5. Direito ao aborto, gênero e a pesquisa jurídica em direitos fundamentais

    OpenAIRE

    Azevedo, André Freire

    2017-01-01

    Resumo A partir de um retrato da situação atual do abortamento inseguro e de uma breve reconstrução das lutas feministas pela descriminalização do aborto no Brasil, o trabalho discute o papel do constitucionalismo democrático no reconhecimento de novos sujeitos de direitos sexuais e reprodutivos. Recorremos ao fundamento político-filosófico dos direitos sexuais e reprodutivos para apontar que sua regulamentação jurídica só tem validade se os “sujeitos de direitos” construídos e pressupostos p...

  6. Abordagem ao Doente “ABCDE”. Biomecânica do Trauma

    OpenAIRE

    Amaral, T

    2013-01-01

    Apresentação na qual é efectuada uma caracterização epidemiológica do Trauma comparando a distribuição bimodal vs trimodal assim como a causa e local de morte. De seguida são definidos cuidados emergentes a nível pré-hospitalar e as competências indispensáveis à práxis por parte do Enfermeiro. Por último reflectimos de que forma a abordagem e o assegurar do continuum de cuidados desde o pré-hospitalar à UCI (com passagem no SU) contribuem para a melhoria dos cuidados ao doente politraumatizad...

  7. AIDS e religiosidade: influências intersubjetivas aos acometidos pela epidemia

    OpenAIRE

    Silva, Paulo Emanuel

    2009-01-01

    Nos dias atuais, apesar de todas as informações inerentes aos mais diversos tipos de doenças, algumas delas ainda são motivos de angústia, receios e preconceitos. Na antiguidade, a lepra e a peste e, a partir do século XIX, o câncer, a sífilis e a tuberculose permeavam as mentalidades e marcavam seus portadores, uma vez que os significados das doenças iam além de seus diferentes sintomas. Algo semelhante vem ocorrendo no mundo contemporâneo no que diz respeito à Síndrome da Imu...

  8. Educação: pensadores ao longo da história: Seymour Papert

    OpenAIRE

    Sousa, João Sérgio de Pina Carvalho (Ed.); Meirinhos, Manuel; Patrício, Maria Raquel; Gonçalves, Vitor

    2016-01-01

    Seymour Aubrey Papert (1928-2016) natural de Pretória, África do Sul, faleceu aos 88 anos nos Estados Unidos da América. Matemático de renome mundial, pioneiro da inteligência artificial e da computação educacional, foi docente do MIT Media Lab. Este poster evidencia os principais fundamentos teóricos e práticos da sua obra pedagógica, a atualidade da sua pedagogia e as suas implicações na educação. info:eu-repo/semantics/publishedVersion

  9. Future use of silicon photomultipliers for K AOS at MAMI and P¯ANDA at FAIR

    Science.gov (United States)

    Achenbach, P.; Lorente, A. Sanchez; Majos, S. Sánchez; Pochodzalla, J.

    2009-10-01

    A characterization of scintillating fibres with silicon photomultiplier read-out was performed in view of their possible application in fibre tracking detector systems. Such a concept is being considered for the K AOS spectrometer at the Mainz Microtron MAMI and as a time-of-flight start detector for the hypernuclear physics programme at the P¯ANDA experiment of the FAIR project. Results on particle detection efficiency and time resolution are discussed. In summary, the silicon devices are very suitable for the detection of the low light yield from scintillating fibres insofar a trigger scheme is found to cope with the noise rate characteristics.

  10. Concepções de mulheres sobre a terminologia relativa ao aparelho reprodutor feminino

    OpenAIRE

    Celina Deves Marques

    2005-01-01

    Esta é uma pesquisa qualitativa fenomenológica com embasamento filosófico na fenomenologia da percepção de Merleau-Ponty. Tem como propósito conhecer as concepções das mulheres sobre a terminologia relativa ao aparelho reprodutor feminino. Os sujeitos do estudo foram 10 mulheres não-gestantes, não-puérperas e não-nulíparas usuárias do Programa de Saúde da Família (PSF) Jenor Jarros. O instrumento de pesquisa utilizado foi entrevista semi-estruturada no qual perguntava-se sobre o significado d...

  11. On random walk de Lévy aplicado aos mapas de variâncias

    Science.gov (United States)

    Klafke, J. C.

    2003-08-01

    Uma pergunta que surge ao nos confrontarmos com os mapas de variâncias, ou s-Maps [Klafke, J. C. "Estudo da Difusão Caótica em Ressonâncias Asteroidais", Tese de Doutorado, IAG/USP, 2002] diz respeito ao conteúdo físico de tais representações do espaço de fase. Ou seja, o que representa as variâncias das ações obtidas para uma determinada condição inicial e como relacioná-las com o tempo de difusão das órbitas, supondo-se que estas de fato estejam envolvidas em um processo difusivo? Para discutirmos essa questão, lançamos mão da modelagem dos processos estocásticos subjacentes às variâncias determinadas e implementamos uma série de simulações do tipo Monte Carlo a partir das informações registradas nos s-Maps calculados para algumas ressonâncias asteroidais bem estudadas (p.ex. 3: 1, 2: 1 e 3: 2). Para tanto, temos usado uma função de densidade de probabilidade gaussiana ao definir os n passos que permitirão estabelecer uma relação direta entre o Mapa de Difusão e o Mapa de Variâncias. Contudo, os resultados obtidos até agora tem subestimado o tempo de difusão esperado para os fenômenos conhecidos. Tal se deve ao fato de que, no processo difusivo real, é possível existirem passos de comprimento consideravelmente maiores que a média estabelecida pelas distribuições gaussiana ou normal, sobretudo quando se cruza uma região caótica. Neste trabalho, apresentamos os resultados comparativos de simulações de Monte Carlo com base no random walk de Lévy [Klafter, J. et al. 2002. "Beyond Brownian motion", Phys. Today, Feb, 33-39.], o qual possibilita passos esporádicos de comprimento acima do valor médio (saltos) permitindo estabelecer uma escala de tempo mais próxima da esperada para a difusão.

  12. Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor

    Science.gov (United States)

    2016-03-10

    AFRL-AFOSR-VA-TR-2016-0126 DURIP 09) AN ATOMIC OXYGEN FLUX MONITOR FOR USE IN THE SEARCH FOR NEW AND BETT Malcolm Beasley LELAND STANFORD JUNIOR UNIV...Grant # FA9550-01-1-0433 M. R. Beasley, PI Stanford University Project Title: Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor...with its ability to achieve controlled layer-by-layer growth on the atomic level. In the case of oxides and nitrides, one problem has been the lack

  13. Translation between the Neer- and the AO/OTA-classification for proximal humeral fractures

    DEFF Research Database (Denmark)

    Brorson, Stig; Eckardt, Henrik; Audigé, Laurent

    2013-01-01

    The reporting and interpretation of data from clinical trials of proximal humeral fractures are hampered by the use of two partly incommensurable fracture classification systems: the Neer classification and the AO/OTA classification. It remains difficult to interpret and generalize results......, to conduct prognostic studies, and to obtain consensus on treatment recommendations when concise definitions and a common 'fracture language' are lacking. Thus, we compared both classifications systems using primary data from large clinical studies to assess how thoroughly both systems conveyed clinically...

  14. Peru: cultivo de coca, cocaína e combate ao narcotráfico

    Directory of Open Access Journals (Sweden)

    Marcelo Santos

    2010-06-01

    Full Text Available O artigo apresenta uma breve análise sobre a atual situação dos cultivos de coca, produção de cocaína e combate ao narcotráfico no Peru.

  15. Mortalidade atribuível ao tabagismo no Brasil em 2003

    OpenAIRE

    Paulo Cesar Rodrigues Pinto Correa

    2007-01-01

    Existem vários métodos para fazer a estimativa da mortalidade atribuível ao tabagismo (MAT). Estimativas confiáveis da MAT são muito importantes para planejar, implementar e avaliar o impacto de programas de controle do tabagismo. A presente dissertação descreve o resultado de uma revisão dos artigos sobre MAT publicados nas bases Medline, Lilacs e Bireme até 20/10/2005. Foram identificados e analisados sete métodos para cálculo da mesma. O método de Levin, o primeiro a ser descrito - em 1953...

  16. Suscetibilidade do capim-colonião e de cultivares de milho ao flúor

    Directory of Open Access Journals (Sweden)

    Rimena Ramos Domingues

    2011-01-01

    Full Text Available A emissão de fluoretos à atmosfera oriunda da produção de superfosfatos e de cerâmica tem causado preocupação pelo efeito tóxico às plantas, contudo são poucos os estudos desenvolvidos acerca do problema com espécie de interesse econômico agrícola. Desenvolveu-se o estudo para avaliar o efeito do flúor (F atmosférico em plantas de capim-colonião e de cultivares de milho, utilizando como referência espécies bioindicadoras do tipo sensível e tolerante. As plantas foram expostas à contaminação pelo F atmosférico por curtos períodos durante 32 dias em sistema de nebulização com 0,16 mol L-1 de ácido fluorídrico no ambiente interno de uma câmara (~0,20 mmol m-3 de F, havendo um controle não exposto, com quatro repetições. A exposição das plantas ao F causou aumento da concentração do elemento nas folhas até 60 mg kg-1 para o capim-colonião, e entre 100 mg kg-1 nas folhas novas e 170 mg kg-1 nas folhas velhas para quatro cultivares de milho, o que demonstrou o efeito cumulativo do elemento no ambiente. Sintomas visuais da toxicidade foram observados nas plantas e se caracterizaram pela ocorrência de cloroses e necroses na lâmina foliar. O capim-colonião é uma espécie bastante sensível ao poluente no ar. As cultivares de milho DKB 390 e Ômega 8315 também são mais sensíveis ao F quando comparadas às AG7088 e 2B707. Os teores de clorofila a nas plantas foram mais afetados pelo F em relação aos teores de clorofila b.

  17. Var??n de 30 a??os con dolor pretibial bilateral

    OpenAIRE

    Vargas-Hitos, Jos?? Antonio; Garc??a-Castro, Jos?? Miguel; Ja??n- ??guila, Fernando; Jim??nez-Alonso, Juan

    2012-01-01

    Var??n de 30 a??os que consultaba por dolor intenso y progresivo de dos meses de evoluci??n localizado en la cara anterior y distal de ambas piernas sin factor desencadenante aparente y mala respuesta a tratamiento analg??sico convencional. El paciente negaba otros s??ntomas a excepci??n de un rash eritematoso no pruriginoso generalizado que hab??a afectado tronco, palmas y plantas y que hab??a sido considerado como una reacci??n de hipersensibilidad a alguna de las medicaciones p...

  18. Fenómenos cognitivos subjacentes ao milenarismo: quando uma profecia falha

    OpenAIRE

    Soares Martins, José; Cameira, Miguel

    2012-01-01

    Apresenta-se o conceito de dissonância cognitiva (Festinger, 1957) como o mecanismo cognitivo explicativo do proselitismo que frequentemente sucede a profecias não verificadas. Pormenorizam-se as características da dissonância cognitiva ao nível individual e as tácticas de redução do desconforto provocado pela existência de cognições contraditórias (crença-evidência empírica). Discriminam-se as condições propostas por Festinger et al (1956) para o surgimento da necessidade de angariar novos c...

  19. Cateterismo cardíaco esquerdo: lacunas nas informações transmitidas aos pacientes

    OpenAIRE

    Cavalcanti,Taciana de Castilhos; Sarmento-Leite, Rogério; Carlos A.M. Gottschall; de Quadros, Alexandre Schaan; Goldmeier,Sílvia; De Souza, Emiliane Nogueira; de Moraes, Maria Antonieta Pereira

    2008-01-01

    INTRODUÇÃO: A prática dos procedimentos na Cardiologia Intervencionista está marcada por grandes avanços, mas o mesmo não se verifica no trato das informações e conhecimento dos pacientes acerca do tema. É imperativa a necessidade de consolidar as orientações transmitidas aos pacientes, instruindo-os sobre os benefícios alcançados pela sua compreensão sobre os exames invasivos. OBJETIVO: Verificar o conhecimento dos pacientes submetidos a cateterismo cardíaco em um hospital especializado em C...

  20. Por uma abordagem relacional ao conceito de vida no ensino de biologia

    OpenAIRE

    Coutinho,Francisco Ângelo; Martins,Rogério Parentoni; Ribeiro, Natália Almeida

    2015-01-01

    Segundo a teoria de perfil conceitual, o conceito “vida” possui três zonas diferenciadas correspondentes a três modos de compreensão. A internalista concebe “vida” como processo, propriedade ou objeto inerente ao vivente. A externalista propõe “vida” desvinculada do vivente, ou seja, vida apenas teria sentido a partir de uma referência externa como, por exemplo, admitem certas concepções religiosas e filosóficas. A relacional admite que vida deva expressar uma relação entre entidades e/ou sis...

  1. Ao serviço do líder: as campanhas eleitorais do Partido Socialista

    OpenAIRE

    Marco Lisi

    2008-01-01

    Este artigo procura analisar a evolução das campanhas eleitorais do Partido Socialista entre 1976 e 2005, evidenciando as suas principais características organizativas ao nível nacional e local. As conclusões apontam para a importância dos especialistas externos e para o reforço da centralização, que contribuem para o aumento da autonomia do líder socialista.This article analyses the development of the Socialist Party's election campaigns between 1976 and 2005, revealing their main organizati...

  2. Novas abordagens terapêuticas no combate ao Envelhecimento Cutâneo

    OpenAIRE

    Santos, Joana Loureiro Marques dos

    2011-01-01

    Trabalho apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Ciências Farmacêuticas. O envelhecimento cutâneo é um processo complexo e multifatorial, que resulta em alterações funcionais e estéticas da pele. Os avanços na biologia da pele têm aumentado a compreensão da homeostasia deste órgão, assim como do seu processo de envelhecimento, levando ao desenvolvimento de tratamentos e técnicas com a finalidade de prevenir este mecanismo e de...

  3. Pela atenção ao comum: entrevista com Muniz Sodré

    Directory of Open Access Journals (Sweden)

    Anelise Angeli De Carli

    2017-09-01

    Full Text Available A entrevista com Muniz Sodré propõe ao teórico da comunicação algumas perguntas que atravessam a sua proposta de pensamento ampliado para o termo comunicação. O autor fala sobre a linguagem na perspectiva da reflexividade e sobre os efeitos e as limitações do bios midiático. Ainda, Sodré propõe pensar o algoritmo das tecnologias de informação como um tipo de imagem do contemporâneo.

  4. A visita de um afro-americano ao paraíso racial

    OpenAIRE

    Petrônio Domingues

    2006-01-01

    Em 1923, o jornalista e empresário afro-americano Robert Abbott visitou o Brasil. De volta aos Estados Unidos, publicou uma série de artigos no jornal Chicago Defender, informando que, aqui, os negros não enfrentavam problemas que dificultasse ou impedisse seu pleno desenvolvimento econômico, social, político, cultural, ou seja, eles viviam numa espécie de paraíso racial. A principal questão que vai ser investigada neste artigo é saber por que Abbott retratou um quadro tão mítico das relações...

  5. [Compression osteosyntheses with the new AO universal nail. Functional principle and biomechanical prerequisites].

    Science.gov (United States)

    Ritter, G

    1991-01-01

    The new AO universal nail, with its special construction, allows extremely stable compression osteosynthesis in correctly selected fractures. Compression osteosynthesis with an intramedullary brace has definite advantages for fracture healing and biomechanics. The basic requirement, especially for the long-term maintenance of pressure, is truly stable anchorage of the locking bolts in the bone. Previous investigations by the author have shown that this is only possible in the shaft of the bone. Anchoring stability is not sufficient in the cancellous juxta-articular bone. Five years of clinical experience fully confirm the theoretical expectations.

  6. Toxicidade subcrônica de lambaris Astyanax aff. bimaculatus expostos ao zinco

    OpenAIRE

    Condessa, Suellen Silva

    2009-01-01

    Muitos metais ocorrem naturalmente em ambientes aquáticos e são classificados como poluentes somente quando adicionados pelo homem em quantidades suficientes para produzir efeitos deletérios em organismos. Dentre estes metais já existentes no ambiente aquático pode-se citar o zinco (Zn) que é um elemento essencial para os seres vivos. Em concentrações elevadas, o Zn pode se tornar tóxico aos seres vivos por reduzir os níveis séricos de cobre, causando a diminuição da imunidade. O presente est...

  7. Marketing aplicado ao território o estudo de caso de Queluz

    OpenAIRE

    Marques, Sérgio Carlos Esteves

    2013-01-01

    A presente investigação visa compreender como o marketing poderá ser aplicado ao território através de um caso prático, a cidade de Queluz. O enquadre teórico base desta pesquisa contempla os conceitos de marketing territorial (Caroli 2006, 2010; Cidrais 1998; Kotler et al., 2003, 2004, 2007, 2009) e marca territorial (Azevedo, 2008, 2010; Elizagarate, 2008; Lencastre, 2007). A metodologia envolve observação directa, recolha de informação documental e de divulgação da cidade, t...

  8. Fatores imunogenéticos associados ao diabetes mellitus do tipo 1

    OpenAIRE

    Ana Paula Morais Fernandes; Ana Emilia Pace; Maria Lúcia Zanetti; Milton Cesar Foss; Eduardo Antonio Donadi

    2005-01-01

    O diabetes mellitus do tipo 1 tem sido considerado uma doença auto-imune órgão-específica, decorrente da destruição seletiva das células betapancreáticas. Apresenta patogenia complexa, envolvendo a participação de vários fatores, dentre esses a susceptibilidade imunogenética com forte associação aos genes de histocompatibilidade (HLA), eventos ambientais e resposta auto-imune com presença de auto-anticorpos e/ou linfócitos auto-reativos, culminando em anormalidades metabólicas. Neste estudo, ...

  9. Mecanismos e fatores associados aos sintomas gastrointestinais em pacientes com diabetes melito

    OpenAIRE

    Mônica Loureiro Celino Rodrigues; Maria Eugênia Farias Almeida Motta

    2012-01-01

    OBJETIVOS: Apresentar a frequência, os principais fatores causadores dos sintomas gastrointestinais em pacientes portadores do diabetes melito e controvérsias quanto à sua ocorrência em crianças e adolescentes. FONTES DOS DADOS: Revisão não sistemática nas bases de dados MEDLINE/PubMed e SciELO (1983-2011), além de capítulos de livros relevantes. Foram selecionados os artigos mais atuais e representativos do tema. SÍNTESE DOS DADOS: A prevalência do diabetes melito vem aumentando ao longo dos...

  10. Neuropatia Periférica Familiar por Susceptibilidade ao Entrapment (Neuropatia Tomaculosa)

    OpenAIRE

    Pinto Viana, J; Coimbra, J.; Goulart, Z; Bigotte de Almeida, L; Cabral Beirão, J

    1991-01-01

    Os autores apresentam um caso de neuropatia periférica familiar por susceptibilidade ao entrapment e comparam-no com os descritos na literatura. As principais características desta neuropatia são: hereditariedade autossómica dominante, mononeuropatias recorrentes de localização variável (cubital, mediano, ciático poplíteo, externo, plexo braquial) e aspectos morfológicos característicos na biópsia do nervo. O nervo sensitivo revela alterações predominantes desmielinizantes, com espessamentos ...

  11. Pneumonia em organização secundária ao uso de amiodarona

    Directory of Open Access Journals (Sweden)

    GULMINI LIA AUGUSTA DE SOUZA

    2001-01-01

    Full Text Available A pneumonia em organização secundária ao uso de amiodarona é rara, com apenas oito casos relacionados na literatura. No presente relato uma paciente de 75 anos, com uso cumulativo de 43g, apresentou tosse produtiva, dispnéia progressiva e infiltrados bilaterais na radiografia do tórax. A biópsia transbrônquica confirmou o diagnóstico. Com a retirada da droga houve melhora clínica e funcional.

  12. Delivery assistance in fetal macrosomia Assistência ao parto na macrossomia fetal

    Directory of Open Access Journals (Sweden)

    Renato Augusto Moreira de Sá

    2003-12-01

    Full Text Available OBJECTIVES: to evaluate delivery assistance in fetal macrosomia. METHODS: this was a hospital-based cohort study of consecutive births at a tertiary perinatal center from January 1, 1996 to October 31, 1999. A total of 5261 pregnancies met the inclusion criteria which were singleton pregnancies with minimal birth weight of 1000 g. Fetal macrosomia was defined as birth weight of 4000 g or more. We studied the mode of delivery, the newborn condition at birth, considered low when the Apgar scored below seven in the first or fifth minute, and the presence of abnormalities that could indicate a Caesarian section (disproportion, uterine dysfunction, prolonged second period of birth and fetal distress. RESULTS: 296 (5,6% of the babies were macrosomic. Macrosomia was a risk factor for Caesarian section (RR = 1,59, p OBJETIVOS: avaliar a assistência ao parto na macrossomia fetal. MÉTODOS: Estudo do tipo coorte realizado em centro perinatal terciário no período de 1 de janeiro de 1996 a 31 de outubro de 1999. Foram selecionadas 5261 gestações de acordo com os critérios de inclusão, que foram: gestação única e peso mínimo ao nascimento de 1000 g. A macrossomia fetal foi definida como peso ao nascimento acima de 4000 g. Estudamos a via de parto, as condições ao nascimento, Apgar baixo quando inferior a sete no primeiro e quinto minutos e as anormalidades que serviram de indicação para cesariana (desproporção, distocia uterina, segundo período prolongado e sofrimento fetal. RESULTADOS: 296 (5,6% dos conceptos eram macrossômicos. Macrossomia foi fator de risco para cesariana (RR = 1,59, p <0,001 e para parto operatório vaginal (RR = 1,12 p <0,001. As condições do recém-nascido não foram piores nos fetos macrossômicos. Houve correlação positiva entre macrossomia fetal e desproporção mas não para distocia uterina, prolongamento do segundo período ou sofrimento fetal. CONCLUSÕES: Houve maior número de indicações de cesariana

  13. A experiência de adolescentes abandonados e institucionalizados frente ao desligamento institucional

    OpenAIRE

    Severino Ramos Lima de Souza

    2001-01-01

    Sabemos que muitas das crianças abrigadas em instituições para abandonados, infelizmente, não serão beneficiadas pelos Programas de Colocação em Lar Substituto (guarda, tutela e adoção). Desse modo, passam a viver na instituição até que completem a maioridade quando, inevitavelmente, terão que ser desligadas. Este estudo vem focalizar, portanto, a experiência de adolescentes abandonados e institucionalizados frente ao desligamento institucional, em função da maioridade. Trata-se de uma pesqui...

  14. Tratamento fungicida e peliculização de sementes de soja submetidas ao armazenamento

    OpenAIRE

    Pereira,Carlos Eduardo; Oliveira,João Almir; Guimarães,Renato Mendes; Vieira,Antônio Rodrigues; Evangelista,José Renato Emilioreli; Oliveira,Gustavo Evangelista

    2011-01-01

    O tratamento de sementes de soja com fungicidas vem sendo utilizado como importante ferramenta no controle de patógenos. Nesse trabalho, objetivou-se estudar o desempenho de sementes de soja tratadas com fungicidas e peliculizadas, antes e após o armazenamento. Foram utilizados cinco lotes de sementes, cultivar Monsoy 6101, submetidos aos tratamentos: thiabendazole+thiram sem polímero, carbendazin+thiram sem polímero, sem fungicida (testemunha) sem polímero, além desses tratamentos realizados...

  15. Do códige ao monitor: a trajetória do escrito

    Directory of Open Access Journals (Sweden)

    Roger Chartier

    1994-08-01

    Full Text Available Estariam os textos, de agora em diante, fadados a uma existência eletrônica? Os livros, na forma que conhecemos, desde o século XVI, estariam condenados a desaparecer progressiva e definitivamente? Antes de responder a essas perguntas, Roger Chartier percorre a longa história do livro até aos nossos dias: do volumen ao códice, da xilografia oriental à invenção de Gutenberg, da biblioteca de Alexandria até às nossas grandes bibliotecas modernas, do códice ao monitor. A nossa época encontra-se diante de um desafio: o de utilizar de modo adequado o suporte eletrônico do escrito, pois os significados de um texto dependem muito do suporte material deste. A felicidade extravagante vislumbrada diante da produção, consulta, comunicação imediata e universal de textos na telinha do computador deverá harmonizar-se com a consciência do papel reservado ao novo suporte: proteção, conservação e divulgação do patrimônio escrito da humanidade na sua materialidade tanto quanto na sua simbólica.Would texts, from now on, be fated to a mere electronic existence? Would books, in their format known since the sixteenth century, be condemned to disappear progressively and definitely? Before answering these questions we must follow the long history of books: from volumen to codex, from oriental xylography to Gutenberg's invention, from the Alexandrian bibliotheca to our great modern libraries, from codices to monitors. Our time faces a challenge: how to use appropriately the electronic support of writing, since the meanings of a text depend very much on its material support. The extravagant happiness gleamed before the production, the consultation, the immediate and universal communication of texts in the computer's screen should be in harmony with the conscience of the role reserved for the new support: protection, conservation and divulgation of the writing heritage of manking, both in its material and symbolic character.

  16. Vulnerabilidade de adolescentes afrodescencentes e brancos em relação ao HIV/Aids

    OpenAIRE

    Camargo, Brigido Vizeu; Giacomozzi, Andréia Isabel; Wachelke, João Fernando Rech; Aguiar, Adriana de

    2010-01-01

    Trata-se de um estudo quantitativo e comparativo entre adolescentes brancos e afrodescendentes sobre vulnerabilidade ao HIV/Aids. A amostra não é randômica e foi formada por 715 estudantes do ensino público noturno de escola de periferia de Santa Catarina. O instrumento utilizado foi um questionário autoadministrado com questões fechadas. Foram analisadas cinco dimensões: afetiva e sexual, conhecimento sobre Aids, atitude, risco e percepção de risco e conduta protetora. Verificou-se que 73,8%...

  17. Prevalência e fatores de risco relacionados ao uso de drogas entre escolares

    Directory of Open Access Journals (Sweden)

    José Baus

    2002-02-01

    Full Text Available OBJETIVO: Analisar a prevalência e os fatores de risco relacionados ao uso indevido de drogas entre estudantes de uma escola pública de primeiro e segundo graus. MÉTODOS: Foi realizado estudo descritivo transversal, utilizando, como instrumento de pesquisa, um questionário anônimo, padronizado e amplamente testado no Brasil para levantamento do uso de drogas. A população estudada foi constituída de 478 estudantes de escola pública de primeiro e segundo graus, de Florianópolis, SC. Os questionários foram aplicados por estudantes universitários devidamente treinados. Entre os estudantes pesquisados, 43% e 32% foram de faixa etária de 13 a 15 anos e de 16 a 18 anos, respectivamente, com predomínio de classes socioeconômicas mais altas. RESULTADOS: A prevalência de uso de maconha na vida (19,9%, solventes (18,2%, anfetamínicos (8,4% e álcool (86,8% foi elevada em Florianópolis, comparada a outras capitais da região Sul e à média brasileira. Notou-se elevado e freqüente uso (seis ou mais vezes por mês de álcool (24,2%, maconha (4,9%, solventes (2,5% e anfetamínicos (2,3%. Os fatores demográficos relacionados ao uso de drogas na vida foram idade, sexo, classe socioeconômica e vida junto aos pais. A chance de garotas usarem remédios para emagrecer ou ficarem acordadas foi o dobro da chance de garotos e, quanto ao uso de tranqüilizantes, quase o triplo. Os garotos tinham um risco quase duas vezes maior de uso de solvente do que as garotas. A classe socioeconômica alta foi associada a um risco duas vezes maior do uso de álcool do que a classe baixa. O risco de uso de cigarro e maconha na vida foi 84% e 67% maior, respectivamente, para alunos cujos pais estavam separados. CONCLUSÃO: Constatou-se alta prevalência de uso de várias drogas entre os alunos de primeiro e segundo graus.

  18. Prevalência e fatores de risco relacionados ao uso de drogas entre escolares

    Directory of Open Access Journals (Sweden)

    Baus José

    2002-01-01

    Full Text Available OBJETIVO: Analisar a prevalência e os fatores de risco relacionados ao uso indevido de drogas entre estudantes de uma escola pública de primeiro e segundo graus. MÉTODOS: Foi realizado estudo descritivo transversal, utilizando, como instrumento de pesquisa, um questionário anônimo, padronizado e amplamente testado no Brasil para levantamento do uso de drogas. A população estudada foi constituída de 478 estudantes de escola pública de primeiro e segundo graus, de Florianópolis, SC. Os questionários foram aplicados por estudantes universitários devidamente treinados. Entre os estudantes pesquisados, 43% e 32% foram de faixa etária de 13 a 15 anos e de 16 a 18 anos, respectivamente, com predomínio de classes socioeconômicas mais altas. RESULTADOS: A prevalência de uso de maconha na vida (19,9%, solventes (18,2%, anfetamínicos (8,4% e álcool (86,8% foi elevada em Florianópolis, comparada a outras capitais da região Sul e à média brasileira. Notou-se elevado e freqüente uso (seis ou mais vezes por mês de álcool (24,2%, maconha (4,9%, solventes (2,5% e anfetamínicos (2,3%. Os fatores demográficos relacionados ao uso de drogas na vida foram idade, sexo, classe socioeconômica e vida junto aos pais. A chance de garotas usarem remédios para emagrecer ou ficarem acordadas foi o dobro da chance de garotos e, quanto ao uso de tranqüilizantes, quase o triplo. Os garotos tinham um risco quase duas vezes maior de uso de solvente do que as garotas. A classe socioeconômica alta foi associada a um risco duas vezes maior do uso de álcool do que a classe baixa. O risco de uso de cigarro e maconha na vida foi 84% e 67% maior, respectivamente, para alunos cujos pais estavam separados. CONCLUSÃO: Constatou-se alta prevalência de uso de várias drogas entre os alunos de primeiro e segundo graus.

  19. “DAY AFTER”: O ADEUS AOS JOGOS OLÍMPICOS DE LONDRES/2012 E AS BOAS VINDAS AO RIO/2016

    Directory of Open Access Journals (Sweden)

    Silvan Menezes dos Santos

    2015-08-01

    Full Text Available Este trabalho discute os modos e as estratégias de enquadramento presentes na cobertura jornalística do encerramento dos Jogos Olímpicos de Londres/2012 realizada por três emissoras brasileiras de TV: Rede Globo, Bandeirantes e Record. Partindo dos dados obtidos, aborda os seguintes eixos de discussão: 1 o agendamento dos Jogos Olímpicos do Rio de Janeiro 2016; 2 a construção do ídolo esportivo; 3 infotenimento. Por fim, destaca a ocorrência de agendamento midiático dos Jogos Olímpicos de 2016 já no encerramento dos Jogos de Londres; o estabelecimento de relações de identificação entre atletas medalhistas e sentimentos otimistas em relação aos megaeventos por vir; e, finalmente, a confusão de fronteiras entre informação e entretenimento no discurso jornalístico esportivo.

  20. Do encanto ao encontro de vozes afro-brasileiras na tradição oral

    Directory of Open Access Journals (Sweden)

    Josiley Francisco de Souza

    2010-12-01

    Full Text Available Ao longo da história, é possível perceber que, em todas as sociedades, a arte de contar sempre fez parte da nossa vida e garantiu a manutenção de memórias e saberes transmitidos no tecido das narrativas. Um dos lugares onde essa arte se faz presente com vigor é a África. As tradições orais têm sido apontadas por diversos pesquisadores como um traço distintivo da cultura africana. E, no exercício dessa arte, é possível ouvir diálogos e ressonâncias entre vozes africanas e brasileiras. Por intermédio de uma arte marcada pelo exercício do contar de novo, percebe-se contatos entre vozes que não se calam, que se traduzem e se inscrevem em histórias que se transmitem de boca a ouvido e da letra ao verbo. Portanto, o que se pretende neste artigo é, no processo de intensos entrecruzamentos de vozes e culturas que permeiam a tradição oral, analisar diálogos e ressonâncias transtextuais entre contos orais registrados no Brasil e em Angola.Palavras-chave: Tradição; Arte de contar; Conto oral; Memória; África; Brasil; Chatelain.

  1. Fatores associados ao aborto induzido entre jovens pobres na cidade de São Paulo, 2007

    Directory of Open Access Journals (Sweden)

    Rebeca de Souza e Silva

    2012-12-01

    Full Text Available Esse artigo investiga fatores associados ao aborto induzido entre jovens residentes numa comunidade pobre da cidade de São Paulo. A amostra foi composta por 102 homens e 99 mulheres de 14 a 25 anos de idade que já haviam iniciado suas vidas sexuais. Usou-se o modelo hierárquico de regressão logística. As variáveis não ter companheiro sexual no momento da entrevista, sexo do entrevistado, idade no momento da entrevista, priorizar morar só e número de gestações compuseram o modelo final. Dar muita importância a morar só quadruplica a chance de ocorrer um aborto. Jovens mais velhos foram menos propensos a se deparar com um aborto, dado que a chance de se optar pelo aborto se reduz 17% para cada incremento de um ano na idade dos jovens. Isso é indicativo de que as gestações ocorreram de forma inesperada, intempestiva, como é praxe nas condutas adolescentes, sendo as maiores candidatas a terminarem em aborto provocado. Evidencia-se, portanto, a necessidade de serem investidos recursos financeiros para obtenção de métodos contraceptivos eficazes e inócuos, destinados ao início da vida sexual.

  2. Trabalho em turnos: estado geral de saúde relacionado ao sono em trabalhadores de enfermagem

    Directory of Open Access Journals (Sweden)

    Sandra Soares Mendes

    2012-12-01

    Full Text Available O objetivo deste estudo foi identificar os sintomas referentes ao estado geral de saúde associado ao trabalho em turnos de enfermagem e relacioná-los com a qualidade do sono. O estudo foi realizado no Hospital da Irmandade da Santa Casa de Poços de Caldas, Minas Gerais. Participaram 136 profissionais de enfermagem, com média de idade de 33,1 anos, divididos nas seguintes categorias: enfermeiro (8,1%; técnico de enfermagem (80,9%; auxiliar de enfermagem dos turnos diurno e noturno (11%. Os sintomas de saúde foram identificados a partir do Inventário de Estado Geral de Saúde, e a qualidade do sono foi avaliada pelo Diário do Sono. Os dados foram estatisticamente significativos pelo Teste Qui-Quadrado (p=0,021 para a presença do sintoma de flatulência ou distensão abdominal no turno noturno. Constatou-se com a análise de regressão linear múltipla que os sujeitos do turno diurno que apresentaram os sintomas de má digestão (às vezes ou sempre e irritabilidade (sempre tiveram pior qualidade de sono noturno.

  3. LUCRO RESIDUAL E CONTABILIDADE: INSTRUMENTAL DE ANALISE FINANCEIRA E MENSURAcAO DE PERFORMACES

    Directory of Open Access Journals (Sweden)

    Gualter Portella

    2009-09-01

    Full Text Available Estes últimos anos, os mercados de capitais e financeiro tem sido invadidos por sistemas de administração financeira baseados no conceito de lucro residual. As firmas de consultoria financeira apresentam o Iucro residual rebatizado sob o nome de EVA (Economic value added ou Lucro Econômico - como instrumento de avaliação economico-financeira, alinhamento dos interesses de acionistas e administradores e mensuração de performance empresarial. Por essa multifuncionalidade, esses sistemas têm alcançado altos índices de popularidade junto ao empresariado. Entretanto, pouco tem se falado sobre a base te6rica desses sistemas de gerenciamento financeiro que liga os fundamentos de finanças com a disciplina contábil, sendo que e justamente esse elo o que os tem tornado populares. Afinal de contas, a contabilidade c conhecida como a linguagem dos neg6cios e por intermédio de seu vocabulário especifico são comunicados os desempenhos atuais c as expectativas em relação ao desempenho futuro das empresas. Por exemplo, os executivos utilizam-se de indicadores como o retorno sobre o patrimônio liquido (RSPL ou a margem de lucros para avaliar e comunicar a performance atual de suas empresas.

  4. Fatores associados aos óbitos entre homens envenenados por carbamato (“chumbinho”

    Directory of Open Access Journals (Sweden)

    Júlio César Santos da Silva

    Full Text Available RESUMO Objetivo Determinar os fatores associados aos óbitos em vítimas de envenenamento por carbamato (“chumbinho”. Método Estudo retrospectivo, epidemiológico tipo caso-controle, baseado nas fichas de notificação de intoxicação do centro de controle de intoxicações localizado na região metropolitana do Rio de Janeiro. Foram utilizadas 24 fichas de notificação de intoxicações de homens dos 20 aos 59 anos com história de envenenamento por carbamato entre 2005 e 2009. As fichas foram sorteadas aleatoriamente, respeitando-se a razão de 1:3 (um caso para três controles. A faixa etária variou de 23 a 58 anos; a média 43,83 anos. Resultados Os sintomas mais recorrentes foram: miose (OR = 1.0; IC 95%: 0,27 – 3,69. p= 1.0, sialorreia (OR = 0,83; IC 95%: 0,22 – 3,12. p= 0,78, dispneia (OR = 0,66; IC 95%: 0.14 – 3,03. p= 0,59. Conclusão Os óbitos apresentaram associação com sialorreia, miose e dispneia e uma forte associação com estertores pulmonares, broncoespasmos e os roncos pulmonares.

  5. VizieR Online Data Catalog: Robo-AO observed cool subdwarf companions (Ziegler+, 2015)

    Science.gov (United States)

    Ziegler, C.; Law, N. M.; Baranec, C.; Riddle, R. L.; Fuchs, J. T.

    2017-09-01

    We selected targets from the 564 spectral type F- through M-subdwarf candidates studied by Marshall (2007, J/AJ/134/778). These targets were selected from the New Luyten Two-Tenths catalog (NLTT; Luyten, 1979nlcs.book.....L; Luyten & Hughes 1980, Proper-Motion Survey with the Forty-Eight Inch Schmidt Telescope LV First Supplement to the NLTT Catalogue (Minneapolis, MN: Univ. Minnesota Press)) of high proper motion stars (>0.18 arcsec/yr) using a reduced proper motion diagram (RPM). Of the 552 subdwarfs confirmed by Marshall, a randomly selected sample of 348 G-, K-, and M-subdwarfs were observed by Robo-AO when available between other high priority surveys. We obtained high-angular-resolution images of the 348 subdwarfs during 32 separate nights of observations between 2012 September 3 and 2013 August 21 (UT). The observations were performed using the Robo-AO laser adaptive optics system (Riddle et al. 2012SPIE.8447E..2OR; Baranec et al. 2013, J. Visualized Exp. 72 e50021; 2014ApJ...790L...8B) mounted on the Palomar 60 inch telescope. (1 data file).

  6. Prevenção ao crime e teoria social Crime prevention and social theory

    Directory of Open Access Journals (Sweden)

    João Trajano Sento-Sé

    2011-01-01

    Full Text Available O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime do que se costuma reconhecer.The article establishes a dialogue between positivist criminology and some contemporary currents on crime prevention inspired in sociological theories. Through this exercise, we seek to highlight that some of the formulations focused in the preventions field appear, in embryonic state, in the positivist theoretical agenda. Likewise, it is possible to explicit that some empirical and practical tenets of positivism are less foreign to contemporary theories of crime prevention than is usually recognized.

  7. LUCRO RESIDUAL E CONTABILIDADE: INSTRUMENTAL DE ANALISE FINANCEIRA E MENSURAcAO DE PERFORMACES

    Directory of Open Access Journals (Sweden)

    Gualter Portella

    2009-09-01

    Full Text Available Estes últimos anos, os mercados de capitais e financeiro tem sido invadidos por sistemas de administração financeira baseados no conceito de lucro residual. As firmas de consultoria financeira apresentam o Iucro residual rebatizado sob o nome de EVA (Economic value added ou Lucro Econômico - como instrumento de avaliação economico-financeira, alinhamento dos interesses de acionistas e administradores e mensuração de performance empresarial. Por essa multifuncionalidade, esses sistemas têm alcançado altos índices de popularidade junto ao empresariado. Entretanto, pouco tem se falado sobre a base te6rica desses sistemas de gerenciamento financeiro que liga os fundamentos de finanças com a disciplina contábil, sendo que e justamente esse elo o que os tem tornado populares. Afinal de contas, a contabilidade c conhecida como a linguagem dos neg6cios e por intermédio de seu vocabulário especifico são comunicados os desempenhos atuais c as expectativas em relação ao desempenho futuro das empresas. Por exemplo, os executivos utilizam-se de indicadores como o retorno sobre o patrimônio liquido (RSPL ou a margem de lucros para avaliar e comunicar a performance atual de suas empresas.

  8. Resistência de genótipos de tomateiro ao ácaro rajado

    Directory of Open Access Journals (Sweden)

    Maruyama Wilson Itamar

    2002-01-01

    Full Text Available Avaliou-se a resistência de genótipos de tomateiro selvagens [Lycopersicon pennellii (LA 716, L. hirsutum var. glabratum (PI 126449, PI 134417, L. hirsutum (PI 127826, PI 127827, L. peruvianum (CGO 6707, L. peruvianum var. dentatum (WYR 2020, LA 111, L. peruvianum var. glandulosum (LA 1113-1, LA 1113-2] e comerciais [(L. esculentum Gem Pride, Santa Clara, e híbridos Bruna VFN, Carmem, Fortaleza, Débora Plus VFN] ao ácaro rajado (Tetranychus urticae. O número médio de ovos, fases imaturas (larvas, protoninfas e deutoninfas e adultos por folíolo foi contado; o índice de preferência para oviposição (IPO foi calculado. O delineamento experimental foi blocos ao acaso, com 6 repetições. Os genótipos LA 716, PI 126449, PI 134417, PI 127827, PI 127826 e Gem Pride apresentaram não-preferência para oviposição do ácaro rajado, sendo deterrentes quanto à classificação do IPO, enquanto os genótipos LA 111, WYR 2020, LA 1113-2 e LA1113-1 foram os mais preferidos para a oviposição e foram considerados como estimulantes pelo IPO.

  9. PATOGENICIDADE DE BEAUVERIA BASSIANA (BALS. VUILL. AO ÁCARO Tetranychus urticae KOCH

    Directory of Open Access Journals (Sweden)

    Tamai Marco Antonio

    1999-01-01

    Full Text Available O estudo da patogenicidade de Beauveria bassiana (Bals. Vuill. ao ácaro Tetranychus urticae Koch foi desenvolvido a 25 ± 2°C, 70 ± 5% UR e 12 horas de fotofase, utilizando-se fêmeas recém-emergidas. Os ácaros foram mantidos durante seis dias em discos de folha de Canavalia ensiformis (L. DC. inoculadas com B. bassiana, isolado 447, nas concentrações: 5x106, 1x107, 5x107, 1x108, 5x108 e 1x109 conídios/ml. Este isolado mostrou-se patogênico a T. urticae, apresentando aumento nos valores das mortalidades acumuladas (total, corrigida e confirmada à medida que a suspensão de conídios se tornou mais concentrada. Nas seis concentrações testadas, os valores de mortalidade corrigida ao sexto dia, foram inferiores a 50%, sendo observada apenas na concentração de 1x109 conídios/ml, mortalidade total superior a 50%.

  10. Resistência de plantas daninhas aos herbicidas Weed resistance to herbicides

    Directory of Open Access Journals (Sweden)

    Pedro J. Christoffoleti

    1994-01-01

    Full Text Available A resistência de plantas daninhas aos herbicidas ocorre em função de um processo evolutivo. O desenvolvimento de biótipos de plantas daninhas resistentes é imposto pela agricultura moderna, através da pressão de seleção causada pelo uso intensivo dos herbicidas. O conhecimento dos mecanismos e fatores que favorecem o aparecimento de biótipos de plantas daninhas resistentes é fundamental para que técnicas de manejo sejam utilizadas no sentido de evitar ou retardar o aparecimento de plantas resistentes em uma área. São poucos os relatos ou citações de literatura no Brasil. Sendo assim, este trabalho de revisão procura relatar os principais avanços e descobertas na área de plantas daninhas resistentes aos herbicidas.Weed herbicide resistance has evolved from weed evolution. The modern agriculture is responsible for this evolution because of the intensive use of herbicides. The knowledge of mechanisms and factors that influence the weed herbicide resistance play an important role in the weed manegement techniques used to avoid or delay herbicide resistance appearence. There are not many report or scientific papers about herbi cide resistance in Brasil. Therefore, this literature review aims to provide information about the main advances and discoveries in the field of weed herbicide resistance.

  11. Sintomatologia osteomuscular e qualidade de vida de portadores de distúrbios osteomusculares relacionados ao trabalho

    Directory of Open Access Journals (Sweden)

    Giselle Santana Dosea

    Full Text Available RESUMO Objetivo: Analisar, a partir de um perfil ocupacional, os aspectos da sintomatologia osteomuscular e da qualidade de vida (QV de trabalhadores notificados como portadores de distúrbios osteomusculares relacionados ao trabalho (DORT no estado de Sergipe. Métodos: A pesquisa foi realizada entre os meses de julho/2013 e julho/2014 e utilizou-se os questionários Nórdico de Sintomas Osteomusculares e o SF-36, em 56 voluntários. Resultados: Observou-se maior severidade dos sintomas na região dos ombros e cervical, e baixas médias de QV em todos os domínios, com relação significativa entre sexo e sintomatologia nos membros superiores, e entre componentes mentais e físicos da QV e a sintomatologia em ombros e punhos. Considerações finais: Esta pesquisa possuiu limites metodológicos relacionados ao reduzido número de indivíduos da amostra, no entanto, ainda assim, foi possível atingir seus objetivos, através da análise do perfil ocupacional, da sintomatologia osteomuscular e da QV dos trabalhadores notificados como portadores de DORT no estado de Sergipe. A QV do portador de DORT é reduzida, embora sua relação com a sintomatologia da doença precise ser investigada mais profundamente.

  12. Durabilidade natural de espécies florestais madeireiras ao ataque de cupim de madeira seca

    Directory of Open Access Journals (Sweden)

    Fabricio Gomes Gonçalves

    Full Text Available Esta pesquisa objetivou avaliar a resistência de dez madeiras ao térmita, Cryptotermes brevis, em condições de laboratório. As espécies estudadas foram amoreira (Chlorophora tinctoria, angelim-pedra (Hymenolobium petraeum, angico-vermelho (Anadenanthera columbrinavar. cebil, angico-verdadeiro (Anadenanthera peregrina, jacarandá-da-bahia (Dalbergia nigra, parajú (Manilkara longifolia, roxinho (Peltogine nitens, pau-brasil (Caesalpiniaechinata, Eucalyptus cloeziana e Eucalyptus torelliana. As madeiras estudadas foram susceptíveis ao ataque de C. brevis, à exceção das madeiras de A. columbrina e M. Longifolia; H. petraeum, D. nigra e C. echinata apresentaram mortalidade inferior à média das demais espécies. As madeiras de D. nigra, H. petraeum, C. echinata e E. Cloeziana foram as mais consumidas pelos cupins. C. tinctoria, P. nitens e E. torelliana apresentaramdesgastes superficiais. Nas madeiras de maior densidade e maiores teores de extrativos e de cinzas, observaram-se maiores valores de mortalidade dos cupins. Não existe, porém, uma característica única, que permita ser empregada visando a relacionar o ataque provocado pelos cupins nas madeiras estudadas.

  13. Resposta fisiológica de sementes de palmeiras ao envelhecimento acelerado

    Directory of Open Access Journals (Sweden)

    Negreiros Gisele de Freitas

    2004-01-01

    Full Text Available O objetivo deste trabalho foi avaliar a qualidade fisiológica de sementes de quatro espécies da família Palmae submetidas ao envelhecimento acelerado. Sementes recém-colhidas de cada uma das espécies foram expostas às condições de envelhecimento acelerado em câmara a 45ºC e 100% de UR, durante os períodos de 0 (controle, 12, 24, 36 e 48 horas. Sementes de Euterpe edulis e Dypsis lutescens foram sensíveis ao tratamento, sendo a germinação totalmente suprimida após 12 horas de permanência na câmara. As espécies Roystonea oleracea e Phoenix reclinata apresentaram sementes mais resistentes que as outras espécies, mas redução gradativa do vigor, de acordo com o aumento do período de exposição às condições de envelhecimento; o período de 48 horas foi crítico para determinados parâmetros de vigor avaliados.

  14. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    Directory of Open Access Journals (Sweden)

    Diana Palaversich

    2013-12-01

    Full Text Available O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e se reflete em áreas da cultura como as artes plásticas e a literatura, produzindo um novo tipo de expressão artística ou narrativa, que tanto pode ser oportunista e contribuir para a banalização da violência do narcotráfico como ser crítica e narrar o impacto individual e coletivo do tráfico de drogas, narrar a desenfreada e violenta realidade mexicana sem cair no estilo da imprensa marrom, do folclore ou dos lugares comuns dos romances de ação.

  15. A vulnerabilidade social aos perigos naturais e tecnológicos em Portugal

    Directory of Open Access Journals (Sweden)

    José Manuel Mendes

    2012-05-01

    Full Text Available Neste artigo apresenta‑se um novo modelo de análise da vulnerabilidade social aos perigos naturais e tecnológicos. O índice utilizado nesta análise permite a estruturação da avaliação da vulnerabilidade em duas dimensões: as vulnerabilidades das populações e comunidades (criticidade e a vulnerabilidade territorial (capacidade de suporte, os quais reflectem a exposição ou a vulnerabilidade biofísica, a resiliência social e a capacidade de suporte infraestrutural. Este novo índice de vulnerabilidade social é aplicado ao sistema territorial de Portugal continental, tendo por base a escala municipal e submunicipal, apreendendo a resiliência social dos indivíduos, dos grupos e das comunidades face a acontecimentos extremos. Os resultados obtidos evidenciam o papel crucial da escala na análise dos processos relacionados com a vulnerabilidade social. Propõe‑se que a cartografia das áreas e dos grupos mais vulneráveis, bem como a identificação dos factores desencadeantes, podem constituir um contributo relevante para os programas de ordenamento e de planeamento destinados a mitigar os riscos e as vulnerabilidades do território.

  16. REABILITAÇÃO PROFISSIONAL E RETORNO AO TRABALHO: UMA APOSTA DE INTERVENÇÃO

    Directory of Open Access Journals (Sweden)

    Ana Luisa Poersch

    Full Text Available Resumo Muitas são as dificuldades dos trabalhadores acometidos por doenças ocupacionais para retornar ao trabalho. Esta pesquisa-intervenção teve como objetivo conhecer e se aproximar das experiências do retorno ao trabalho e as implicações na produção de subjetividade em trabalhadores da área hospitalar. Ela foi realizada com grupos de trabalhadores reabilitados de um hospital universitário geral de grande porte, em Porto Alegre, RS. Os encontros (n=8 foram compostos por trabalhadores (n=20 de diversas funções e áreas de trabalho no hospital, que tenham participado de programa de reabilitação profissional e estejam desenvolvendo suas atividades em sua área de origem, ou em novo posto de trabalho. Os resultados apontam para as dificuldades, limitações e para a problematização dos modelos de gestão no trabalho vigentes. Por outro lado, também apontam para a criação de novos modos de trabalhar e viver e para a construção coletiva de estratégias de inventividade.

  17. Cor e produção de respostas ao Rorschach: um estudo transcultural

    Directory of Open Access Journals (Sweden)

    Danilo Rodrigues Silva

    2011-08-01

    Full Text Available Estudos anteriores revelaram que a cor aumenta a produção de respostas ao Rorschach nos adultos mas não nas crianças e que esse aumento se observa a partir dos 15-16 anos. Este dado desenvolvimental, obtido a partir de crianças e jovens portugueses, levou os autores a verificar se esta propriedade da cor é inata ou condicionada pelo desenvolvimento neuropsicológico ou, antes, aprendida ou adquirida. A aplicação do Rorschach, segundo a mesma metodologia, a dois grupos de crianças e de jovens negros de Moçambique, com 11-12 e 15-20 anos, proporcionou resultados que sugerem que, no primeiro grupo etário, não ocorrem diferenças fundamentais em relação ao obtido em Lisboa; no segundo grupo, tais diferenças são acentuadas, em particular para o sexo feminino, levantando-se a questão da natureza cultural do fenômeno.

  18. A QUESTÃO DA PARÓDIA: A FILOSOFIA AO LADO DE GIORGIO AGAMBEN

    Directory of Open Access Journals (Sweden)

    Vinícius Nicastro Honesko

    2015-07-01

    Full Text Available A partir da leitura de diversos textos de Giorgio Agamben,o presente ensaio pretende expor como o conceito de paródia podeser fundamental para a compreensão da filosofia do autor italiano.Além disso, propõe a aproximação entre os conceitos de paradigma,parábola e paródia, elaborando uma constelação teórica a partir daqual pensar o problema da constituição essencial do homem paraalém da questão metafísica – aproximando-se, para tanto, de certasleituras que Deleuze faz da patafísica de Alfred Jarry. Por fim,pretende estabelecer uma vinculação do conceito benjaminiano deorigem com os problemas filosóficos fundamentais de Agamben,sobretudo no que diz respeito às questões atinentes ao pensamentoda História (e, por isso, à impossibilidade de atribuição de umaessência, um fim, ao homem.

  19. Da fala do outro ao texto negociado: discussões sobre a entrevista na pesquisa qualitativa

    Directory of Open Access Journals (Sweden)

    Márcia Tourinho Dantas Fraser

    2004-08-01

    Full Text Available O artigo discute a entrevista como técnica qualitativa de apreensão da percepção e da vivência pessoal das situações e eventos do mundo. A relação intersubjetiva, entrevistador e entrevistado, é de fundamental importância para permitir o acesso aos significados atribuídos pelas pessoas aos eventos do mundo, cujo produto é fruto das mútuas influências no processo de interação na entrevista. A primeira seção discute a abordagem qualitativa de pesquisa e aponta suas principais diferenças em relação à abordagem quantitativa, bem como as implicações da escolha teórico-metodológica para o uso da entrevista como técnica de pesquisa. A segunda seção caracteriza as entrevistas qualitativas quanto à estrutura, tipos, objetivos, papel dos participantes e discute ainda critérios de seleção dos entrevistados, representatividade, validade e fidedignidade das interpretações dos resultados. A última seção apresenta algumas considerações sobre os limites e possibilidades de uso da técnica.

  20. Tolerância da mamoneira ao herbicida trifluralin em solos com diferentes texturas

    Directory of Open Access Journals (Sweden)

    Katty A. A. de L. Medeiros

    2013-12-01

    Full Text Available A escassez de herbicidas registrados para a cultura da mamoneira ainda é fator limitante para sua expansão. Objetivou-se então, com este trabalho, avaliar a tolerância da mamoneira ao herbicida trifluralin em solos com diferentes texturas. O experimento foi conduzido em casa de vegetação, em delineamento inteiramente casualizado com cinco repetições, em esquema fatorial com 8 doses do herbicida trifluralin aplicado em pré-emergência (0; 187,5; 375; 750; 1.500; 3.000; 6.000 e 12.000 g ha-1 i.a. e quatro tipos de substrato (areia lavada; franco-arenoso; franco argiloso-arenoso e franco-argiloso. Aos 28 dias após a semeadura foram determinadas as variáveis: altura de plantas, área foliar, massa seca da parte aérea, volume e massa seca do sistema radicular. Concluiu-se que a dose do herbicida trifluralin tolerada pela mamoneira é influenciada pelas características químicas e físicas do solo. Em solos de textura arenosa e franco-arenosa doses do herbicida trifluralin abaixo daquelas comumente utilizadas para controle de plantas daninhas, são suficientes para ocasionar redução no crescimento das plantas de mamoneira.

  1. DA MANUFATURA À MAQUINARIA MODERNA: A SUBSUNÇÃO REAL DO TRABALHO AO CAPITAL

    Directory of Open Access Journals (Sweden)

    Osmar Martins de Souza

    2017-03-01

    Full Text Available O presente texto tem como intento discutir sobre o processo de transformação que ocorreu no modo de produção capitalista com a passagem da manufatura à indústria moderna, pois essa modificação na forma de produção, possibilitou a transição da subsunção formal para a subsunção real do trabalho ao capital. Para compreender essa modificação, recorreu-se, principalmente, à análise que Karl Marx desenvolveu em sua principal obra: O Capital: crítica da economia política. Nesta obra, o autor escreveu dois capítulos intitulados: Divisão do trabalho e manufatura e A maquinaria e a indústria moderna, nos quais procurou explicar historicamente que a transição da manufatura à indústria moderna foi o meio fundamental para a subsunção real do trabalho ao capital e para consolidação do modo capitalista de produção. A partir disto, o sistema capitalista tornou-se o modo de produção hegemônico, pois teve condições materiais para aumentar a produtividade do trabalho, o lucro e remover os entraves que a produção manufatureira impunha à expansão do capital.

  2. CARTA AOS LOUCOS: UMA NARRATIVA ÉPICA MODERNA LETTER TO CRAZY: A MODERN EPIC NARRATIVE

    Directory of Open Access Journals (Sweden)

    MOEMA DE CASTRO e SILVA OLIVAL

    1998-01-01

    Full Text Available Carta aos loucos – romance de Carlos Nejar – é uma narrativa alegórica em queo autor, a partir da tradição da narrativa clássica de Homero, e valendo-se dorecurso parodístico, instaura nova épica, assentada não no relato do acontecido,mas no questionamento, revelando a consciência crítica pós-moderna. Nesteensaio, procura-se relevar os meios pelos quais o narrador ousa novos paradigmasliterários, recriando a mitologia clássica, em torno do binômio Tempo versusPalavra, e mostrar como, enriquecido com a convivência dinâmica da prosa e dapoesia, o romance é a apologia do Verbo, tese que encontra reforço em ficcionistascontemporâneos.Carta aos loucos, Carlos Nejar’s romance, is an allegoric narrative in which theauthor, inspired on the tradition of Homero’ s classical narrative, and makinguse of the parodist resource creates a new epic, based not on the relating of thealready happened, but on the questioning, revealing a post-modern criticalconscience. The esayist tries to elevate the ways by which the narrator daresnew literary paradigms, recreating the classical mithology towards the binomialTime versus Word and to show how, enriched by the dinamic convenience onprose and poetry, the romance is an apology to “Verb”, a thesis shared by thecontemporaneous fictionists.

  3. "Conselhos ao povo": educação contra a influenza de 1918

    Directory of Open Access Journals (Sweden)

    Liane Maria Bertucci-Martins

    Full Text Available Quando os primeiros casos de gripe espanhola começaram a vitimar os paulistanos em outubro de 1918, o Serviço Sanitário do Estado de São Paulo publicou uma série de prescrições com a intenção de esclarecer e instruir os moradores da capital do estado sobre a doença, suas características e algumas formas de combate de uma moléstia também chamada de influenza ou influenza espanhola. Resumidos e reeditados na imprensa, muitas vezes sob o título de "Conselhos ao Povo", os pareceres elaborados pela diretoria de saúde ganharam diferentes nuanças, mas algo permaneceu constante: o apelo à higiene pessoal e ao cuidado com os contatos sociais, como maneiras de se evitar a enfermidade e sua propagação. O objetivo deste texto é recuperar um pouco dessa história, em que as questões de higiene, educação e saúde se mesclavam.

  4. Gestão do cuidado de enfermagem ao adolescente que vive com HIV/AIDS

    Directory of Open Access Journals (Sweden)

    Cintia Koerich

    2015-03-01

    Full Text Available Objetivo: Caracterizar a gestão do cuidado de enfermagem ao adolescente que vive com HIV/AIDS por transmissão vertical, frente ao processo de transição do atendimento em Serviços de Referência no Tratamento de HIV/AIDS (infantil e adulto em um estado do Sul do Brasil, propondo estratégias para a transição deste atendimento. Métodos: Pesquisa qualitativa, exploratória e descritiva. Os dados foram coletados por meio de observação participante e entrevista individual semiestruturada, sendo analisados e interpretados segundo Bardin. Resultados: Da análise dos dados emergiram três categorias, que apontaram os desafios na gestão do cuidado, o envolvimento incipiente do enfermeiro e as estratégias a serem utilizadas na transição do adolescente. Conclusão: Revela a importância do enfermeiro nesse processo de transição, com participação ativa no planejamento, gestão e execução das ações, em suas competências.

  5. Vigilância laboratorial da resistência aos antibacilares em Portugal em 2000 - 2001

    Directory of Open Access Journals (Sweden)

    Cristina Furtado

    2003-07-01

    Full Text Available RESUMO: INTRODUÇÃO: Iniciado em Abril de 2000, o Sistema Nacional de Vigilância da Resistência aos Antibacilares (VigLab-Tuberculose constitui um sistema de vigilância de base laboratorial, assente nos laboratórios nacionais que executam testes de sensibilidade aos antibacilares de 1.ª linha, e tem como finalidade conhecer e monitorizar o padrão de resistência das estirpes de Mycobacterium tuberculosis isoladas em Portugal.OBJECTIVO: Neste artigo descrevemos o padrão de resistência aos antibacilares de 1ª linha nos casos de tuberculose diagnosticados em Portugal em 2000 e 2001 e declarados ao VigLab-Tuberculose.MATERIAL E MÉTODOS: Participam no VigLab-Tuberculose os 15 laboratórios que em 2000 e 2001 realizavam o teste de sensibilidade aos antibacilares de 1.ª linha. Estes laboratórios colhem dados demográficos, clínicos e laboratoriais dos casos de Mycobacterium tuberculosis complex em que foi realizado o teste de sensibilidade aos antibacilares. O tratamento dos dados foi efectuado em Epi-Info versão 6.04c.RESULTADOS: No período de 1 de Abril de 2000 a 31 de Dezembro de 2001 foram declarados os resultados dos testes de sensibilidade aos antibacilares de 4170 doentes em que foi isolado o Mycobacterium tuberculosis complex. Do total dos casos testados em simultâneo para os 5 fármacos, 23% (541/2358 apresentaram resistência a pelo menos um dos fármacos de 1.ª linha. Observou-se monorresistência à estreptomicina em 7,6% (179/2358 dos casos testados, à isoniazida em 2,6% (62/2358, à rifampicina em 0,6% (15/ /2358 e à pirazinamida em 1,3% (30/2358. Dos 4164 casos testados em simultâneo para a isoniazida e rifampicina, 244 (5,9% foram multirresistentes. Dos doentes classificados como casos novos de tuberculose, 1,8% (28/1557 foram monorresistentes à isoniazida, 0,4% (7/1557 à rifampicina, 4,2% (66/1557 à estreptomicina e 1,7% (27/1557 à pirazinamida. A frequência de multirresistência primária foi de 2,8% (43

  6. Os efeitos na formação de residentes de psiquiatria ao experimentarem grupos GAM

    Directory of Open Access Journals (Sweden)

    Thais Mikie de Carvalho Otanari

    Full Text Available Trata-se de uma dissertação de mestrado que propôs conhecer e descrever os efeitos desencadeados na formação de residentes de psiquiatria ao participarem de grupos constituídos por pessoas diagnosticadas com transtorno mental que utilizaram a intervenção GAM (Gestão Autônoma da Medicação como norteadora. A aposta foi que, ao participarem dos encontros, os residentes experienciariam uma nova situação em que a palavra do paciente passaria a ser ouvida de forma diferente da trabalhada no currículo da residência, construindo um dispositivo capaz de transformar suas práticas clínicas. Para verificar esses efeitos, utilizamos dois grupos focais, realizados antes e depois dos grupos de intervenção, além de entrevistas individuais conduzidas após o término dos grupos. A análise do material indicou efeitos principalmente quanto à escuta clínica desses profissionais, mostrando a necessidade de estudos mais aprofundados.

  7. A pipa como um fé(itiche: passando ao largo de dicotomias

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Aranha de Queiroz e Melo

    Full Text Available Resumo Operamos com o conceito de fé(itiche, proposto por Latour, para entender o poder de influência e aglutinação de um brinquedo milenar na relação com os humanos que o têm como um objeto de alta significação em suas biografias. Neste artigo, a palavra fetiche foi problematizada para assumir uma versão composta que se traduz, ao mesmo tempo, como fato e feitiço, objeto feito e objeto encantado, passando ao largo das dicotomias entre o que é fabricação e o que é realidade. Na busca por restaurar a integração dos todos que foram cindidos pelo pensamento moderno, opta-se por estudar os fenômenos como efeitos de cadeias cujos mediadores são investigados tendo o mesmo valor enquanto operadores de efeitos. Foram privilegiadas as narrativas de pipeiros coletadas em entrevistas, assim como contribuições encontradas na literatura, realçando o poder de encantamento do papagaio de papel como objeto sagrado que protagoniza eventos e mobiliza afetos e ações.

  8. Closed-loop focal plane wavefront control with the SCExAO instrument

    Science.gov (United States)

    Martinache, Frantz; Jovanovic, Nemanja; Guyon, Olivier

    2016-09-01

    Aims: This article describes the implementation of a focal plane based wavefront control loop on the high-contrast imaging instrument SCExAO (Subaru Coronagraphic Extreme Adaptive Optics). The sensor relies on the Fourier analysis of conventional focal-plane images acquired after an asymmetric mask is introduced in the pupil of the instrument. Methods: This absolute sensor is used here in a closed-loop to compensate for the non-common path errors that normally affects any imaging system relying on an upstream adaptive optics system.This specific implementation was used to control low-order modes corresponding to eight zernike modes (from focus to spherical). Results: This loop was successfully run on-sky at the Subaru Telescope and is used to offset the SCExAO deformable mirror shape used as a zero-point by the high-order wavefront sensor. The paper details the range of errors this wavefront-sensing approach can operate within and explores the impact of saturation of the data and how it can be bypassed, at a cost in performance. Conclusions: Beyond this application, because of its low hardware impact, the asymmetric pupil Fourier wavefront sensor (APF-WFS) can easily be ported in a wide variety of wavefront sensing contexts, for ground- as well space-borne telescopes, and for telescope pupils that can be continuous, segmented or even sparse. The technique is powerful because it measures the wavefront where it really matters, at the level of the science detector.

  9. Organizadores e cortadores de comprimidos: riscos e restrições ao uso

    Directory of Open Access Journals (Sweden)

    Caroline Ribeiro de Borja-Oliveira

    2013-02-01

    Full Text Available Com base em análise documental, foram discutidas e problematizadas as limitações associadas à utilização de organizadores e cortadores de comprimidos, como questão de saúde pública. Os organizadores destinados ao armazenamento e transporte de comprimidos e cápsulas expõem essas formas farmacêuticas a fatores ambientais dos quais estariam protegidos em suas embalagens originais, comprometendo sua estabilidade, eficácia e segurança. Os cortadores oferecem risco adicional quanto a perda da eficácia, reações adversas e intoxicação. Por outro lado, o transporte de medicamentos pelo usuário é reflexo da conciliação entre autonomia e autocuidado e a partição de comprimidos é necessária para cumprir certos regimes posológicos. Conclui-se que cabe aos profissionais observar e orientar pacientes e cuidadores, visando à adequação dessas condutas e à prevenção dos riscos envolvidos.

  10. A decadal survey of AO wavefront sensing detector developments in Europe

    Science.gov (United States)

    Feautrier, Philippe

    2011-09-01

    The success of the next generation of instruments for 8 to 40-m class telescopes will depend on the ability of Adaptive Optics (AO) systems to provide excellent image quality and stability. This will be achieved by increasing the sampling, wavelength range and correction quality of the wave front error in both spatial and time domains. The modern generation of AO wavefront sensor detectors started in the late nineties with the development of the CCD50 detector by e2v under ESO contract for the ESO NAOS AO system. With a 128x128 pixels format, this 8 outputs CCD runs at a 500 Hz frame rate with a readout noise of 7e-. A major breakthrough has been achieved with the recent development of the CCD220, also by e2v technologies. This 240x240 pixels 8 outputs EMCCD (CCD with internal multiplication), also developed by e2v, has been jointly funded by ESO and Europe under the FP6 programme. The CCD220 detector and the OCAM2 camera are now the most sensitive system in the world for advanced adaptive optics systems, offering an astonishing frame rate of 1500 Hz with negligible dark current. Extremely easy to operate, OCAM2 only needs a 24 V power supply and a modest water cooling circuit. This system is extensively described elsewhere in this conference (see Gach J-L. et al). An upgrade of OCAM2 is foreseen to boost its frame rate to 2500 Hz, opening the window of XAO wavefront sensing for the ELT. Since this major success, new developments started in Europe. One is fully dedicated to Laser Guide Star AO for the ELT. The spot elongation from a LGS SH wavefront sensor induces an increase of the pixel format. Two detectors are currently developed by e2v. The NGSD will be a 672x672 pixels CMOS detector with a readout noise of 4e (goal 1e) at 700 Hz frame rate. The LGSD is a scaling of the NGSD with 1680x1680 pixels and 3 e readout noise (goal 1e) at 700 Hz frame rate. New technologies will be developed for that purpose: new CMOS pixel architecture, CMOS back thinned and back

  11. Teoria da resposta ao item aplicada ao Inventário de Depressão Beck Item response theory applied to the Beck Depression Inventory

    Directory of Open Access Journals (Sweden)

    Stela Maris de Jezus Castro

    2010-09-01

    Full Text Available O Inventário de Depressão Beck (BDI, uma escala que mede o traço latente de intensidade de sintomas depressivos, pode ser avaliado através da Teoria da Resposta ao Item (TRI. Este estudo utilizou o modelo TRI de Resposta Gradual na avaliação da intensidade de sintomas depressivos de 4.025 indivíduos que responderam ao BDI, de modo a explorar eficientemente a informação disponível nos diferentes aspectos possibilitados pelo uso desta metodologia. O ajuste foi efetuado no software PARSCALE. Foram identificados 13 itens do BDI nos quais pelo menos uma categoria de resposta não tinha chance maior que as demais de ser escolhida, de modo que estes itens tiveram de ser recategorizados. Os itens com maior capacidade de discriminação são relativos à tristeza, pessimismo, sentimento de fracasso, insatisfação, auto-aversão, indecisão e dificuldade para trabalhar. Os itens mais graves são aqueles relacionados com perda de peso, retraimento social e idéias suicidas. O grupo dos 202 indivíduos com as maiores intensidades de sintomas depressivos foi composto por 74% de mulheres, e praticamente 84% possuíam diagnóstico de algum transtorno psiquiátrico. Os resultados evidenciam alguns dos inúmeros ganhos advindos da utilização da TRI na análise de traços latentes.The Beck Depression Inventory (BDI, a scale that measures the latent trait intensity of depression symptoms, can be assessed by the Item Response Theory (IRT. This study used the Graded-Response model (GRM to assess the intensity of depressive symptoms in 4,025 individuals who responded to the BDI, in order to efficiently use the information available on different aspects enabled by the use of this methodology. The fit of this model was done in PARSCALE software. We identified 13 items of the BDI in which at least one response category was not more likely than others to be chosen, so that these items had to be categorized again. The items with greater power of

  12. A Teoria da Resposta ao Item: possíveis contribuições aos estudos em marketing The Item Response Theory: possible contributions to marketing studies

    Directory of Open Access Journals (Sweden)

    Danielle Ramos de Miranda Pereira

    2011-01-01

    Full Text Available A constatação da ampla utilização de escalas multidimensionais por parte dos pesquisadores da área de marketing motivou a elaboração de um artigo com o propósito de discutir a aplicação da Teoria da Resposta ao Item (TRI, bem como apresentar a essa área um método que tem se mostrado bastante eficaz na estimação de construtos comportamentais. Sendo assim, o artigo apresenta uma discussão sobre a TRI, ressaltando seus avanços em relação à Teoria Clássica do Teste (TCT e suas aplicações tradicionais no campo da psicometria e da avaliação educacional. Para verificar sua aplicabilidade nos estudos de marketing, julgou-se adequado conduzir uma aplicação prática da TRI em um estudo envolvendo uma escala já bastante utilizada pelos pesquisadores - a de orientação de mercado (Escala MkTor proposta por Narver e Slater (1990. Os resultados da aplicação demonstraram que, embora o modelo da TRI proposto possa ser considerado satisfatório para a aplicação no contexto da Orientação para o Mercado, existem muitos desafios a serem enfrentados por novos estudos como a construção de uma escala com interpretação prática, indicando o que significa para uma empresa possuir um nível de maturidade associado a um determinado construto. As considerações finais ressaltam que a grande contribuição do artigo aos estudos em marketing é a apresentação de um método alternativo para estimar de forma mais apurada os construtos e avaliar a qualidade dos itens das escalas.The widespread utilization of multidimensional scales by researchers in field of marketing have motivated the conduction of a study to discuss the application of the Item Response Theory (IRT as well as presenting a method that has proved very effective in the estimation of behavioral constructs. Therefore, this article presents a discussion about IRT highlighting its advances regarding the Classical Theory of Tests (CTT and its traditional applications in the

  13. Expectativas de jovens do ensino médio público em relação ao estudo e ao trabalho

    Directory of Open Access Journals (Sweden)

    Davisson Charles Cangussu Souza

    2015-06-01

    Full Text Available O artigo analisa as expectativas de jovens do ensino médio de escolas públicas em relação à continuidade dos estudos e à inserção no mercado de trabalho. O principal procedimento da pesquisa foi a aplicação de um questionário a 1363 estudantes da região metropolitana de São Paulo. Em diálogo com as teorias críticas de Althusser (1999, Bourdieu e Passeron (1975, e Baudelot e Establet (1975, partimos da hipótese de que esses jovens possuiriam alta expectativa de ingresso no mercado de trabalho e baixa expectativa de continuidade dos estudos. Por um lado, os dados revelaram que os jovens pesquisados pretendem seguir estudando, e inclusive ingressar no ensino superior. Porém, por outro lado, foram constatadas desigualdades significativas de expectativas e avaliação de chances segundo as seguintes variáveis: autodefinição de raça; escolaridade e tipo de ocupação dos pais/responsáveis; autodefinição na estrutura de classes; experiência atual e anterior de trabalho. Tais desigualdades revelam a existência de um teto de vidro que reduz as chances de ingresso no ensino universitário (principalmente nas universidades públicas, segundo o grupo social considerado. Este artigo demonstra que conciliar estudo com trabalho é visto como a maior dificuldade e, ao mesmo tempo, como a principal estratégia para obter o nível superior, considerando os efeitos das políticas recentes de ampliação da oferta das vagas públicas e privadas.

  14. Alergia ao látex Alergia al látex Latex allergy

    Directory of Open Access Journals (Sweden)

    Jorge Barrios Allarcon

    2003-02-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O látex, (cis 1,4 polyisoprene está muito presente no dia-a-dia do anestesiologista. Os primeiros relatos de alergia ao látex datam de 1933. A sensibilidade ao látex na população de anestesiologistas é de 12,5% a 15,8%. A incidência de sensibilidade ao látex aumenta muito em grupos específicos, podendo produzir reações graves e até mesmo fatais. O objetivo desse estudo foi realizar uma revisão bibliográfica sobre o assunto, abordando este tema de interesse para o anestesiologista, considerando diagnóstico, prevenção e tratamento da alergia ao látex. CONTEÚDO: Os estudos sobre a prevalência das reações alérgicas ao látex variam muito conforme a população estudada e os métodos utilizados para estabelecer a sensibilidade ao antígeno. Mesmo com estas variações, existem alguns grupos em que o risco é elevado, particularmente em pacientes com distúrbio na formação do tubo neural. As manifestações clínicas variam desde dermatite de contato até anafilaxia e óbito. O diagnóstico precoce com pesquisa de IgE pode prevenir as reações de hipersensibilidade. CONCLUSÕES: É de extrema importância o diagnóstico precoce da alergia ao látex. A abordagem desses pacientes em ambientes livres de látex evitam a sensibilização e evolução muitas vezes para quadros dramáticos.JUSTIFICATIVA Y OBJETIVOS: El látex, (cis 1,4 polyisoprene está muy presente en el dia-a-dia del anestesista. Los primeros relatos de alergia al látex se originan desde 1933. La sensibilidad al látex en la población de médicos anestesistas es de 12,5 a 15,8%. La incidencia de sensibilidad al látex aumenta mucho en grupos específicos, pudiendo producir reacciones graves y también fatales. El objetivo de ese estudio fue realizar una revisión bibliográfica sobre el asunto, abordando este tema de interés para el anestesista, considerando diagnóstico, prevención y tratamiento de la alergia al látex. CONTENIDO

  15. Alergia ao látex em paciente com síndrome de Kabuki: relato de caso Alergia al látex en paciente con síndrome de Kabuki: relato de caso Latex allergy in a patient with Kabuki syndrome: case report

    Directory of Open Access Journals (Sweden)

    Vera Coelho Teixeira

    2010-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: O conhecimento do profissional de Anestesiologia sobre aspectos específicos de pacientes portadores de síndromes raras é uma necessidade crescente, já que cada vez mais esses pacientes são levados aos centros cirúrgicos. O objetivo é descrever um caso de alergia ao látex ocorrido em um desses pacientes com diagnóstico da Síndrome de Kabuki, cujos aspectos ainda não foram completamente esclarecidos, alertando os anestesiologistas quanto à possibilidade dessa associação. RELATO DO CASO: Paciente de 11 anos com diagnóstico de Síndrome de Kabuki foi admitida para exérese de lesões de partes moles. Apresentava histórico de reações alérgicas prévias após procedimentos cirúrgicos de pequeno porte. Com a necessidade da realização de um novo procedimento, após avaliação pré-anestésica, foi encaminhada a um alergologista, que a submeteu a testes cutâneos que confirmaram a hipótese de alergia ao látex. Foi levada mais uma vez ao centro cirúrgico para exérese das lesões, sob anestesia geral. Foram tomadas todas as precauções, com o objetivo de evitar novas manifestações clínicas. O procedimento transcorreu sem intercorrências e a paciente recebeu alta no mesmo dia, sem apresentar qualquer tipo de complicação, o que reforçou ainda mais o diagnóstico. CONCLUSÕES: A Síndrome de Kabuki parece ter um curso relativamente benigno em sua história natural. Entretanto, há muitos aspectos ainda a serem esclarecidos e, portanto, não se descarta a possibilidade da associação dessa patologia com outras condições que interessam ao anestesiologista. Essa descrição tem por objetivo alertar quanto ao risco da associação dessa síndrome com a alergia ao látex. Para tanto, deve-se incentivar, na avaliação pré-anestésica desses pacientes, a realização de uma anamnese bem feita, com a análise de outros fatores predisponentes que não a síndrome per seJUSTIFICATIVA Y OBJETIVOS: El

  16. Assistência ao nascimento na Bahia oitocentista Assisted birth in 19th century Bahia

    Directory of Open Access Journals (Sweden)

    Maria Renilda Nery Barreto

    2008-12-01

    Full Text Available Esse artigo aborda as culturas de assistência ao parto na Bahia oitocentista e trabalha com a hipótese de que, em Salvador, coexistiram duas culturas obstétricas: a dos médicos-parteiros, que faziam uso dos recursos técnicos e cognitivos disponibilizados pela obstetrícia como especialidade médica; e a das tradicionais parteiras, cujo saber era de natureza empírico-sensorial. Apesar de todo o esforço empreendido pelos médicos para angariar a confiança das famílias baianas, as parteiras continuaram hegemônicas na arte de 'aparar' crianças e de tratar das doenças de mulheres. A análise enfoca os segmentos sociais e profissionais que atuaram na assistência ao parto; o papel da Faculdade de Medicina da Bahia na formação e certificação das parteiras; e a utilização dos periódicos como meio de legitimação dos médicos-parteiros; ao tempo em que problematiza a pequena participação das parteiras nesses veículos de comunicação.This paper presents the traditions of assisted childbirth in the Brazilian state of Bahia in the 19th Century and develops the hypothesis that two obstetrical traditions coexisted in the capital, Salvador, namely the doctor-midwives - who used technical resources and knowledge acquired from obstetrics as a medical specialty - and the traditional midwives, whose know-how was purely of an empirical-sensorial nature. Despite all efforts employed by the doctors to win over the confidence of Bahian families, the midwives continued to be predominant in the art of 'delivering' children and treating female illnesses. The analysis focuses on the social and professional segments that were active in assisted birth; the role of the Bahian College of Medicine (Faculdade de Medicina da Bahia in the training and certification of midwives and the use of newspapers as a way to legitimize the doctor-midwives; it also discusses the scant coverage of the midwives in these media.

  17. Política Industrial de Apoio ao Desenvolvimento da Indústria Brasileira de Semicondutores

    Directory of Open Access Journals (Sweden)

    Milton Abreu Campanario

    2009-12-01

    Full Text Available http://dx.doi.org/10.5007/2175-8077.2009v11n24p69   A conquista da estabilidade macroeconômica tende a aumentar a discussão em torno de formas de intervenção nos planos microeconômico e setorial. A Política Industrial, Tecnológica e de Comércio Exterior (PITCE, lançada no início de 2004, sinalizou nessa direção, elegendo quatro setores considerados prioritários: fármacos, bens de capital, software e semicondutores. O presente artigo procura analisar a indústria de semicondutores nos contextos nacional e internacional e focaliza o papel da política industrial seletiva na dinamização de seu desenvolvimento. A partir da caracterização dessa indústria, é feito um benchmarking das políticas adotadas pela Coreia do Sul – país que apresentou, em certas fases de seu desenvolvimento industrial, características semelhantes ao brasileiro, mas que despontou como grande produtor e exportador de tecnologia de ponta. O texto indica que as políticas orientadas ao desenvolvimento da indústria de semicondutores, na PITCE, geram condições para a maturidade do setor. Contudo, essa maturidade enfatiza a fase de “imitação” (ligada ao processo de engenharia reversa e de internalização (por meio do incremento dos processos de aprendizado e produção interna, mas pouca ênfase seria alcançada na fase de criação (obtenção de tecnologia própria e de desenvolvimento de tecnologia nacional. Com esses percalços, em 2008, o governo atrelou o padrão da TV Digital (High Definition TV – HDT à construção de uma fábrica de semicondutores no Brasil, buscando uma saída para implantar tal indústria por uma empresa transnacional.

  18. Compostos bioativos em polpas de mangas 'rosa' e 'espada' submetidas ao branqueamento e congelamento

    Directory of Open Access Journals (Sweden)

    Lucimara Piauí Soares

    2013-06-01

    Full Text Available A manga (Mangifera indica L. constitui uma importante fonte de compostos bioativos, dentre os quais se destacam os carotenoides e a vitamina C, que contribuem para a promoção da saúde. Vários métodos podem ser utilizados para conservação de alimentos a fim de aproveitar melhor os frutos durante a safra e permitir seu armazenamento fora de época de produção. No entanto, podem alterar a qualidade nutricional do alimento. Dessa forma, sendo o branqueamento e o congelamento métodos que são utilizados no processamento industrial para conservação de polpas de frutas, objetivou-se, neste trabalho, analisar a influência do branqueamento e do congelamento sobre os teores de carotenoides totais e ácido ascórbico em mangas 'Rosa' e 'Espada' em relação ao tempo de armazenamento. As mangas no estádio maduro, após serem colhidas, lavadas, cortadas e despolpadas, foram submetidas ao congelamento (-18ºC ou branqueamento por imersão em água (75ºC, por 3 minutos ou branqueamento por vapor em água fervente, por 3 minutos. Em seguida, foram realizadas as determinações bioquímicas dos teores de carotenoides totais e ácido ascórbico no tempo zero e após 20; 40 e 60 dias de armazenamento sob congelamento. Após análise dos resultados obtidos, conclui-se que, na forma in natura (tempo zero, as variedades Rosa e Espada apresentam os máximos teores de ácido ascórbico, porém o uso do branqueamento com vapor e o congelamento após 60 dias de armazenamento provocam perdas de, respectivamente, 53% ('Rosa' e 35% ('Espada'; 72% ('Rosa' e 60% ('Espada' destes compostos. No branqueamento por imersão em água, há perda completa do ácido ascórbico nas polpas das variedades Rosa e Espada. Em relação aos carotenoides totais, os valores foram semelhantes em polpas branqueadas a vapor e sem branqueamento no tempo zero,com tendência de redução durante o longo da armazenagem.

  19. Prednisona e meloxicam no tratamento de ratos submetidos ao trauma agudo da medula espinhal

    Directory of Open Access Journals (Sweden)

    Graciane Aiello

    2015-01-01

    Full Text Available O objetivo deste estudo foi investigar o efeito da prednisona e do meloxicam na terapia de ratos submetidos ao modelo experimental de trauma agudo da medula espinhal, induzida pelo cateter de Fogarty 2Fr, mediante a avaliação dos parâmetros de estresse oxidativo, dos testes neurológicos e do exame histopatológico da medula espinhal. Foram utilizados 90 ratos Wistar, distribuídos em seis grupos, denominados controle salina ou GCS (n=15, controle prednisona ou GCP (n=15, controle meloxicam ou GCM (n=15, trauma mais salina ou GTS (n=15, trauma mais prednisona ou GTP (n=15 e trauma mais meloxicam GTM (n=15. Cada grupo foi redistribuído em três subgrupos de igual número, de acordo com o tempo de tratamento no pós-operatório de 24h, 72h e sete dias. Todos os grupos foram submetidos à laminectomia e, nos grupos GTS, GTM e GTP, após a exposição da medula espinhal, foi realizado o trauma medular compressivo, utilizando o cateter de Fogarty 2Fr. Os grupos GCS e GTS foram tratados com solução salina, os GSM e GTM receberam meloxicam e os GSP e GTP prednisona, sendo administrados pela via intraperitoneal. Em todos os ratos, foram avaliados os parâmetros de estresse oxidativo, testes neurológicos e exame histopatológico da medula espinhal. Os animais dos grupos GTS, GTM e GTP, nos diferentes tempos (24h, 72h e sete dias, tiveram pontuação zero na escala de Basso, Beattie e Bresnahan (BBB; no plano inclinado, permaneceram com pontuação três e perderam a percepção da dor profunda. Os grupos GTM e GTP apresentaram menor atividade da catalase e de níveis de TBARS, quando comparado ao grupo GTS. Foi constatada degeneração Walleriana e necrose da substância cinzenta de intensidades variáveis, não apresentando diferença entre os grupos submetidos ao trauma. O meloxicam e a prednisona apresentam possível efeito antioxidante, mas não impedem a necrose e a degeneração Walleriana da medula espinhal de ratos.

  20. Mecanismos e fatores associados aos sintomas gastrointestinais em pacientes com diabetes melito

    Directory of Open Access Journals (Sweden)

    Mônica Loureiro Celino Rodrigues

    2012-02-01

    Full Text Available OBJETIVOS: Apresentar a frequência, os principais fatores causadores dos sintomas gastrointestinais em pacientes portadores do diabetes melito e controvérsias quanto à sua ocorrência em crianças e adolescentes. FONTES DOS DADOS: Revisão não sistemática nas bases de dados MEDLINE/PubMed e SciELO (1983-2011, além de capítulos de livros relevantes. Foram selecionados os artigos mais atuais e representativos do tema. SÍNTESE DOS DADOS: A prevalência do diabetes melito vem aumentando ao longo dos anos em vários países do mundo. No sistema digestório, é conhecida a ocorrência de complicações do diabetes melito, entre elas os sintomas gastrointestinais (náuseas, vômitos, dor abdominal, azia, disfagia, constipação, diarreia e incontinência fecal. A patogênese das alterações das funções gastrointestinais no diabetes melito está ainda sob investigação, e o papel do sistema nervoso entérico e seus neurotransmissores tem ganhado significância. Em decorrência do comprometimento do sistema digestório, com danos ao sistema nervoso entérico, portadores do diabetes melito podem apresentar quadros específicos de distúrbios de motilidade, alguns de grande relevância clínica, como gastroparesia diabética, constipação e diarreia. A disfunção deste sistema contribui para aumentar a morbidade desta doença e piora a qualidade de vida de seus portadores. CONCLUSÕES: O diabetes melito, ao longo dos anos, afeta o sistema digestório. Por ser uma condição que piora a qualidade de vida dos portadores e também pode indicar complicação da doença, deve ser valorizada no acompanhamento e tratamento do paciente com diabetes melito. Na infância e na adolescência, ainda existem poucos estudos que abordam o problema.

  1. Natureza desumana: desmesuras do mundo ao homem Inhuman being nature: discourtesies of world for the man

    Directory of Open Access Journals (Sweden)

    Luis Artur Costa

    2011-04-01

    Full Text Available O presente artigo propõe-se a erigir um conceito de natureza imanente e paradoxal que dê sustento às práticas da psicologia social de desnaturalização das configurações sociais. A partir da problematização da natureza em autores fundamentais da filosofia, Aristóteles e Rousseau, elabora-se uma nova concepção de natureza desnaturada e livre das amarras das representações essencialistas e totalizantes do humanismo clássico e iluminista. Afirmando outra possibilidade de homem e humanidade para além da clausura de sua própria representação ideal e analítica, o conceito de natureza aqui erigido impede o esvaziamento das práticas de desnaturalização em slogan, ao fornecer para essa prática um substrato ontoepistêmico adequado às suas desmesuras ao humano. Abre-se então a possibilidade de operar conceitos fluidos como o de subjetivação e devir ao invés do de identidade e estado.This article proposes to build a concept of immanent and paradoxical nature that gives sustenance to the practices of the social psychology of denaturalization of social configurations. From the problematization of the nature in fundamental authors in western philosophy, Aristotle and Rousseau, a new concept of an unnatural nature is created, free from the essentialistic and totalizing representations of classical and enlightened humanism. Affirming further possibility of man and humanity beyond the closing of his/her own ideal and analytical representation, the concept of nature here erected prevent the practice of emptying in denaturalization slogan, to provide for this practice a-epistemic suitable substrate onto their disproportionate to the human. Then it opens up the possibility of operating fluid concepts such as subjectivity instead of becoming an identity and status.

  2. Prevalência e fatores associados ao doping cosmético entre frequentadores de academias

    Directory of Open Access Journals (Sweden)

    Jhonatan Lima-Oliveira

    2015-05-01

    Full Text Available Introdução: O crescente culto ao corpo na sociedade atual tem levado diversos frequentadores de academia à prática sistemática de injetar óleos por via intramuscular, procedimento denominado doping cosmético. Assim, o presente estudo teve como objetivo verificar a prevalência de doping cosmético na região do Vale do São Francisco, buscando estabelecer os perfis sociodemográfico e clínico desse grupo de indivíduos. Relato de caso: Trata-se de um estudo retrospectivo e documental, com análise dos registros de 346 frequentadores de academias de ginástica, dos quais sete relataram utilização de doping cosmético. Destes registros, foram coletados dados sociodemográficos, cineantropométricos, hemodinâmicos, história patológica pessoal e familiar pregressa e de consumo de drogas lícitas e ilícitas. A prevalência de doping cosmético foi 2,0% (IC95% 0,8–4,1, e a maioria dos usuários são adultos jovens com segundo grau completo, trabalhadores de classe média, sendo considerados ativos com baixo percentual de gordura. Eles utilizam suplementos alimentares, esteroides anabolizantes e outras drogas ilícitas. Conclusão: Os achados contribuem na determinação do perfil dessa população, demonstrando que os usuários de doping cosmético são adultos jovens preocupados com a estética corporal. As características sociodemográficas encontradas diferem de estudos prévios quanto ao nível de escolaridade, renda e ocupação. Nesse sentido, ações voltadas para a conscientização dessa população quanto aos riscos e perigos da utilização do doping cosmético devem ser apoiadas o mais breve possível.

  3. Masculinidade e vulnerabilidade ao HIV de homens heterossexuais, São Paulo, SP

    Directory of Open Access Journals (Sweden)

    Guerriero Iara

    2002-01-01

    Full Text Available OBJETIVO: Identificar aspectos da masculinidade relacionados à vulnerabilidade dos homens à infecção pelo HIV. MÉTODOS: Pesquisa qualitativa realizada com homens motoristas de ônibus e integrantes de uma Comissão Interna de Prevenção de Acidentes (Cipa em uma empresa de transportes coletivos na cidade de São Paulo, SP. Foram gravadas e transcritas dez entrevistas individuais e quatro oficinas de sexo seguro. Seu conteúdo foi disposto e discutido em blocos temáticos relacionados à sexualidade, à infidelidade, ao preservativo, às doenças sexualmente transmissíveis e à Aids. RESULTADOS: São aspectos que tornam os homens mais vulneráveis: sentir-se forte, imune a doenças; ser impetuoso, correr riscos; ser incapaz de recusar uma mulher; considerar que o homem tem mais necessidade de sexo do que a mulher e de que esse desejo é incontrolável. A infidelidade masculina é considerada natural; a feminina é atribuída a deficiências do parceiro. A decisão por usar ou não camisinha é feita pelo homem; a mulher só pode solicitá-la para evitar gravidez. A não-utilização da camisinha é atribuída a: estética, alto custo, medo de perder a ereção, perda de sensibilidade no homem e na mulher. Os entrevistados não se consideram vulneráveis ao HIV nem a doenças sexualmente transmissíveis (DST e confundem suas formas de transmissão. CONCLUSÕES: A idéia de que ser homem é ser um bom provedor para a família e ter responsabilidade pode constituir um aspecto que favoreça a prevenção, já que pode levá-los a usar camisinha como contraceptivo e para não trazer doenças para casa. É importante conhecer e intervir sobre as concepções de masculinidade, não só porque elas podem contribuir para aumento da vulnerabilidade ao HIV, mas também porque podem apontar caminhos mais efetivos para a prevenção.

  4. Fatores associados aos sintomas depressivos em idosos: estudo EpiFloripa

    Directory of Open Access Journals (Sweden)

    Lucelia Justino Borges

    2013-08-01

    Full Text Available OBJETIVO Analisar a prevalência e fatores associados a sintomas depressivos em idosos. MÉTODOS Estudo epidemiológico transversal e de base domiciliar (inquérito EpiFloripa Idoso com 1.656 idosos, realizado por conglomerados em dois estágios, setores censitários e domicílios, em Florianópolis, SC. A prevalência de sintomas depressivos (desfecho foi obtida por meio da Geriatric Depression Scale (GDS-15, e testadas associações segundo variáveis sociodemográficas, de saúde, comportamentais e sociais. Foram calculadas razões de prevalências brutas e ajustadas com intervalo de 95% de confiança por regressão de Poisson. RESULTADOS A prevalência de sintomas depressivos foi de 23,9% (IC95% 21,84;26,01. Os fatores de risco associados no modelo final foram: escolaridade de cinco a oito anos (RP = 1,50; IC95% 1,08; 2,08, um a quatro anos (RP = 1,62; IC95% 1,18; 2,23 e nenhum ano de estudo (RP = 2,11; IC95% 1,46;3,05; situação econômica pior quando comparada com a que tinha aos 50 anos (RP = 1,33; IC95% 1,02;1,74; déficit cognitivo (RP = 1,45; IC95% 1,21;1,75; percepção de saúde regular (RP = 1,95; IC95% 1,47;2,60 e ruim (RP = 2,64; IC95% 1,82;3,83; dependência funcional (RP = 1,83; IC95% 1,43; 2,33; e dor crônica (RP = 1,35; IC95% 1,10;1,67. Grupo etário de 70 a 79 anos (RP = 0,77; IC95% 0,64;0,93; atividade física de lazer (RP = 0,75; IC95% 0,59;0,94; participação em grupos de convivência ou religiosos (RP = 0,80; IC95% 0,64;0,99; e ter relação sexual (RP = 0,70; IC95% 0,53;0,94 mostraram-se fatores protetores ao aparecimento dos sintomas depressivos. CONCLUSÕES Situação clínica adversa, desvantagem socioeconômica e pouca atividade social e sexual mostraram-se associadas aos sintomas depressivos em idosos.

  5. RETORNO AO ESPORTE APÓS ARTROPLASTIA TOTAL DO JOELHO: REVISÃO SISTEMÁTICA

    Directory of Open Access Journals (Sweden)

    Pedro Baches Jorge

    Full Text Available RESUMO Esta revisão sistemática da literatura teve como objetivo analisar as variáveis envolvidas no retorno às atividades esportivas em pacientes submetidos à artroplastia total do joelho (ATJ, verificar o tipo de esporte recomendado, o tempo de retorno ao esporte, a satisfação do paciente e o nível de atividade física após a cirurgia. Os estudos relacionados com a prática de atividade física e desportiva depois da ATJ foram selecionados por dois revisores independentes. Foram incluídos 11 estudos (10 transversais retrospectivos e um caso-controle. A maioria dos pacientes que participou de alguma atividade física regular antes da ATJ retornou à prática esportiva após a cirurgia, sendo mais comuns os esportes de baixo impacto como caminhada, esportes aquáticos, golfe, bicicleta estacionária, entre outros. Foi possível observar que o nível de atividade física não depende da dor e dos sintomas pós-operatórios, mas da satisfação com a cirurgia, motivação e capacidade funcional dos indivíduos. O tempo de retorno ao esporte variou de seis a 18 meses depois da ATJ. Apesar de alguns estudos mostrarem que os cirurgiões não recomendam a prática de esportes de alto impacto após a cirurgia, alguns estudos mostraram bons resultados, desde que o nível de atividade prévio à cirurgia, a população adequada e a expectativa do paciente no pós-operatório sejam considerados. Assim, conclui-se que o retorno ao esporte após ATJ não só é possível, como é recomendado em níveis recreativos, e um paciente colaborativo, instruído e com preparo adequado de condicionamento físico pode melhorar tanto no nível funcional e cardiovascular quanto no psicológico, com aumento da autoestima e da qualidade de vida. Há ainda a necessidade de estudos futuros, de boa qualidade metodológica como os ensaios clínicos randomizados, sobre os efeitos (benefícios e prejuízos dos esportes de alto impacto para os pacientes submetidos

  6. Marketing de Relacionamento: Agregando Valor ao Negócio com Big Data

    Directory of Open Access Journals (Sweden)

    Ana Cláudia Borges Coutrim dos Reis

    2016-12-01

    Full Text Available Nos últimos anos, as constantes inovações tecnológicas, o aumento exponencial do volume de dados, junto às evoluções nas tendências de consumo, geraram um cenário global de grandes desafios para as organizações. O uso de tecnologias de Big Data, para análise do volume crescente de dados, disponíveis no mundo virtual globalizado, oferece uma nova visão sobre o mercado e pode contribuir com o futuro das organizações, por meio da disponibilização de informações de qualidade que apoiarão fortemente a tomada de decisão. Nesse cenário de alta competitividade, considerar o contexto de análises de dados, com o uso de tecnologias de Big Data, pode ampliar a visão das empresas para as tendências do mercado, favorecendo a identificação de estratégias melhor direcionadas aos perfis de comportamentos e preferências de consumo. O objetivo da pesquisa é investigar como o uso das tecnologias de Big Data pode ampliar a capacidade do marketing de relacionamento das organizações, agregando valor ao negócio. Os resultados demonstram que as organizações que fazem uso das tecnologias de Big Data, conseguem melhor definir suas estratégias de marketing de relacionamento com os clientes, obtendo como resultados relacionamentos mais duradouros com o mercado e seus clientes e retornos favoráveis aos seus negócios. Em um futuro próximo, a utilização de Big Data, para ampliação das estratégias de marketing de relacionamento, serão regras de sobrevivência para as organizações. O diferencial estará na forma como o gestor interpretará as informações disponíveis e agirá para alcançar os resultados almejados.

  7. O Método Delfos Aplicado ao Turismo no Espaço Rural

    Directory of Open Access Journals (Sweden)

    Rosane Maria Lanzer

    2012-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE O Brasil encontra-se na quarta posição quanto ao desenvolvimento da atividade de Turismo Rural, sendo superado somente pela Espanha, Portugal e Argentina. O Turismo Rural no Brasil pode ser explicado por três fatores principais: o interesse dos habitantes do meio urbano em conviver com a natureza, a necessidade do produtor em diversificar sua fonte de renda e de agregar valor aos seus produtos. O método Delfos, criado nos anos de 1950, tem por objetivo gerar informações sobre o futuro. O método se constitui em uma sondagem multifásica, desenvolvida com a participação de um grupo de especialistas no assunto, onde o consenso sobre determinado tópico representaria uma tendência. A aplicação desse método feita em 2003, tendo como horizonte 2010, identificou as possíveis tendências para o turismo no espaço rural. O objetivo deste estudo foi avaliar se a prospecção realizada se concretizou. Nesse estudo foram consideradas quatro questões: 1 o aumento ou diminuição do turismo rural como alternativa de renda; 2 aumento do número de turistas acima de 65 anos; 3 incremento da participação feminina no gerenciamento dos empreendimentos e 4 quando o número de propriedades integradas ao turismo rural chegará a 8.000. Com exceção da questão 2, as respostas otimistas dadas pelos especialistas foram corroboradas por meio das informações obtidas. A previsão de aumento, não demasiado otimista, no número de turistas com idade acima de 65 anos, não pode ser confirmada, ainda que tenha sido constatado na população brasileira um maior número de indivíduos nessa faixa etária.  

  8. Resistência ao cisalhamento e grau de intemperismo de cinco solos na região de Lavras (MG

    Directory of Open Access Journals (Sweden)

    W. W. Rocha

    2002-06-01

    Full Text Available Atualmente os parâmetros da resistência ao cisalhamento dos solos podem ser uma ferramenta muito útil na estabilização de taludes e recuperação de voçorocas, bem como na adoção de práticas mecânicas de conservação para os solos agrícolas. Com o objetivo de avaliar a resistência ao cisalhamento de cinco solos da região de Lavras (MG e sua relação com o grau de intemperismo, realizou-se um experimento, utilizando uma prensa de cisalhamento direto, a qual permite ensaiar amostras indeformadas de solos. Essas amostras foram coletadas na profundidade de 0-0,03 m e submetidas ao ensaio de cisalhamento, para a definição das envoltórias de resistência e obtenção da coesão aparente (C e o ângulo de atrito interno (φ. Observou-se que C, de forma geral, foi maior para solos que apresentaram maior densidade, umidade a -0,01 MPa e maior teor de areia. Os valores de (φ foram maiores nos solos com maiores teores de argila. O Latossolo Vermelho-Amarelo distrófico (LVAd e o Argissolo Vermelho-Amarelo distrófico típico (PVAd, com densidades do solo, teores de areia e umidade a -0,01MPa maiores, apresentaram maiores resistências ao cisalhamento em relação ao Latossolo Vermelho distrófico (LVd, Cambissolo Háplico Tb distrófico (CXbd e Latossolo Vermelho distroférrico (LVdf, que apresentaram maiores teores de argila e matéria orgânica. Para a classe dos Latossolos, a resistência ao cisalhamento foi maior onde os índices Ki e Kr foram mais elevados, graças à estrutura em blocos apresentada pelo LVAd, que condicionou maior resistência ao cisalhamento. Do ponto de vista da resistência ao cisalhamento, os solos LVAd e PVAd mostraram-se mais resistentes a voçorocamento e ao preparo do solo.

  9. Contribuição ao estudo do eletrodeposito de niquel preto

    OpenAIRE

    Annette Gorenstein

    1986-01-01

    Resumo: Este trabalho é uma contribuição ao estudo da superfície seletiva eletrodepositada conhecida como níquel preto. São discutidas as reações químicas/eletroquímicas envolvidas no processo de formação do filme. A voltametria de dissolução anódina de depósitos metálicos de níquel e zinco é também apresentada. A caracterização química e microestrutural foi obtida através da técnica de Espectroscopia Auger, difração de raio x e microscopia eletrônica de transmissão associada à difração de el...

  10. AoA-Based Local Positioning System Using a Time-Modulated Array

    Directory of Open Access Journals (Sweden)

    Kyung-Jin Baik

    2017-10-01

    Full Text Available In this paper, we propose an angle-of-arrival (AoA-based local positioning system using a time-modulated array (TMA. The proposed system can determine a two-dimensional position using only two TMAs without any synchronization between the two receivers. The hardware for the proposed system consists of two commercial monopole antennas, a self-designed switch, and a well-known software-defined radio receiver. Furthermore, the location can be simply estimated in real time without the need for complicated positioning algorithms such as the MUSIC and ESPRIT algorithms. In order to evaluate the performance of our system, we estimated the position of the wireless node in an office environment. The position was estimated with a mean error of less than 0.1 m. We therefore believe that our system is appropriate for various wireless local positioning applications.

  11. Do mito original ao mito ideológico: alguns percursos

    Directory of Open Access Journals (Sweden)

    Raul Fiker

    1984-01-01

    Full Text Available Este artigo é parte de uma Dissertação de Mestrado - "Mito e Paródia: sua estrutura e função no texto literário" - defendida em novembro de 1983 no Instituto de Estudos da Linguagem/Unicamp. A passagem aqui reproduzida pertence ao capítulo que trata da conceituação do mito. Ela procura apreender alguns de seus aspectos básicos dinamicamente, na transição de sua forma original, tal como ocorre nas sociedades primitivas e arcaicas, para seu sucedâneo ideológico, no contexto das sociedades históricas.

  12. Chacal ou Cordeiro? O Brasil frente aos desafios e oportunidades do Sistema Internacional

    Directory of Open Access Journals (Sweden)

    Júlio César Cossio Rodriguez

    2012-12-01

    Full Text Available Este artigo analisa as configurações da política externa brasileira pós-2002 para relacionar os ganhos e perdas com as mudanças estruturais do sistema internacional. O intuito e realizar um balanço das capacidades materiais do Brasil, assim como dos seus desafios e oportunidades, a partir das categorias propostas por Randall Schweller. Chacal ou Cordeiro? Como se comporta o Brasil num sistema internacional em transição e quais podem ser as consequências? Ou seja, atua como chacal na busca de ganhos relativos ao seguir o ator mais revisionista (China, e como cordeiro na associação direta com a potência unipolar.

  13. Contribuição ao conhecimento do "bicho bôlo", praga da batatinha

    Directory of Open Access Journals (Sweden)

    O. J. Boock

    1952-03-01

    Full Text Available Os tubérculos de batatinha provenientes de culturas feitas em terras marginais ao rio Paraíba, ricas em matéria orgânica, vêm sendo corroídos pelas larvas de um coleóptero denominadas "bicho bôlo", inutilizando grande parte da produção. Foi identificado como pertencente à família Seara-bseidae - Dyscinetus planatus (Burm., 1847 -. Constatações feitas pela Secção de Raízes e Tubérculos do Instituto Agronômico, em experiências de variedades, revelaram, em alguns casos, até 44% de ataque, como, por exemplo, o ocorrido em julho de 1951, na variedade "Krasava". Larvas coligidas em São José dos Campos, foram trazidas para o laboratório, juntamente com o solo da região, continuando a se nutrir e sofrendo metamorfose, Estas, de hábitos lucífugos, medem, quando adultas, cêrca de 35 mm de comprimento, e a largura ao meio do corpo, oscila ao redor de 9 mm, apresentando-se quase sempre recurvadas em forma de U. A pupa mede 21 mm de comprimento e, sob as condições de laboratório, o período pupal foi de 20 e 24 dias, Como inimigo natural, foi observado um fungo imperfeito, cuja identificação não foi ainda possível obter, chegando a destruir, em laboratório, mais de 90% dos lotes de larvas, atacando, também, as pupas e os adultos. Constatou-se ainda, em adultos mortos, a presença de grande número de ácaros, de espécie ainda não determinada. Resultados preliminares, de combate ao ''bicho bôlo" com "Gesarol .P", em doses baixas - 1.400, 2.150 e 2.800 gramas por hectare - não influíram sôbre a redução do ataque.Tubers of Irish potato Solanum tuberosum L. - harvested in soil rich in organic matter along the Paraiba river in the State of São Paulo, are severely damaged by a Coleopterus larva - Scarabxidas - Dyscinetus planatus (Burm., 1847, known by the local name of "bicho bôlo". Potato tubers from eight commercial varieties harvested in trials carried out in the Taubaté region were examined in order to verify

  14. "Is there a text in this class?" - Comentário ao texto de Stanley Fish

    Directory of Open Access Journals (Sweden)

    Rafael Eugenio Hoyos-Andrade

    2001-02-01

    Full Text Available

    Apresenta-se aqui um comentário ao texto de Stanley Fish, cuja tradução aparece nestemesmo número da revista Ma. Utilizando elementos de outros capítulos do mesmo livro, mostra-seque o Autor defende uma doutrina bem menos radical que aquela difundida em nosso meio por algunsintérpretes do famoso crítico literário. Acrescentam-se, porém, algumas considerações e distinçõesque, na opinião do comentarista, tornariam a teoria de Fish menos sujeita a interpretações radicais.

  15. Prevalência e fatores associados ao doping cosmético entre frequentadores de academias

    OpenAIRE

    Jhonatan Lima-Oliveira; Paulo Adriano Schwingel

    2015-01-01

    Introdução: O crescente culto ao corpo na sociedade atual tem levado diversos frequentadores de academia à prática sistemática de injetar óleos por via intramuscular, procedimento denominado doping cosmético. Assim, o presente estudo teve como objetivo verificar a prevalência de doping cosmético na região do Vale do São Francisco, buscando estabelecer os perfis sociodemográfico e clínico desse grupo de indivíduos. Relato de caso: Trata-se de um estudo retrospectivo e documental, com análise d...

  16. Resistência de café em coco e despolpado ao fluxo de ar

    OpenAIRE

    Danilo J. P. da Silva; Couto, Sandra M.; Peixoto,Abraão B.; Ana E. O. dos Santos; Vieira,Stella M. J.

    2006-01-01

    Determinaram-se, neste trabalho, expressões para descrever: (1) variações da massa específica, aparente e real, e porosidade do café (coco e despolpado) em função do teor de umidade do produto e (2) o comportamento dos valores de resistência ao fluxo de ar em colunas de café (coco e despolpado) em função do teor de umidade do produto, intensidade do fluxo e profundidade na coluna. Para café despolpado, as massas específicas, reais e aparentes, e porosidade, são funções lineares do teor de umi...

  17. The CHARIS Integral Field Spectrograph with SCExAO: Data Reduction and Performance

    Science.gov (United States)

    Kasdin, N. Jeremy; Groff, Tyler; Brandt, Timothy; Currie, Thayne; Rizzo, Maxime; Chilcote, Jeffrey K.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Norris, Barnaby; Tamura, Motohide

    2018-01-01

    We summarize the data reduction pipeline and on-sky performance of the CHARIS Integral Field Spectrograph behind the SCExAO Adaptive Optics system on the Subaru Telescope. The open-source pipeline produces data cubes from raw detector reads using a Χ^2-based spectral extraction technique. It implements a number of advances, including a fit to the full nonlinear pixel response, suppression of up to a factor of ~2 in read noise, and deconvolution of the spectra with the line-spread function. The CHARIS team is currently developing the calibration and postprocessing software that will comprise the second component of the data reduction pipeline. Here, we show a range of CHARIS images, spectra, and contrast curves produced using provisional routines. CHARIS is now characterizing exoplanets simultaneously across the J, H, and K bands.

  18. Ao serviço do líder: as campanhas eleitorais do Partido Socialista

    Directory of Open Access Journals (Sweden)

    Marco Lisi

    2008-07-01

    Full Text Available Este artigo procura analisar a evolução das campanhas eleitorais do Partido Socialista entre 1976 e 2005, evidenciando as suas principais características organizativas ao nível nacional e local. As conclusões apontam para a importância dos especialistas externos e para o reforço da centralização, que contribuem para o aumento da autonomia do líder socialista.This article analyses the development of the Socialist Party's election campaigns between 1976 and 2005, revealing their main organizational characteristics both nationally and locally. The conclusions demonstrate that outside experts were important and that there was increasing centralization, both of which contribute to the increased autonomy of the socialist leader.

  19. Imagem, magia e imaginação: desafios ao texto antropológico

    Directory of Open Access Journals (Sweden)

    Sylvia Caiuby Novaes

    2008-10-01

    Full Text Available Quais as diferentes formas de engajamento que imagem e texto propiciam ao espectador/leitor? Sabemos que texto e imagem comunicam e que toda comunicação depende de uma relação entre aqueles que se comunicam; o objetivo deste texto é entender as novas possibilidades para a antropologia da expressão do conhecimento que se utiliza de imagens, como fotografias ou filmes.What different forms of engagement do image and text allow the spectator/reader? We know that text and image communicate, and that all communication depends on a relationship between those who communicate. The objective of this text is therefore to understand the new possibilities available to an anthropology of the expression of knowledge that makes use of images, such as photographs and films.

  20. Hipoterapia na GNR: uma forma de proximidade ao cidadão

    OpenAIRE

    Afonso, Nuno

    2012-01-01

    “Hipoterapia Na GNR: uma forma de proximidade ao cidadão” é um trabalho que mostra o lado solidário e humano numa força de segurança. A GNR, uma força de segurança centenária, única no país dotada de solípedes na sua orgânica, rentabiliza este meio não só no cumprimento da sua missão geral, mas também no apoio a pessoas portadoras de necessidades especiais. Com este Trabalho de Investigação Aplicada pretendeu-se analisar de que forma é materializada a Hipote...

  1. Photooxidation of the phenylazonaphthol AO20 on TIO2: kinetic and mechanistic investigations.

    Science.gov (United States)

    Galindo, C; Jacques, P; Kalt, A

    2001-11-01

    The results of the photocatalytic and photosensitized degradations of the monoazo dye AO20 in aqueous solution using suspended titanium dioxide are presented. Kinetic and mechanistic details have been elucidated using UV/Vis, FTIR and TCO techniques. It was proven that adsorption of dye molecules onto the support material is essential for the processes to be effective. Moreover, even if their mechanisms differ during the early stages, photocatalysis and photosensitization lead to very similar ultimate breakdown products. Indeed, the original dye anchored to the oxide surface systematically undergoes fast decomposition until it is transformed into CO2 or aliphatic acids (formic, acetic, oxalic acids), which react rather slowly with hydroxyl radicals or trapped holes.

  2. Do instante ao estado de coisas: formas da estabilidade no discurso visual do fotojornalismo

    Directory of Open Access Journals (Sweden)

    Benjamim Picado

    2009-06-01

    Full Text Available O texto procura examinar a questão da função narrativa atribuída aos temas da estabilidade no fotojornalismo, tomando como modelo de comparação as relações entre os temas de paisagem e o conceito de sublimidade da representação pictórica, na análise que o historiador da arte Louis Marin faz das funções narrativas nas tópicas da natureza, em Nicolas Poussin. Do lado do fotojornalismo, tomamos como exemplo dessas questões o ensaio visual “Shattered”, realizado pelo fotógrafo de guerra James Nachtwey, sobre os instantes seguintes do ataque às torres gêmeas, publicada na revista Time, como campo de provas da análise desse problema da estabilidade e do dicurso visual na fotografia.

  3. UPYZVS CCD-photometry for the IC 4665 open cluster sky area (Andrushivka AO).

    Science.gov (United States)

    Andruk, V.; Bartashiute, S.; Butenko, G.; Gerashchenko, O.; Ivashchenko, Yu.; Kovalchuk, G.; Lokot', V.; Perekhod, A.; Samoylov, V.

    2007-09-01

    CCD observations of four sky area in the IC 4665 open cluster were made to examine the Zeiss-600 telescope photometric system (the Andrushivka AO, Ukraine) with the aim of the Vilnius system implementation. Magnitudes and coordinates of stars up to V=15.m6 were determinate for 23'.5x23'.5 overlapping fields. Equatorial coordinates of stars were obtained in the USNO-A2.0 catalog system. The CCD frame processing method is describe. It is based on a new technique for flat field elumination with the MIDAS/ROMAFOT software (the LINUX shell). The rms error of single determination of magnitude for the stars up to V=13m is ±0m.02/0m.03 for 60 s exposure. The photometric system of the telescope the UPYZVS Vilnius system is determined; the reduction accuracy is 0m.02/0m.10.

  4. Mercosul aos dez anos: crise de crescimento ou perda de identidade?

    Directory of Open Access Journals (Sweden)

    Alcides Costa Vaz

    2001-06-01

    Full Text Available O texto analisa a trajetória de uma década do Mercosul e suas perspectivas de médio prazo em suas dimensões econômica e político-institucional, com ênfase aos reflexos de injunções internas e externas para o desempenho das duas principais economias do bloco e às respostas dos respectivos governos às oportunidades e constrangimentos para a consolidação do bloco.The text analyses the course of Mercosur along its first decade as well as its mid-term perspectives in economic, polical and institutional terms, with emphasis on the consequences of internal and external injunctions to the performance of its two main economies and the responses of the respective governments to opportunities and restraints towards the bloc's consolidation.

  5. A visita de um afro-americano ao paraíso racial

    Directory of Open Access Journals (Sweden)

    Petrônio Domingues

    2006-12-01

    Full Text Available Em 1923, o jornalista e empresário afro-americano Robert Abbott visitou o Brasil. De volta aos Estados Unidos, publicou uma série de artigos no jornal Chicago Defender, informando que, aqui, os negros não enfrentavam problemas que dificultasse ou impedisse seu pleno desenvolvimento econômico, social, político, cultural, ou seja, eles viviam numa espécie de paraíso racial. A principal questão que vai ser investigada neste artigo é saber por que Abbott retratou um quadro tão mítico das relações raciais no Brasil.

  6. Problemas relacionados ao uso de sêmen refrigerado de garanhões

    Directory of Open Access Journals (Sweden)

    Gustavo Mendes Gomes

    2016-09-01

    Full Text Available Inúmeras biotecnologias se tornaram difundidas, sendo a inseminação artificial a mais utilizada na indústria equina. Pela necessidade em aumentar a longevidade dos espermatozoides e garantir altas taxas de fertilização, a tecnologia de refrigeraçãoespermática tem sido amplamente estudada e utilizada comercialmente na produção de cavalos.No entanto, até o presente existem alguns pontos que impedem a difusão plena dessa biotecnologia, como os resultados inconstantes e as vezes insatisfatórios que ocorrem ao trabalhar com sêmen refrigerado. O objetivo deste trabalho foi revisar os pontos críticos relativos à utilização de sêmen refrigerado equino em programas de reprodução animal na espécie.

  7. Do vazio ao objeto: das ding e a sublimação em Jacques Lacan

    OpenAIRE

    Ariana Lucero; Ângela Vorcaro

    2013-01-01

    Pretende-se esclarecer a formulação lacaniana de que "a sublimação eleva um objeto à dignidade da Coisa". A hipótese de que das Ding, ou a Coisa, é o que permanece de irrepresentável na experiência de satisfação, o que padece do significante e pode ser remetido à pura falta, ao vazio, leva-nos a pensar a sublimação como a construção de um objeto que explicite essa opacidade. Este percurso argumentativo será ilustrado por análises da literatura de amor cortês e de algumas obras de arte referid...

  8. Colelitíase associada ao uso de ceftriaxona Cholelithiasis associated with the use of ceftriaxone

    Directory of Open Access Journals (Sweden)

    Dorcas Lamounier Costa

    2005-12-01

    Full Text Available Criança de sete anos recebeu ceftriaxona para o tratamento de meningite, evoluindo com dor em hipocôndrio direito associada a cálculo na vesícula biliar. Após três meses, a ultrassonografia abdominal foi normal. O conhecimento de que a ceftriaxona pode levar ao surgimento de colelitíase pode evitar intervenções cirúrgicas desnecessárias.A seven-year-old boy treated with ceftriaxone for meningitis who presented a right upper quadrant abdominal pain associated with cholelithiasis. After three months he was symptom-free and abdominal ultrasonography was normal. Awareness of this phenomenon is highly important and can save many unnecessary cholecystectomies.

  9. Retinopatia associada ao uso de didanosina Retinopathy associated with the use of didanosine

    Directory of Open Access Journals (Sweden)

    Acácio Muralha

    2001-10-01

    Full Text Available Os autores descrevem um caso de paciente adulto infectado com o vírus da imunodeficiência humana (HIV que apresentou retinopatia tóxica secundária ao uso da didanosina (DDI. A didanosina é inibidor da transcriptase reversa utilizado no tratamento da síndrome da imuno-deficiência adquirida (AIDS. A associação da didanosina com retinopatia é bem estabelecida em crianças, porém é bastante rara em adultos.The authors report a case of an adult patient infected with the human immunodeficiency virus (HIV who presented with retinal toxicity due to didanosine. Didanosine is a reverse transcriptase inhibitor used in AIDS treatment. The association of didanosine and retinal toxicity is well established in children although it is very rare in adults.

  10. Psicoterapia Psicodinâmica Breve: dos precursores aos modelos atuais

    OpenAIRE

    Oliveira, Iraní Tomiatto de

    2009-01-01

    O artigo apresenta uma visão panorâmica da psicoterapia psicodinâmica breve, desde sua origem até os dias atuais. Após a localização histórica de seu surgimento, faz referência aos modelos teóricos e técnicos mais utilizados nas últimas décadas e seus principais representantes. Inclui também algumas das principais contribuições à aplicação destas técnicas à população infantil.Palavras-chave: Psicoterapia Breve, Modelos de Psicoterapia Breve, Psicoterapia Breve de Crianças....

  11. Esfenoidotomia anterior para acesso aos tumores selares: nota técnica

    Directory of Open Access Journals (Sweden)

    Landeiro José Alberto

    2001-01-01

    Full Text Available A dissecção da mucosa do septo nasal durante o acesso transesfenoidal tradicional tem significante morbidade. A técnica de acesso direto ao seio esfenoidal, sem descolamento da mucosa septal é descrita. Elimina complicações como perfuração de septo, perda do olfato, epistaxe, fístula oronasal e dormência nos lábios. A esfenoidotomia pode ser feita sob visão do microscópio cirúrgico, do endoscópio ou mesmo sob luz frontal, e proporciona um ótimo espaço para remoção dos tumores de origem selar.

  12. Seria a Metafísica Essencial à Ciência e ao Senso Comum?

    Directory of Open Access Journals (Sweden)

    Rafael Sandoval

    2017-02-01

    Full Text Available Uma das declarações mais consensuais da História da Filosofia é a que diz que a Metafísica não é ciência, mas pensamento. Neste artigo, procurar-se-á defender a tese que a Metafísica é condição para o senso comum e a ciência. Primeiro, é mostrado que os termos ao qual nós utilizamos diariamente refletem nossa imagem de mundo. Quando pensamos e fazemos previsões, fazemos o uso espontâneo de termos com significado universal. Depois, é procurado evidenciar que a ciência naturalmente faz uso de termos com significado universal quando faz previsões. Finalmente, buscará apresentar que a Metafísica é anterior às nossas hipóteses e especulações.

  13. Mídia advocacy : alternativa de prevenção ao uso de drogas

    Directory of Open Access Journals (Sweden)

    Crisvalter Rogério de Araújo Medeiros

    2015-12-01

    Full Text Available Este trabalho contesta as duas vertentes de prevenção ao uso de drogas mais abordadas pelos meios de comunicação social: o discurso de “guerra às drogas” e as campanhas educativas, com o objetivo de apresentar uma alternativa midiática a essas intervenções, conhecida como mídia advocacy. A partir de uma pesquisa bibliográfica na Medline, de publicações do período de 1997 a 2009, discorre-se sobre o conteúdo de mídia advocacy nas publicações dessa base de dados. Conclui-se que essa estratégia se apresenta como uma alternativa eficiente de empoderamento das comunidades para influenciar quem tem o poder de implantar políticas públicas sobre drogas.

  14. Estudo da compensação ambiental aplicado ao Estado de Minas Gerais

    OpenAIRE

    Barros, Eva Costa de

    2013-01-01

    A questão ambiental é a temática de destaque na sociedade atual. Os processos sociais, a mobilização da sociedade e a estrutura jurídica composta ao redor do meio ambiente são levados em consideração para o entendimento do surgimento do instrumento de compensação ambiental no Brasil. Este instrumento foi implementado no Brasil, por meio da Lei Federal nº 9.985 de 18 de abril de 2000 (Lei do SNUC), em seu artigo 36, como critério obrigatório no processo de licenciamento de empreendimentos cau...

  15. Envelhecimento humano e sensibilidade ao contraste fotópica para frequências angulares

    Directory of Open Access Journals (Sweden)

    Thiago Leiros Costa

    Full Text Available O objetivo deste estudo foi investigar o efeito do envelhecimento na sensibilidade a frequências angulares com luminância fotópica (42,6cd/m². Foram mensuradas curvas de sensibilidade ao contraste em oito adultos jovens (20-29 anos e oito idosos (60-70 anos por meio do método psicofísico da escolha forçada. Todos os participantes estavam livres de doenças oculares identificáveis e tinham acuidade visual normal. Os resultados mostraram que o grupo de idosos apresentou alteração significante na faixa de frequências baixas e altas. Concluiu-se que o envelhecimento parece afetar o processamento de frequências angulares baixas e altas em condições de luminância fotópica.

  16. ASSISTÊNCIA DE ENFERMAGEM AO PREMATURO: ALGUNS PROCEDIMENTOS BÁSICOS

    Directory of Open Access Journals (Sweden)

    Miriam Aparecida Barbosa Merighi

    Full Text Available São apresentados os procedimentos básicos de assistência de enfermagem ao prematuro, a saber: observação nas primeiras 24 horas de vida, hidratação, alimentação com mamadeira, alimentação por sonda nasogástrica, cuidados após a alimentação, técnica do banho na incubadora, cuidado com a pele, cuidado com o coto umbilical, cuidado do prematuro com monilíase, diarréia, vômito, problemas respiratórios, cuidado do prematuro em oxigenoterapia, limpeza e conservação da incubadora.

  17. Sub-rubble communities of Curaçao and Bonaire coral reefs

    Science.gov (United States)

    Meesters, E.; Knijn, R.; Willemsen, P.; Pennartz, R.; Roebers, G.; van Soest, R. W. M.

    1991-12-01

    The distribution and abundance of sessile organisms under coral rubble has been studied at Bonaire and Curaçao, Netherlands Antilles. Species richness under rubble is extremely high with at least 367 species of which sponges, tunicates and bryozoans are the most important. Shallow sub-rubble communities can be considered refuges as the majority of these species are crypt-obligate. Sub-rubble communities may also have a preserve function for sponges, but do not harbour enough corals to ensure a quick coral recolonization of the reef surface after a major disaster. Cryptic community composition is affected by depth and pollution, and differs substantially between the two neighbouring islands, possibly as a result of different bottom characteristics. Biomass of the sub-rubble communities may contribute considerably to total reef biomass. Diversity varies inversely with increased depth and increased rubble size, possibly indicating abiotic control (e.g. physical disturbance by wave action and reef slope substrate collapse).

  18. The constitutional limits to the tributary planning Os limites constitucionais ao planejamento tributário

    Directory of Open Access Journals (Sweden)

    Marlene Kempfer Bassoli

    2005-12-01

    Full Text Available Tax planning is a self-organization’s right of tax payers, due to that, they can organize its activities in the limits of legality, in order to reduce, to postpone or even to prevent rate of tributes. However, this right to self-organization is not, and cannot be, absolute. It has to find its limits in the respect to constitutional principles like: the fact’s precision with the hypothesis of the law, and strict legality.O planejamento tributário é o direito de auto-organização do contribuinte, para que, agindo nos limites da licitude, possa planejar suas atividades, de forma a reduzir, retardar, ou mesmo evitar o pagamento de tributos. Todavia, este direito de auto-organizar-se não é, e nem pode ser absoluto, devendo encontrar os seus limites no respeito aos princípios da Tipicidade e da Estrita Legalidade.

  19. Narrativas ao Sul: viagem e música em quatro romances de Assis Brasil

    Directory of Open Access Journals (Sweden)

    André Tessaro Pelinser

    2014-01-01

    Full Text Available Visitantes ao Sul is the title of a set of novels written by Luis Antonio de Assis Brasil and published from 2001 to 2012. In such novels, the writer deals with traveling as a literary theme, presenting characters in constant movement and, sometimes, in situations of displacement. This paper aims at analysing not only the transit experienced by the four protagonists o f the novels, taking into account their contacts with diverse cultural spaces, but also intends to reflect upon their insertion in the specific temporality of modernity and in the so - called fin de siècle . This paper also discusses one feature that characte rises that set of novels: music, which frequently provides the characters’ mobility with a rhythm, implying the development of a comprehensive metaphor and suggesting new meanings to those narratives.

  20. Contribuições teóricas recentes ao estudo da criatividade

    Directory of Open Access Journals (Sweden)

    Alencar Eunice M. L. Soriano de

    2003-01-01

    Full Text Available O artigo apresenta três abordagens recentes no estudo da criatividade, a saber: a Teoria do Investimento em Criatividade, de Sternberg, o Modelo Componencial da Criatividade, de Amabile, e a Perspectiva de Sistemas, de Csikszentmihalyi. Esses teóricos atribuem a produção criativa a um conjunto de fatores, que interagem de forma complexa, referentes tanto ao indivíduo quanto a variáveis sociais, culturais e históricas do ambiente onde o indivíduo se encontra inserido. Tais abordagens contrastam com contribuições teóricas anteriores pela ênfase a distintos elementos do contexto social, que oportunizam e reconhecem, em maior ou menor extensão, a expressão criativa.

  1. Contribuições teóricas recentes ao estudo da criatividade

    Directory of Open Access Journals (Sweden)

    Eunice M. L. Soriano de Alencar

    Full Text Available O artigo apresenta três abordagens recentes no estudo da criatividade, a saber: a Teoria do Investimento em Criatividade, de Sternberg, o Modelo Componencial da Criatividade, de Amabile, e a Perspectiva de Sistemas, de Csikszentmihalyi. Esses teóricos atribuem a produção criativa a um conjunto de fatores, que interagem de forma complexa, referentes tanto ao indivíduo quanto a variáveis sociais, culturais e históricas do ambiente onde o indivíduo se encontra inserido. Tais abordagens contrastam com contribuições teóricas anteriores pela ênfase a distintos elementos do contexto social, que oportunizam e reconhecem, em maior ou menor extensão, a expressão criativa.

  2. Goals, Strategies and First Discoveries of AO327, the Arecibo All-sky 327 MHz Drift Pulsar Survey

    Science.gov (United States)

    Deneva, J. S.; Stovall, K.; McLaughlin, M. A.; Bates, S. D.; Freire, P. C. C.; Martinez, J. G.; Jenet, F.; Bagchi, M.

    2013-09-01

    We report initial results from AO327, a drift survey for pulsars with the Arecibo telescope at 327 MHz. The first phase of AO327 will cover the sky at declinations of -1° to 28°, excluding the region within 5° of the Galactic plane, where high scattering and dispersion make low-frequency surveys sub-optimal. We record data from a 57 MHz bandwidth with 1024 channels and 125 μs sampling time. The 60 s transit time through the AO327 beam means that the survey is sensitive to very tight relativistic binaries even with no acceleration searches. To date we have detected 44 known pulsars with periods ranging from 3 ms to 2.21 s and discovered 24 new pulsars. The new discoveries include 3 ms pulsars, three objects with periods of a few tens of milliseconds typical of young as well as mildly recycled pulsars, a nuller, and a rotating radio transient. Five of the new discoveries are in binary systems. The second phase of AO327 will cover the sky at declinations of 28°-38°. We compare the sensitivity and search volume of AO327 to the Green Bank North Celestial Cap survey and the GBT350 drift survey, both of which operate at 350 MHz.

  3. Aspergillus oryzae AoSO is a novel component of stress granules upon heat stress in filamentous fungi.

    Directory of Open Access Journals (Sweden)

    Hsiang-Ting Huang

    Full Text Available Stress granules are a type of cytoplasmic messenger ribonucleoprotein (mRNP granule formed in response to the inhibition of translation initiation, which typically occurs when cells are exposed to stress. Stress granules are conserved in eukaryotes; however, in filamentous fungi, including Aspergillus oryzae, stress granules have not yet been defined. For this reason, here we investigated the formation and localization of stress granules in A. oryzae cells exposed to various stresses using an EGFP fusion protein of AoPab1, a homolog of Saccharomyces cerevisiae Pab1p, as a stress granule marker. Localization analysis showed that AoPab1 was evenly distributed throughout the cytoplasm under normal growth conditions, and accumulated as cytoplasmic foci mainly at the hyphal tip in response to stress. AoSO, a homolog of Neurospora crassa SO, which is necessary for hyphal fusion, colocalized with stress granules in cells exposed to heat stress. The formation of cytoplasmic foci of AoSO was blocked by treatment with cycloheximide, a known inhibitor of stress granule formation. Deletion of the Aoso gene had effects on the formation and localization of stress granules in response to heat stress. Our results suggest that AoSO is a novel component of stress granules specific to filamentous fungi. The authors would specially like to thank Hiroyuki Nakano and Kei Saeki for generously providing experimental and insightful opinions.

  4. GOALS, STRATEGIES AND FIRST DISCOVERIES OF AO327, THE ARECIBO ALL-SKY 327 MHz DRIFT PULSAR SURVEY

    Energy Technology Data Exchange (ETDEWEB)

    Deneva, J. S. [Arecibo Observatory, HC3 Box 53995, Arecibo, PR 00612 (United States); Stovall, K.; Martinez, J. G.; Jenet, F. [Center for Advanced Radio Astronomy, Department of Physics and Astronomy, University of Texas at Brownsville, Brownsville, TX 78520 (United States); McLaughlin, M. A.; Bates, S. D.; Bagchi, M. [Department of Physics, West Virginia University, 111 White Hall, Morgantown, WV 26506 (United States); Freire, P. C. C. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)

    2013-09-20

    We report initial results from AO327, a drift survey for pulsars with the Arecibo telescope at 327 MHz. The first phase of AO327 will cover the sky at declinations of –1° to 28°, excluding the region within 5° of the Galactic plane, where high scattering and dispersion make low-frequency surveys sub-optimal. We record data from a 57 MHz bandwidth with 1024 channels and 125 μs sampling time. The 60 s transit time through the AO327 beam means that the survey is sensitive to very tight relativistic binaries even with no acceleration searches. To date we have detected 44 known pulsars with periods ranging from 3 ms to 2.21 s and discovered 24 new pulsars. The new discoveries include 3 ms pulsars, three objects with periods of a few tens of milliseconds typical of young as well as mildly recycled pulsars, a nuller, and a rotating radio transient. Five of the new discoveries are in binary systems. The second phase of AO327 will cover the sky at declinations of 28°-38°. We compare the sensitivity and search volume of AO327 to the Green Bank North Celestial Cap survey and the GBT350 drift survey, both of which operate at 350 MHz.

  5. Atividade fisica de idosos relacionada ao transporte e lazer, Maceio, Brasil

    Directory of Open Access Journals (Sweden)

    Ana Raquel de Carvalho Mourao

    2013-12-01

    Full Text Available OBJETIVO : Analisar o nível de atividade física de idosos nos domínios do transporte e lazer e fatores associados. MÉTODOS : Estudo transversal com amostra populacional de 319 idosos em Maceió, AL, em 2009. O nível de atividade física relacionada ao transporte e ao lazer foi mensurado com aplicação do Questionário Internacional de Atividade Física, versão longa. As variáveis analisadas foram: idade, escolaridade, sexo, renda per capita e saúde percebida. Foram utilizadas análise descritiva e de regressão múltipla da razão de prevalência e teste de Fisher. RESULTADOS : Foram classificados insuficientemente ativos no transporte 87,5%, significativamente maior entre idosos com idades mais avançadas, com maior escolaridade e que se consideram insatisfeitos com a saúde física comparada. A prevalência dos idosos insuficientemente ativos no lazer foi de 76,2%, mais frequente nas mulheres, nos homens com idade avançada, nos idosos com menor renda per capita, nos que relataram estarem insatisfeitos com a saúde física comparada e a autopercepção da saúde mental. CONCLUSÕES : A prevalência de insuficientemente ativos foi elevada nos domínios transporte e lazer. Os fatores idade, sexo e renda devem ser considerados particularmente no lazer, a fim de garantir equidade no desenvolvimento de políticas de promoção da saúde e atividade física nessa população.

  6. Sobrepeso e obesidade e fatores associados ao climatério

    Directory of Open Access Journals (Sweden)

    Jaqueline Teixeira Teles Gonçalves

    2016-04-01

    Full Text Available Resumo O objetivo deste estudo é verificar a associação entre sobrepeso e obesidade e fatores sociodemográficos, comportamentais e clínicos em mulheres climatéricas. Estudo transversal, com amostra de 253 mulheres climatéricas, que responderam questões sobre fatores socioeconômicos e demográficos, saúde geral, hábitos alimentares e comportamentais. Para a avaliação do estado nutricional, foi utilizado índice de massa corpórea (IMC. Para avaliação da qualidade de vida foi utilizado a Menopause Rating Scale (MRS. Empregou-se o Quociente Sexual (QS-F-Versão Feminina para a avaliação do desempenho sexual. Utilizou-se análise bivariada e regressão múltipla hierarquizada para identificar fatores associados ao sobrepeso e à obesidade no climatério. Pela análise do IMC, 30,8% apresentaram sobrepeso e 35,2%, obesidade, totalizando 66% de excesso de peso. Na análise múltipla, não possuir casa própria, gravidade de sintomas pela avaliação do MRS, uso de medicamento de forma contínua e ter feito algum tipo de dieta apresentaram associação com sobrepeso e obesidade. Intervenção nutricional, visando ao controle de peso e mudanças de hábitos de vida, poderá resultar em benefícios consideráveis relativos à saúde e qualidade de vida das mulheres climatéricas.

  7. Durkheim e o vínculo aos grupos: uma teoria social inacabada

    Directory of Open Access Journals (Sweden)

    Serge Paugam

    Full Text Available Resumo Durkheim sustenta a tese da diversidade dos vínculos sociais, que constituem muitas fontes variadas da moral, ou, mais precisamente, muitas possibilidades diferenciadas para o indivíduo elevar-se à vida moral. O homem solidário de Durkheim é um indivíduo ao mesmo tempo autônomo e ligado a outros e à sociedade, um indivíduo consciente das regras morais que implicam a participação na vida social. Se ele as aceita, é pelo prazer que encontra na reciprocidade da associação e no sentimento de ser útil. Essa consciência permanece, todavia, frágil, ela corre até mesmo o risco de desaparecer em certas circunstâncias. Interessa-lhe, então, mantê-la: tal é a função do Estado. Durkheim conceituou, de certa forma, um modo particular de regulação social dos vínculos a partir de uma representação organicista da solidariedade. É preciso reconhecer a força dessa teoria, mesmo se o conhecimento das sociedades modernas nos conduz a ressaltar que podem existir outras configurações ou regimes de vínculos. A teoria social do vínculo, tal como podemos construir hoje, é ao mesmo tempo a herdeira do núcleo conceitual deixado pelo fundador da sociologia francesa e o resultado das aquisições da sociologia comparativa, que é fundada sobre uma abordagem não normativa das sociedades modernas e sensível à sua diversidade.1

  8. Robotic laser adaptive optics imaging of 715 Kepler exoplanet candidates using Robo-AO

    Energy Technology Data Exchange (ETDEWEB)

    Law, Nicholas M.; Ziegler, Carl [Department of Physics and Astronomy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599-3255 (United States); Morton, Tim; Riddle, Reed; Tendulkar, Shriharsh P.; Bui, Khanh; Dekany, Richard G.; Kulkarni, Shrinivas; Punnadi, Sujit [Division of Physics, Mathematics, and Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Baranec, Christoph [Institute for Astronomy, University of Hawai' i at Mānoa, Hilo, HI 96720-2700 (United States); Ravichandran, Ganesh [West Tresper Clarke High School, East Meadow School District, 740 Edgewood Drive, Westbury, NY 11590 (United States); Johnson, John Asher [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Burse, Mahesh P.; Das, H. K.; Ramaprakash, A. N. [Inter-University Centre for Astronomy and Astrophysics, Ganeshkhind, Pune 411007 (India)

    2014-08-10

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging to search for blended nearby stars, which may be physically associated companions and/or responsible for transit false positives. In this paper, we present the results from the 2012 observing season, searching for stars close to 715 Kepler planet candidate hosts. We find 53 companions, 43 of which are new discoveries. We detail the Robo-AO survey data reduction methods including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for large adaptive optics surveys. Our survey is sensitive to objects from ≈0.''15 to 2.''5 separation, with magnitude differences up to Δm ≈ 6. We measure an overall nearby-star probability for Kepler planet candidates of 7.4% ± 1.0%, and calculate the effects of each detected nearby star on the Kepler-measured planetary radius. We discuss several Kepler Objects of Interest (KOIs) of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are 'coincident multiple' systems, with several transiting planets shared between the two stars. Finally, we find 98% confidence evidence that short-period giant planets are two to three times more likely than longer-period planets to be found in wide stellar binaries.

  9. Fatores associados ao câncer do colo uterino em Propriá, Sergipe, Brasil

    Directory of Open Access Journals (Sweden)

    Carlos Anselmo Lima

    Full Text Available O câncer do colo uterino apresenta uma alta incidência nas regiões pobres dos países em desenvolvimento. Relaciona-se a fatores ligados ao estilo de vida que levam à infecção pelo Papilomavirus humano (HPV. O objetivo do estudo foi avaliar quais os fatores que favoreciam a infecção pelo HPV e ao desenvolvimento do carcinoma do colo uterino no Município de Própria, Sergipe, Brasil. Para o desenvolvimento da pesquisa, realizou-se um estudo de caso-controle, pareando-se quatro controles para cada caso quanto à idade, procedência e condição sócio-econômica. Foram identificadas vinte mulheres portadoras de carcinoma do colo uterino e oitenta controles. As mulheres do grupo casos apresentaram maior número de gestações e freqüência menor de realização de exame preventivo de rotina. Verificou-se também que as mulheres nos dois grupos tinham conhecimento pobre sobre o câncer e as suas formas de prevenção, alto índice de analfabetismo e os seus companheiros tinham múltiplas parceiras sexuais. O estudo concluiu que no Município de Própria, o maior número de gestações e a não realização de exames preventivos de rotina associaram-se à ocorrência de carcinoma do colo uterino.

  10. Fatores associados ao uso de cadeira de rodas por idosos institucionalizados

    Directory of Open Access Journals (Sweden)

    Elysama Fernandes Alves

    Full Text Available Resumo Devido à alta prevalência do uso de cadeira de rodas por idosos institucionalizados, objetivou-se verificar se os fatores sexo, idade, escolaridade, tempo de admissão, comorbidades, cognição e funcionalidade estão associados ao uso deste dispositivo, como também averiguar os motivos que podem levar a essa utilização segundo a percepção dos idosos. Estudo transversal e descritivo, incluídos 55 idosos subdivididos em G1 (locomoção sem auxílio e G2 (cadeirantes. Análise do perfil através dos prontuários, cognição e funcionalidade pelo Mini-Exame do Estado Mental e Índice de Barthel. Foram questionados 33(60,0% cadeirantes no G1 e 22(40,0% no G2 sobre os fatores que os levaram à utilização da cadeira de rodas. Houve diferença entre os grupos em relação à funcionalidade (p = 0,005. O idoso que não tem acidente vascular encefálico tem menor chance de utilizar cadeira de rodas (OR:0,09; IC95%:0,02-0,36. Idosos cadeirantes relataram: medo de cair, dor, cansaço, fraqueza nas pernas, dificuldades de caminhar e falta de auxílio na deambulação. O acidente vascular encefálico e a funcionalidade estão associados ao uso de cadeira de rodas. O conhecimento destes fatores e dos motivos relatados pelos idosos pode permitir que alternativas de prevenção sejam traçadas.

  11. Robotic Laser Adaptive Optics Imaging of 715 Kepler Exoplanet Candidates Using Robo-AO

    Science.gov (United States)

    Law, Nicholas M.; Morton, Tim; Baranec, Christoph; Riddle, Reed; Ravichandran, Ganesh; Ziegler, Carl; Johnson, John Asher; Tendulkar, Shriharsh P.; Bui, Khanh; Burse, Mahesh P.; Das, H. K.; Dekany, Richard G.; Kulkarni, Shrinivas; Punnadi, Sujit; Ramaprakash, A. N.

    2014-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging to search for blended nearby stars, which may be physically associated companions and/or responsible for transit false positives. In this paper, we present the results from the 2012 observing season, searching for stars close to 715 Kepler planet candidate hosts. We find 53 companions, 43 of which are new discoveries. We detail the Robo-AO survey data reduction methods including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for large adaptive optics surveys. Our survey is sensitive to objects from ≈0.''15 to 2.''5 separation, with magnitude differences up to Δm ≈ 6. We measure an overall nearby-star probability for Kepler planet candidates of 7.4% ± 1.0%, and calculate the effects of each detected nearby star on the Kepler-measured planetary radius. We discuss several Kepler Objects of Interest (KOIs) of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are "coincident multiple" systems, with several transiting planets shared between the two stars. Finally, we find 98% confidence evidence that short-period giant planets are two to three times more likely than longer-period planets to be found in wide stellar binaries.

  12. Nao adesao ao tratamento medicamentoso continuo: prevalencia e determinantes em adultos de 40 anos e mais

    Directory of Open Access Journals (Sweden)

    Felipe Assan Remondi

    2014-01-01

    Full Text Available O presente estudo investiga os fatores associados a não adesão à terapia medicamentosa contínua em indivíduos de 40 anos e mais de idade. Foi realizado um inquérito de base populacional em Cambé, Paraná, Brasil. A adesão à terapia foi avaliada pela escala de quatro itens de Morisky et al. e analisaram-se também variáveis sociodemográficas, de utilização dos serviços de saúde e do uso de medicamentos. Foram entrevistados 1.180 indivíduos, dos quais 78% utilizaram medicamentos nos 15 dias anteriores à entrevista e em 55% registrou-se o uso contínuo. A amostra do estudo consistiu em 639 indivíduos, com predominância do sexo feminino, idade entre 40 e 59 anos, baixa escolaridade. A prevalência de não adesão foi de 63,5%. Após análise ajustada, permaneceram associados a não adesão: não ser acompanhado pelo agente comunitário de saúde, ter tido descontinuidade no acesso aos medicamentos e a elevada frequência de utilização dos medicamentos ao longo do dia. Os resultados indicam uma alta prevalência da não adesão com possíveis impactos negativos para os indivíduos e para a sociedade.

  13. PERIGOS ASSOCIADOS AO CONSUMO DA ALFACE, (Lactuca sativa, IN NATURA

    Directory of Open Access Journals (Sweden)

    A. D. I. MOGHARBEL

    2008-09-01

    Full Text Available

    A prevenção de riscos de contaminação por agentes patogênicos em folhas de alface passa pelas boas práticas agrícolas que vai desde a semeadura até a colheita além de outros importantes aspectos, ainda no processo do cultivar, como qualidade da água usada para irrigação, emprego de práticas sanitárias adequadas pelos produtores na manipulação das plantas e higiene do agricultor no campo. Manter a segurança de contaminação bacteriana de frutas e de vegetais frescos requer um conhecimento de sistemas que abranja todos os aspectos da produção, do processamento, da distribuição e do uso. A orientação aos consumidores quanto aos cuidados no armazenamento e na manipulação apropriados do produto fresco, deve ser incentivada pelas autoridades sanitárias, como forma de se evitar doenças veiculadas pelos alimentos. Desta forma, a proteção de contaminantes patológicos em vegetais frescos, visando a proteção tanto do produtor como do consumidor, vão de encontro a algumas práticas similares do sistema APPCC, onde se projetam atributos de limitação, controle, e monitoramento das fontes de contato na produção dos vegetais.

  14. O estigma atribuído pelos psiquiatras aos indivíduos com esquizofrenia

    Directory of Open Access Journals (Sweden)

    Alexandre Andrade Loch

    2011-01-01

    Full Text Available CONTEXTO: A literatura acerca da maneira como a população geral estigmatiza indivíduos com distúrbios mentais aumentou consideravelmente nas últimas décadas. Mas a dúvida sobre se os psiquiatras também estigmatizam seus pacientes ainda permanece. OBJETIVO: O presente estudo visou avaliar as atitudes de psiquiatras brasileiros em relação aos indivíduos com esquizofrenia. MÉTODOS: Dos cerca de 6.000 participantes do Congresso Brasileiro de Psiquiatria em 2009, 1.414 psiquiatras concordaram em participar do estudo. Entrevistas face a face foram realizadas utilizando um questionário que avaliava o estigma em três dimensões: estereótipos, distância social e preconceito, todas relacionadas a alguém com esquizofrenia. Opinião sobre medicações psicotrópicas e tolerância aos efeitos colaterais também foram avaliadas. Dados sociodemográficos e profissionais foram coletados. RESULTADOS: Psiquiatras brasileiros tenderam a estereotipar negativamente pessoas com esquizofrenia. Estereótipos negativos correlacionaram-se com uma melhor opinião sobre medicações psicotrópicas e com maior tolerância a efeitos colaterais. Idade maior correlacionou-se com estereótipos positivos e com menor preconceito. CONCLUSÃO: Os psiquiatras estigmatizam indivíduos com esquizofrenia e possivelmente têm certa dificuldade em admitir esse fato. Campanhas antiestigma para profissionais de saúde mental devem ser promovidas.

  15. Do gorila amestrado de taylor ao macaco de nicolelis From taylor's tamed gorilla to nicolelis' monkey

    Directory of Open Access Journals (Sweden)

    Laymert Garcia dos Santos

    2010-11-01

    Full Text Available Partindo de uma análise de Gramsci das transformações pelas quais passava o trabalhador humano no capitalismo do início do século XX, busca-se neste texto indicar aspectos de como tais processos de transformação vêm se dando no capitalismo do início do século XXI. Para isso, abordamos a transição da problemática muscular e energética da substituição do trabalhador humano pela máquina para a problemática cognitiva e informacional do controle nos acoplamentos homem-máquina. Do gorila amestrado de Taylor ao macaco de Nicolelis, mudaram as formas de subsunção do trabalhador ao capital, mas não a própria subsunção.With Gramsci's analysis of the transformations the human worker underwent in capitalism in the early 20th century as a starting point, this article seeks to point to aspects of how such transformation processes are taking place in capitalism in the early 21st century. To achieve this, we approach the transition from muscular and energetic problem of substituting human for machine labor to the cognitive and informational issue of control in the man-machine couplings. From Taylor's tamed gorilla to Nicolelis' monkey, the forms of subsumption of the worker to capital changed, but not the actual subsumption.

  16. Atividade residual de seis herbicidas aplicados ao solo em época seca

    Directory of Open Access Journals (Sweden)

    Saul Jorge Pinto de Carvalho

    2012-04-01

    Full Text Available Este trabalho foi desenvolvido em campo, com o objetivo de avaliar a atividade residual de herbicidas recomendados para a cultura da cana-de-açúcar, quando aplicados ao solo na época seca. Os tratamentos foram organizados em esquema de parcelas subdivididas, em que, no âmbito das parcelas, foram aplicados seis herbicidas e, no âmbito das subparcelas, foram considerados três períodos de permanência dos produtos no solo (130 dias, 70 dias e testemunha, sem aplicação. Os tratamentos herbicidas foram (g ha-1: amicarbazone a 1260; clomazone a 1250; hexazinone a 450; imazapic a 147; isoxaflutole a 187,5; e sulfentrazone a 900. Além da infestação natural de plantas daninhas, para avaliação da atividade residual dos produtos, semeou-se pepino na área, considerado como bioindicador. A mesma molécula herbicida teve avaliação diferenciada em razão da espécie bioindicadora considerada. Os herbicidas amicarbazone, hexazinone, isoxaflutole e sulfentrazone têm propriedades positivas para aplicação ao solo em época seca, tais como elevada solubilidade, baixo Kow e baixa fotodegradação. A aplicação de imazapic em pré-emergência tem eficácia consistente em época seca, controlando adequadamente o pepino e a comunidade natural de plantas daninhas. O herbicida clomazone não controlou adequadamente o pepino e a comunidade natural de plantas daninhas.

  17. A DECIDUIDADE FOLIAR INDICA A VULNERABILIDADE DE ESPÉCIES LENHOSAS AO FOGO

    Directory of Open Access Journals (Sweden)

    Isabela Codolo de Lucena

    2015-02-01

    Full Text Available Pesquisas indicaram que a ocorrência de queimadas pode ocasionar comportamentos fenológicos divergentes aos padrões comumente descritos. Este estudo teve como objetivo avaliar se a deciduidade foliar pode indicar a vulnerabilidade de espécies lenhosas ao fogo. Os índices de atividade e intensidade de diferentes fenofases foram comparados entre indivíduos queimados e não queimados de espécies lenhosas com diferentes graus de deciduidade foliar (decídua, semidecídua e sempre-verde. Para a espécie decídua, as fenofases vegetativas foram similares entre indivíduos queimados e não queimados. Indivíduos queimados de uma espécie semidecídua apresentaram maior intensidade e atividade das fenofases vegetativas. Para as espécies sempre-verdes, foi registrado o estímulo à produção de novas folhas, retardamento de folhas expandidas e senescentes para indvíduos queimados. Quanto à fenologia reprodutiva, em indivíduos queimados, foram registradas menor intensidade e atividade de frutos verdes e maduros para espécies decídua e semidecídua, bem como o estímulo da floração e da frutificação para as espécies sempre-verdes. A periodicidade das fenofases pode ser modulada pela ocorrência do fogo mesmo após um intervalo de dois anos. O efeito do fogo foi gradualmente mais pronunciado de espécies decíduas às sempre-verdes, o que indica maior vulnerabilidade de espécies lenhosas sempre-verdes a esse distúrbio.

  18. Escória de aciaria elétrica: uma alternativa aos materiais granulares tradicionais

    Directory of Open Access Journals (Sweden)

    Luciana Rohde

    2009-12-01

    Full Text Available

    São apresentados os resultados de um estudo sobre o emprego da escória de aciaria elétrica como agregado para pavimentação. Este resíduo é gerado na produção do aço em siderúrgicas que utilizam fornos elétricos a arco. As características físicas e mecânicas do agregado foram determinadas através de ensaios de granulometria, durabilidade ao sulfato de sódio, abrasão no equipamento de Los Angeles, compactação, Índice de Suporte Califórnia e módulo de resiliência. Constatou-se a necessidade de corrigir a granulometria da escória, procedimento que melhorou a capacidade de suporte e a trabalhabilidade do material, gerando módulos de resiliência superiores aos de materiais granulares tradicionais. Através da avaliação do potencial expansivo do material concluiu-se que o tempo de estocagem mínimo para liberação do agregado é 4 meses. Os resultados do estudo permitem concluir que a escória de aciaria elétrica pode ser empregada como material de pavimentação proporcionando boa qualidade técnica e benefícios ambientais e econômicos.

  19. Assalto ao Estado e ao mercado, neoliberalismo e teoria econômica Assault on the State and on the market: Neoliberalism and economic theory

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Bresser-Pereira

    2009-01-01

    Full Text Available O Estado e o mercado são instituições complementares. O Estado é a instituição principal que coordena as sociedades modernas; é o sistema constitucional e a organização que o garante; é o principal instrumento por meio do qual as sociedades democráticas estão moldando o capitalismo de modo a alcançar seus próprios objetivos políticos. Os mercados são instituições baseadas na competição regulada pelo Estado para que contribuam com a coordenação da economia. Enquanto o liberalismo emergiu no século XVIII para combater o Estado autocrático, desde os anos 1980 o neoliberalismo (uma distorção maior do liberalismo econômico tornou-se dominante e montou um assalto ao Estado em nome do mercado, mas eventualmente também atacou o mercado. A macroeconomia neoclássica e a teoria da escolha pública foram as metaideologias que deram a esse assalto um apelo "científico" e matemático.State and market are complementary institutions. The state is the major institution coordinating modern societies; it is the constitutional system and the organizations guaranteeing it; it is the main instrument through which democratic societies have been changing capitalism so as to achieve their own agreed political objectives. Markets are institutions based on competition which the state regulates so that they contribute to the coordination of the economy. While liberalism emerged in the 18th century to fight an autocratic state, since the 1980s neoliberalism (a major distortion of economic liberalism became dominant and mounted a political assault to the state in the name of the market, but eventually also attacked the market. Neoclassical macroeconomics and public choice theory were the meta-ideologies that gave to this assault a "scientific" and mathematical allure.

  20. A HARMONIZAÇÃO DOS PADRÕES CONTÁBEIS INTERNACIONAIS NO CONTEXTO DA GLOBALIZAÇAO E SUA EVOLUÇAO NO BRASIL

    Directory of Open Access Journals (Sweden)

    Danival Sousa Cavalcante

    2017-06-01

    Full Text Available O fenômeno da globalização, em grande medida, implica a homogeneização de estratégias e práticas, em busca de maior eficiência e/ou legitimidade. No contexto atual, diversos tipos de organizações inserem-se no mercado global. Todas assumem, assim, a obrigação de prestar contas acerca de suas operações e resultados, para um amplo conjunto de stakeholders. Neste cenário, a contabilidade assume papel informacional estratégico, através de técnicas que retratem a posição econômica e a financeira das organizações para os diversos usuários. Verifica-se, porém, um paradoxo, pois, apesar da necessidade de os relatórios contábeis serem cada vez mais globalizados, cada país tem práticas contábeis próprias. O estudo tem como objetivo analisar a relação entre a globalização e o processo de harmonização contábil internacional. A metodologia alinha-se ao modelo de compilação, quando se busca compulsar criticamente parte significativa da literatura pertinente disponível e expô-la de forma clara. Conclui-se que a globalização atua como mecanismo de isomorfismo. O início do processo de harmonização contábil se deu sob o choque da globalização, no início da década de 1990. Como sistema normativo, a governança corporativa constitui, também, um mecanismo de isomorfismo, contribuindo para a convergência das normas contábeis.

  1. ENGENHARIA DO CONHECIMENTO APLICADA AO SERVIÇO DE ATENDIMENTO AO CLIENTE NA INDÚSTRIA DO SOFTWARE KNOWLEDGE ENGINEERING APPLIED TO COSTUMER SERVICE IN THE SOFTWARE INDUSTRY

    Directory of Open Access Journals (Sweden)

    Mauricio Uriona Maldonado

    2010-04-01

    Full Text Available A representação do conhecimento apoia as técnicas e ferramentas de gestão e deve possuir uma compreensão substancial do negócio em que está inserido. A identificação e análise do negócio onde estão embutidos os aspectos de conhecimento são fundamentais para o sucesso da gestão do conhecimento nas organizações. Este artigo descreve a construção da primeira fase de um sistema de conhecimento para o serviço de atendimento ao usuário de uma software-house no Brasil. A metodología empregada é a engenharia do conhecimento e mais específicamente os modelos da camada contextual do CommonKADS. Inicialmente é apresentada uma revisão sobre o framework metodológico CommonKADS, com foco nos modelos de organização, tarefa e agente. Em seguida são descritas as etapas de construção do sistema de conhecimento e apresentado o local de aplicação. Conclui com as implicações do sistema de conhecimento para a software-house analizada bem como as recomendações dos próximos passos de aplicação do CommonKADS.Knowledge representation supports management tools and techniques and must possess a substantial comprehension of the business in which is inserted. This paper describes the first phase construction of a knowledge system for a Brazilian software-house´s customer service. The method applied is knowledge engineering and specifically the context-layer models of CommonKADS. First, a literature review is presented regarding the CommonKADS Methodology, focusing in the Organization, Tasks and Agent Models. Next, the development phases for the knowledge system are described as well as the company where the study was made. It concludes with the business implications of the knowledge system for the software-house as well as the next steps of application for CommonKADS.

  2. Shear bond strength of self-etch and total-etch adhesives to bovine enamel and dentin = Resistência ao cisalhamento de adesivo autocondicionante e convencional ao esmalte e dentina bovinos

    OpenAIRE

    Raposo, Carolina Carramilo; Santana, Ivone Lima

    2012-01-01

    Objetivo: Avaliar a resistência ao cisalhamento de adesivo autocondicionante e adesivo convencional ao esmalte e dentina bovinos Metodologia: As superfícies vestibulares de 28 incisivos mandibulares bovinos foram lixadas, sob refrigeração, para obtenção de superfícies de esmalte ou dentina planas. Um adesivo autocondicionante de passo único e um convencional de três passos foram utilizados de acordo com as instruções dos fabricantes (Adper Easy One and Adper Scotchbond, respectivamente). U...

  3. Tuberculose em Recife, PE: o efeito da estratégia DOTS (Directly Observed Treatment Short-course) e fatores associados ao óbito e ao abandono de tratamento, 1996 a 2005

    OpenAIRE

    Mirian Pereira Domingos

    2007-01-01

    O abandono de tratamento de tuberculose é considerado o principal obstáculo no controle da doença. Persistência da fonte de infecção, aumento da mortalidade e da taxa de recidiva, além do desenvolvimento de cepas resistentes aos fármacos, estão associados ao abandono. Os componentes essenciais das políticas de controle da tuberculose foram sintetizados num pacote que constitui a estratégia DOTS (Directly Observed Treatment Short-course), recomendada pela Organização Mundial de Saúde. Este tra...

  4. Habilidades sociais e competência social: Analisando conceitos ao longo das obras de Del Prette e Del Prette

    Directory of Open Access Journals (Sweden)

    Camila Negreiros Comodo

    2017-08-01

    Full Text Available Considerando a diversidade conceitual do campo das Habilidades Sociais, tanto entre diferentes autores, como para um mesmo autor ao longo de suas obras, este estudo objetivou analisar as definições de habilidades sociais e competência social, a partir das obras de Del Prette e Del Prette. As definições dos conceitos foram selecionadas de livros e artigos teóricos desses autores, desde 1996 até 2012, e comparadas, em ordem cronológica. Com base nessas análises, observaram-se diferenças importantes em ambos os conceitos, ao longo das obras dos autores, produto de revisões, complementações e aprimoramentos de conhecimentos conceituais, empíricos e metodológicos que ocorreram ao longo do tempo.

  5. A mudança de paradigma em sociologia urbana: do paradigma ecológico ao socioespacial

    Directory of Open Access Journals (Sweden)

    Lucas Pizzolatto Konzen

    2011-01-01

    Full Text Available http://dx.doi.org/10.5007/2178-4582.2011v45n1p79 O artigo discute a mudança do paradigma ecológico ao socioespacial na so ciologia urbana, ocorrida nos países centrais do capitalismo ao longo das décadas de 1970 e 1980. Os dois paradigmas são descritos em suas feições principais, ao que se segue uma análise específica das obras dos três autores que lideraram a mudança de paradigma: Henri Lefebvre, Manuel Castells e David Harvey. A análise referencia-se teoricamente na contribuição de Thomas Kuhn à sociologia do conhecimento.

  6. A proibição de comportamento contraditório aplicada ao Direito Processual Civil

    OpenAIRE

    Romeu, Talita Macedo

    2012-01-01

    124 p. A aplicação da boa-fé objetiva ao processo civil conduz à revalorização dos princípios da cooperação e da lealdade, inerentes à realização do contraditório, impondo aos sujeitos do processo o dever de atuar conforme o padrão de confiança esperado em dada relação jurídica. Quando o comportamento adotado por um sujeito processual (partes ou juiz) for contraditório ao seu comportamento anterior, é necessário investigar se tal conduta revela deslealdade, capaz de frustrar as expectativa...

  7. Experimental evidence of a xylose-catabolic pathway on the pAO1 megaplasmid of Arthrobacter nicotinovorans

    Directory of Open Access Journals (Sweden)

    Marius Mihasan

    2012-09-01

    Full Text Available The pAO1 megaplasmid of A. nicotinovorans consists of 165 ORF's related mainly to nicotine degradation, uptake and utilization of carbohydrates, amino acids and sarcosine. A putative sugar catabolic pathway consisting of 11 ORF's organized as a single operon were previously described. The current work brings experimental data supporting the existence of a D-Xylose catabolic pathway on the pAO1 megaplasmid. When grown on D-xylose containing media, the cells harboring the pAO1 megaplasmid grow to higher cell densities and also express the OxRe protein coded by the megaplasmid. A putative pathway similar to Weimberg pentose pathway is postulated, in which D-xylose is transported in the cell by the ABC-type transport system and then transformed using the putative sugar-dehidrogenase OxRe to D-xylonate, which is further degrated to 2-ketoglutarate and integrated into the general metabolism of the cell

  8. Fracture and dislocation classification compendium for children: the AO pediatric comprehensive classification of long bone fractures (PCCF).

    Science.gov (United States)

    Slongo, Theddy F; Audigé, Laurent

    2007-01-01

    The AO Pediatric Expert Group and the AO Pediatric Classification Group, in cooperation with the AO Investigation and Documentation Group introduce and present the first comprehensive classification of pediatric long bone fractures. The anatomy is related to the 4 long bones and their 3 segments defined as proximal (1), shaft (2) and distal (3). It is further described by the fracture subsegment recorded as epiphyseal (E), metaphyseal (M) and diaphyseal (D), whereby proximal and distal fractures are classified as E or M and shaft fractures are always D. The distinction between metaphyseal and diaphyseal fractures is achieved by localizing the center of fracture lines with regard to a square drawn over the respective growth plates. The morphology of the fracture is documented by a subsegment-specific child pattern code, a severity code as well as an additional code for displacement of specific fractures such as supracondylar fractures and radial heads. The classification process requires trained observers to read standard radiographic images.

  9. Comparative Analysis of the Main Bioactive Components of San-ao Decoction and Its Series of Formulations

    Directory of Open Access Journals (Sweden)

    Anwei Ding

    2012-11-01

    Full Text Available A high performance liquid chromatographic (HPLC method with diode array detection (DAD was established for simultaneous determination of seven main bioactive components in San-ao decoction and its series of formulae (San-ao decoction, Wu-ao decoction, Qi-ao decoction and Jia-wei San-ao decoction. Seven compounds were analyzed simultaneously with a XTerra C18 column (4.6 mm × 250 mm, 5 µm using a linear gradient elution of a mobile phase containing acetonitrile (A and a buffer solution (0.02 mol/L potassium dihydrogen phosphate and adjusted to pH 3 using phosphoric acid (B; the flow rate was 1.0 mL/min. The sample was detected with DAD at 210, 254 and 360 nm and the column was maintained at 30 °C. All the compounds showed good linearity (r2 > 0.9984 in the tested concentration range. The precisions were evaluated by intra-day and inter-day tests, and relative standard deviation (R.S.D. values within the range of 0.83%–2.53% and 0.64%–2.77% were reported, respectively. The recoveries of the quantified compounds were observed to cover a range from 95.34% and 104.82% with R.S.D. values less than 2.72%. The validated method was successfully applied for the simultaneous determination of seven main bioactive components including ephedrine (1, amygdalin (2, liquiritin (3, benzoic acid (4, isoliquiritin (5, formononetin (6 and glycyrrhizic acid (7 in San-ao decoction and its series of formulae. The results also showed a wide variation in the content of the identified active compounds in these samples, which could also be helpful to illustrate the drug interactions after some herbs combined in different formulations.

  10. Bioremediation of bisphenol-A polluted soil by Sphingomonas bisphenolicum AO1 and the microbial community existing in the soil.

    Science.gov (United States)

    Matsumura, Yoshinobu; Akahira-Moriya, Ayako; Sasaki-Mori, Miho

    2015-01-01

    Bisphenol A (BPA, 2,2'-Bis (4-hydroxyphenyl) propane) is an artificial pollutant that is easily detected in soil and water environments. BPA decomposition and removal from the environment is relatively difficult due to its stability. This study evaluated the BPA decomposition and removal activities of the microbial community existing in the soil with or without Sphingomonas bisphenolicum AO1, and revealed the toxic effects of BPA towards the microbial community. The microbial community in soil was able to degrade BPA at 1.0 mg·g(-1) soil or lower, although its degradation was slow. On the other hand, BPA at more than 10 mg·g(-1) soil was not only degraded by the microbial community but also decreased its diversity, suggesting that BPA is harmful to many microorganisms. PCR-TTGE analysis and the cloned 16S rRNA gene sequence analysis indicated that Sphingomonadales, Xanthomonadales, Burkholderiales and Pseudomonadales in the microbial community might independently or cooperatively degrade BPA. On the other hand, supplementation with strain AO1 was able to significantly improve the BPA decomposition activity of the microbial community in soil even at 10 mg BPA·g(-1) soil, although BPA at 100 mg·g(-1) soil overwhelmed the BPA decomposition activity of strain AO1. Furthermore, it was also concluded that strain AO1 could not inhabit BPA purified soil after decomposition of BPA by strain AO1 and the soil microbial community, suggesting that the application of strain AO1 could be a low-burden method for the decomposition and removal of BPA from the natural environment.

  11. Subaru SCExAO First-Light Direct Imaging of a Young Debris Disk around HD 36546

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Tamura, Motohide; Kudo, Tomoyuki; Jovanovic, Nemanja; Lozi, Julien; Schlieder, Joshua E.; Brandt, TImothy D.; Kuhn, Jonasa; Serabyn, Eugene; hide

    2017-01-01

    We present H-band scattered light imaging of a bright debris disk around the A0 star HD 36546 obtained from the Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) system with data recorded by the HiCIAO camera using the vector vortex coronagraph. SCExAO traces the disk from r approximately 0 3 to r approximately 0".3 to r approximately 1" (34-114 au). The disk is oriented in a near east west direction (PA approximately 75deg), is inclined by I approximately 70deg-75deg, and is strongly forward-scattering(g greater than 0.5). It is an extended disk rather than a sharp ring; a second, diffuse dust population extends from the disks eastern side. While HD 36546 intrinsic properties are consistent with a wide age range (t approximately 1-250 Myr), its kinematics and analysis of coeval stars suggest a young age (310 Myr) and a possible connection to Taurus-Aurigas star formation history. SCExAOs planet-to-star contrast ratios are comparable to the first-light Gemini Planet Imager contrasts; for an age of 10 Myr, we rule out planets with masses comparable to HR 8799 b beyond a projected separation of 23 au. A massive icy planetesimal disk or an unseen super-Jovian planet at r greater than 20 au may explain the disks visibility. The HD 36546 debris disk may be the youngest debris disk yet imaged, is the first newly identified object from the now-operational SCExAO extreme AO system, is ideally suited for spectroscopic follow-up with SCExAO/CHARIS in 2017, and may be a key probe of icy planet formation and planet disk interactions.

  12. Os efeitos da crise global no Brasil: aversão ao risco e preferência pela liquidez no mercado de crédito The effect of the global crisis in Brazil: risk aversion and preference for liquidity in the credit market

    Directory of Open Access Journals (Sweden)

    Maria Cristina Penido de Freitas

    2009-01-01

    Full Text Available O artigo procura discutir os impactos da crise internacional na economia brasileira, com ênfase na virtual paralisia do mercado de crédito bancário doméstico a partir de setembro de 2008. Sustenta-se que a dinâmica concorrencial bancária conduziu à emergência de práticas de alto risco, cujo potencial desestabilizador veio à tona quando da reversão das expectativas ante o agravamento da crise financeira internacional e seus efeitos-contágio sobre as economias periferias, dentre as quais o Brasil. O conservadorismo dos bancos na fase de retração foi exacerbado, no caso brasileiro, pelo prazo relativamente curto do crédito e pela existência de títulos públicos líquidos, rentáveis e de baixo risco, que permitem uma rápida recomposição dos seus portfólios. A desaceleração da atividade produtiva em decorrência da contração do crédito não foi mitigada pelo Banco Central, apegado ao seu mandato de guardião da estabilidade dos preços.This article discusses the impacts of the international crisis on the Brazilian economy, with emphasis on the virtual paralysis of the domestic banking credit market that has occurred since September 2008. It argues that the dynamics of banking competition led to the emergence of high-risk practices. The destabilizing potential of these practices came to light when the aggravation of the international financial crisis and its contagion in peripheral countries such as Brazil caused a reversal of expectations. Generalized conservative behavior by banks during the retraction phase was exacerbated in Brazil by the relatively short credit cycle and by the liquidity, profitability and low-risk of public bonds, allowing a rapid recomposition of portfolios. The Central Bank, sticking to its mandate as the guardian of price stability, failed to move to mitigate the deceleration of productive activities that resulted from the contraction of credit.

  13. Comportamento de Cistus Ladanifer L. e Cistus Monspeliensis L. face aos elementos vestigiais em solos na área mineira do Chança Cistus Ladanifer L. and Cistus Monspeliensis L. behaviour in Chança mine soils contaminated with trace elements

    Directory of Open Access Journals (Sweden)

    Eliana Fernandes

    2011-07-01

    Full Text Available Comparou-se a acumulação e translocação de elementos vestigiais em duas espécies de plantas espontâneas na área mineira do Chança, Cistus ladanifer L. e Cistus monspeliensis L., e caracterizaram-se os solos da área da rizosfera. Os solos apresentaram diferenças no conteúdo em arsénio, cobre, crómio, manganês, vanádio e zinco e alguns elementos atingiram valores totais (mg kg-1 de: 151 (As; 320 (Cr; 926 (Cu; 1010 (Mn; 235 (V. As concentrações em crómio, manganês e vanádio são diferentes na raiz das duas espécies. Na parte aérea, apenas a concentração de manganês e de níquel é semelhante. As espécies mostraram comportamento acumulador relativamente ao manganês, com excepção do C. monspeliensis numa das zonas de amostragem. Para a maioria dos elementos vestigiais, o C. monspeliensis possui maior capacidade de translocação (raiz-parte aérea do que o C. ladanifer. Os coeficientes de translocação do crómio, manganês, níquel e zinco são superiores a 1,5 nas duas espécies.Trace elements accumulation and translocation in two spontaneous plants of genus Cistus, Cistus ladanifer L. and Cistus monspeliensis L., growing in the Chança mine area, were compared. Samples of plants and soils from rizosphere were collected and characterized. Soil samples showed different total content of arsenic, chromium, copper, manganese, vanadium and zinc, and some of the trace elements had the following total values (mg kg-1: 151 (As; 320 (Cr; 926 (Cu; 1010 (Mn; 235 (V. The concentrations of chromium, manganese and vanadium in roots were different between species. In the shoots, only manganese and nickel concentrations were similar. The two species were manganese accumulators, with C. mon-speliensis exception in one of the sampled areas. Cistus monspeliensis showed the largest translocation capacity of trace elements from roots to shoots. Both species presented the translocation coefficient of chromium, manganese, nickel and zinc

  14. Análise de prontuários de pacientes oncológicos quanto ao monitoramento auditivo

    OpenAIRE

    Costa,Juliana Cunha da; Buss,Ceres Helena

    2009-01-01

    OBJETIVO: realizar uma análise retrospectiva dos prontuários de pacientes oncológicos quanto ao monitoramento auditivo. MÉTODOS: foram utilizados os prontuários dos pacientes em atendimento durante os meses de setembro a novembro de 2006. A amostra constituiu-se de 25 prontuários de indivíduos com idade compreendida entre um e 53 anos. Foram analisados os dados quanto aos seguintes aspectos: idade, sexo, classificação do câncer, tempo de apresentação da doença, medicamentos utilizados, tempo ...

  15. O DIREITO FUNDAMENTAL AO MEIO AMBIENTE NO NOVO CONSTITUCIONALISMO LATINO-AMERICANO: BOLÍVIA E EQUADOR

    Directory of Open Access Journals (Sweden)

    Ana Cristina Willemann

    2013-11-01

    constitucional que vem se desenvolvendo nos países latinos; e (ii abordar o direito ao meio ambiente na nova visão do constitucionalismo latino-americano; e analisar como o respeito a Pacha Mama, Madre Tierra, impõe o direito fundamental à água e aos outros seres vivos. A metodologia utilizada é a revisão bibliográfica por meio de leitura e análise comparada dos textos dos autores mencionados na bibliografia deste artigo.

  16. Influência do "primer" sobre o esmalte na resistência ao cisalhamento de sistemas adesivos

    OpenAIRE

    Eliza Maria Agueda RUSSO; GARONE NETTO,Narciso; CARVALHO,Rubens Corte Real de; SANTOS Márcio Garcia dos

    1998-01-01

    A proposta deste estudo foi comparar a adesão ao esmalte de dois sistemas adesivos de frasco único com sistemas que usam "primer" e "bond" separadamente, com o objetivo de verificar se a força de adesão da resina composta ao esmalte é influenciada pela presença do "primer" de dentina sobre o esmalte. Foram avaliados quatro sistemas adesivos: ONE STEP (Bisco), PRIME & BOND (Dentsply), SCOTCHBOND MULTI-PURPOSE PLUS (3M) e PROBOND (Dentsply). Molares humanos foram seccionados no sentido oclu...

  17. Influência do "primer" sobre o esmalte na resistência ao cisalhamento de sistemas adesivos

    OpenAIRE

    Eliza Maria Agueda RUSSO; Garone NETTO Narciso; CARVALHO,Rubens Corte Real de; SANTOS Márcio Garcia dos

    1998-01-01

    A proposta deste estudo foi comparar a adesão ao esmalte de dois sistemas adesivos de frasco único com sistemas que usam "primer" e "bond" separadamente, com o objetivo de verificar se a força de adesão da resina composta ao esmalte é influenciada pela presença do "primer" de dentina sobre o esmalte. Foram avaliados quatro sistemas adesivos: ONE STEP (Bisco), PRIME & BOND (Dentsply), SCOTCHBOND MULTI-PURPOSE PLUS (3M) e PROBOND (Dentsply). Molares humanos foram seccionados no sentido ocluso-c...

  18. O ACESSO AO CUIDADO ESPECIALIZADO EM SAÚDE POR PESSOAS ACOMETIDAS POR LESÕES NEUROLÓGICAS

    OpenAIRE

    Jodéli Pommerehn

    2016-01-01

    Objetivo: Analisar o acesso de adultos com Lesão Neurológica (LN) ao cuidado especializado em Fisioterapia, Fonoaudiologia e Terapia Ocupacional, no contexto hospitalar e no retorno ao domicílio, as condições de saúde e a Qualidade de Vida (QV) dessas pessoas. Materiais e Métodos: Estudo descritivo, documental e quantitativo. A amostra foi composta por sujeitos com LN, de idade superior a 18 anos que acessaram um hospital público e regional, entre março de 2015 e fevereiro de 2016. A coleta f...

  19. GeMS: from the on-sky experimental system to science operation. The AO point of view

    Science.gov (United States)

    Vidal, Fabrice; Neichel, Benoit; Rigaut, François; Carrasco, Rodrigo; Winge, Claudia; Pessev, Peter; Serio, Andrew; Arriagada, Gustavo; Moreno, Cristian; Rambold, William; Luhrs, Javier; Boccas, Maxime; D'Orgeville, Celine; Fesquet, Vincent; Trujillo, Chadwick; Galvez, Ramon; Gausachs, Gaston; Vucina, Tomislav; Montes, Vanessa; Urrutia, Cristian; Marchant, Claudio; Diggs, Sarah

    2013-12-01

    Two years after its first light in 2011, GeMS, the Gemini Multi conjugate adaptive optics System achieved the science verification process and started queue observations. From the Adaptive Optics (AO) point of view it is time to summarize the performance provided by the system after more than 6 months of science on very different observing conditions. We present a statistical study of the overall performance from the AO data recorded by the GeMS telemetry. In particular we study the seeing and LGS photon return performance dependency and conclude on the current limitations of the system

  20. Transformações no ensino superior e interdição ao marxismo (anos 1980)

    OpenAIRE

    Wasserman, Claudia

    2014-01-01

    O artigo aborda o retorno dos intelectuais exilados ao Brasil nos Anos 1980 e as transformações nos ambientes culturais e acadêmicos no periodo, com destaque para as Universidades. Analisa as transformações no ensino superior, a interdição ao marxismo após a queda do socialismo e as dificuldades de readaptação a partir das experiências de Vânia Bambirra, Ruy Mauro Marini e Theotônio dos Santos. El artículo aborda el retorno de los intelectuales exilados al Brasil en los años 1980 y las tra...