WorldWideScience

Sample records for terceiro reich ao

  1. Crime e ideologia: do Terceiro Reich ao assassinato de Moisés Crime and ideology: from the Third Reich to the murder of Moses

    Directory of Open Access Journals (Sweden)

    Verônica Martinelli

    2005-12-01

    Full Text Available Objetiva-se considerar em quais condições o homicídio se torna moralmente aceitável como forma de restauração social. Ademais, trata do funcionamento de certos grupos que legitimam o mal e o crime. Para tanto, recorre-se ao modelo fornecido pelo nazismo. A Alemanha de Hitler estabeleceu novos laços sociais, possibilitando a legitimação de uma lei de gozo. Considera-se, aqui, o nazismo, sobretudo, como instrumento para uma leitura do Moisés e o monoteísmo. O texto freudiano aborda a origem do judaísmo, articulando as noções de "estrangeiro" e "assassinato". Freud evidencia, então, que os ideais, o que há de mais nobre em nós, também empuxam ao crime.This article refers to the conditions that make homicide morally acceptable as an instrument for social restoration. It also considers the way certain groups that legitimate evil and crime work. In order to reach these goals, it resorts to the model that Nazism provides. The Hitler Administration in Germany created new social ties that permitted to legitimate a Law of enjoyment. However, in this article Nazism is essentially a means to draw a particular approach to Moses and Monotheism, by Freud. The Freudian text articulates the notions of "foreigner" and "murder" to deal with the origins of Judaism. Then, Freud evidences that ideals, the noblest objectives we have, favor crime.

  2. O Terceiro Reich e as conexões culturais com o Brasil em Kautschuk

    Directory of Open Access Journals (Sweden)

    José Rocha Filho

    2014-06-01

    The present article analyses some cultural connections between the Third Reich and Brazil, through film production – specifically in the film Kautschuk, produced in Brazil, in 1938. It is important here to clarify the huge presence of elements that exposes the expansionist character from that period and the full support gave from national socialist to imperialist domination policies on the period immediately before the Second World War. This film is a historical document from German cultural policy in 1938 and also how cultural production in Third Reich was permanently changing in order to achieve short term political goals.

  3. Gestão baseada em valor aplicada ao terceiro setor Value based management applied to the tertiary sector

    Directory of Open Access Journals (Sweden)

    Alexandre Assaf Neto

    2006-08-01

    Full Text Available Nos últimos anos, o mundo assistiu ao crescimento do assistencialismo e das preocupações sociais. Pessoas se reúnem e formam instituições cujo único objetivo é tentar amenizar problemas sociais. Surge o chamado Terceiro Setor, que vem crescendo e conseguindo ajudar no suprimento das carências resultantes da incapacidade do governo em exercer o seu papel. No entanto, muitas organizações desse setor apresentam problemas de gestão. A metodologia centra-se em revisão bibliográfica sobre os temas principais do trabalho, além de uma pesquisa empírica. A pesquisa empírica mostrou que, na prática, é possível aplicar a GBV, sendo necessárias adaptações para a avaliação econômica da entidade. Este trabalho apresenta uma adequação da gestão baseada em valor, ferramenta sedimentada nas empresas lucrativas, para as empresas desse setor e apresenta o cálculo do EVA® para uma organização sem fins lucrativos.In recent years, the world has witnessed growing concern about social issues and assistance. People join to create organizations with the only goal of trying to mitigate social problems. This gives rise to the so-called Tertiary Sector, which is expanding and manages to help to fulfill the needs generated by the government's incapacity to play its role. Nevertheless, many organizations in this sector present management problems. The methodology focuses on a bibliographic review of the subject, as well as an empirical research. The empirical research has shown that it is actually possible to apply value based management, provided that modifications are made for the organization's economic assessment. This study presents an adaptation of value based management, a tool used by for-profit companies, to tertiary-sector organizations, as well as the calculation of EVA TM for not-for-profit organizations.

  4. AvaliaÃÃo da fragilidade mandibular ao trauma devido à presenÃa de terceiros molares: Uma anÃlise tridimensional com elementos finitos

    OpenAIRE

    TÃcio Pinheiro Bezerra

    2012-01-01

    O Ãngulo mandibular tem sido descrito como uma Ãrea frÃgil e, acredita-se que, com a presenÃa do terceiro molar, a mandÃbula perde parte de sua estrutura para abrigar tecidos que nÃo contribuem para sua resistÃncia estrutural. Neste contexto, o artigo produzido nessa tese teve como objetivo identificar Ãreas de concentraÃÃo e distribuiÃÃo de estresse na regiÃo do Ãngulo em uma mandÃbula portando os dois terceiros molares erupcionados, outra portando apenas um terceiro molar erupcionado e outr...

  5. Reich e o movimento de higiene mental Reich y el movimiento de higiene mental Reich and the mental hygiene movement

    Directory of Open Access Journals (Sweden)

    Paulo Albertini

    2007-08-01

    Full Text Available Este estudo visa investigar se a atuação do psicanalista dissidente Wilhelm Reich no cenário científico-cultural da primeira metade do século passado permite associá-lo ao movimento de higiene mental. A fim de cumprirmos tal objetivo, duas direções de pesquisa foram assumidas. A primeira envolveu escritos sobre as origens e as orientações definidoras da moderna saúde pública, do higienismo e, em especial, do movimento de higiene mental. A segunda diz respeito a um levantamento na obra reichiana - artigos, livros, capítulos de livros, cartas e entrevistas - de forma a observar: a referências diretas ao movimento de higiene mental; b análises ou relatos de ações do autor vinculadas a esse movimento; c uso de linguagem característica de tal movimento. Como conclusão, foram formuladas linhas de entendimento sobre a participação de Reich no cenário científico-cultural da primeira metade do século passado, no que tange à associação desse autor com o movimento de higiene mental.Este estudio tiene como objetivo el de investigar si la actuación del psicoanalista disidente Wilhelm Reich en el escenario científico-cultural de la primera mitad del siglo pasado permite asociarle al movimiento de higiene mental. Para cumplir con ese objetivo, la investigación ha tomado dos direcciones: por la primera se ocupa de escritos sobre los orígenes y las orientaciones definidoras de la moderna salud pública, del higienismo y, en especial, del movimiento de higiene mental. Por la segunda se hace una lectura de la obra reichiana - artículos, libros, capítulos de libros, cartas y entrevistas - de manera a observar: a referencias directas al movimiento de higiene mental; b análisis o relatos de acciones del autor relacionadas a ese movimiento; c uso de lenguaje característico del movimiento. Como conclusión, se formularon líneas de entendimiento sobre la participación de Reich en el escenario científico-cultural de la primera mitad

  6. Puente Reich, Viena - Austria

    Directory of Open Access Journals (Sweden)

    Staber, Johann

    1979-11-01

    Full Text Available The Reich Bridge substitutes for another bridge linking the centre and North areas of the city, collapsed on 8th August 1976. The purpose of this bridge is to regulate traffic and lends urban distinction to this city section. The structure is a suspended bridge, some 300 m in span, with two abutments on the banks and two piers for anchoring support. The cross section is a box girder large enough to carry motor traffic and the urban railway line.

    El puente Reich sustituye a otro anterior, derrumbado el 8 de agosto de 1976, que servía de enlace entre el centro y la parte norte de la ciudad de Viena. Debe servir para ordenar el tráfico y para realzar urbanísticamente esta zona de la ciudad. La estructura que presenta es un puente colgante de unos 300 m de luz, con dos estribos en zona de tierra y dos apoyos para los anclajes El perfil es una viga-cajón Vierendel que permite el tráfico automovilístico y el trazado del Metropolitano.

  7. Maria Reiche's Line to Archaeoastronomy

    OpenAIRE

    Sparavigna, Amelia Carolina

    2013-01-01

    Maria Reiche was a German mathematician and archaeologist that, from 1940, devoted her life to the study of the Nazca Lines, the most famous Peruvian geoglyphs, gaining recognition and preservation of them. Created by removing the upper most layer of the arid soil of the Nazca desert, these geoglyphs, declared in 1995 a UNESCO World Heritage Site, are composed by very long straight and trapezoidal lines, spirals and large figures representing animals. Maria Reiche, in fact an archaeoastronome...

  8. La corrispondenza Malinowski-Reich

    Directory of Open Access Journals (Sweden)

    Carlos Liendro

    2004-06-01

    Full Text Available Nel libro 'Reich habla de Freud' compaiono cinque lettere che si scambiarono l'antropologo Broni-slaw Malinowski e lo psichiatra Wilhelm Reich. Le date approssimative si collocano tra il 1938 ed il 1942, anno in cui l'autore di 'Sexo y represiòn en la sociedad primitiva' morì. Da questa corri-spondenza si possono ricavare tre scenari: la situazione che stavano attraversando entrambi gli scien-ziati nei loro rispetti percorsi; il funzionalismo come teoria centrale dei rispettivi lavori; le sue con-seguenze e ripercussioni.

  9. La correspondencia Malinowski-Reich

    Directory of Open Access Journals (Sweden)

    Carlos Liendro

    2004-06-01

    Full Text Available En el libro 'Reich habla de Freud', aparecen cinco cartas que se envìan entre el antròpologo Bronislaw Malinowski y el psiquiatra Wilhelm Reich. La fechas aproximadas son entre 1938 y 1942, año en que fallece el autor de 'Sexo y represiòn en la sociedad primitiva'. Tres aspectos pueden tomarse de esta correspondencia: la situaciòn que atravesaban ambos investigadores en sus distintos campos. El funcionalismo como teorìa central para sus trabajos. Las consecuencias y repercusiones.

  10. Linguistics and the Third Reich.

    Science.gov (United States)

    Plockinger, Othmar

    2001-01-01

    Examines linguistics during the Third Reich in Nazi Germany. Discusses Nazi linguistics or linguistics in Nazism, Yiddish studies and the horror of assimilation, and remarks on the relevance of historical approaches in linguistics in the field of academic education. (Author/VWL)

  11. Reich e a possibilidade do bem-estar na cultura

    Directory of Open Access Journals (Sweden)

    Paulo Albertini

    2003-01-01

    Full Text Available Numa entrevista dada em 1952, Reich afirmou que o texto freudiano O mal-estar na cultura fora escrito em resposta a uma conferência que proferira na casa do Freud sobre o tema profilaxia das neuroses. Inspirado nesse depoimento, este trabalho procura investigar as teses reichianas que se contrapõem ao pensamento freudiano de O mal-estar na cultura. Diferenciam-se as posições dos autores a partir das idéias de conflito inevitável (Freud e de possibilidade de harmonia (Reich. As principais noções focalizadas são as de: sexualidade, agressividade e formação reativa.

  12. Wilhelm Reich y el fascismo

    Directory of Open Access Journals (Sweden)

    Ignacio Dobles-Oropeza

    2003-01-01

    Full Text Available Este artículo discute diversos aspectos de los aportes elaborados por Wilhelm Reich en las décadas de los 30 y 40 para abordar el fenómeno nazi-fascista en Alemania, y sus polémicas con el movimiento psicoanalítico y también con la Internacional Comunista. Enfatiza el abordaje caracterológico del fascismo por parte de Reich y su análisis de la política, la propaganda y la estrategia fascista, cubriendo su lectura del marxismo y del psicoanálisis y las tareas psicopolíticas que intentó esbozar.

  13. Último Desejo e Testamento de Wilhelm Reich

    Directory of Open Access Journals (Sweden)

    Matthiesen Sara Quenzer

    2001-01-01

    Full Text Available O objetivo desta tradução é contribuir para a divulgação do pensamento do médico psiquiatra e inicialmente, psicanalista, Wilhelm Reich. Nascido em 24 de março de 1897, em parte da Galícia pertencente ao Império austro-húngaro, Reich morreu na prisão em 03 de novembro de 1957 nos Estados Unidos da América. Contudo, poucos meses antes do ataque cardíaco que o levou à morte, Reich legou sua obra às "crianças do futuro" em testamento assinado em 08 de março de 1957, onde registrou seus últimos desejos sob o testemunho de Willian Moise, Michael Silvert e Willian Steig, temendo possíveis distorções, difamações, adulterações e destruição de seus escritos após a sua morte.

  14. Último Desejo e Testamento de Wilhelm Reich

    Directory of Open Access Journals (Sweden)

    Sara Quenzer Matthiesen

    Full Text Available O objetivo desta tradução é contribuir para a divulgação do pensamento do médico psiquiatra e inicialmente, psicanalista, Wilhelm Reich. Nascido em 24 de março de 1897, em parte da Galícia pertencente ao Império austro-húngaro, Reich morreu na prisão em 03 de novembro de 1957 nos Estados Unidos da América. Contudo, poucos meses antes do ataque cardíaco que o levou à morte, Reich legou sua obra às "crianças do futuro" em testamento assinado em 08 de março de 1957, onde registrou seus últimos desejos sob o testemunho de Willian Moise, Michael Silvert e Willian Steig, temendo possíveis distorções, difamações, adulterações e destruição de seus escritos após a sua morte.

  15. Ideologia gerencialista e subjetividade do trabalhador no terceiro setor

    Directory of Open Access Journals (Sweden)

    Mário Ibraim Salimon

    2013-12-01

    Full Text Available Neste artigo, trata-se o impacto de reestruturações de cunho gerencialista sobre a subjetividade de trabalhadores em organizações ambientalistas do terceiro setor historicamente ligadas à benemerência, ao humanismo e à luta por direitos. O crescimento dessa população organizacional tem gerado competição por recursos, com a consequente busca por sistemas e modelos gerenciais que possam viabilizar a sobrevivência de cada organização via vantagens comparativas associadas à eficácia, à eficiência, à efetividade e ao posicionamento de marca. Nesse contexto, percebe-se uma crescente adoção de modelos importados do segundo setor - privado de interesse privado. Elementos característicos do gerencialismo, tais como intensificação e aceleração do trabalho, precarização das relações trabalhistas e primazia do determinismo econômico, são também assimilados no processo. Investe-se no culto à excelência e na mobilização psíquica do sujeito como formas de se enquadrar a pessoa como ativo estratégico da organização. As práticas decorrentes chocam-se com os valores humanistas geralmente vigentes no terceiro setor, causando conflitos de racionalidade e intrapsíquicos. Desenvolveu-se pesquisa qualitativa e exploratória, baseada em entrevistas com profissionais de quatro organizações ambientais de relevo no País, para fazer emergir, por meio da análise do discurso, a percepção dos sujeitos sobre o fenômeno em questão. Os resultados mostram que a ideologia gerencialista foi, pelo menos nos casos estudados, assimilada pelo trabalhador, que as relações de trabalho estão se precarizando em nome da rentabilidade financeira dos investimentos na organização, que as estratégias de defesa e adesão implicam sofrimento subjetivo e que o terceiro setor se distancia crescentemente de sua identidade histórica de esfera de agenciamento marcada por uma racionalidade substantiva.

  16. Music in the Third Reich

    Directory of Open Access Journals (Sweden)

    DeLora J. Neuschwander

    2012-12-01

    Full Text Available Music played a prominent role in the rise of Nazi culture in Germany and was used extensively in propaganda and indoctrination of the entire country; the Nazi party brought music and politics together and sought to shape their ideal culture by elevating their ideas of pure music to the highest status and outlawing what they defined as inferior. This study addresses Hitler’s specific views on music and explores several of the factors and individuals that contributed to his views. His views were directly inferred into the core of the Nazi party. Hitler himself was an artist and felt that art and music were a vital part of life and culture. He was deeply influenced by Wagner’s views as well as his music, and Hitler saw many parallels between Wagner’s conception of Germany and the stories which the composer used in his operas. This study also explores how the Nazis used music to spread their propaganda, what was considered to be “pure” music, and the impact which the idea of “pure” art had on Jewish musicians and composers. The party made significant use of music to strengthen their political events and indoctrinate the individual citizen. Not only was the actual music used to portray Nazi ideology, but Nazi doctrine played a significant role in the fate of Jewish composers and performers. Many Jewish musicians lost their jobs and found themselves banned from mainstream cultural and musical organizations. Arnold Schoenberg is the prime example of the effect of the Nazi ideology on the music and perception of a Jewish composer, while Wagner is the perfect example of the response to a composer who met the Nazi criteria of pure Aryanism. This study attempts to examine these historical facts in an effort to promote a better understanding of the cultural aspects of the Third Reich in the hopes that the informed individual will ensure that such views will never again permeate government and society.

  17. Formas de financiamento do terceiro setor

    Directory of Open Access Journals (Sweden)

    Flávia Verônica Jacques

    2014-05-01

    Full Text Available Há muito tempo o terceiro setor ocupa um importante espaço na sociedade. Sua origem é considerada tão antiga quanto qualquer outro tipo de organização. Mesmo antes de ser assim denominado, sua existência era percebida por meio de obras assistenciais de caridade, executadas por igrejas e hospitais filantrópicos. Para o alcance de seus fins, essas instituições se utilizam de financiamentos, os quais provêm de fontes diversas. Nesse sentido, torna-se relevante o estudo sobre a composição dos financiamentos utilizados pelas mesmas. O objetivo geral deste estudo é evidenciar como ocorre o financiamento das atividades desempenhadas pelas entidades do terceiro setor. Justifica-se a presente pesquisa pela relevância do setor em questão para desenvolvimento econômico e social do país. Em termos metodológicos, a pesquisa é descritiva, de campo e com abordagem qualitativa; foi utilizada para coleta dos dados uma entrevista estruturada com questões previamente estabelecidas. Constatou-se que as associações, igrejas e sindicatos, de modo geral, têm seus recursos provindos 100% de pessoas físicas, enquanto os hospitais e a fundação possuem subvenções provindas do governo e de convênios com pessoas jurídicas. Já os educandários e ONGs, suas fontes de financiamento variam entre governo, pessoa física, pessoa jurídica e receitas próprias.

  18. Nazca-Lines and Maria Reiche - I.

    Science.gov (United States)

    Kaifu, N.

    Huge and numerous geometrical lines and figures drawn on the stony desert near Nazca, Peru, are known as "Nazca Lines". Those lines might be the "largest calendar" which were drawn by ancient Peruvian towards the directions of setting and rising celestial bodies, proposes Maria Reiche, a great researcher and introducer of the Nazca Lines. The author reports the status of the Nazca Lines, and reviews the various studies to explain the purpose why the Nazca Lines were drawn.

  19. Economia social, economia solidária, terceiro setor: do que se trata?

    Directory of Open Access Journals (Sweden)

    Lechat, Noëlle Marie Paule

    2002-01-01

    Full Text Available A partir da segunda metade da década de 90, aparece na literatura acadêmica brasileira uma série de novas categorias que poderiámos agrupar sob as apelações de "terceiro setor" e "economia solidária". A pesquisa concentra-se na segunda categoria e tem por objetovo identificar sua origem e a realidade que ela pretende abranger. Neste texto são expostas algumas definições que podem ser encontradas na literatura internacional a respeito de termos como economia social, economia solidária, terceiro setor e outros mais. Deste confronto aparece que os conceitos utilizados no Brasil para estudar o campo da economia solidária tendem a uma certa estreiteza devido à pouca ênfase sobre questões como o resgate histórico anterior aos anos 80, a pluralidade ideológica e o hibridismo econômico, porém demonstram sensibilidade quanto à construção de uma outra cultura econômica de mercado, economia estatal e economia de reciprocidade que a categoria de terceiro setor tende a mascarar. Em vista disto, constata-se a necessidade de repensar esta categoria e de questionar as grandes expectativas assentadas na for mação de uma economia solidária para a transformação da sociedade

  20. Estado, mercado e terceiro setor: A redefinição das regras do jogo

    Directory of Open Access Journals (Sweden)

    Vasco Almeida

    2012-12-01

    Full Text Available Este artigo parte de uma revisão crítica à teoria dos bens coletivos e à teoria da falha do contrato para mostrar que o terceiro setor não deve ser encarado como um resíduo deixado pelo mercado e pelo Estado, mas sim como uma forma de coordenação da atividade socioeconómica. Tendo como cenário empírico a evolução do terceiro setor em Portugal, pretende‑se mostrar que o seu papel crescente na governação se traduziu no aumento da diversidade e da complexidade dos processos socioeconómicos, quer a perspetiva de análise se situe ao nível micro, quer se desloque para o plano macrossocial. Em virtude da sua crescente importância na governação socioeconómica, o terceiro setor tem provocado uma redefinição das regras do jogo e uma transformação da própria lógica de funcionamento do mercado, do Estado e da comunidade.

  1. The Self According to Allan Bloom and Charles Reich.

    Science.gov (United States)

    Aspy, David N.; Aspy, Cheryl B.

    1998-01-01

    Discusses the works of Charles Reich and Allan Bloom that have helped to shape current social and political debate concerning self theory. Both Reich and Bloom were concerned with the relationship between self and environment. Argues that it is important to insure that its cultural role of self theory is clearly interpreted and applied. (MKA)

  2. 'Electroshock Therapy' in the Third Reich.

    Science.gov (United States)

    Rzesnitzek, Lara; Lang, Sascha

    2017-01-01

    The history of 'electroshock therapy' (now known as electroconvulsive therapy (ECT)) in Europe in the Third Reich is still a neglected chapter in medical history. Since Thomas Szasz's 'From the Slaughterhouse to the Madhouse', prejudices have hindered a thorough historical analysis of the introduction and early application of electroshock therapy during the period of National Socialism and the Second World War. Contrary to the assumption of a 'dialectics of healing and killing', the introduction of electroshock therapy in the German Reich and occupied territories was neither especially swift nor radical. Electroshock therapy, much like the preceding 'shock therapies', insulin coma therapy and cardiazol convulsive therapy, contradicted the genetic dogma of schizophrenia, in which only one 'treatment' was permissible: primary prevention by sterilisation. However, industrial companies such as Siemens-Reiniger-Werke AG (SRW) embraced the new development in medical technology. Moreover, they knew how to use existing patents on the electrical anaesthesia used for slaughtering to maintain a leading position in the new electroshock therapy market. Only after the end of the official 'euthanasia' murder operation in August 1941, entitled T4, did the psychiatric elite begin to promote electroshock therapy as a modern 'unspecific' treatment in order to reframe psychiatry as an 'honorable' medical discipline. War-related shortages hindered even the then politically supported production of electroshock devices. Research into electroshock therapy remained minimal and was mainly concerned with internationally shared safety concerns regarding its clinical application. However, within the Third Reich, electroshock therapy was not only introduced in psychiatric hospitals, asylums, and in the Auschwitz concentration camp in order to get patients back to work, it was also modified for 'euthanasia' murder.

  3. Para entender Marcel Reich-Ranicki

    Directory of Open Access Journals (Sweden)

    Klaus Eggensperger

    2014-06-01

    Full Text Available O artigo apresenta o crítico literário Marcel Reich-Ranicki e também procura explicar o fenômeno de seu sucesso na Alemanha. Aprofunda algumas particularidades de sua crítica, sua relação com a mídia de massas e o entretenimento. Finalmente investiga o percurso incomum de sua vida como crítico judeu das literaturas de língua alemã nascido na Polônia e sua relação com a cultura alemã.

  4. Nazca-lines and Maria Reiche - II.

    Science.gov (United States)

    Kaifu, N.

    Huge and numerous geometrical lines and figures drawn on the stony desert near Nazca, Peru, are known as "Nazca Lines". Those lines might be the "largest calendar" which were drawn towards the directions of setting and rising celestial bodies by ancient Peruvian, proposes Maria Reiche, a great researcher and introducer of the Nazca Lines. The future of the Nazca Lines is seriously concerned due to the recent rapid developments in Peru. The author reports the status of the Nazca Lines, and reviews the various studies to explain the purpose why the Nazca Lines were drawn.

  5. Abfallwirtschaft und Ressourcenmanagement im Dritten Reich

    Directory of Open Access Journals (Sweden)

    Neumaier, Dorothee

    2013-07-01

    Full Text Available The consideration of the history of the Third Reich from an approach concerning waste industry dues not only touch aspects of National Socialist economic policy, but also essential elements of social policy. Besides government agencies, representatives from economy and sciences, also the general public is concerned with waste management, and thus mainly with the transformation of formerly unused waste products into exploitable raw resources. In the following, it is attempted to deserche the areas of the waste industry (collection, handling/transport, sorting, reutilisation, treatment, accumulation in the context of general National Socialist structures. The main focus is on a selection of material flows in the light of the extraction of secondary raw resources. Finally, it is also examined to which extent the system of National Socialist waste management resulted from a systemically conditioned necessity, whether it was due to the specific circumstances of the time, or if its peculiarity can be considered as a characteristic of totalitarian political systems.

  6. Balanço social no terceiro setor: análise do nível de adesão ao modelo IBASE de uma organização hospitalar = Social report in the third sector: analysis of the adherence level to the IBASE model of a hospital organization

    Directory of Open Access Journals (Sweden)

    Paulo Roberto da Cunha

    2010-09-01

    Full Text Available O objetivo deste estudo é identificar quais são as informações que uma organização hospitalar do terceiro setor, o HNSC, dispõe para elaborar o Balanço Social conforme o modelo proposto pelo IBASE. Realizou-se pesquisa exploratória, por meio de um estudo de caso, com abordagem qualitativa. Os dados foram coletados adotando-se análise documental, observação e entrevistas com os responsáveis pelos departamentos de recursos humanos, contabilidade e assistência social de um hospital da Congregação das Irmãs da Divina Providência, uma instituição sem fins lucrativos estabelecida em Santa Catarina. Os resultados da pesquisa mostram que nos itens identificação, origem dos recursos e aplicação dos recursos, as informações disponíveis no hospital são satisfatórias para a elaboração do Balanço Social conforme o modelo IBASE, porém, sugere-se a elaboração de planilhas auxiliares para detalhar o total investido em capital. Nos indicadores sociais internos e sobre o corpo funcional o nível de informações foi baixo. O hospital possui uma quantidade significativa de projetos sociais que não são mensurados quantitativa e qualitativamente. Concluiu-se que a instituição necessita aperfeiçoar alguns aspectos para elaborar o Balanço Social conforme o preceitos do modelo IBASE. Apesar de alguns projetos sociais não terem sido evidenciados adequadamente, destaca-se a relevância dos serviços prestados à comunidade por essa organização hospitalar do terceiro setor, especialmente os atendimentos realizados pelo Sistema Único de Saúde (SUS.The aim of this study is to identify what are the information a hospital institution of the third sector have (HNSC, so as to elaborate the Social Report according to the IBASE proposed model. The aim of this study is to identify the level of adherence to the IBASE (Brazilian Institute of Social and Economic Analysis model in the Social Report preparation of a hospital organization in

  7. Church-State relations in the Third Reich

    Directory of Open Access Journals (Sweden)

    Isakov Pavel Sergeevich

    2017-04-01

    Full Text Available The article reviews the relations between the State and Church in the Third Reich. The author considers the views of the ideologists of National Socialism concerning religious beliefs. The conceptual level of construction of the Church-State relations in the Third Reich is represented. The article is filled with examples of the state's attitude to the Church during the period of National-Socialism.

  8. GOVERNANÇA CORPORATIVA E CUSTO DE CAPITAL DE TERCEIROS: EVIDÊNCIAS ENTRE EMPRESAS BRASILEIRAS DE CAPITAL ABERTO

    Directory of Open Access Journals (Sweden)

    Camila Veneo Campos Fonseca

    Full Text Available RESUMO O reduzido acesso ao capital de terceiros, especialmente os de mais longo prazo, é um dos principais problemas do ambiente corporativo brasileiro. Conflitos de agência e existência de informação assimétrica nas transações efetivadas no mercado financeiro resultam no racionamento do crédito e no encarecimento do custo de capital. A adoção de melhores práticas de governança corporativa pelas empresas, ao implicar redução do custo de capital, amplia a captação de recursos para o investimento, mitigando o problema do financiamento empresarial. O objetivo deste estudo é avaliar a relação entre a adoção de melhores práticas de governança corporativa e o custo do capital de terceiros das empresas brasileiras não financeiras de capital aberto no período 2010-2014. De forma a atingir tal objetivo, foi utilizado um modelo de dados de painel com 230 companhias, sendo a estimação realizada pelo Método dos Momentos Generalizado Sistêmico (GMM-Sis. Os resultados apontaram que a adoção de melhores níveis de governança corporativa reduziu o custo do capital de terceiros das companhias presentes na amostra. Além disso, verificou-se que as variáveis custo de capital de terceiros do ano anterior, lucratividade e nível de emissão de ações preferenciais exerceram uma influência estatisticamente significativa sobre o custo contemporâneo da dívida.

  9. Ebbe Kløvedal Reich - et forfatterportræt

    DEFF Research Database (Denmark)

    Bæk, Peter

    1987-01-01

    Videoportræt af Ebbe Kløvedal Reich med supplerende teksthæfte om forfatterskabet og om Reichs samfundspolitiske engagement. Teksthæftet rummer forslag til undervisningsforløb for folkeskolens ældste klassetrin.......Videoportræt af Ebbe Kløvedal Reich med supplerende teksthæfte om forfatterskabet og om Reichs samfundspolitiske engagement. Teksthæftet rummer forslag til undervisningsforløb for folkeskolens ældste klassetrin....

  10. Sobre as traduções da obra de Wilhelm Reich para o português

    Directory of Open Access Journals (Sweden)

    Sara Q. Matthiesen

    Full Text Available O aumento dos textos traduzidos e da investigação acadêmica no campo reichiano realça a necessidade de se estar atento à qualidade das traduções dos textos de Reich para o português. Utilizando a palavra Trieb como exemplo, o objetivo deste artigo foi identificar quais os termos utilizados nas traduções dessa palavra para o português. Os resultados demonstraram, a exemplo do que acontece nas traduções da obra freudiana, que os termos mais comuns são: pulsão, instinto e impulso. Tal variação de termos reforça a necessidade de se cotejar diferentes traduções de um mesmo texto, de se confrontar os textos traduzidos com os textos originais e de se ater ao devido uso de termos específicos, contribuindo para que se leia, da melhor forma possível, as ideias originais de Reich em português.

  11. "Terceiro setor": um projeto solidário complementar

    Directory of Open Access Journals (Sweden)

    Eliane da Silva Cara

    2012-11-01

    Full Text Available O objetivo principal deste artigo é refletir sobre o novo papel social das empresas, mostrando sua responsabilidade social como forma de mudança do discurso de mercado. Além disso, o trabalho mostra que a sociedade civil busca alternativas· diante da dificuldade do Estado em atender adequadamente as necessidades de cunho social, trabalhando a questão sobre as implicações que envolve o crescimento do "terceiro setor".

  12. Mulheres no segundo e terceiro trimestres de gravidez: suas alterações psicológicas

    OpenAIRE

    Melo,Luciana de Lione; Lima,Maria Alice Dias da Silva

    2000-01-01

    O propósito do artigo é relatar a experiência das autoras ao coordenar um grupo de gestantes, que teve a finalidade de esclarecer algumas dúvidas sobre o período gestacional, cuidados com o recém-nascido e anticoncepção. Aborda as percepções e sentimentos das gestantes a respeito do tema sexualidade e aspectos psicológicos da gravidez. As alterações psicológicas apresentadas pelas gestantes no segundo e terceiro trimestres da gravidez evidenciam a importância da função educadora da enfermeira...

  13. Sobre a crítica da perversão social em reich, fromm e Marcuse

    OpenAIRE

    Peixoto Junior, Carlos Augusto

    1998-01-01

    o objetivo deste ensaio é fazer uma breve análise dos aportes de Wilhelm Reich, Erich Fromm e Herbert Marcuse, que de alguma forma contribuíram para a formulação de uma teoria psicanalítica da perversão social. Nesse sentido, percorremos algumas obras dos autores ao analisar conceitos importantes, tais como os de economia sexual, caráter autoritário, princípio de desempenho e dessublimação repressiva, para avaliar até que ponto eles podem ser utilizados como operadores conceituais na análise ...

  14. Tumor da região do terceiro ventrículo diagnóstico eletrencefalográfico

    Directory of Open Access Journals (Sweden)

    Paulino W. Longo

    1948-06-01

    Full Text Available Depois de rápidas considerações sobre as dificuldades do diagnóstico topográfico dos tumores da região do terceiro ventrículo e sobre as aquisições recentes da eletrencefalografia nesse sentido, os AA. apresentam a observação de uma paciente de 36 anos de idade, com história de 4 meses, portadora de uma síndrome de hipertensão intracraniana grave, acompanhada de hemiparesia esquerda muito discreta e alterações psíquicas. O exame do liqüido cefalorraquidiano revelou hipertensão e a eletrencefalografia evidenciou alterações difusas e bilaterais, ao lado de surtos persistentes e repetidos de ritmo teta, simétrica e sincronicamente reproduzidos, em áreas centrais e parietais de ambos os hemisférios, bem como ondas de ritmo delta focal, no lobo frontal direito, com típicas figuras de reversão. Os primeiros foram atribuídos ao edema cerebral e à hipertensão intracraniana, enquanto que estas (as ondas de ritmo teta acompanhadas de ritmo delta focal frontal direito foram interpretadas como dependentes de tumor cerebral profundamente situado, mediano, da região do terceiro ventrículo, comprometendo secundariamente o lobo frontal direito. A ventriculografia, em parte, e a intervenção cirúrgica subseqüente, confirmaram o diagnóstico, revelando a existência de um tumor cístico pediculado, que, da sela turca invadia o terceiro ventrículo e a parte profunda do lobo frontal direito (craniofaringioma.

  15. Peste emozionale e immaginario sociale in Wilhelm Reich

    Directory of Open Access Journals (Sweden)

    Georges Bertin

    2003-12-01

    Full Text Available Per noi è impressionante, quasi letteralmente, constatare oggi che le analisi sociologiche sviluppate da Wilhelm Reich settanta anni fa sono nuovamente di estrema attualità. Mentre una delle grandi voci dell'analisi critica, quella di Castoriadis, lontano certamente dai sofismi attuali dei nuovi filosofi che si adoperano ad accedere ai benefici pubblici e editoriali, si è ormai spenta da sei anni, mentre i politici si adoperano, sui podi della Società dello Spettacolo, a prendere di mira i processi di comunicazione più derisori per mascherare la loro assenza di pensiero politico, mai la nostra società post-moderna è stata in effetti così vicina a questa crisi di significati immaginari sociali che Reich definiva già negli anni trenta, peste emozionale.

  16. The Theory of Reich's Fixed Point Theorem for Multivalued Operators

    Directory of Open Access Journals (Sweden)

    Moţ Ghiocel

    2010-01-01

    Full Text Available The purpose of this paper is to present a theory of Reich's fixed point theorem for multivalued operators in terms of fixed points, strict fixed points, multivalued weakly Picard operators, multivalued Picard operators, data dependence of the fixed point set, sequence of multivalued operators and fixed points, Ulam-Hyers stability of a multivalued fixed point equation, well-posedness of the fixed point problem, and the generated fractal operator.

  17. Estrutura trófica da ictiofauna, ao longo do gradiente longitudinal do reservatório de Salto Caxias (rio Iguaçu, Paraná, Brasil, no terceiro ano após o represamento - DOI: 10.4025/actascibiolsci.v27i1.1362 Fishfauna trophic structure across longitudinal gradient of Salto Caxias Reservoir (Iguaçu River – state of Paraná – Brazil in the third year after dam - DOI: 10.4025/actascibiolsci.v27i1.1362

    Directory of Open Access Journals (Sweden)

    Rosilene Luciana Delariva

    2005-03-01

    Full Text Available Objetivou-se, neste estudo, avaliar a estrutura trófica da ictiofauna, ao longo do gradiente longitudinal do reservatório de Salto Caxias, no terceiro ano após seu represamento (pós 3. Compararam-se os dados obtidos neste trabalho com dados anteriores (pré e pós 1, a fim de verificar se as espécies que alteraram suas dietas no início do represamento voltaram a utilizar os mesmos recursos alimentares oferecidos no ambiente natural. Foram analisados conteúdos estomacais de 1527 exemplares pelo método volumétrico. A maioria das espécies apresentou dietas compostas por grande diversidade de itens alimentares, predominando, geralmente, um tipo de recurso. A ictiofauna foi organizada em oito guildas tróficas. As espécies detritívoras e piscívoras não alteraram consideravelmente seu hábito alimentar ao longo do gradiente espacial. A montante, todas as guildas estiveram distribuídas em proporção mais semelhante do que nos demais locais. Comparando-se os períodos de pré e pós 1 com o pós 3, verifica-se que poucas espécies retomaram seu hábito alimentar originalThis study aims at evaluating the fishfauna trophic structure across the longitudinal gradient of Salto Caxias reservoir, in the third year after its dam (post 3. The data obtained were compared with the previous ones (pre and post 1 to verify if the species that altered their diets in the initial phase of the dam, returned to the same food resources offered by natural environment. S(tomachal contents of 1527 fishes were analyzed, using the volumetric method. In general, fishes presented a great diversity of food items in their diets, usually with a predominant resource kind. Thus, the fishfauna was synthetized in eight trophic guilds. The detrivore and piscivore species did not alter their feeding habit across spatial gradient considerably. (A montanteUpstream, all the trophic guilds were equally distributed compared to the other sites. Comparing pre and post 1 periods

  18. Relações de força: uma análise a partir do Primeiro, Segundo e Terceiro Setor

    Directory of Open Access Journals (Sweden)

    Patrícia Franck Pichler

    2013-12-01

    Full Text Available Através do método da análise dos discursos em editais à seleção de projetos do Terceiro Setor – voltando-se à enunciação e chegando aos contratos de leitura – é traçado um panorama de como os Primeiro e Segundo setores da sociedade recebem, organizam e coordenam o Terceiro Setor. O trabalho investiga as relações de força como maneira de compreender a adequada atuação de relações públicas nas interações existentes entre os poderes Público, Privado e Social.

  19. The Education of Nations: An Analysis of Robert B. Reich's Economic Theory.

    Science.gov (United States)

    Lockwood, John H.

    This essay critiques the book "The Work of Nations: Preparing Ourselves for 21st Century Capitalism" (1991), by Robert Reich, Secretary of Labor in the Clinton administration. Reich described the development of the symbolic-analyst as the new citizen in the economic order, utilizing the basic skills of abstraction, system thinking,…

  20. ‘Electroshock Therapy’ in the Third Reich

    Science.gov (United States)

    Rzesnitzek, Lara; Lang, Sascha

    2017-01-01

    The history of ‘electroshock therapy’ (now known as electroconvulsive therapy (ECT)) in Europe in the Third Reich is still a neglected chapter in medical history. Since Thomas Szasz’s ‘From the Slaughterhouse to the Madhouse’, prejudices have hindered a thorough historical analysis of the introduction and early application of electroshock therapy during the period of National Socialism and the Second World War. Contrary to the assumption of a ‘dialectics of healing and killing’, the introduction of electroshock therapy in the German Reich and occupied territories was neither especially swift nor radical. Electroshock therapy, much like the preceding ‘shock therapies’, insulin coma therapy and cardiazol convulsive therapy, contradicted the genetic dogma of schizophrenia, in which only one ‘treatment’ was permissible: primary prevention by sterilisation. However, industrial companies such as Siemens–Reiniger–Werke AG (SRW) embraced the new development in medical technology. Moreover, they knew how to use existing patents on the electrical anaesthesia used for slaughtering to maintain a leading position in the new electroshock therapy market. Only after the end of the official ‘euthanasia’ murder operation in August 1941, entitled T4, did the psychiatric elite begin to promote electroshock therapy as a modern ‘unspecific’ treatment in order to reframe psychiatry as an ‘honorable’ medical discipline. War-related shortages hindered even the then politically supported production of electroshock devices. Research into electroshock therapy remained minimal and was mainly concerned with internationally shared safety concerns regarding its clinical application. However, within the Third Reich, electroshock therapy was not only introduced in psychiatric hospitals, asylums, and in the Auschwitz concentration camp in order to get patients back to work, it was also modified for ‘euthanasia’ murder. PMID:27998332

  1. Mulheres no segundo e terceiro trimestres de gravidez: suas alterações psicológicas

    Directory of Open Access Journals (Sweden)

    Luciana de Lione Melo

    2000-03-01

    Full Text Available O propósito do artigo é relatar a experiência das autoras ao coordenar um grupo de gestantes, que teve a finalidade de esclarecer algumas dúvidas sobre o período gestacional, cuidados com o recém-nascido e anticoncepção. Aborda as percepções e sentimentos das gestantes a respeito do tema sexualidade e aspectos psicológicos da gravidez. As alterações psicológicas apresentadas pelas gestantes no segundo e terceiro trimestres da gravidez evidenciam a importância da função educadora da enfermeira no trabalho com grupos.

  2. Mulheres no segundo e terceiro trimestres de gravidez: suas alterações psicológicas

    Directory of Open Access Journals (Sweden)

    Luciana de Lione Melo

    Full Text Available O propósito do artigo é relatar a experiência das autoras ao coordenar um grupo de gestantes, que teve a finalidade de esclarecer algumas dúvidas sobre o período gestacional, cuidados com o recém-nascido e anticoncepção. Aborda as percepções e sentimentos das gestantes a respeito do tema sexualidade e aspectos psicológicos da gravidez. As alterações psicológicas apresentadas pelas gestantes no segundo e terceiro trimestres da gravidez evidenciam a importância da função educadora da enfermeira no trabalho com grupos.

  3. Tobacco policies in Austria during the Third Reich.

    Science.gov (United States)

    Bachinger, E; McKee, M

    2007-09-01

    The anti-smoking stance taken by Adolf Hitler, coupled with Nazi support for research on smoking and lung cancer and campaigns to discourage smoking, have encouraged pro-smoking groups to equate tobacco control activities with totalitarianism. Previous work has described the situation in Germany. To examine the situation in Austria, also part of the Reich after 1938. Iterative analysis of documents and reports about the situation in Austria in the 1930s and 1940s, supplemented by a review of Reich legal ordinances, party newspapers, health behaviour guidelines issued by Nazi party organisations and interviews with expert informants. In contrast to the situation in Germany where, albeit to a much lesser degree than is commonly believed, some anti-smoking policies were adopted, the Nazi authorities in Austria made almost no attempt to discourage smoking and the Austrian tobacco company worked closely with the Nazi authorities to ensure that supplies were maintained. Especially when looked at in the Austrian context, the much-cited link between anti-smoking policies and Nazism is a gross over-simplification. This purported link should not be used to justify the continued failure to act effectively against smoking in Germany and Austria.

  4. Peste émotionnelle et imaginaire social chez Wilhelm Reich

    Directory of Open Access Journals (Sweden)

    Georges Bertin

    2003-12-01

    Full Text Available Il est pour nous frappant, presque au sens premier, de constater aujourd'hui que les analyses sociologiques posées par Wilhelm Reich voici 70 ans sont à nouveau d'une extrême actualité. Alors qu'une des grandes voix de l'analyse critique, celle de Castoriadis, bien éloignée des sophismes actuels de nouveaux philosophes s'évertuant surtout à accéder aux prébendes publiques et éditoriales, s'est éteinte depuis maintenant six ans, alors que les politiciens s'évertuent, sur les scènes de la Société du Spectacle, à faire assaut des procédés de communication les plus dérisoires pour masquer leur absence de pensée politique, jamais notre société post moderne n'a en effet été aussi proche de cette crise des significations imaginaires sociales que Reich nommait déjà, dans les années 30, peste émotionnelle.

  5. A reforma do marco legal do terceiro setor no Brasil : a criação da Lei das OSCIP (lei 9.790/99)

    OpenAIRE

    Ferrarezi, Elisabete Roseli

    2009-01-01

    O principal objetivo desta tese é compreender quais foram os principais fenômenos políticos e sociais que propiciaram que a reforma da legislação relativa ao terceiro setor entrasse na agenda governamental e tivesse êxito com a promulgação da Lei 9.790/99, que criou a qualificação de Organização da Sociedade Civil de Interesse Público (OSCIP) para as pessoas jurídicas de direito privado sem fins lucrativos. Elementos geralmente apontados como impulsionadores de ações públicas como uma c...

  6. Ideias e Política Externa: As Relações do Brasil com o Terceiro Mundo durante o Governo Castelo Branco

    Directory of Open Access Journals (Sweden)

    Suhayla Khalil

    2014-12-01

    Full Text Available Este artigo analisa as relações entre o Brasil e os países em desenvolvimento durante o primeiro governo militar pós-1964. Busca-se explicar o enigma por trás dessa política externa que, apesar do discurso fortemente vinculado à bipolaridade, ao alinhamento com os Estados Unidos e à luta contra o comunismo, apresentou notável incremento de relações com os países do Terceiro Mundo e seus arranjos multilaterais. Sugerimos que a análise de ideias institucionalizadas é fundamental para explicar tal achado.

  7. The Politics of Memory: Otto Hahn and the Third Reich

    Science.gov (United States)

    Sime, Ruth Lewin

    2006-03-01

    As President of the Kaiser Wilhelm Society and its successor, the Max Planck Society, from 1946 until 1960, Otto Hahn (1879 1968) sought to portray science under the Third Reich as a purely intellectual endeavor untainted by National Socialism. I outline Hahn’s activities from 1933 into the postwar years, focusing on the contrast between his personal stance during the National Socialist period, when he distinguished himself as an upright non-Nazi, and his postwar attitude, which was characterized by suppression and denial of Germany’s recent past. Particular examples include Hahn’s efforts to help Jewish friends; his testimony for colleagues involved in denazification and on trial in Nuremberg; his postwar relationships with émigré colleagues, including Lise Meitner; and his misrepresentation of his wartime work in the Kaiser Wilhelm Institute for Chemistry.

  8. Philanthropy in Democratic Societies: History, Institutions, Values by Rob Reich, Chiara Cordelli, and Lucy Bernholz

    Directory of Open Access Journals (Sweden)

    Nancy Beaman Stutts

    2017-07-01

    Full Text Available Reich, R., Cordelli, C., & Bernholz, L. (2016. Philanthropy in Democratic Societies: History, Institutions, Values. Chicago, IL: University of Chicago Press. $30.00 (paperback, ISBN: 978-022633-564-3.

  9. A Atuação do Secretário Executivo no Terceiro Setor na Cidade de Aracaju

    Directory of Open Access Journals (Sweden)

    Karen Almeida Pereira

    2014-04-01

    Full Text Available A atuação dosecretário executivo é indispensável para a gestão das organizações modernas.Essa afirmativa advém da atuação deste profissional diretamente com os gestorese executivos, por meio da multiplicidade de competências e da polivalência queele possui, uma vez que este ator está apto a trabalhar em qualquer tipologiaorganizacional. Com o crescimento das organizações do terceiro setor no Brasile também na cidade de Aracaju, o objetivo da pesquisa foi de identificar quaisas formas de atuação do secretário e quais as competências pertinentes desseprofissional para trabalhar nessas instituições que possuem característicaspeculiares na sua gestão. Para subsídio da pesquisa discutiu-se sobre terceirosetor e as características das organizações inseridas neste campo, a evoluçãoda carreira do secretário, considerando a sua atuação no mercado de trabalho; eas competências a serem desenvolvidas. Dessa forma, identificaram-se, na cidadede Aracaju, organizações do terceiro setor que possuem uma gestão fragilizadadevido, principalmente, à falta de recursos, à dependência financeira de outrosórgãos e à ausência de mão de obra qualificada. No que se refere ao perfil dossecretários, a maioria não possui formação específica, são polivalentes, porémnão são inovadores. Quanto à rotina de trabalho dos mesmos, ela está divididaem atividades operacionais e estratégicas, tendo como principal atribuição oassessoramento.

  10. Produção científica brasileira sobre comportamento organizacional no terceiro setor

    OpenAIRE

    NASCIMENTO,Thainá Tavares do; BORGES-ANDRADE,Jairo Eduardo; PORTO,Juliana Barreiros

    2016-01-01

    Este trabalho revisa a produção científica brasileira sobre comportamento organizacional no terceiro setor. Utilizou-se um levantamento pré-existente de pesquisas empíricas sobre micro comportamento organizacional, publicadas em 15 periódicos nacionais de Psicologia e Administração, no período de 1996 a 2012. Do total de 629 artigos sobre o tema, apenas 31 apresentaram estudos realizados no terceiro setor. O achado sugere que esse segmento econômico encontra--se ainda sub-representado. "Inter...

  11. Gestão social e desenvolvimento local: princípios, conceitos e possíveis relações com o Terceiro Setor

    Directory of Open Access Journals (Sweden)

    Natham Ribeiro Martins

    2014-05-01

    Full Text Available O presente artigo discute sobre os conceitos de gestão social e desenvolvimento local e como estes conceitos se relacionam com a educação dentro da perspectiva do trabalho com o terceiro setor. São analisados conceitos propostos por diferentes autores e como o terceiro setor se organiza no processo de captação de recursos e relacionamento com o Estado e a iniciativa privada. Ao final é feita uma proposta de conciliação das diferentes abordagens para uma práxis da gestão social e do desenvolvimento local, onde são retomados os principais pontos dos conceitos trabalhados no artigo.   Abstract  This article discusses the concepts of social management and local development and how these concepts relate to education within the perspective of working with the third sector. Concepts proposed by different authors are analyzed and how the third sector is organized in fundraising and relationship with the state and second sector. At the end a proposal is made to reconcile the different approaches to a praxis of social management and local development, which are reproduced the main points of the concepts used in the article.    

  12. História dos intelectuais no Terceiro Mundo: reflexões a partir do caso de Guerreiro Ramos

    Directory of Open Access Journals (Sweden)

    João Marcelo E. Maia

    Full Text Available Resumo:Este artigo tem por objetivo discutir a questão dos intelectuais no Terceiro Mundo a partir de um estudo de caso focado no sociólogo Alberto Guerreiro Ramos. Parte-se da hipótese de que a bibliografia sobre intelectuais é excessivamente eurocêntrica e que é possível superar tal problema com a análise empírica de intelectuais periféricos. O artigo utiliza dados de pesquisa realizada ao longo de 3 anos e enfoca 3 aspectos da prática sociológica de Ramos: a o diálogo crítico com as teorias produzidas no Hemisfério Norte; b o seu estilo de escrita; c sua busca por autonomia intelectual. Os dados são analisados à luz da bibliografia produzida por historiadores e sociólogos sobre intelectuais. Conclui-se que estudos sobre intelectuais periféricos evidenciam uma relação entre ideias e vida pública diferente daquela encontrada nos países centrais.

  13. [Morbidity in the concentration camps of the Third Reich].

    Science.gov (United States)

    Shasha, Shaul M

    2004-04-01

    Life in the concentration camps of the Third Reich was like living on another planet. The prisoners, stripped of all rights, experienced constant humiliation, uncertain survival and endless terror. Living conditions were harsh, characterized by crowding, poor sanitation and personal hygiene, lack of proper clothing and heating. The days began early with long marches and slave labor. Sleep was short and interrupted, and fatigue was constant and severe. Above all hoovered the dark cloud of ever-present famine. The prisoners were given about a fourth of the daily calorie requirements, and the food lacked vital components such as vitamins and other essential ingredients. The psychological stress was extreme, yet morbidity and mortality were mainly due to infections, injuries and hunger. Lice, scabies and other skin diseases were common. Typhus fever was ever-present, both endemic and epidemic, with a fatal outcome. Many suffered from tuberculosis, typhoid, dysentery, pneumonia and other infections diseases. Injuries were common, caused by beating, punitive whiplashing and other forms of physical abuse, gunshot wounds and dog-bites. Skull injuries with brain contusions and hemorrhages were prevalent, as well as fractured limbs, ribs and pelvic bones. Blunt injuries to chest and abdomen often had fatal outcomes due to the perforation of viscera and peritonitis or as a result of massive hemorrhage from ruptured blood vessels. The harsh winters were marked by frozen gangrenous limbs and hypothermia. Yet, the most ominous condition was the "hunger disease" with its multiple clinical expressions which, in their extreme form, led to the emaciated "musleman" and eventual death.

  14. Generalized Reich-Moore R-matrix approximation

    Science.gov (United States)

    Arbanas, Goran; Sobes, Vladimir; Holcomb, Andrew; Ducru, Pablo; Pigni, Marco; Wiarda, Dorothea

    2017-09-01

    A conventional Reich-Moore approximation (RMA) of R-matrix is generalized into a manifestly unitary form by introducing a set of resonant capture channels treated explicitly in a generalized, reduced R-matrix. A dramatic reduction of channel space witnessed in conventional RMA, from Nc × Nc full R-matrix to Np × Np reduced R-matrix, where Nc = Np + Nγ, Np and Nγ denoting the number of particle and γ-ray channels, respectively, is due to Np full R-matrix to N × N, where N = Np + N, and where N is the number of capture channels defined in GRMA. We show that N = Nλ where Nλ is the number of R-matrix levels. This reduction in channel space, although not as dramatic as in the conventional RMA, could be significant for medium and heavy nuclides where N full Nc × NcR-matrix. This suggests that GRMA could yield improved nuclear data evaluations in the resolved resonance range at a cost of introducing N(N - 1)/2 resonant capture width parameters relative to conventional RMA. Manifest unitarity of GRMA justifies a method advocated by Fröhner and implemented in the SAMMY nuclear data evaluation code for enforcing unitarity of conventional RMA. Capture widths of GRMA are exactly convertible into alternative R-matrix parameters via Brune tranform. Application of idealized statistical methods to GRMA shows that variance among conventional RMA capture widths in extant RMA evaluations could be used to estimate variance among off-diagonal elements neglected by conventional RMA. Significant departure of capture widths from an idealized distribution may indicate the presence of underlying doorway states.

  15. Cisto coloide no terceiro ventrículo e morte súbita em jovem Colloid cyst in the third ventricle and sudden death in young man

    Directory of Open Access Journals (Sweden)

    Angela Augusta Ferreira de Alencar

    2010-12-01

    Full Text Available Morte súbita de jovem, sexo masculino, 23 anos, assintomático, suscitou verificação de óbito. Antes queixou-se de cefaleia excruciante, em sala de aula, caindo sobre o computador. Encéfalo apresentou edema e congestão vascular. Sem herniações. Cortes coronais evidenciaram dilatação dos ventrículos laterais e nódulo aderido ao teto do terceiro ventrículo. À microscopia o diagnóstico foi cisto coloide do terceiro ventrículo. A ameaça de morte súbita em portadores de cisto coloide é sério problema diagnóstico na emergência médica. A relevância deste caso está em lembrar aos médicos que esta entidade deve permanecer como diagnóstico diferencial nas cefaleias em crianças, adolescentes e adultos jovens.Sudden death of 23 year-old asymptomatic male patient led to further investigation into its cause. Previously, he had complained of excruciating headache in the classroom, falling on the computer. His brain showed edema and vascular congestion without herniation. Coronal sections showed dilatation of the lateral ventricles and nodule attached to the roof of the third ventricle. The microscopic diagnosis was colloid cyst of third ventricle. The threat of sudden death among colloid cyst patients is a serious diagnostic problem in medical emergencies. The relevance of this case is to remind doctors that this entity should remain as differential diagnosis in headaches among children, adolescents and young adults.

  16. Addressing the Concept of Historical Empathy: With "Frauen: German Women Recall the Third Reich."

    Science.gov (United States)

    Stern, Barbara Slater

    1998-01-01

    Contends that Alison Owings' book, "Frauen: German Women Recall the Third Reich," makes an important contribution toward helping students develop historical empathy. Explains that she strives to understand why the women she interviewed behaved the way they did during the Holocaust by situating the womens stories in the context of their…

  17. Süss Judutarra filma. III. Reich-eko zine propagandako trilogia antisemita

    OpenAIRE

    Díaz Ugarte, Eneko

    2016-01-01

    [EUS] Alemaniar III. Reich-eko garaian ikusentzuneko porpagandaren arloan hanibat film estreinatu ziren. Horietako bat Adibide modura hartuz, Süss Judutarra, lanean Goebbelsek Der Angriff egunkarian argitaratutako judutarren dekalogoa eta NSDAPko 25 puntuetan agertzen den antisemitismoa filman nola islatzen den aztertuko da.

  18. The Western Allied project to denazify Third Reich feature film stock

    NARCIS (Netherlands)

    van Eeghen, I.

    2017-01-01

    The three Allied powers that occupied West Germany from 1945 to 1955 subjected the feature film legacy of the Third Reich to a process of denazification. The origins and implementation of this project are examined here along chronological and comparative lines. Part One looks at British and American

  19. Diener vieler Herren. Die Reichs-Agenten am Kaiserhof (1550-1740

    Directory of Open Access Journals (Sweden)

    Thomas Dorfner

    2017-06-01

    Full Text Available Die am Kaiserhof in Wien bzw. Prag tätigen „Reichs-Agenten“ waren eine wichtige Funktionselite im Heiligen Römischen Reich deutscher Nation. Sie fungierten als Interessenvertreter der Fürsten und Stände des Reiches, die in der Regel mehrere hundert Kilometer vom Kaiserhof entfernt lebten: Zu den zentralen Aufgaben der Agenten gehörte es beispielsweise, Prozesse vor dem kaiserlichen Höchstgericht zu führen, diplomatische Aufträge zu erledigen sowie Informationen zu sammeln. Der Aufsatz analysiert das Tätigkeitsspektrum der Agenten und trägt somit zum besseren Verständnis der Funktionsweise des Kaiserhofs sowie des Reiches bei. Zugleich wird die These belegt, dass auch der Kaiser von der Tätigkeit der „Reichs-Agenten“ profitierte. Working at the Imperial Court in Vienna and Prague, respectively, the “Imperial Agents” were an important functionary elite in the Holy Roman Empire of the German Nation. They served as representatives of the princes and estates of the Empire, who usually lived several hundred kilometers from the Imperial Court. One of the agents’ central tasks was, for example, to conduct trials before the Imperial Supreme Court, to carry out diplomatic missions, and to gather information. The essay analyzes the activity spectrum of the agents and thus contributes to a better understanding of the mode of operation of both the Imperial Court and the empire. At the same time it proves the thesis that the emperor also benefited from the activities of the “Imperial Agents”.

  20. [Medicine in the concentration camps of the Third Reich].

    Science.gov (United States)

    Shasha, Shaul M

    2005-04-01

    Between 1942 and 1944 millions of prisoners were subjected to forced labor in concentration camps throughout the Third Reich, all the while being the victims of a systematic and "scientific" extermination policy. Though the policy was directed mainly against Jews, it was implemented against other "inferior races" as well. The prisoners, stripped of all rights, experienced constant humiliation, uncertain survival and terror. The harsh living condition, characterized by crowding, absent sanitation and poor personal hygiene led to considerable morbidity, mainly due to injuries, infectious diseases and famine, and to high mortality rates. Medical care in the camps was the responsibility of the S.S. Each camp had a chief S.S. physician accompanied by a number of assistants and orderlies. There was also a parallel system of "prisoner-physicians." There was a chief prisoner-physician in every camp, and each block was assigned a "block doctor" who was responsible for sanitation, the removal of corpses, setting up the sick- call and authorizing sick leave. Work teams were accompanied by "mobile doctors" (Streckenpfleger), who dispensed first aid for work injuries. Prisoner-physicians were also charged with disinfecting the blocks and maintaining hygienic conditions in the camp. Every camp had one or more blocks, called "Reviers", that were used for treatment and hospitalization. In the larger camps a number of blocks were designated to function as a sort of hospital (Krankenbau). At times one camp out of a group of camps would be set aside as quarantine, primarily for patients with infectious diseases. Officially, the "Revier" was the responsibility of an S.S. physicians', assisted by a chief prisoner-physician, his assistants and, at times, nurses. But in actuality the Reviers were managed by prisoners (Capos) who did not have medical training but were authorized to make decisions in medical matters such as operations and, on occasion, even performed them. The Reviers

  1. Política e sexualidade na trajetória de Reich: Berlim (1930-1933

    Directory of Open Access Journals (Sweden)

    Ailton Bedani

    2014-09-01

    Full Text Available This study focuses on the sex-political work undertaken by Wilhelm Reich in Berlin, between 1930 and 1933. Four aspects have been chosen to be exposed here: a the Reichian project of joining together in a single organization, known as SEXPOL, diverse German groups that discussed issues relating to sexuality; b the publications of sex-political connotation in which the author and his collaborators focused on themes related to childhood and adolescence; c Reichian analysis dealing with the social function of sexual repression; d the studies elaborated by Reich, by the light of Political Sexology, focused on Nazi-Fascism. Three sources of data were consulted: the main sex-political works by Reich published during the period 1930-1933; autobiographical reports and an interview in which the author, in the mature days of his work, reassessed his political participation in Europe; the works by some of the commentators who examined Reich's Freudo-Marxian production.

  2. AS PUBLICAÇÕES ACADÊMICAS DA PESQUISA CONTÁBIL NO BRASIL, NO ÂMBITO DAS ORGANIZAÇÕES DO TERCEIRO SETOR

    Directory of Open Access Journals (Sweden)

    PAULO ARNALDO OLAK

    2008-04-01

    Full Text Available As organizações privadas sem fins lucrativos, neste trabalho denominadas de Terceiro Setor, vêm desempenhando funções cada vez mais amplas e relevantes na sociedade moderna. Estas organizações desenvolvem atividades de caráter beneficente, filantrópico, caritativo, religioso, cultural, educacional, científico, artístico, literário, recreativo, de proteção ao meio ambiente, esportivo, além de outros serviços, objetivando sempre a consecução de fins sociais. Como conseqüência, o campo de estudos desse setor é, atualmente, uma das áreas que vêm despertando grande interesse de pesquisadores multidisciplinares das chamadas ciências sociais, incluindo áreas aplicadas como as das ciências econômicas, administrativas e contábeis. Nesse sentido, é oportuno questionar a evolução da produção acadêmica contábil no âmbito dessas organizações, sendo este o principal objetivo deste artigo. Para identificar e sistematizar as diferentes produções acadêmicas realizadas sobre essa temática, fez-se, preliminarmente, uma revisão da literatura sobre o Terceiro Setor e, em seguida, levantou-se a produção acadêmica no período de 2000 a 2006, a partir de bases de dados dos programas de doutorado e mestrado em Ciências Contábeis e Controladoria, congressos e revistas especializadas. Ficou evidente, a partir da análise dos resultados, que a produção tem origem, basicamente, em dois programas de mestrado, a disseminação é mais forte em congressos e é inexpressiva a publicação em revista.

  3. Quando o passado legitima o presente: a música no III Reich

    Directory of Open Access Journals (Sweden)

    Sílvia Sônia Simões

    2010-10-01

    Full Text Available Este pequeno artigo é parte de um trabalho maior intitulado Música e História na República de Weimar e no III Reich: uma aproximação possível, e visa ressaltar as formas de adequação utilizadas pelo nazismo no campo musical, buscando um entendimento de qual foi a música que este regime considerou adequada para expressar sua ideologia.

  4. [Psychoanalysis during the Nazi era. Contemporary consequences of a historical controversy: the Wilhelm Reich "case"].

    Science.gov (United States)

    Nitzschke, B

    1999-01-01

    The paper sheds light on the extent of collaboration between the pre-World War II German Psychoanalytic Society (DPG) and the Nazi regime. This is shown by the story of the expulsion of Wilhelm Reich from membership in the DPG, at Freud's own bid. A leading German psychoanalyst, Carl Müller-Braunschweig, published the paper "Psychoanalysis and Weltanschauung" in the fanatically "national" (so-called "völkisch") Nazi propaganda organ Reichswart in 1993 following consultations with officials of the International Psychoanalytic Association (IPA) who endorsed these policies. This paper by Müller-Braunschweig was used both to prevent the possible outlawing of psychoanalysis by the Nazis and to deny official DPG support to Wilhelm Reich and the group of leftist-oriented IPA analysts who joined forces with him in opposing Nazi ideology. The paper concludes with examples from post-1945 historiography showing how the exclusion of Reich and the related DPG/IPA compromise and "appeasement" policy were either ignored or disclaimed.

  5. Serving the Reich the struggle for the soul of physics under Hitler

    CERN Document Server

    Ball, Philip

    2013-01-01

    Serving the Reich tells the story of physics under Hitler. While some scientists tried to create an Aryan physics that excluded any 'Jewish ideas', many others made compromises and concessions as they continued to work under the Nazi regime. Among them were three world-renowned physicists: Max Planck, pioneer of quantum theory, regarded it as his moral duty to carry on under the regime. Peter Debye, a Dutch physicist, rose to run the Reich's most important research institute before leaving for the United States in 1940. Werner Heisenberg, discovered the Uncertainty Principle, and became the leading figure in Germany's race for the atomic bomb. After the war most scientists in Germany maintained they had been apolitical or even resisted the regime: Debye claimed that he had gone to America to escape Nazi interference in his research; Heisenberg and others argued that they had deliberately delayed production of the atomic bomb. Mixing history, science and biography, Serving the Reich is a gripping exploration o...

  6. AUDITORIA EXTERNA EM ORGANIZAÇÕES DO TERCEIRO SETOR: UM ESTUDO DA PERCEPÇÃO DE CONTADORES E NÃO CONTADORES

    Directory of Open Access Journals (Sweden)

    Selma Austricliano de Souza

    2012-08-01

    Full Text Available Este estudo teve por objetivo identificar a percepção de contadores e não contadores a respeito das possíveis contribuições que a Auditoria Independente imprime na confiabilidade e transparência das Demonstrações Contábeis de Organizações do Terceiro Setor, além de verificar se existe diferença significativa entre as percepções desses dois grupos. A auditoria independente é uma técnica exercida por profissionais independentes da organização que verifica se as demonstrações contábeis foram elaboradas de acordo com as normas e princípios contábeis vigentes. Trata-se de uma ferramenta que subsidia as técnicas de gestão, a elaboração de projetos, o planejamento estratégico e a captação de recursos, um instrumento de governança corporativa. Nas organizações do Terceiro Setor, um espaço público de atuação das instituições da sociedade civil organizada que tem como escopo o bem público, percebe-se a necessidade de melhorar a confiabilidade e transparência nas demonstrações contábeis, visto que obtém recursos da iniciativa privada, do governo e de pessoas físicas para financiar suas atividades. Ao buscando resposta para o questionamento desta pesquisa, os seguintes procedimentos metodológicos foram adotados: a revisão na literatura pertinente ao tema, a aplicação de um questionário a uma amostra por acessibilidade a estudantes de pós graduação, nas áreas de contabilidade e finanças,  a contadores e a não contadores na cidade de Salvador, Bahia. Na análise de dados, a escala “Grau de confiabilidade na auditoria independente” foi validada de acordo com a sua dimensionalidade, confiabilidade e convergência. Ao analisar as estatísticas descritivas, observou-se alto grau de confiabilidade na auditoria independente por parte dos dois grupos estudados. Em seguida, a análise de co-variância univariada (ANCOVA confirmou não existir diferença significativa quanto às percepções analisadas

  7. Comunicador no terceiro setor: a influência da trajetória de vida nas estratégias da organização

    Directory of Open Access Journals (Sweden)

    Nivea Canalli Bona

    2013-12-01

    Full Text Available RESUMOEsse artigo traz as reflexões e análises sobre parte de uma investigação que busca o sentido das práticas dos comunicadores inseridos em movimentos sociais. São apresentados os conceitos relacionados ao terceiro setor, à comunicação em ONGs e ao papel do comunicador nessa esfera. A incursão empírica foi realizada por meio de entrevistas em profundidade com duas comunicadoras da ONG Terra de Direitos. Dentre os resultados, encontram–se sinais de que a trajetória de vida e o consumo midiático dessas duas profissionais podem influenciar nas escolhas e determinações de estratégias comunicativas na organização.Palavras-chave: ONG. Comunicação no terceiro setor. Comunicadores. Trajetória de vida.Consumo midiático. ABSTRACTThis paper presents the reflections and analysis on part of a researchthat seeks the meaning of  communicators’ practices inserted within social movements. Concepts related to the third sector, the communication of non-profit organizations (NGOs and the communicator´s role in this area are presented. The empirical data were obtained by means of in-depth interviews with two   communicators from the NGO “Terra de Direitos” (Land of Rights. Among the results, there are signs that the life trajectory and media consumption of these two professionals can influence the choices and determinations of communication strategies within the organization.Key words: Non-profit organizations. Communications in third sector.  Communicators.  Life trajectory.  Media consumption. RESUMENEsteartículo reúne las reflexiones y análisis sobre parte de la investigación quebusca el significado de las prácticas de los comunicadores insertados en losmovimientos sociales. Se presentan los conceptos relacionados con el tercersector, en la comunicación en las organizaciones no gubernamentales (ONGs y alpapel del comunicador en este ámbito. La incursión empírica se realizó pormedio de entrevistas en profundidad

  8. ["In the Third Reich there must be no cruelty to animals anymore"--the development of the Reich's Animal Welfare Law from 1933].

    Science.gov (United States)

    Schimanski, Michael

    2009-04-01

    In the German Reich cruelty to animals was punishable over decades only under anthropozentrical points of view, animal experiments and slaughter without stunning were also settled insufficient. Then at the end of the republic of Weimar initiated by the national socialists slaughter without stunning was forbidden. After the takeover by the national socialists the ban was immediately extended to the hole country, the criminal punishment of cruelty to animals was increased and finally the Reichstierschutzgesetz was enacted--influenced by an ethical way of protection of animals. The societies for the prevention of cruelty to animals were aligned and offences against the law were punished with hard sentences. Protection of animals was particularly promoted by the national socialists on propagandistic purposes and served for the compensation of an increasing degeneration of social values.

  9. A Quantitative Version of a Theorem due to Borwein-Reich-Shafrir

    DEFF Research Database (Denmark)

    Kohlenbach, Ulrich

    2001-01-01

    We give a quantitative analysis of a result due to Borwein, Reich and Shafrir on the asymptotic behaviour of the general Krasnoselski-Mann iteration for nonexpansive self-mappings of convex sets in arbitrary normed spaces. Besides providing explicit bounds we also get new qualitative results...... concerning the independence of the rate of asymptotic regularity of that iteration from various input data. In the special case of bounded convex sets, where by well-known results of Ishikawa, Edelstein/O'Brien and Goebel/Kirk the norm of the iteration converges to zero, we obtain uniform bounds which do...

  10. A influência da narrativa criada por terceiros na imagem da marca: o caso do vídeo do Spoleto

    Directory of Open Access Journals (Sweden)

    Fábio Pimenta de Pádua Júnior

    2016-08-01

    Full Text Available A narrativa de marca ajuda a formar e a mudar atitudes e crenças, se tornando um importante processo de persuasão. Por ser um tema pouco explorado, o objetivo deste trabalho é analisar a narrativa criada por um terceiro na internet e a sua influência na imagem da marca na qual é feita alusão. São explorados os processos de persuasão narrativa por meio dos mecanismos transportation (imersão dentro de um texto ou estória e identification (conexão da audiência com o personagem da narrativa. Foram realizadas entrevistas em profundidade, em que os pesquisados assistiram a dois vídeos. A narrativa do primeiro filme é uma paródia e foi criada de modo independente, ao passo que a do segundo é uma resposta da marca. Os resultados encontrados enfatizam a ocorrência do processo de “imersão” na estória e a identificação com os personagens, o que gera um impacto direto na imagem da marca, nem sempre de modo positivo.

  11. Anatomy in the Third Reich: an outline, part 1. National Socialist politics, anatomical institutions, and anatomists.

    Science.gov (United States)

    Hildebrandt, S

    2009-11-01

    Although it is known that anatomists working in Germany during the Third Reich have used bodies of victims of the National Socialist (NS) regime for dissection and research, a comprehensive history of the anatomy in the Third Reich has not yet been written. Recent studies of the history of German anatomy departments during this time period provide material for a first outline of the subject matter. A historical review can help with the formulation of ethical foundations in modern anatomy. From the outset, the NS regime sought to reorganize German universities according to NS leadership principles and political goals. Many German academics, especially physicians and among them anatomists, followed these intentions with a voluntary "self-alignment" that encompassed their professional actions as well as their ethics. Currently, political information is available for 111 of 178 anatomists. Thirty-eight of the anatomists were dismissed for racial or political reasons, among them 10 chairmen of anatomy, whereas 35 of the anatomists were politically active members of one of the NS organizations. Over 70% of the chairmen of anatomical departments in the time period from 1941 to 1944 were members of NS organizations. Anatomists, as so many other physicians and academics, belonged both, to the group of victims of the regime, i.e., those being dismissed from their positions for racial and political reasons, and to the group of supporters and sometimes active perpetrators of NS policies.

  12. Notas sobre a noção de caráter em Reich

    Directory of Open Access Journals (Sweden)

    João Rodrigo Oliveira e Silva

    Full Text Available Este estudo visa ampliar o conhecimento a respeito da fundamentação teórica das proposições do analista austríaco Wilhelm Reich. Investiga-se a noção de caráter presente em trabalhos reichianos da década de 1920 e início dos anos 1930. Foi sobretudo nessa época que o autor, então engajado no movimento psicanalítico, desenvolveu a conceituação de caráter e organizou a sua primeira técnica terapêutica, a análise do caráter. Em termos mais específicos, esta pesquisa busca: a mostrar a vinculação entre as idéias reichianas de caráter com determinadas orientações presentes em escritos freudianos; b contribuir para o esclarecimento da noção de caráter contida em textos reichianos publicados originalmente no período de 1922 a 1933. Dentre os pontos levantados nas abordagens de Freud e Reich, pode-se destacar a importância de se investigar o caráter como fonte de resistência. Já particularmente no domínio reichiano, merece relevo a aproximação efetuada pelo autor entre caráter e forma do comportamento.

  13. Dentina: relação entre densidade tubular em diferentes profundidades e a resistência ao cisalhamento de quatro diferentes sistemas adesivos

    OpenAIRE

    Elisabete Aparecida Balestrin

    2009-01-01

    A dentina em diferentes profundidades apresenta diferentes densidades tubulares e permeabilidades dentinárias, afetando diretamente a adesão dos sistemas adesivos. Objetivos: avaliar a resistência ao cisalhamento de quatro sistemas adesivos e a densidade tubular em diferentes profundidades de dentina. Material e Método: Quatro grupos de dentina de terceiros molares humanos (superior vestibular, superior palatina, inferior vestibular, inferior lingual) foram avaliados quanto à resistência ao c...

  14. Política e sexualidade na trajetória de Reich: Berlim (1930-1933

    Directory of Open Access Journals (Sweden)

    Ailton Bedani

    2009-01-01

    Full Text Available This study focuses on the sex-political work undertaken by Wilhelm Reich in Berlin, between 1930 and 1933. Four aspects have been chosen to be exposed here: a the Reichian project of joining together in a single organization, known as SEXPOL, diverse German groups that discussed issues relating to sexuality; b the publications of sex-political connotation in which the author and his collaborators focused on themes related to childhood and adolescence; c Reichian analysis dealing with the social function of sexual repression; d the studies elaborated by Reich, by the light of Political Sexology, focused on Nazi-Fascism. Three sources of data were consulted: the main sex-political works by Reich published during the period 1930-1933; autobiographical reports and an interview in which the author, in the mature days of his work, reassessed his political participation in Europe; the works by some of the commentators who examined Reich¿s Freudo-Marxian production.

  15. Rethinking the Boundaries and Burdens of Parental Authority over Education: A Response to Rob Reich's Case Study of Homeschooling

    Science.gov (United States)

    Glanzer, Perry L.

    2008-01-01

    Rob Reich's claim that fruitful discussions about the balance among state, parental, and children's educational interests would benefit by contemplating the widespread phenomenon of homeschooling is a welcome suggestion. His policy recommendations, however, place an unjustified burden on parents to show the adequacy of homeschooling arrangements…

  16. Imunidade celular em caninos neonatos - do nascimento ao 45° dia de idade

    Directory of Open Access Journals (Sweden)

    R.P. Klein

    2014-06-01

    Full Text Available O objetivo do presente trabalho foi acompanhar o desenvolvimento imunológico dos neonatos caninos, a fim de avaliar a imunidade celular pela análise dos leucócitos e linfócitos totais e das subpopulações de linfócitos T (CD4+ e CD8+ pela técnica de citometria de fluxo. Foram utilizados 30 cães neonatos de ambos os sexos, sem raça definida, aos três, 10, 17, 24, 31, 38 e 45 dias de idade. A contagem de leucócitos totais aos 45 dias (11.639±3.574 foi significativamente maior que no terceiro dia de idade (8.740±1.812 (P<0,05; não houve diferença entre a contagem total de linfócitos aos 45 dias em relação ao terceiro dia de idade. Quanto às subpopulações de LT CD4+ e LT CD8+, os percentuais de LT CD4+, aos três dias de idade (24,9±16,8%, foram inferiores quando comparados à média entre o 10°, o 24° e o 31°dia (35,5%, e os de CD8+, ao terceiro dia, menores em relação às médias do 10° e do 31° dia de idade. Pode-se concluir que as subpopulações de LT CD4+ e CD8+ sofrem oscilações durante o desenvolvimento pós-natal, sendo estas crescentes em relação aos níveis obtidos aos três dias de idade. A relação CD4+:CD8+ mostrou superioridade para o primeiro tipo celular, sendo que a maior relação entre CD4+ e CD8+ ocorreu no terceiro dia de idade. Com base nos resultados obtidos neste estudo, notaram-se as diferenças semanais nas populações linfocitárias, o que demonstra a dinâmica dessas células durante o período neonatal.

  17. O terceiro sexo revisitado: a homossexualidade no Archives of Sexual Behavior Third sex revisited: homosexuality in the Archives of Sexual Behavior

    Directory of Open Access Journals (Sweden)

    Marina Fisher Nucci

    2009-01-01

    Full Text Available Uma das primeiras teorias científicas sobre a homossexualidade é a ideia de "terceiro sexo", desenvolvida na segunda metade do século XIX, em que o homossexual era visto como possuidor de uma "alma feminina em um corpo masculino". Com o objetivo de analisar se e como determinadas teorias contemporâneas sobre a homossexualidade se articulam à ideia de "terceiro sexo", foi feito um levantamento de 211 artigos sobre homossexualidade, publicados no periódico Archives of Sexual Behavior entre 1971 e 2006. Os artigos foram divididos em cinco categorias: Psicológicos, Biomédicos, Sociológicos/Culturais, HIV e Outros. Analisamos dois grupos de artigos da categoria Biomédicos. O primeiro grupo analisado engloba pesquisas que procuram estabelecer uma relação entre homossexualidade na vida adulta e "comportamento atípico" em crianças (como meninas preferirem bolas a bonecas e vice-versa. No segundo grupo de artigos, os pesquisadores buscam por diferenças anatômicas entre homossexuais e heterossexuais (como a proporção do comprimento dos dedos, ou o tamanho do pênis, que seriam indicadores de "níveis anormais" de hormônios pré-natais, responsáveis pela lateralização cerebral, que por sua vez definiria a orientação sexual. Concluímos que ambos os grupos de artigos estão calcados numa visão da heterossexualidade como característica distintiva de gênero, que aproxima, de um lado, o homem homossexual às mulheres heterossexuais e, do outro, as mulheres homossexuais aos homens heterossexuais. Este tipo de raciocínio possui grande similaridade com a teoria do "terceiro sexo"; entretanto, noções mais vagas ou metafísicas - como "alma" ou "mente" - são substituídas agora por outra mais concreta e física - o cérebro.One of the first scientific theories about homosexuality is the "Third sex" theory, developed in late 1900's. According to this theory, the homosexual male had a "female soul in a male body". With the aim of

  18. O casamento putativo e seu papel perante a proteção das relações jurídicas do agregado social - Cônjuges, filhos e terceiros

    Directory of Open Access Journals (Sweden)

    Karina Almeida do Amaral

    2014-12-01

    Full Text Available O presente trabalho tem por objetivo examinar o instituto jurídico do casamento putativo, tendo por base o ordenamento português. Nesse sentido, trata-se da evolução do casamento perante a sociedade e a sua constituição enquanto contrato. Além disso, analisam-se os principais aspetos desse instrumento, quais sejam, os fundamentos de existência, os efeitos em relação ao agregado social, o que inclui cônjuges, filhos e terceiros, assim como pretende-se traçar uma ideia da relação jurídica considerando-se não apenas o espaço familiar fechado mas, também, o convívio em sociedade.

  19. O fenômeno do Terceiro Templo Judaico e os símbolos de esperança

    OpenAIRE

    Silva, Egivanildo Tavares da

    2015-01-01

    O Fenômeno do Terceiro Templo Judaico e os Símbolos de Esperança. Sob este título construímos esta dissertação, procurando descrever e analisar como se estrutura a esperança nos símbolos que evocam o Terceiro Templo Judaico, por meio de uma tríplice abordagem: História, Antropologia e Teologia. Realizamos uma pesquisa de caráter bibliográfico valendo-nos do método Qualitativo. A pesquisa foi estruturada em três momentos: o primeiro, que trata da historiografia do Templo e sua instauração simb...

  20. Meeting "REICH"

    CERN Multimedia

    Peyrou,C

    1979-01-01

    Le Prof.Charles Peyrou parle de l'étude qui a été faite avec l'aide de 5 personnes de signataires et 5 personnes de l'association du personel concernant la comparaison des coordonnées avec la situation au Cern (salaires recrutements...) suivi des questions

  1. [Anthropology and synthetic Darwinism in the Third Reich: The Evolution of Organisms (1943)].

    Science.gov (United States)

    Hossfeld, Uwe; Junker, Thomas

    2003-03-01

    This essay will analyse early attempts to base anthropology on the theoretical model provided by the emerging synthetic Darwinism of the 1940s. In the first section we will investigate the historical context of the publication of one of the central documents of synthetic Darwinism in Germany: Gerhard Heberer's Die Evolution der Organismen (1943). Anthropology was covered extensively in this book. The second section will give an impression of the live and work of the five anthropologists represented in Heberer's book: Christian von Krogh, Wilhelm Gieseler, Otto Reche, Hans Weinert, and Gerhard Heberer. The third part of our paper will clarify whether these anthropologists shared a common theoretical outlook with the founders of synthetic Darwinism, and to what degree they were committed to the racial ideas of the Third Reich.

  2. La importancia e influencia de las artes plásticas como elemento propagandístico durante el Tercer Reich

    OpenAIRE

    Ramos Quevedo, Agustín O.

    2016-01-01

    [ES]Se aborda el papel y la importancia que desempeñaron las artes plásticas como elemento propagandístico durante el Tercer Reich, centrándonos en la escultura, la pintura y los carteles. Asimismo, se analiza la trayectoria de los diferentes autores artísticos y su participación durante el perío que comprende el Tercer Reich.

  3. Exiliados judíos del Tercer Reich en el cine español: 1933-1936 / Jews in Exile from the 3rd Reich in the Spanish Cinema: 1933-1936

    Directory of Open Access Journals (Sweden)

    Fernando González García

    2016-08-01

    Full Text Available Este artículo pretende dar cuenta por extenso de la participación de judíos exiliados del Tercer Reich en el cine español entre 1933 y 1936, años en los que florece la industria cinematográfica española tras la crisis del sonoro. Se analizan aquí las estrategias de las empresas que estos exiliados forman o gestionan, y el papel de los técnicos y artistas en el conjunto de la cinematografía española, ofreciendo un listado pormenorizado de nombres y actividades, y su destino tras el inicio de la Guerra Civil en España.Palabras clave: capitales, empresarios, gestores, técnicos, artistas, productoras, películas, Tercer Reich, cine español, años treinta.AbstractThe aim of this paper is to fully inform the participation in the Spanish cinema between 1933and 1936 of Jews in exile from the Third Reich. It is in these years that the Spanish film industry flourishes after the ‘Sound Crisis’. Not only the strategies of the production companies that these exiled Jews created or managed will be analysed, but also the role of technicians and artists that participated in every aspect of the Spanish cinematography. Additionally, a detailed list of names and activities will be provided, with indication of their destiny after the beginning of the Spanish Civil War.Keywords: capital, businessmen, managers, technicians, artists, production companies, movies, Third Reich, Spanish cinema, Thirties.

  4. Wilhelm Reich e a produção acadêmica brasileira entre 1979 e 2008

    Directory of Open Access Journals (Sweden)

    Sara Quenzer Matthiesen

    Full Text Available O interesse por pesquisas relacionadas a Wilhelm Reich é notório nos últimos anos. Com o intuito de contribuir com a difusão das produções acadêmicas nesse campo, o objetivo desta pesquisa foi identificar as dissertações de mestrado e as teses de doutorado desenvolvidas em universidades brasileiras entre 1979 e 2008. Os resultados revelaram a existência de 81 produções acadêmicas, das quais 60 são dissertações de mestrado e 21, teses de doutorado. Isso nos leva a concluir que Reich tem sido objeto de interesse de pesquisadores em áreas diversas, o que evidencia que esse autor é um referencial teórico importante para a reflexão de temas contemporâneos.

  5. Qualidade de serviços nas organizações do terceiro setor Service quality in nonprofit organizations

    Directory of Open Access Journals (Sweden)

    Cristiano Rocha Heckert

    2008-01-01

    Full Text Available Este artigo examina a qualidade de serviços nas organizações do terceiro setor. Por meio de revisão da literatura e de um estudo de caso, discutem-se as diferenças na aplicação do conceito de qualidade de serviços (expectativas X percepção dos clientes no terceiro setor em comparação com as empresas de mercado. Conclui-se que as organizações do terceiro setor não apresentam um único tipo de cliente, mas diversos stakeholders que assumem esse papel. Cada um desses atores possui diferentes expectativas com relação à instituição e apresenta diferentes critérios de avaliação da qualidade de seus serviços. Destaca-se, ainda, que, em função de valores como "justiça" e "solidariedade", fundamentais neste tipo de organização, o processo de prestação de serviços assume especial relevância no terceiro setor, sendo muitas vezes tão ou mais importante que os resultados obtidos.This article analyses service quality in nonprofit organizations. Based on a literature review and a case study, it discusses the differences in applying the service quality concept (customer expectations X perception in the nonprofit sector, in comparison to for-profit companies. It concludes that nonprofits don't present a single type of customer, but several stakeholders playing that role. Each of those actors has different expectations towards the organization and presents different criteria when evaluating service quality. It should also be pointed that, due to values such as "justice" and "solidarity", essential in that type of organization, the service deliver process assumes special importance in nonprofits and, sometimes, become as or even more important than the results obtained.

  6. [Pharmacologists in the camps In the Third Reich--part one].

    Science.gov (United States)

    Prusek, Katarzyna; Labuzek, Krzysztof; Gonciarz, Maciej; Okopień, Boguslaw

    2013-10-01

    The outbreak of World War II is considered as the inception of the pharmacology of the III Reich. Hitler's soldiers are decimated on the front lines by malaria, typhoid, gas gangrene, they need efficient and easy accessible medicines. From now on German forces are engaged into pharmacology of war. Only augmentation of Fuehrer's army effectiveness is reckoned with. Research centers in the concentrations camps are being organized, prisoners are used as the human subject. In the investigations many noted and respected personages are involved. Dr. Helmut Vetter and Dr. Ding Erwing Schuler studied chemicals which may had potential use in the prevention and treatment of typhoid. Professor Eugen Haagen carried out experiments concerning the use of vaccines against typhoid. The latter, although sentenced to life imprisonment, he returned to research in 1952 as a result of the amnesty activities in the former West Germany, and then worked as a researcher. His studies were reflected in the book, and scientific publications. Professor. Eugen Haagen died of natural causes in 1972.

  7. 'Neue Deutsche Heilkunde': complementary/alternative medicine in the Third Reich.

    Science.gov (United States)

    Ernst, E

    2001-03-01

    The aim of this article is to discuss complementary/alternative medicine (CAM) in the Third Reich. Based on a general movement towards all things natural, a powerful trend towards natural ways of healing had developed in the 19(th)century. By 1930 this had led to a situation where roughly as many lay practitioners of CAM existed in Germany as doctors. To re-unify German medicine under the banner of 'Neue Deutsche Heilkunde', the Nazi officials created the 'Heilpraktiker' - a profession which was meant to become extinct within one generation. The 'flag ship' of the 'Neue Deutsche Heilkunde' was the 'Rudolf Hess Krankenhaus' in Dresden. It represented a full integration of CAM and orthodox medicine. An example of systematic research into CAM is the Nazi government's project to validate homoeopathy. Even though the data are now lost, the results of this research seem to have been negative. Even though there are some striking similarities between today's CAM and yesterday's 'Neue Deutsche Heilkunde' there are important differences. Most importantly, perhaps, today's CAM is concerned with the welfare of the individual, whereas the 'Neue Deutsche Heilkunde' was aimed at ensuring the dominance of the Aryan race.

  8. The Third Reich and the Cossacks: Relations during the World War II

    Directory of Open Access Journals (Sweden)

    Oleg V. Ratushnyak

    2013-09-01

    Full Text Available The article analyses the fight of the Cossacks on the side of the Nazi Germany in the World War II. Both the emigrant Cossacks and the Soviet Cossacks are the subject of the research. The study is topical due to disputes on the problem of collaboration, which recently started in the academic circles and among the public. The articles reveals the reasons of Hitler support by a substantial number of Cossacks, the attitude of the Nazi leaders towards the Cossacks, the main spheres of cooperation between the Cossacks and the Nazi Germany. The conclusion that the emigrant Cossacks cannot be fully attributed to collaborators due to the fact that they were not citizens of the USSR was made. However, many Cossacks who went with the Germans to the west showed not so much the support of Germany as the desire to avoid possible repressions of the Soviet leadership. In its turn, the leadership of the Third Reich and the command of the Wehrmacht, despite the official ideological attitude, were forced to cooperate with the representatives of the Cossacks closely and make extensive use of its potential in the course of war for a variety of objective reasons.

  9. [Neurological and psychiatric journals during the Third Reich : National socialistic and racist contents].

    Science.gov (United States)

    Claus, D

    2017-02-01

    The aim of this study was to investigate scientific articles in three German journals for national socialist and racist contents. The three journals evaluated for the period of the Third Reich were the Der Nervenarzt, Deutsche Zeitschrift für Nervenheilkunde and the Archiv für Psychiatrie und Nervenkrankheiten. The specialist disciplines of neurology and psychiatry were united in the year 1935 and Ernst Rüdin, a neurological geneticist, was appointed as president (Reichsleiter) of the society. The universal idea of a degenerative development, which was believed to exert a negative influence on public health, was widely accepted in this time period; therefore, in some articles measures were called for, such as termination of pregnancy, sterilization and castration of diseased people and also of criminals. National socialist ideals became part of articles on nervous diseases, works of art of the mentally ill and suicidal tendencies. The recruitment of volunteers and informed consent for participation in human experiments were not described in scientific publications.

  10. Disfunção sexual: Avaliação de mulheres durante o terceiro trimestre gestacional

    Directory of Open Access Journals (Sweden)

    Ana Eliza Rios de Araújo Mathias

    2015-08-01

    Full Text Available Introdução: Disfunção sexual (DS é caracterizada pela falta, excesso, desconforto e/ou dor no desenvolvimento do ciclo da resposta sexual, se manifestando de forma persistente ou recorrente. Objetivo: Determinar a prevalência das disfunções sexuais femininas em gestantes de baixo risco no terceiro trimestre e verificar sua associação com fatores de risco. Métodos: É um estudo transversal composto por 102 gestantes de baixo risco durante o terceiro trimestre gestacional e com vida sexual ativa, que estiveram em acompanhamento nos postos de saúde das cidades de Petrolina (PE e Juazeiro (BA entre setembro de 2013 e março de 2014. Para isso, utilizou-se uma ficha de dados pessoais, com características sociodemográficas e clínicas e o questionário Female Sexual Function Index (FSFI. Foram calculadas prevalências e possíveis associações por meio do teste do χ2. Em todas as análises foi adotado o nível de significância de p˂0,05. Intervalos de confiança (IC95%, quando determinados, foram exatos. Resultados: Do total da amostra, 45,1% apresentaram disfunção sexual com taxa média de função sexual feminina de 26,15. Os menores escores de domínios foram em desejo e excitação. Ocorreu ainda associação de disfunção sexual com paridade. Conclusão: O presente estudo evidenciou uma taxa moderada de mulheres com disfunção sexual no terceiro trimestre gestacional, mostrando uma diminuição significativa em todos os domínios do FSFI. Além disso, constatou-se diferença estatisticamente significativa na associação de disfunção sexual com a variável paridade. Contudo, não foi encontrada diferença significativa na disfunção sexual com a variável idade, índice de massa corpórea, escolaridade e renda familiar.

  11. Avaliação de dois protocolos farmacológicos em exodontias de terceiros molares inferiores retidos

    OpenAIRE

    Júlio Cesar Leite da Silva

    2011-01-01

    Resumo: A análise das complicações pós-operatórias na remoção de terceiros molares retidos tem sido comumente usada e amplamente aceita como modelo para avaliar a eficácia dos vários fármacos analgésicos e anti-inflamatórios em humanos. Entretanto, ainda não existe consenso na literatura a respeito do melhor protocolo para o controle medicamentoso da dor e/ou inflamação nesse tipo de procedimento. Foi proposta deste estudo randomizado, duplo-cego e cruzado, observar e comparar a eficácia de d...

  12. Anatomy in the Third Reich: Careers disrupted by National Socialist Policies.

    Science.gov (United States)

    Hildebrandt, Sabine

    2012-06-01

    The history of anatomy in the Third Reich is still insufficiently explored, especially concerning its victims. These include not only the victims of the NS regime whose bodies were used in anatomical dissection, but also the Scholars of Anatomy whose careers were disrupted by NS policies. The spectrum of career disruption spanned from short-term suspension from work to death in concentration camps. In this study, the biographies of 462 Scholars of Anatomy were examined. 414 were members of the Anatomische Gesellschaft (Anatomical Society). Eighty-six persons (80 men, 6 women) were identified whose anatomical careers were disrupted by National Socialist policies. Sixty-two of them were members of the Anatomical Society. Their subsequent fate was dependent on the stage of the scholars' careers, their field of expertise, reason for dismissal (i.e. so-called Jewish descent or political dissent), nationality, country of residence or exile. Forty-three scholars emigrated, of whom 6 returned to positions in Germany and Austria after the war. Twenty-one remained in their home countries, of whom 17 were later reinstated in their positions. Twelve scholars were imprisoned, and 5 died in concentration camps. Five fates remain unresolved. As diverse as this group of scholars was, all of them had in common that a criminal regime forced them, being innocent of any crime, out of their position and work. Further work including the exploration of potential archival sources is necessary before a detailed and complete recounting of each individual life is possible. Copyright © 2011 Elsevier GmbH. All rights reserved.

  13. [German neurology and neurologists during the Third Reich: exemplified by research on epilepsy].

    Science.gov (United States)

    Martin, M; Fangerau, H; Karenberg, A

    2016-08-01

    There are only a small number of studies dealing with the impact of eugenic theories and practices on the research of particular neurological diseases during the Third Reich. Thus, this contribution to the special issue on neurology in Germany between 1933 and 1945 focuses exemplarily on epilepsy research. By drawing on primary sources and secondary literature the article tries to reconstruct the scientific discourse of the time and consider the implications for patients. National socialistic ideology was based on eugenic thinking and the implementation of eugenic policies was a major political objective. An immediate effect of this policy was the passing of the Law for the Prevention of Genetically Diseased Offspring (Gesetz zur Verhütung erbkranken Nachwuchses) in 1933. According to this law "hereditary epilepsy" along with various other neurological and psychiatric disorders was regarded as a mandatory indication for forced sterilization. Subsequently, funding of epileptological research was generously increased and extended, e. g. at the German Research Institute (Deutsche Forschungsanstalt) in Munich and the Rheinische Provinzial-Institut in Bonn. The main focus was placed on idiopathic forms of the disease, which were a priori considered as hereditary. At the annual meetings of the Society of German Neurologists and Psychiatrists (Gesellschaft deutscher Neurologen und Psychiater), lectures and debates on epilepsy repeatedly constituted a key topic. Some participants opted for a broad interpretation of "endogeneity" and thus favored an extension of the practice of sterilization but others advocated a more differentiated and restricted attitude. Several neurology researchers showed a penchant for self-mobilization in line with the doctrine of the new government.

  14. Seismic tomography for charaterization of an ore vein in the research and education mine Reiche Zeche

    Science.gov (United States)

    Winter, Sebastian; Schlüter, Ralf; Hlousek, Felix; Buske, Stefan

    2017-04-01

    A test site for the design, implementation and operation of an underground in-situ bioleaching unit has been installed by the „Biohydrometallurgical Center for Strategic Elements" at the research and education mine "Reiche Zeche" of Technical University Bergakademie Freiberg. For this purpose an ore vein block will be developed and mined with the bio-hydrometallurgical in-situ leaching technology. As a site survey an underground seismic tomography experiment has been performed to investigate the spatial distribution of the ore vein within this block consisting mainly of gneiss and with dimensions of about 30 x 10 meters. The experiment was performed with a sledgehammer as source and 76 three-component receivers with source and receiver point intervals of about 1 m surrounding the approximately rectangular block. High precision laser scanning was performed to obtain accurate source and receiver positions which was particularly necessary to obtain reliable results due to the generally high wave velocities of the gneiss. The resulting seismic data set showed a high signal-to-noise ratio with clear first arrivals which were picked for all source and receiver combinations and subsequently used as input to a first-arrival tomographic inversion scheme. The resulting velocity model has very good ray coverage and shows well resolved high- and low-velocity regions within the block. These regions can be clearly assigned to mapped outcrops of the ore vein along the galleries surrounding the block, including a correlation of low velocities to fractured rock parts as well as high velocities to the undisturbed ore vein core, respectively. In summary the obtained velocity model and the inferred spatial distribution of the ore vein provides a good basis for planning and implementing the actual ore mining step using the envisaged bioleaching technology.

  15. Okupeeritud Eestist Saksa Reich'i: täiendusi 1941. aasta järelümberasumise uurimisse / Olev Liivik, Triin Tark

    Index Scriptorium Estoniae

    Liivik, Olev, 1975-

    2016-01-01

    Ümberasustamise operatsiooni allikatest. Saksamaa ja NSV Liidu kokkuleppest välissakslaste järelümberasumise suhtes. Riigisakslastest ja rahvussakslastest, nende jagamisest ümberasujateks ja põgenikeks. Märtsi keskpaigaks 1941 oli enamik järelümberasujaid Saksamaale lahkunud. Järelümberasujate vastuvõtmisest ja käsitlemisest Saksa Reich'is. Mittesakslastest ümberasujad ei olnud Saksa Reich'is oodatud, kuid samal ajal tehti keeruliseks ka nende tagasipöördumine kodumaale

  16. Incentivos ao investimento estrangeiro

    OpenAIRE

    Mendes, Valter Nuno Dias

    2015-01-01

    Dissertação de Mestrado apresentada ao Instituto de Contabilidade e Administração do Porto para a obtenção do grau de Mestre em Contabilidade e Finanças, sob orientação de Doutor José de Campos Amorim O presente estudo tem por tema os Incentivos ao Investimento Estrangeiro ao nível das pessoas singulares: o Regime Fiscal do Residente Não Habitual (RNH) e a Autorização de Residência para Atividade de Investimento (ARI) – Vistos Dourados (Golden Visa), tendo por objetivo a análise mais po...

  17. CONSIDERAÇÕES SOBRE A SOCIOECONOMIA SOLIDÁRIA E O TERCEIRO SETOR

    Directory of Open Access Journals (Sweden)

    Renata Rodrigues da Silva

    2011-08-01

    Full Text Available O capitalismo, embora seja um modo de produção bastante resistente, capaz de enfrentar várias crises e, ainda assim se fortalecer depara-se com formas de resistências, uma vez que esse sistema é sustentado por desigualdades e injustiças. Como exemplo dessas resistências destaca-se a socioeconomia solidária ou economia solidária, que se constitui em uma alternativa de geração de trabalho e renda, buscando a inserção de excluídos social e economicamente na sociedade. Entende-se por socioeconomia solidária, alternativas que visem minimizar problemas relacionados ao desemprego crescente, sendo também uma fonte de geração de renda para parte da população que não é atendida pelo modo capitalista de produção. A prática de socioeconomia solidária constitui-se como um fenômeno antigo, tendo origem com a Revolução Industrial. Porém, observa-se um incentivo maior a esta outra economia a partir das últimas décadas do século XX, principalmente no Brasil, destacando-se o processo de expansão da socioeconomia solidária no país, bem como no estado de Minas Gerais. Neste sentido, o presente trabalho tem como objetivo analisar a atual situação da socioeconomia solidária.

  18. Do Stemhagen, Reich, and Muth Have Ears to Hear and Eyes to See? Toward the Subaltern and Counternarratives in Curriculum Studies

    Science.gov (United States)

    Malewski, Erik

    2013-01-01

    In this essay, I offer a response to Stemhagen, Reich, and Muth's (see EJ1089246) delineation of disciplined judgment. I draw from my latest obsession with epistemologies of ignorance to complicate their focus on disciplinarity with questions over how non-knowledge gets framed and created. I use Suniti Sharma's seven-year study to highlight the…

  19. Controle da ansiedade odontológica: estudo comparativo entre a sedação oral com midazolam e a sedação consciente com a mistura de óxido nitroso e oxigênio em pacientes submetidos à extração de terceiros molares inferiores

    OpenAIRE

    Darklilson Pereira Santos

    2012-01-01

    O objetivo do trabalho foi avaliar comparativamente o efeito do midazolam 7,5 mg administrado por via oral e da sedação consciente empregando óxido nitroso associado ao oxigênio a 50% em pacientes submetidos à extração de terceiros molares inferiores na alteração do nível de ansiedade do paciente por meio da dosagem de cortisol salivar, no nível de saturação de oxigênio, na frequência cardíaca e na pressão arterial, na produção de amnésia anterógrada, além de avaliar as Escalas de Ansiedade D...

  20. Organizações civis: Buscando uma definição para além de ONGs e "terceiro setor"

    Directory of Open Access Journals (Sweden)

    Sobottka, Emil Albert

    2002-01-01

    Full Text Available Nas ciências sociais, a divisão da sociedade em três âmbitos distintos tem uma longa tradição. Vai de regra nessas abordagens os autores partem de uma definição do que seja estado/política e mercado/economia, para agrupar o "restante" num terceiro conjunto que se define pela exclusão: não é nem isso, nem aquilo. Por este procedimento, o terceiro âmbito, seja qual for seu nome, torna-se residual e abarca fenômenos díspares que pouco ou nada têm em comum. Mais limitado em sua pretensão de abrangência, com organizações civis busca-se precisar melhor uma parte importante daquele "terceiro âmbito". Centrado numa abordagem que previlegia os aspectos organizacionais, distingue-se, com base no médium regulador, solidariedade civil (Cohen e Arato, o substrato organizado da esfera pública (Habermas. Dentro das organizações civis, uma nova distinção, com base nas formas que o meio regulador solidariedade assume, permite distinguir organizações civis de fins públicos (altruísmo, de fins coletivos (lealdade e de fins mútuos e de auto-ajuda (reciprocidade. Com estas definições parece ser possível rediscutir ONG's, "terceiro setor" e movimentos sociais sem recorrer a categorias residuais.

  1. O terceiro milênio e o paradigma da informação 10.5007/1518-2924.1999v4n8p35

    Directory of Open Access Journals (Sweden)

    Edilene Vieira Scotti

    1999-01-01

    Full Text Available Reflexão sobre o papel da informação, do conhecimento e das tecnologias de informação na sociedade atual. Discorre sobre as relações da informação com o poder e com a sociedade. Aborda a Sociedade da Informação e os desafios profissionais no terceiro milênio.

  2. Organizações civis: buscando uma definição para além de ONGs e "terceiro setor"

    Directory of Open Access Journals (Sweden)

    Sobottka, Emil Albert

    2002-01-01

    Full Text Available Nas ciências sociais, a divisão da sociedade em três âmbitos distintos tem uma longa tradição. Vai de regra nessas abordagens os autores partem de uma definição do que seja estado/política e mercado/economia, para agrupar o "restante" num terceiro conjunto que se define pela exclusão: não é nem isso, nem aquilo. Por este procedimento, o terceiro âmbito, seja qual for seu nome, torna-se residual e abarca fenômenos díspares que pouco ou nada têm em comum. Mais limitado em sua pretensão de abrangência, com organizações civis busca-se precisar melhor uma parte importante daquele "terceiro âmbito". Centrado numa abordagem que previlegia os aspectos organizacionais, distingue-se, com base no médium regulador, solidariedade civil (Cohen e Arato, o substrato organizado da esfera pública (Habermas. Dentro das organizações civis, uma nova distinção, com base nas formas que o meio regulador solidariedade assume, permite distinguir organizações civis de fins públicos (altruísmo, de fins coletivos (lealdade e de fins mútuos e de auto-ajuda (reciprocidade. Com estas definições parece ser possível rediscutir ONG's, "terceiro setor" e movimentos sociais sem recorrer a categorias residuais

  3. Carta ao Editor

    OpenAIRE

    Correia, Miguel

    2017-01-01

    Exmos. Senhores Editores-Chefe,Li com muito interesse o artigo de Sousa R e colaboradores, intitulado “Que fatores levam ao abandono de crianças do serviço de urgência antes da observação médica?”.

  4. Uma contribuição à história do movimento psicanalítico: a trajetória de Wilhelm Reich

    Directory of Open Access Journals (Sweden)

    Amadeu de Oliveira Weinmann

    Full Text Available O artigo propõe-se a reconstituir a trajetória de Wilhelm Reich na história do movimento psicanalítico através da análise de suas contribuições teórico-clínicas e político-institucionais, realizadas no interior desse movimento no período compreendido entre 1920/34.

  5. Covert Operation ``Sun God'' - History of German Solar Research in the Third Reich and Under Allied Occupation (German Title: Kommandosache ``Sonnengott'' - Geschichte der deutschen Sonnenforschung im Dritten Reich und unter alliierter Besatzung)

    Science.gov (United States)

    Seiler, Michael P.

    Between 1939 and 1945 the Luftwaffe of the Third Reich invested large sums in solar research and the establishment of a chain of solar observatories under the code word “Sun God”. Observations of the different phenomena of solar activity were intended to allow a dependable daily prediction of the best frequency bands for long-range military radio. For the development of these research activities the Luftwaffe used a young astrophysicist, who - being the son of a well-known leftist publisher of the Weimar Republic - did appear not well suited to perform “war decisive research” for the Nazi regime: Karl-Otto Kiepenheuer (1910-1975). Circumventing the usual academic tenure, Hitler's war turned the barely thirty-year-old and up to then rather unsuccessful Kiepenheuer into an influential director of a research institution, which he was to remain for the next three decades as well. This book recounts the history of German solar research in the period 1939-1949, her entanglement with the crimes of the Nazi regime as well as her use by the Western Allies until the founding of the German Federal Republic.

  6. AO Group Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, S

    2005-10-04

    The Adaptive Optics (AO) Group in I Division develops and tests a broad range of advanced wavefront control technologies. Current applications focus on: Remote sensing, High power lasers, Astronomy, and Human vision. In the area of remote sensing, the AO Group leads a collaborative effort with LLNL's Nonproliferation, Arms Control & International Security (NAI) Directorate on Enhanced Surveillance Imaging. The ability to detect and identify individual people or vehicles from long-range is an important requirement for proliferation detection and homeland security. High-resolution imaging along horizontal paths through the atmosphere is limited by turbulence, which blurs and distorts the image. For ranges over {approx}one km, visible image resolution can be reduced by over an order of magnitude. We have developed an approach based on speckle imaging that can correct the turbulence-induced blurring and provide high resolution imagery. The system records a series of short exposure images which freeze the atmospheric effects. We can then estimate the image magnitude and phase using a bispectral estimation algorithm which cancels the atmospheric effects while maintaining object information at the diffraction limit of the imaging system.

  7. Marx no século XXI: uma triste história de adeus ao socialismo ou uma outra coisa?

    Directory of Open Access Journals (Sweden)

    Yann Moullier Boutang

    2012-07-01

    Full Text Available Peter Evans DOI: 10.12957/periferia.2009.3416Há, sob a luz dos infortúnios do último marxismo do século XX, alguma esperança ou futuro para uma análise marxista? Se, por um lado, o marxismo foi claramente afetado pelo declínio do socialismo real, por outro, a emergência de um terceiro tipo histórico de capitalismo renova a importância de Marx ao livrá-lo da política econômica do capitalismoindustrial.

  8. Marx no século XXI: uma triste história de adeus ao socialismo ou uma outra coisa?

    OpenAIRE

    Yann Moullier Boutang

    2012-01-01

    Peter Evans DOI: 10.12957/periferia.2009.3416Há, sob a luz dos infortúnios do último marxismo do século XX, alguma esperança ou futuro para uma análise marxista? Se, por um lado, o marxismo foi claramente afetado pelo declínio do socialismo real, por outro, a emergência de um terceiro tipo histórico de capitalismo renova a importância de Marx ao livrá-lo da política econômica do capitalismoindustrial.

  9. Teenage pregnancy: use of drugs in the third trimester and prevalence of psychiatric disorders Gravidez na adolescência: uso de drogas no terceiro trimestre e prevalência de transtornos psiquiátricos

    Directory of Open Access Journals (Sweden)

    Sandro Sendin Mitsuhiro

    2006-06-01

    a escola, 90,4% estão desempregadas e 92,5% são financeiramente dependentes, 6% usaram drogas durante o terceiro trimestre da gravidez (maconha: 4%, cocaína: 1,7%, ambos: 0,3% e 27,6% tiveram ao menos um transtorno psiquiátrico. Os diagnósticos mais freqüentes foram: depressão (12,9%, transtorno de estresse pós-traumático (10,0% e ansiedade (5,6%. DISCUSSÃO: Famílias desestruturadas, evasão escolar, desemprego e baixa capacitação profissional são fatores que contribuem para a manutenção desta situação socioeconômica desfavorável, cenário no qual são elementos importantes a alta prevalência de uso de cocaína e maconha no 3º trimestre da gravidez e de transtornos psiquiátricos.

  10. A noção de couraça na obra de Wilhelm Reich: publicações de 1920 a 1933

    Directory of Open Access Journals (Sweden)

    Bruno Prates Almeida

    2014-08-01

    Full Text Available L'étude examine la notion de cuirasse dans les 13 premières années, de 1920 à 1933, de l'œuvre du psychanaliste Wilhelm Reich (1897-1957, période pendant laquelle l'auteur était membre de l'International Psychoanalytical Association [Association Internationale de Pschyanalyse]. Question directrice: quel est/ quels sont le/les sens de cuirasse dans la pensée de Reich? Méthode: nous menons des recherches sur les écrits de Reich, psychanalyste à cette époque-là, conformément à la séquence chronologique de la publication des travaux. Résultats: a la cuirasse est mentionnée pour la première fois en 1922, dans l'article Deux types narcissiques, pour indiquer une défense associée au cadre des névroses caractérielles; b en príncipe, elle est conçue dans la sphère psychique, mais graduellement, elle en vient à être considérée dans le cadre somatique également ; c destinée à exercer une fonction protectrice, la cuirasse constitue quelque chose de naturel et d'inévitable, cependant cette structure peut arriver à compromettre le contact avec le milieu interne et externe et elle affecte aussi la régulation libidinale du sujet.

  11. The role of psychopharmacology in the medical abuses of the Third Reich: from euthanasia programmes to human experimentation.

    Science.gov (United States)

    López-Muñoz, Francisco; Alamo, Cecilio; García-García, Pilar; Molina, Juan D; Rubio, Gabriel

    2008-12-16

    German psychiatry and pharmacology both enjoyed an extraordinary international reputation prior to the promulgation of the Third Reich. However, with the triumph of eugenic ideas and the imposition of a "racial hygiene" policy by the Nazi regime, various organs of the German health system saw themselves involved in a perverse system of social control, in which the illicit use of psychopharmacological tools became customary. In the present work, we review, from the historical perspective, the factors that helped to bring about this situation and we analyze the abuses (known and documented) committed through the specific use of psychotropic drugs during the Nazi period. Among such abuses we can identify the following illegitimate activities: the use of psychoactive drugs, mainly sedatives from the barbiturates family, in the different euthanasia programmes implemented by the Nazi authorities, in police activity and various types of repression, and for purely criminal and extermination purposes within the so-called "Final Solution"; psychopharmacological research on the mentally ill, without the slightest ethical requirements or legal justification; and the use of psychotropic agents in research on healthy subjects, recruited from concentration camps. Finally, we refer to the role of poisonous nerve agents (tabun, sarin and soman) as instruments of chemical warfare and their development by the German authorities. Many of these activities, though possibly only a small portion of the total - given the destruction of a great deal of documentation just before the end of World War II - came to light through the famous Nuremberg Trials, as well as through other trials in which specific persons were brought to justice unilaterally by individual Allied nations or by the authorities of the new German government after the War.

  12. Efeito pré-operatório da dexametasona e da metilprednisolona no controle da dor, edema e trismo após cirurgia de terceiro molar: um ensaio clínico randomizado, triplo-cego, boca dividida.

    OpenAIRE

    ALCÂNTARA,Carlos Eduardo Pinto

    2012-01-01

    O objetivo do presente estudo foi realizar uma avaliação comparativa do efeito da dexametasona e da metilprednisolona no controle da dor, edema e limitação da abertura bucal após a extração de terceiros molares impactados. Dezesseis pacientes saudáveis (3 homens e 13 mulheres) com média de 20,3 (DP= 1,25) anos de idade foram submetidos à extração bilateral dos terceiros molares com intervalo de três a quatro semanas entre as duas cirurgias. Uma hora antes de cada procedimento cirúrgico foi ad...

  13. [Involuntary sterilization of men in the Third Reich using the example of the surgical clinic in Göttingen from 1934-1944].

    Science.gov (United States)

    Hansson, N

    2015-04-01

    The German Law for Prevention of Genetically Diseased Offspring (Das Gesetz zur Verhütung erbkranken Nachwuchses) was enacted in 1933. It allowed forced sterilization of patients who had been diagnosed with certain so-called hereditary diseases. Drawing on patient files from the city of Göttingen, this article provides new research results about the practice of forced sterilization of men in the Third Reich. Results show that around 1000 men were sentenced to sterilization by the local hereditary health court (Erbgesundheitsgericht). In this article, some aspects of the operation and "refertilization" are reconstructed.

  14. A dádiva e o terceiro paradigma nas ciências sociais: as contribuições antiutilitaristas de Alain Caillé

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Martins

    Full Text Available Resumo A palavra dádiva tem recepção ambivalente nas ciências sociais, no Brasil, na medida em que sugere, numa leitura superficial, um entendimento religioso e gratuito da doação. Mas a dádiva é um sistema teórico relacional que revela a complexidade das relações sociais no passado e no presente. Este reconhecimento levou Alain Caillé a propor a dádiva como um terceiro paradigma que seria mais complexo que aqueles marcados pelas tradições do individualismo e do holismo. A análise das contribuições deste autor é fundamental para se entender as tendências contemporâneas do debate que é crucial no desenvolvimento da escola francesa de sociologia fundada por Émile Durkheim.

  15. Anatomy in the Third Reich: an outline, part 3. The science and ethics of anatomy in National Socialist Germany and postwar consequences.

    Science.gov (United States)

    Hildebrandt, S

    2009-11-01

    Anatomists in National Socialist (NS) Germany did research on materials from animals and humans, including tissues from the bodies of NS victims. The research was competent but rarely innovative. This may be due to the isolation of the German research community from international developments, as well as to the dismissal of a great number of successful anatomists for racial or political reasons. Other research was unproductive because of its foundation in the pseudoscience of racial hygiene. Anatomists in the Third Reich acted according to a new set of medical ethics favored by the NS regime. Not the individual human being but the "body of the people" as a whole was the object of this ethics. Every action was ethical that ensured the health of the German people, including sterilization, so-called euthanasia, and finally mass murder. Anatomists made use of the opportunities given to them by the NS regime, which led to the postmortem utilization of the bodies of NS victims. After the war, most anatomists retained their positions and NS history was not discussed until the later 20th century. Since then, historical research and public discussions have led to an increased awareness of questions of ethics in anatomy. The history of anatomy in the Third Reich illustrates that the theory and practice of a science is dependent on the political system it exists in, and that the scientists' competence not only in their science but also in politics and ethics is a prerequisite for the freedom of science.

  16. [Staat und Orden. Das Verhältnis des Deutschen Ordens zu den Städten in Livland, Preußen und im Deutschen Reich] / Bernhart Jähnig

    Index Scriptorium Estoniae

    Jähnig, Bernhart, 1941-

    1995-01-01

    Arvustus: Staat und Orden. Das Verhältnis des Deutschen Ordens zu den Städten in Livland, Preußen und im Deutschen Reich, hg. v. Udo Arnold. (Quellln und Studien zur Geschichte des Deutschen Ordens. 4.) Marburg: N. G. Elwert Verlag 1993

  17. [Stadt und Orden. Das Verhältnis des deutschen Ordens zu den Städten in Livland, Preußen und im Deutschen Reich] / Bernhart Jähnig

    Index Scriptorium Estoniae

    Jähnig, Bernhart, 1941-

    1995-01-01

    Arvustus: Stadt und Orden. Das Verhältnis des deutschen Ordens zu den Städten in Livland, Preußen und im Deutschen Reich, hg. v. Udo Arnold. [Quellen und Studien zur Geschichte des Deutschen Ordens. 44; Veröffentlichungen der Internationalen Historischen Kommission zur Erforschung des Deutschen Ordens. 4) Marburg: N. G. Elwert Verlag 1993. VIII, 311 S.

  18. Novos projetos: o que valoriza mais a empresa, recursos próprios ou de terceiros? qual a proporção ótima?

    Directory of Open Access Journals (Sweden)

    José Danúbio Rozo

    2001-12-01

    Full Text Available Este estudo examina os efeitos, no valor da empresa, das alterações da composição dos capitais que financiam um projeto de investimento. A teoria de finanças sobre estrutura de capitais preconiza que diferentes proporções de capitais próprios e de terceiros são inócuas como política de valorização da empresa. O trabalho objetiva examinar os efeitos de diferentes proporções de capitais próprios e de terceiros como fonte de financiamento de um novo projeto hipotético selecionado pela PETROBRAS - Petróleo Brasileiro S.A., mediante simulações, e determinar qual a proporção que maximiza o valor da empresa. O assunto é de interesse de administradores financeiros, analistas financeiros, investidores, credo-res, consultores e estudiosos do assunto, em especial pela conjuntura econômica do país. O tema é desenvolvido com a definição explícita de problema, hipótese, objetivos, metodologia, revisão do referencial teórico, aplicação de uma abordagem teórica específicica a um exemplo e conclusões do estudo. As conclusões indicam a possibilidade de gerenciar a estrutura de capital para financiar um novo projeto de forma a maximizar o valor da empresa.This study exam the effects, in the value of the company, of different proportions of funds that finance an investment's project. The finance theory about capital structure says that different proportions of capital, the ratio debt/equity, don't affect the value of the company. The paper aims to exam the effects of different ratios of debt and equity as a funding of a hypothetical project selected by PETROBRAS - Petróleo Brasileiro S.A., by simulations, and to determine what is the ratio that maximizes the value of de firm. The subject is important for financial managers, financial analysts, investors, lenders, consultants e and researchers, especially because the economic situation of the country. We have developed the theme with the explicit definition of the problem

  19. INTRODUÇAO AOS MODELOS ODE PARTICIPAÇÃO DE MERCADO EM SERVIÇOS DE TRANSPORTES

    Directory of Open Access Journals (Sweden)

    Antonio Galvão Novaes

    2010-04-01

    Full Text Available

    Análises de participação de mercado ("market share" são comuns em estudos na área de "marketing", envolvendo produtos e respectivas marcas, de um lado, o perfil da demanda de outro, e o posicionamento das empresas produtoras que competem nesse mercado, num terceiro bloco. No setor de transportes a literatura registra aplicações em ligações aéreas e em serviços intermunicipais de ônibus. Os modelos de participação de mercado se aplicam normalmente a situações em que os operadores oferecem serviços de transportes similares num determinado mercado, com a competição sendo feita não com base em atributos modais intrínsecos, mas sim apoiada em características diferenciadoras intra-modais mais tênues, tais como conforto, atendimento, promoções tarifárias, "marketing" e propaganda, etc. Neste artigo é feita uma introdução aos modelos de "market share" em transportes, com a apresentação de um exemplo de aplicação ao transporte intermunicipal de passageiros em ônibus, sendo discutidos também aspectos ligados a calibração e tais modelos.

    ABSTRACT

    Market share analysis is common in marketing studies involving products and respective brands, on one hand, the demand profile on the other hand, and the competiting industries on a third set. In the transport sector the literature registers a number of applications to air transport problems and to intercity bus services. Market share models are normally applied to situations in which operators offer, in a specific market, transport services that are similar in nature, with competition based not on intrinsic modal attributes, but rather on more tenous intra-mode differentiating characteristics, such as comfort, attendance, tariff promotions, marketing and advertising efforts, etc (sub-modal configurations. It is presented in this paper an introduction to market share modelling in transport, with an example concerning an intercity bus service in

  20. Retinosquise juvenil ligada ao X

    Directory of Open Access Journals (Sweden)

    Cesar Gomes da Silveira

    2015-08-01

    Full Text Available RESUMO Relatar o caso de um paciente masculino de 28 anos que foi encaminhado ao Centro de Estudos e Pesquisas Oculistas Associados (RJ para avaliação de retina e apresentou os achados típicos de retinosquise juvenil ligada ao cromossomo X: maculopatia cistóide com formação de cistos na fóvea e retinosquise periférica. Foi realizado o manejo conservador, com atenção para as complicações.

  1. [The history of the Kaiser Wilhelm Society during the Third Reich. Interim reports of the president's commission of the Max Planck Society].

    Science.gov (United States)

    Weber, M M

    2002-11-01

    In 1997 the Max Planck Society set up a presidential commission to do research on the historical development of its precursor organization, the Kaiser Wilhelm Society (KWG), during the Third Reich. This paper presents some of the important results given in the interim reports of this commission that are relevant to psychiatry. It focuses on brain research, anthropology, psychiatric genetics, and the role of the well-known biochemist Adolf Butenandt. In general, the interim reports reflect the numerous links between the biomedical research of the KWG and the institutions of the National Socialist (Nazi) state. However, they do not yet allow a final historical assessment as to the complex situation of this field of research during National Socialism.

  2. Uma Relação a Três: O Papel Político e Sociológico do Terceiro no Tratamento dos Conflitos

    Directory of Open Access Journals (Sweden)

    Fabiana Marion Spengler

    Full Text Available RESUMO O presente artigo objetiva discutir o papel político e sociológico do “terceiro” (incluído e excluído na administração, gestão, tratamento e resolução dos conflitos, tomando como base, especialmente, as teorias de Carl Schmitt (papel político e de Georg Simmel (papel sociológico. Posteriormente, a análise se voltará para a necessidade do “terceiro” na construção de um “pluriverso” político que fuja da dualidade universalista e binária na qual se encontram envolvidos os atuais conflitos sociais. Para cumprir o objetivo proposto utilizou-se do método de abordagem hermenêutico no qual se pretende partir da análise de categorias consideradas fundamentais para o desenvolvimento do tema (como o conflito social, e o desenvolvimento do papel do terceiro no tratamento de tais conflitos para então enfrentar o problema propriamente dito. Como método de procedimento utilizou-se o comparativo e como técnica aplicou-se a pesquisa bibliográfica baseada em documentação indireta que serviu de base teórica para o desenvolvimento do estudo.

  3. Modelos de Gestão do Esporte Educacional e Governança no Terceiro Setor: O Real, O Possível e O Ideal

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Castilho Mota

    2015-09-01

    Full Text Available Esse artigo tem por objetivo analisar os princípios da governança no desenvolvimento do modelo de gestão do esporte educacional em uma organização do terceiro setor. Trata-se de um estudo qualitativo, de perspectiva fenomenológica. A coleta de dados foi feita por meio do grupo focal com a equipe de colaboradores e entrevista com a diretora e o gerente do instituto. Essas técnicas permitem coletar dados, a partir das experiências e visões dos participantes, além de propiciar análise dos dados e tratá-los pela análise de conteúdo e apresentados de forma discursiva (Barbour, 2009. Os resultados mostraram que a adoção de boas práticas de governança e a utilização de um modelo de gestão do esporte são valorizados e reconhecidos pelo grupo e pelos parceiros. A pesquisa revela ainda que tanto a governança quanto o uso de modelo de gestão são praticados de forma incipientes nestas organizações e podem auxiliar ONGs do esporte educacional.

  4. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; hide

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  5. Avaliação da angulação dos gérmenes dos terceiros molares através da análise de radiografias panorâmicas

    OpenAIRE

    Vidal, Maria Beatriz Ferreira

    2016-01-01

    Introdução: A avaliação radiográfica da presença, posição e grau de formação do terceiro molar pode ser uma mais-valia na previsão da necessidade de germectomia. Objetivos: Este estudo visa analisar radiograficamente os gérmenes dos terceiros molares, caracterizando a sua presença/ausência e estadio de mineralização (Nolla) e classificá-los de acordo com a sua orientação (classificação de Winter) e angulação. Métodos: Foi realizado um estudo observacional transversal analítico através d...

  6. Medo, ansiedade e controle relacionados ao tratamento odontológico

    Directory of Open Access Journals (Sweden)

    SINGH Kira Anayansi

    2000-01-01

    Full Text Available Nosso objetivo foi avaliar medo, ansiedade e controle relacionados ao tratamento odontológico. Os sujeitos foram 364 crianças da faixa etária de 7 a 13 anos. Três questionários com questões de múltipla escolha foram aplicados em grupos de 10 crianças. O primeiro questionário destinou-se à avaliação do medo ao tratamento odontológico e outras situações. Foi traduzido e adaptado do "Child's Fear Survey Schedule"9 e contém 15 itens. O segundo questionário contém 20 itens relacionados as situações potencialmente produtoras de ansiedade. Foi traduzido e adaptado do "State Trait Anxiety Inventory for Children"16. O terceiro questionário contém 40 itens sendo 20 relacionados ao controle percebido e 20 ao controle desejado e foi traduzido e adaptado do "Child Dental Control Assessment"19. Em relação ao medo e ansiedade, a média dos escores foi mais elevada para o sexo feminino do que para o sexo masculino (P < 0,05. Em relação a idade, as crianças da faixa de 11 a 13 anos revelaram-se em média mais temerosas que as de 7 a 9 anos. Quanto ao controle percebido as crianças mais novas percebem mais controle do que as mais velhas. Em geral os dados indicam que valores mais altos de medo relacionam-se com valores mais baixos de controle percebido. As crianças que tinham realizado tratamento odontológico com anestesia mostraram-se mais temerosas do que aquelas que não foram submetidas a anestesia, o que permite inferir que a etiologia de medo pode relacionar-se a esse procedimento que pode envolver a percepção de incontrolabilidade.

  7. REALIDADE AUMENTADA APLICADA AO DESIGN

    OpenAIRE

    Fernandes, Bruno Chagas Alves; Sánchez, Joaquín Fernández

    2008-01-01

    Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  8. Realidade aumentada aplicada ao design

    OpenAIRE

    Fernández Sánchez, Joaquín

    2008-01-01

    Este artigo apresenta o estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  9. Cometas: Das Lendas aos Fatos

    Science.gov (United States)

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  10. AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.

    Science.gov (United States)

    Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel

    2017-05-01

    Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.

  11. REALIDADE AUMENTADA APLICADA AO DESIGN

    Directory of Open Access Journals (Sweden)

    Bruno Chagas Alves Fernandes

    2008-07-01

    Full Text Available Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  12. The third sector strategy: a bibliometric and correlation analysis on the topic academic approach Estratégia no terceiro setor: uma análise bibliométrica e de correlação sobre a abordagem acadêmica do tema

    Directory of Open Access Journals (Sweden)

    Bernardo Paraiso de Campos Serra

    2013-05-01

    Full Text Available The purpose of this article is to know related to the academic field of strategy-focused organizations in the Third Sector. It was used for this purpose the research method called bibliometric analysis and subsequently a correlation analysis. With the main keywords related to the topic, the survey achieved a return of 105 works in the database Web of Science - ISI Web Of Knowledge. Thus, it was possible to identify the most referenced authors in the field, the most relevant publications and the mainstream media as well as developing a correlation graphic showing the relationship between the work, identifying the trends of studies on the subject. Starting from the bibliometric analysis and correlation, the main contribution of this work is to illustrate the current state of the art on the theme and its gaps. The paper concludes that the theme of the strategy for the Third Sector is a broad field for future research, and that scholars can deepen the question of the peculiarities of these organizations to develop a more specific theme. It is suggested that further research be done also in other databases to corroborate the results obtained.O propósito do presente artigo é conhecer a produção acadêmica relacionada ao campo da estratégia com foco em organizações do Terceiro Setor. Utilizou-se para este fim o método de pesquisa denominado análise bibliométrica e posteriormente uma análise de correlação. Com as principais palavras-chave relacionadas ao tema, a pesquisa obteve retorno de 105 trabalhos na base de dados Web of Science – ISI Web Of Knowledge. Com isso, foi possível identificar os autores mais referenciados no assunto, as publicações mais relevantes e os principais periódicos, além de construir um gráfico de correlação que mostra as relações entre os trabalhos, identificando tendências dos estudos sobre o tema. Partindo da análise bibliométrica e de correlação, a principal contribuição do trabalho

  13. Sobre o ódio ao professor Entrevista com Fernando Penna

    Directory of Open Access Journals (Sweden)

    Fernando Penna

    2016-01-01

    Full Text Available Ao tomar a decisão de pautar o tema da violência para compor o dossiê do terceiro número de Movimento – revista eletrônica de educação da Universidade Federal Fluminense –, o Conselho Editorial elencou um grande número de facetas da violência que historicamente se manifestam física e presencialmente no interior e fora do espaço escolar. O fenômeno relativamente recente das redes sociais e o vertiginoso processo de crescimento de trocas de informação, interação e mediação virtual a ele agregado, não apenas ampliou o espectro da violência como contribuiu decisivamente para articular o dentro e o fora da escola. Dentre outros exemplos, talvez o mais comum e antigo é o registro de cenas reais de alunos e alunas brigando nos pátios escolares ou nas redondezas da instituição postadas nas redes sociais, muitas delas viralizadas – para usar o barbarismoda ocasião – por um número sempre crescente de adeptos do bullying escolar. Nos últimos cinco anos, nas redes sociais, o exemplo de articulação da violência dentro-fora da escola que mais chama a atenção é o ódio ao professor, conforme observa o professor Fernando Penna na entrevista que publicamos a seguir. Estudioso da manifestação reivindicatória por uma escola sem ideologia trazida nos últimos anos por setores conservadores e reacionários da sociedade brasileira, Penna busca oferecer na entrevista algumas hipóteses para compreendermos o fenômeno do ódio ao professor, bem como algumas pistas para apreendermos os fundamentos que movem aqueles setores no combate ao que denominam de doutrinação ideológica de esquerda, e, concluindo, observa a urgência da resistência ao assédio moral feito dos conservadores ereacionários, chamando a atenção para a importância da ampliação do conhecimento crítico sobre o tema.

  14. Tercer sector y univocidad conceptual: necesidad y elementos configuradores Terceiro setor e univocidade conceitual: necessidade e elementos configuradores The third sector and conceptual univocality: necessity and essential elements

    Directory of Open Access Journals (Sweden)

    Julio Jiménez Escobar

    2008-06-01

    Full Text Available En el presente trabajo se destaca la importancia de que exista un concepto unívoco del tercer sector. En primer lugar se justifica esta relevancia conceptual desde un punto de vista epistemológico tanto para el estudio de los hechos sociales (objeto de conocimiento como para la propia configuración de las comunidades científicas (sujeto del conocimiento. En segundo lugar, también se argumenta esta necesidad de univocidad ya que condiciona las diferentes políticas públicas, y porque incide en la interacción de los agentes que contribuyen al cambio social. Por último se abordan los rasgos que pueden delimitar este espacio social propio, por un lado, y a caracterizar las particularidades de las entidades que operan en el mismo, por otro.No presente trabalho destaca-se a importância de que exista um conceito unívoco do Terceiro Setor. Em primeiro lugar, justifica-se esta relevância conceitual desde um ponto de vista epistemológico, tanto para o estudo dos fatos sociais (objeto de conhecimento, quanto para a própria configuração das comunidades científicas (sujeito do conhecimento. Em segundo lugar, argumenta-se também essa necessidade de univocidade já que condiciona as diferentes políticas públicas, e porque incide na integração dos agentes que contribuem para a mudança social. Por último, são abordados os rasgos que podem, por um lado, delimitar este espaço social próprio, e por outro, caracterizar as particularidades das entidades que operam em ele.This study emphasizes the importance of a univocal concept of the third sector. It first justifies the conceptual importance of univocality from a epistemological perspective and for the study of social facts (as an object of knowledge. Secondly, it argues the need for univocality since the concept is relevant to various public policies, and because it influences the integration of agents who contribute to social change. Finally, it looks at the divisions that can both

  15. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube.   Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  16. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-06-01

    Full Text Available Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  17. Human genetics and politics as mutually beneficial resources: The case of the Kaiser Wilhelm Institute for Anthropology, Human Heredity and Eugenics during the Third Reich.

    Science.gov (United States)

    Weiss, Sheila Faith

    2006-01-01

    This essay analyzes one of Germany's former premier research institutions for biomedical research, the Kaiser Wilhelm Institute for Anthropology, Human Heredity and Eugenics (KWIA) as a test case for the way in which politics and human heredity served as resources for each other during the Third Reich. Examining the KWIA from this perspective brings us a step closer to answering the questions at the heart of most recent scholarship concerning the biomedical community under the swastika: (1) How do we explain why the vast majority of German human geneticists and eugenicists were willing to work for the National Socialist state and, at the very least, legitimized its exterminationist racial policy; and (2) what accounts for at least some of Germany's most renowned medically trained professionals' involvement in forms of morally compromised science that wholly transcend the bounds of normal scientific practice? Although a complete answer to this question must await an examination of other German biological research centers, the present study suggests that during the Nazi period the symbiotic relationship between human genetics and politics served to radicalize both. The dynamic between the science of human heredity and Nazi politics changed the research practice of some of the biomedical sciences housed at the KWIA. It also simultaneously made it easier for the Nazi state to carry out its barbaric racial program leading, finally, to the extermination of millions of so-called racial undesirables.

  18. Fifty years after the Nuremberg Nazi Doctors' Trial: reviewing how the laws of the Third Reich applied to individuals with oral clefts.

    Science.gov (United States)

    Wyszynski, D F

    1998-02-01

    The Nazi Doctors' Trial, held in the city of Nuremberg 50 years ago, is a landmark in the history of medicine and science. For the first time, the horrors inflicted by a group of German scientists on innocent victims became widely known. Most of the defendants received sentences that ranged from relatively short imprisonment to death. The Trial also provided elements to develop standards for permissible medical experimentation, known as the Nuremberg Code. The atrocities judged in the Nazi Doctors' Trial, however, were not isolated. They were part of an overall eugenic system that encouraged euthanasia, compulsory sterilization, and selective marriages based on "genetic health" and "racial hygiene." Individuals with oral clefts were considered subject to these laws and suffered their consequences. This paper describes the main features of the Trial, reviews the state of knowledge on oral clefts in the 1930s and 1940s, presents how the laws of the Third Reich impacted the lives of individuals with oral clefts, and speculates on the implications of past and present eugenic policies in the future of humankind.

  19. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  20. A legitimização dos benefícios do Jiu-jtsu em uma organização do terceiro setor: um estudo de caso no Tatame do Bem

    Directory of Open Access Journals (Sweden)

    Arlete Aparecida de Abreu

    2015-01-01

    Full Text Available As organizações do Terceiro Setor enfrentam dificuldades para alcançar legitimação perante a sociedade e com isso não conseguem os recursos necessários para sua sobrevivência e dessa forma não é possível mensurar quais benefícios estão realmente entregando à população. Este artigo se propôs a mostrar a importância de legitimar as organizações do Terceiro Setor, especificamente o Tatame do Bem em Formiga - MG, e identificar quais os benefícios os responsáveis pelos alunos atendidos realmente percebem. Desta forma o artigo buscou compreender a falta de aceitação do esporte como atividade que gera benefícios sociais e propor estratégias para que os benefícios passem a ser reconhecidos pela comunidade e pessoas envolvidas no projeto.Palavras-chave: Terceiro Setor. Legitimidade social. Esporte. The benefits of jiu-jitsu legitimization in anorganization of the third sector: a case study in Tatame do BemABSTRACTOrganizations of the third sector are struggling to achieve legitimacy, and thus do not get the resources needed to survive and cannot even measure what benefits they are actually delivering to the population. This paper aimed to show the importance of legitimizing nonprofit organizations, specifically the "Tatame do Bem" in Formiga - MG and the benefits those responsible for the students served really realize. Thus the article tried to understand the lack of acceptance of the sport as an activity that generates social benefits and also to propose strategies to make the benefits start being recognized by the community and people involved in the project.Keywords: Third sector. Social legitimacy. Sport.

  1. Método digital complementar na avaliação da relação entre terceiros molares inferiores com o canal da mandíbula em adolescentes e aultos jovens

    OpenAIRE

    Silva, Fabiana Caroline da

    2013-01-01

    Resumo: Foi realizado um estudo em uma amostra com 66 terceiros molares inferiores (3°MI) de adolescentes e adultos jovens, com indicação de exodontia bilateral. Foi avaliada a relação entre esses dentes e o canal da mandíbula (CM) em radiografias panorâmicas, com o objetivo de identificar características de proximidade entre eles que possam predispor alterações sensoriais do nervo alveolar inferior, após a remoção cirúrgica. Foram estabelecidos os critérios de Rood (1990) e o estado de rizog...

  2. Efeito preemptivo do ibuprofeno na dor pós-operatória associada à exodontia de terceiro molar : ensaio clínico randomizado duplo-cego cruzado comparando doses múltiplas versus dose única

    OpenAIRE

    Vieira, Sara Katerine

    2015-01-01

    A dor pós-operatória é a causa mais comum de hiperalgesia em humanos e pode ter sua severidade e duração reduzidas através da analgesia preemptiva, tratamento antinociceptivo que previne o processamento alterado de impulsos nervosos responsáveis pela sensibilização central. A literatura sugere que o uso pré-operatório de anti-inflamatórios pode diminuir a intensidade e a duração da dor pós-operatória. Dezenove participantes submetidos à extração de terceiros molares inclusos inferiores bilate...

  3. Description of the third instar larva of Megadytes latus (Fabricius (Coleoptera, Dytiscidae, with an identification key for described larvae of the genus Descrição da larva de terceiro ínstar de Megadytes latus (Fabricius (Coleoptera, Dytiscidae

    Directory of Open Access Journals (Sweden)

    Nelson Ferreira-Jr

    2006-09-01

    Full Text Available The last instar larva of M. latus (Fabricius, 1801 is described and figured, based on reared specimens from Serra dos Órgãos, Teresópolis, state of Rio de Janeiro, Brazil. Some notes on the biotope are provided.A larva de terceiro ínstar de M. latus (Fabricius, 1801 é descrita e ilustrada, baseado em espécimes criados da Serra dos Órgãos, Teresópolis, Rio de Janeiro, Brasil. Algumas notas acerca do biótopo onde as larvas foram coletadas são incluídas.

  4. Espaço-temporalidade, ressemiotização e letramentos : um estudo sobre os movimentos de significação no terceiro espaço

    OpenAIRE

    Camila Lawson Scheifer

    2014-01-01

    Resumo: Esta tese representa uma tentativa de estabelecer teórica e empiricamente possíveis pressupostos para uma pedagogia de letramentos que assuma o espaço como uma prática social - um terceiro espaço - que abarca dimensões tanto materiais quanto simbólicas. Com base em um projeto pedagógico interdisciplinar desenvolvido em uma classe de alunos de quinto ano, o estudo se propõe a gerar uma racionalidade espacial e um conjunto de ferramentas conceituais e analíticas alternativas que nos per...

  5. Diagnosis of AOS: definition and criteria.

    Science.gov (United States)

    Croot, Karen

    2002-11-01

    Presented in this article is a discussion of current progress in behavioral, cognitive, and neuroanatomic definitions of apraxia of speech (AOS). A behavioral definition summarizes the speech symptoms that should be considered diagnostic of AOS with or without co-occurring aphasia and dysarthria. AOS is defined in cognitive terms as an impairment in the translation of phonological representations into specifications for articulation. Progress toward a neuroanatomic definition of AOS will rely on mapping the processes described by increasingly sophisticated cognitive models of normal speech production to the brain. The article describes criteria that have been proposed for differentiating apraxic from phonological and dysarthric disorders and suggests that syndrome-based approaches to the diagnosis of AOS may obscure important differences between individual presentations of apraxic disruption as well as similarities between AOS and other speech-language disorders.

  6. Implante coclear na adolescência: cinco candidatos, cinco percursos ao implante coclear

    Directory of Open Access Journals (Sweden)

    Heloisa Romeiro Nasralla

    2017-02-01

    Full Text Available Introdução: A seleção e adaptação pós-implante coclear em adolescentes é assunto muito discutido entre nós por suas inerentes dificuldades. Objetivo: Avaliar como as condições de personalidade e a dinâmica fami liar interagem no processo de decisão. Método: Mostramos cinco casos díspares no seu conteúdo e condução, o que nos leva à escolha de instrumentos pertinentes a cada um deles: nos dois primeiros somente entrevista com o paciente e sua mãe; no segundo, entrevista com a mãe, WISC, Colúmbia, Bender, provas pedagógicas e Wartegg no paciente, além de atendimentos em psicoterapia breve com ambos. No terceiro, entrevistas com pais e paciente, provas pedagógicas e Wartegg; no quarto, atendimento familiar, HTP e terapia com paciente. Resultados: O primeiro, 22 anos surdez congênita, bilíngue, com identificação bi-cultural, pais separados e discordantes em relação ao implante coclear, no entanto, espelhando-se numa amiga já implantada, o que a motivou para a cirurgia. Bons resultados pós-implante. O segundo, 17 anos, surdez pós-meningite aos quatro meses, maduro, mãe protetora, além de importante fi gura do avô. Bons resultados pós-implante. O terceiro, 13 anos, surdez congênita, família disfuncional que não acolhe seu filho, com desperdício de potencial, recusando- se ao uso de aparelho, rejeitado no momento para o implante. O quarto, 15 anos, surdez pós-meningite com 1 ano e 3 meses, encontra nos pais proteção, voltando- se para eles nos momentos de angústia, aceitando prognóstico limitado. No entanto, pós-implante mostrou- se mais confiante. A quinta, 14 anos, surdez progressiva, à princípio sob o impacto da perda. Há respeito dos pais e sentimentos equivalentes, todos estiveram em processo terapêutico. Foi implantada e teve sucesso. Conclusão: é importante a aceitação da surdez por ambas as partes, desejo do paciente acompanhado de consciência do próprio papel, condições de lidar com

  7. Governança no terceiro setor: estudo sobre uma organização francesa do século XIX [doi: 10.5329/RECADM.20111001003

    Directory of Open Access Journals (Sweden)

    Marco Antonio Figueiredo Milani Filho

    2011-05-01

    Full Text Available RESUMOA elaboração deste trabalho foi motivada pela possibilidade de identificação, na estrutura organizacional de entidades do passado, das práticas e mecanismos de governança atualmente recomendados. O objetivo deste estudo exploratório foi identificar os principais elementos de governança de uma organização do Terceiro Setor do século XIX e compará-los com os atuais elementos relacionados às melhores práticas. Como base comparativa, adotou-se um conjunto de 24 itens de governança recomendados pelo IBGC, adaptados às organizações sem fins lucrativos. Pretendeu-se verificar a conformidade e a atualidade da estrutura de governança da Société Parisienne des Études Spirites - SPEE, a qual foi selecionada por sua relevância histórica e cultural, pois serviu de modelo para a criação de milhares de organizações religiosas semelhantes em todo o mundo. Efetuou-se uma pesquisa bibliográfica sobre os principais aspectos do projeto elaborado em 1868, por Allan Kardec, para a implantação de um conselho administrativo e para o desenvolvimento operacional da SPEE. Analisou-se a presença ou ausência das práticas de governança listadas pelo IBGC. A investigação apontou que 50% dos modernos elementos de governança estavam integralmente contidos na proposta organizacional da SPEE, 25% estavam parcialmente presentes e os demais 25% estavam ausentes, sinalizando a importância com que essas práticas foram tratadas.Palavras-ChaveGovernança; melhores práticas; Sociedade Parisiense de Estudos Espíritas.ABSTRACTThe preparation of this work was motivated by the possibility of identification of currently recommended practices and mechanisms of governance in the organizational structure of historical entities. The objective of this exploratory study was to identify the key elements of governance of an organization of the Third Sector established in the nineteenth century and compare them with current elements relating to best

  8. Prevalência das posições de terceiros molares nos municípios de Cunha Porã, Maravilha e Palmitos, no extremo oeste de Santa Catarina = Third molars classifications prevalence in the cities of Cunha Porã, Maravilha and Palmitos in the Nortwest of Santa Catarina state in Brazil

    Directory of Open Access Journals (Sweden)

    Marzola, Clóvis

    2006-01-01

    Full Text Available O presente trabalho propõe uma análise da prevalência da classificação de terceiros molares, nos municípios de Cunha Porã, Maravilha e Palmitos, no Extremo Oeste de Santa Catarina. Seguiram-se para os terceiros molares superiores e inferiores as classificações já propostas por alguns autores. Foram examinadas 585 ortopantomografias, 210 de pacientes do gênero masculino e, 375 de pacientes do gênero feminino. Um total de 1815 terceiros molares foi verificado, com o dente 18 (450, dente 28 (465, dente 38 (453 e, dente 48 (447. Os pacientes variaram numa faixa etária de 15-39 anos, sendo a maior prevalência de 390 pacientes com idade de 15-20 anos. Obteve-se maior prevalência para os terceiros molares superiores nas posições vertical, distal e medial respectivamente. Para os terceiros molares inferiores as posições vertical, medial e horizontal respectivamente, com a Classe I C

  9. Formação e prática comunitária do psicólogo no âmbito do "terceiro setor" Psychologist's community training and practice at the "third sector"

    Directory of Open Access Journals (Sweden)

    Ilana Lemos de Paiva

    2010-08-01

    Full Text Available O objetivo deste estudo é investigar a prática social do psicólogo no âmbito do "terceiro setor", buscando as estratégias utilizadas no enfrentamento das mazelas da questão social, bem como a formação necessária para atuar no campo. Foram realizadas vinte entrevistas semi-estruturadas com psicólogos que atuam em no "terceiro setor". As entrevistas foram analisadas qualitativamente, à luz da perspectiva crítica, além dos preceitos da Psicologia Comunitária e da Intervenção Psicossocial. A perspectiva defendida neste estudo é que os psicólogos devem intervir profissionalmente de forma proativa buscando o desenvolvimento, a organização e a emancipação das pessoas, grupos e comunidades, promovendo mudanças efetivas nas suas vidas.The purpose of this study is to investigate the social practice of psychologists working at the "third sector", focusing the strategies used to face the wounds of social issues and the professional training required for this practice. Semi-structured interviews were conducted with twenty psychologists working at the "third sector". The interviews were analyzed in a qualitative way using a critical perspective derived from community psychology and psychosocial intervention. We suggest that psychologists should work proactively pursuing the people's, group's and communities' development, organization and emancipation in order to promote real changes in their lives.

  10. Políticas sociais, "terceiro setor" e "compromisso social": perspectivas e limites do trabalho do psicólogo Social policies, "third sector" and "social responsibility": perspectives and limits of practicing psychology

    Directory of Open Access Journals (Sweden)

    Oswaldo Hajime Yamamoto

    2007-04-01

    Full Text Available O presente artigo tem por objetivo discutir as possibilidades e os limites do trabalho do psicólogo no campo do bem-estar social/público e no "terceiro setor". É apresentada uma remissão histórica sobre a inserção do psicólogo no campo social, uma revisão conceitual sobre o significado das políticas sociais no capitalismo monopolista como resposta à "questão social", uma discussão sobre o impacto da reforma neoliberal nas políticas sociais no Brasil hoje, incluindo a questão da emergência do "terceiro setor", como contexto para a discussão dos limites do compromisso social do psicólogo.The purpose of this paper is to discuss the possibilities and the limits of practicing psychology in social welfare services. The limits of the psychologist's practice is discussed considering: 1 the historical development of the profession in social welfare service; 2 a conceptual review on the significance of social policies in monopolist capitalism in facing the "social issue"; 3 a discussion on the impact of the neo-liberal reform of social policies in Brazil, including the emergence of the "third sector".

  11. A Contribuição do Contador para a Gestão das Empresas do Terceiro Setor: uma pesquisa de campo no Distrito Federal Accountant Contribution for the Third Sector Organizations Management: a research field in the Federal District - BrazilLa Contribución del Contador para la Gestión de las Empresas del Tercer Sector: un estudio de campo en el Distrito Federal

    Directory of Open Access Journals (Sweden)

    JÚNIOR, Idalberto José das Neves

    2007-01-01

    Full Text Available RESUMOEm todo o mundo, organizações do Terceiro Setor surgem e ganham importância no cômputo das economias, seja para suprir lacunas da ação governamental ou para concretizar objetivos de solidariedade que não encontram espaço de realização em outros lugares. A necessidade de informações para a gestão mais profissional dessas empresas fez surgir um novo campo de trabalho para o profissional de contabilidade. O objetivo principal deste artigo é discutir as percepções das empresas do Terceiro Setor em relação aos serviços profissionais contábeis e a confrontação desses com a opinião dos contabilistas, por meio de uma pesquisa de campo realizada no Distrito Federal. Os resultados evidenciaram o baixo grau de atendimento das necessidades de informações das empresas do Terceiro Setor pelos serviços contábeis oferecidos, o desconhecimento por parte dos profissionais de contabilidade do que é este setor, em especial, das empresas que o integram, e a existência de um campo de trabalho a ser explorado pelo profissional da contabilidade.ABSTRACTIn the whole world, Third Sector organizations appear and gain importance in the range of the economies, either to supply gaps of the governmental action or to materialize solidarity objectives that do not find space of accomplishment in other places. The necessity of information for a most professional management of these companies made to appear a new field of work for the accounting professional. The main objective of this article is to argue the perceptions of the Third Sector companies in relation to the countable professional services and the confrontation of these with the opinion of the accountants, by a field research carried through in Distrito Federal. The research results had evidenced the low degree of attendance of the necessities of information of the Third Sector companies for the offered countable services, the unfamiliarity on the part of the professionals of

  12. Resistência de biótipos de arroz-vermelho aos herbicidas imazapyr + imazapic e alternativas de controle

    Directory of Open Access Journals (Sweden)

    Rafael Salles Rubin

    2014-10-01

    Full Text Available O uso intenso de herbicidas com o mesmo mecanismo de ação na cultura do arroz (Oryza sativa L. tem selecionado biótipos resistentes, como, por exemplo, o arroz-vermelho (planta daninha resistente aos herbicidas imidazolinonas. Por essa razão, este trabalho foi desenvolvido com o objetivo de avaliar a resistência de arroz-vermelho ao herbicida imazapyr + imazapic, na região sul do Rio Grande do Sul, e o controle do biótipo resistente de arroz-vermelho com os herbicidas alternativos clethodim e glyphosate. Foram realizados três experimentos, em delineamento casualizado, arranjados em esquema fatorial. No primeiro experimento, o fator A testou biótipos de arroz-vermelho [ORYSA 184 (resistente e ORYSA 188 (susceptível], o fator B comparou herbicidas (imazapyr + imazapic, clethodim e glyphosate e o fator C avaliou doses dos herbicidas (0; 0,5; 1; 2; 4; 8; 16 e 32 vezes a dose recomendada. No segundo, compararam-se biótipos de arroz-vermelho e doses do herbicida imazapyr + imazapic (0; 0,5; 1; 2; 4; 8; 16; 32 e 64 vezes a dose recomendada. No terceiro, testaram-se biótipos de arroz-vermelho e doses diferentes do herbicida imazapyr + imazapic para cada biótipo. O biótipo ORYSA 184 é resistente ao imazapyr + imazapic, quando aplicada a dose máxima de registro e estádio indicado. Os herbicidas clethodim e glyphosate, detentores de mecanismos de ação alternativos, controlam o biótipo resistente ORYSA 184 de arroz-vermelho.

  13. Direito e Risco: do Consumo ao Ambiente

    OpenAIRE

    Marques, Carlos Alexandre Michaello

    2014-01-01

    A presente Dissertação tem como tema de investigação “Direito e Risco: do Consumo ao Ambiente”. Para tanto, essa temática foi delimitada através da investigação sobre a capacidade do Direito a partir de uma leitura Sociológica e Antropológica de compreender e promover aprendizagem nas questões que envolvem o Risco como elemento decorrente do Consumo e que externa suas consequências ao Ambiente. Neste sentido, se direcionou a responder ao problema de saber: em que medida é possível e necessári...

  14. ENSINANDO GENÉTICA DE FORMA LÚDICA: UTILIZAÇÃO DE UM JOGO DE TABULEIRO PARA ALUNOS DO TERCEIRO ANO DO ENSINO MÉDIO

    Directory of Open Access Journals (Sweden)

    Liandra Cristine Belló Grösz

    2017-12-01

    Full Text Available O ensino da Genética é considerado, muitas vezes, complexo pela forma tradicional como é tratado – memorização e transmissão de conhecimentos, métodos marcantes no ensino tradicional. Este trabalho apresenta alternativa lúdica ao ensino de Genética para alunos do 3º ano ensino médio de uma escola estadual do município de Sorriso, estado de Mato Grosso, por meio da utilização de um jogo de tabuleiro intitulado “Ludo da Genética”, criado pelos autores e baseado no antigo jogo indiano de ludo Pachisi. Nessa metodologia, o aluno aprende com diversão e relaciona o conteúdo de forma mais curiosa e agradável, além de desenvolver o espírito esportivo saudavelmente. A pesquisa reúne elementos quali-quantitativos, utilizando como instrumento de coleta de dados, dois questionários semiestruturados, aplicados pré e pós jogo aos 98 alunos partícipes da proposta. Os resultados mostraram que o jogo teve boa aceitação pelo professor da disciplina e pelos alunos que o jogaram, considerando os índices de acertos obtidos nas respostas antes e após a aplicação do jogo. Entende-se que o jogo favoreceu a aquisição e internalização de conhecimentos, além de ter promovido lazer e alegria e que materiais didáticos lúdicos são ferramentas fundamentais para os processos de ensino–aprendizagem, pois fortalecem e enriquecem o ato pedagógico.   Palavras-Chave: Genética; jogos didáticos; ensino.

  15. Customer satisfaction and response to AOS

    Science.gov (United States)

    1999-01-01

    Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...

  16. Existe alteração na função dos músculos do assoalho pélvico e abdominais de primigestas no segundo e terceiro trimestre gestacional?

    OpenAIRE

    Moccellin, Ana Silvia; Rett, Mariana Tirolli; Driusso, Patricia

    2016-01-01

    RESUMO O objetivo deste estudo é comparar a função dos músculos do assoalho pélvico no segundo e terceiro trimestre gestacional de primigestas. Foi desenvolvido em duas unidades de Saúde da Família do município de Aracaju (SE). As gestantes foram submetidas a três avaliações da função dos músculos do assoalho pélvico por meio da eletromiografia de superfície: até 16 semanas gestacionais, entre a 24ª-28ª e 34ª-36ª semanas gestacionais. Foram registrados valores de repouso, contrações voluntári...

  17. Produtividade da bananeira ´Prata-Anã´ e ´Grande Naine´ no terceiro ciclo sob irrigação por microaspersão em tabuleiros costeiros da Bahia Yield of banana ´Prata Ana´ and ´Grande Naine´ at the third cycle under microsprinkler irrigation in the coastland of Bahia State

    Directory of Open Access Journals (Sweden)

    Eugenio Ferreira Coelho

    2006-12-01

    Full Text Available O trabalho teve como objetivo definir o regime de irrigação mais adequado para a bananeira no terceiro ciclo, nas condições dos Tabuleiros Costeiros da Bahia. O experimento seguiu o delineamento experimental em blocos casualizados, com quatro repetições e dez tratamentos, em um esquema fatorial 5 x 2, sendo cinco níveis de suprimento de água à cultura e duas cultivares de bananeira, a Prata-Anã (Grupo Prata e a Grande Naine (Grupo Cavendish. Os tratamentos referentes aos regimes de irrigação foram definidos a partir de cinco frações da evapotranspiração da cultura, definidas, por sua vez, pelo produto da evapotranspiração potencial e dos coeficientes de cultura recomendados. O uso da irrigação antecipou a colheita da Grande Naine em relação à Prata-Anã em 45 dias. A lâmina de 415 mm foi considerada mais adequada para ser aplicada à cultivar Grande Naine, enquanto a lâmina de 554 mm foi a mais adequada para a bananeira 'Prata-Anã'. Os coeficientes de cultura tiveram uma amplitude de 0,44 a 0,89 e 0,58 a 1,18 para as cultivares Grande Naine e Prata-Anã, respectivamente.The work had as objective to define the most adequate irrigation system to banana crop in the third cycle under Bahia Coast Tableland conditions. The experiment followed a random block design with four replications and 10 treatments, in a 5 x 2 factorial scheme with five levels of water depths and two banana cultivars: "Prata Anã" (Prata Group and "Grande Naine" (Cavendish Group. The treatments or irrigation systems were defined from five fractions of the crop evapotranspiration, defined by the product of potential evapotranspiration and the recommended crop coefficients. The Grande Naine cultivar was harvested 45 days earlier than the Prata Ana, under irrigation. The irrigation depth of 415 mm was considered the most adequate to be applied to the Grande Naine cv., while the water depth of 554 mm was the most adequate for the 'Prata Anã'. The crop

  18. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Science.gov (United States)

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  19. Effekt einer ad libitum verzehrten fettreduzierten Kost, reich an Obst, Gemüse und Milchprodukten auf den Blutdruck bei Borderline-Hypertonikern

    Science.gov (United States)

    Möseneder, Jutta M.

    2002-01-01

    In der randomisierten, multizentrischen DASH-Studie (Dietary Approaches to Stop Hy-pertension), die unter kontrollierten Bedingungen stattfand, führte eine fettreduzierte Mischkost, reich an Obst, Gemüse und Milchprodukten, bei Borderline-Hypertonikern zu einer signifikanten Blutdrucksenkung. Während der Studienphase wurden Körpermasse, Natrium-Aufnahme sowie Alkoholzufuhr aufgrund der bekannten Einflussnahme auf den Blutdruck konstant gehalten. In der eigenen Pilot-Studie sollte untersucht werden, ob das Ergebnis der DASH-Studie (i) mit deutschen Hypertonikern und (ii) unter habituellen Ernährungs- und Lebensbedingungen mit regelmäßig durchgeführter Ernährungsberatung und ad libitum Verzehr anstelle des streng kontrollierten Studienansatzes bestätigt werden kann. Eine Konstanz der Körpermasse, der Natrium-Urinausscheidung (unter diesem Studienansatz valider als die Aufnahme) und des Alkoholkonsums wurde vorausgesetzt. Die Studienpopulation setzte sich aus 53 übergewichtigen Probanden mit einer nicht medikamentös therapierten Borderline-Hypertonie und ohne Stoffwechselerkrankungen zusammen. Die Studienteilnehmer wurden randomisiert entweder der Idealgruppe mit einer fettarmen Kost reich an Milchprodukten, Obst und Gemüse (ähnlich der DASH-Idealgruppe) oder der Kontrollgruppe mit habitueller Ernährungsweise zugeteilt. Über einen Zeitraum von fünf Wochen wurde den Probanden etwa 50% ihres täglichen Lebensmittelbedarfes entsprechend ihrer Gruppenzugehörigkeit kostenfrei zur Verfügung gestellt. Gelegenheitsblutdruckmessungen und 24h-Blutdruckmessungen, Ernährungs- und Aktivitätsprotokolle, Blut- und Urinproben sowie anthropometrische Messungen wurden vor, während und fünf Wochen nach der Interventionsphase durchgeführt. Die Ergebnisse zeigen, dass in der Idealgruppe keine signifikante Blutdrucksenkung beobachtet werden konnte. Dies lässt sich durch die Tatsache erklären, dass die Lebens-mittel- und Nährstoffaufnahme der deutschen

  20. Os desafios de proteção aos refugiados e migrantes forçados no marco de Cartagena + 30

    Directory of Open Access Journals (Sweden)

    Liliana Lyra Jubilut

    Full Text Available Em dezembro de 2014, o Brasil sediará o encontro denominado Cartagena + 30 em comemoração ao trigésimo aniversário da Declaração de Cartagena sobre Refugiados de 1984. Terceiro encontro regional do processo latino-americano de construção de um regime de proteção a refugiados e migrantes forçados, Cartagena + 30 possui a tarefa de manter o desenvolvimento da proteção a essas pessoas na região. Para tanto, espera-se que a Declaração e Plano de Ação do Brasil - documento que resultará do encontro - seja capaz não apenas de lidar com os atuais desafios de proteção aos refugiados, mas ainda responder às necessidades de apátridas, deslocados internos e outros migrantes forçados. Este artigo descreverá os principais desafios à proteção dos refugiados e migrantes forçados, tentando apontar quais os itinerários para avanços protetivos a partir de Cartagena + 30.

  1. Qual pedagogia para aos alunos em dificuldade escolar? Which pedagogy for students with school difficulties?

    Directory of Open Access Journals (Sweden)

    Marcel Crahay

    2007-04-01

    Full Text Available Repetir o ano não ajuda os alunos com dificuldades. Numerosas pesquisas sobre os efeitos da repetência mostram que em regra geral os alunos fracos que recomeçam o mesmo ano progridem menos que os alunos fracos que são promovidos. Que medidas pedagógicas são necessárias para combater o fracasso escolar? O objetivo deste artigo é proceder a uma revisão do que as pesquisas empíricas revelam sobre os procedimentos mais freqüentemente mencionados como meios de obter um aperfeiçoamento pedagógico. Os primeiros dizem respeito à composição e ao manejo de turmas homogêneas e heterogêneas, de classes grandes ou pequenas, e de grupos de alunos com necessidades específicas; os segundos remetem aos dispositivos de individualização da aprendizagem ou à estratégia oposta, de aprendizagem cooperativa e tutoral; os terceiros são relativos à avaliações formativas, seguidas ou não de ações corretivas. Discutindo o conjunto dos resultados, o autor defende um redirecionamento das pesquisas pedagógicas no sentido de investigar prioritariamente os procedimentos mais genéricos, deixando para casos extremos a mobilização de dispositivos baseados num diagnóstico fino das dificuldades de aprendizagem.To repeat the year does not help students with difficulties. Several studies about the effects of grade repetition show that in general students who do poorly and start again the same school year progress less than weak students who are promoted. Which pedagogical measures are necessary to combat school failure? The aim of this article is to review what empirical studies reveal about the most often mentioned procedures as a means to attain pedagogical improvement. The first procedures relate to the composition and management of homogeneous and heterogeneous groups, small or big classes, and groups of students with specific needs; the second procedures relate to the learning individualization devices or to the opposite strategy of cooperative

  2. O Banco Mundial como referência para a justiça social no terceiro mundo: evidências do caso brasileiro

    Directory of Open Access Journals (Sweden)

    Marília Fonseca

    1998-01-01

    Full Text Available Observando-se a trajetória da cooperação do Banco Mundial com o setor educacional brasileiro ao longo de vinte anos, é perceptível que o Banco vem ampliando suas funções técnicas e financeiras, assumindo um papel cada vez mais político, mediante a formulação de políticas globais e setoriais, as quais tendem a influenciar a agenda dos países credenciados para seu financiamento. O que ressalta, na análise dos documentos políticos, é que os mesmos são respaldados por uma base ideológica e conceitual que imprime uma diretriz redutora e seletiva às políticas sociais dos países credenciados. Constitui objetivo deste estudo, ensejar uma visão sobre a realidade que envolve os projetos internacionais, permitindo que as decisões nesse campo levem mais em conta os resultados concretos da experiência do que a retórica que envolve os acordos.The evolution, during these last twenty years, of the World Bank cooperation with the Brazilian education sector shows that it has extended its actions from technical and financial support to an ever more political role, preparing country and sector policies which have impacted on the decision-making process in the nations requesting the Bank’s financial support. What stands out in political documents is their ideological and conceptual basis set within systemic and "realistic" parameters which have restricting and restraining effects on the walfare policies of the candidate nations. This study seeks to identify the reality of internacional projects, allowing the decision-making process to take into account actual results obtained in Brazil.

  3. De como se chegou ao conceito de Philosophia Christiana

    OpenAIRE

    de Sales, Antônio Patativa

    2012-01-01

    O presente artigo tem por objetivo analisar, na História da Igreja cristã dosprimeiros séculos, o surgimento das idéias e dos motivos que levaram os cristãosa, no encontro com a filosofia pagã (ou helenista), cultivarem e usarem aterminologia: nostra philosophia christiana. Assim, num primeiro instante trataremossobre esse encontro entre a filosofia grega/pagã e a religião cristã primitiva.Na Patrística (grega e latina) do segundo e terceiro séculos, mais precisamente,demonstraremos que já há...

  4. Hitler's Reich Viewed from 1984

    Science.gov (United States)

    Ward, James E.

    1971-01-01

    Viewed within a context of Orwell's 1984," the author's visit to East Germany, and particularly to the Museum for German History, revealed the efforts of an authoritarian regime to manipulate the thoughts and directions of that society to its own advantage. (JB)

  5. Transmissão Vertical Zero: parceria entre o serviço público e o terceiro setor Transmisión Vertical Cero: sociedad entre el servicio público y el Tercer Sector Project Zero Perinatal HIV Transmission: partnership between public and private agencies

    Directory of Open Access Journals (Sweden)

    Janie Maria de Almeida

    2009-01-01

    Full Text Available OBJETIVOS: Divulgar experiência multidisciplinar de parceria entre gestores da rede pública de saúde e organizações não-governamentais voltadas à atenção à gestante HIV positivo; e caracterizar as situações de exposição ao HIV por gestantes atendidas pelo Projeto Transmissão Vertical Zero do Município de Sorocaba - SP. MÉTODOS: Estudo retrospectivo com emprego de fontes documentais, e com levantamento de dados para caracterização sócio-demográfica e situações de exposição ao risco de infecção pelo HIV de 120 gestantes atendidas pelo Projeto, entre 1998 e 2004. RESULTADOS: O compartilhamento de ações entre o público e o terceiro setor constituiu-se em eficiente alternativa de assistência à mulher soropositiva para o HIV, ainda que 56,7% das gestantes desconhecessem a sorologia do parceiro e 73,3% nunca terem usado preservativo. CONCLUSÃO: A parceria contribuiu para a redução da transmissão vertical do HIV em Sorocaba - SP.OBJETIVOS: Divulgar la experiencia multidisciplinaria de sociedad entre gestores de la red pública de salud y organizaciones no gubernamentales dirigidas a la atención de la gestante VIH positivo; y caracterizar las situaciones de exposición al VIH por gestantes atendidas por el Proyecto Transmisión Vertical Zero del Municipio de Sorocaba - SP. MÉTODOS: Se trata de un estudio retrospectivo realizado con el empleo de fuentes documentales, y con el levantamiento de datos para caracterización socio-demográfica y situaciones de exposición al riesgo de infección por el VIH de 120 gestantes atendidas por el Proyecto, entre 1998 y 2004. RESULTADOS: El compartir acciones entre el público y el tercer sector se constituye en una eficiente alternativa de asistencia a la mujer seropositiva para el VIH, aunque el 56,7% de las gestantes desconociese la serología de la pareja y el 73,3% nunca haya usado preservativo. CONCLUSIÓN: La sociedad contribuyó a la reducción de la transmisión vertical

  6. Gorgonids from Curaçao Island

    NARCIS (Netherlands)

    Gordon, Isabella

    1925-01-01

    This report contains an account of a collection of Gorgonids made by Dr. C. J. VAN DER HORST at the island of Curaçao and also of a few specimens collected in the same locality by Ir. G. J. H. MOLENGRAAFF. The Majority of the specimens are taken from Caracas bay at a depth of not more than five

  7. Estados Unidos: do Iraque ao Brasil

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-12-01

    Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.

  8. Cisto dentígero: relação entre imagem radiográfica do espaço pericoronário e laudo histopatológico em terceiros molares inclusos

    Directory of Open Access Journals (Sweden)

    Marileia Alves

    2015-02-01

    Full Text Available Justificativa: O Cisto Dentígero é uma patologia benigna que se origina pela separação do folículo da coroa de um dente incluso, sendo o tipo mais comum de cisto odontogênico de desenvolvimento. Objetivo: O objetivo deste trabalho foi verificar a relação entre o espaço pericoronário e laudo histopatológico, através de exames radiográficos e histopatológicos dos folículos no diagnóstico de cisto dentígero em terceiros molares inclusos, de pacientes do Curso de Atualização em Cirurgia Oral Menor no Centro de Estudos Odontológicos Meridional – CEOM (Passo Fundo, RS-BR. Metodologia: Foram analisados 18 laudos histopatológicos e radiografias panorâmicas de pacientes submetidos à exodontia de terceiros molares inclusos. Foi realizada mensuração das imagens radiolúcidas pericoronárias no exame radiográfico, utilizando como parâmetros medidas iguais ou superiores a 2,5 mm. Resultados: Os resultados mostraram que 11,11% da amostra foram diagnosticados como cisto dentígero. O gênero feminino foi o mais afetado (83% e foi predominante em pacientes da cor branca (100%. Os dois casos diagnosticados como cisto dentígero foram mais prevalentes entre a segunda e a terceira década de vida. Conclusão: Concluiu-se que a medida de 2,5 mm para o halo radiolúcido foi pouco significativa para o diagnóstico de cisto dentígero. Para o diagnóstico diferencial devem ser analisados dados clínicos, histopatológicos e radiográficos, sendo necessários outros estudos, com um maior número de amostras para um resultado mais preciso.

  9. AoB PLANTS: origins and features.

    Science.gov (United States)

    Jackson, Michael B

    2009-01-01

    AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access helps sidestep library budgets which are struggling to purchase the increasing numbers of journals. Open Access makes research freely available both to the academic community and beyond while publishing online only eliminates the need to reject good manuscripts simply to control the size of the printed journal. Finally, the journal chose to go OA to ensure the widest possible international readership for the growing amount of high-quality plant science research being carried out worldwide in response to problems such as climate change and food shortages. Responses to a wide-ranging online questionnaire indicated strong international support for a journal such as AoB PLANTS. AoB PLANTS strives for fair and rapid peer review followed by fast publication of accepted papers. For an initial period, there will be no OA fees, and fees will remain modest once introduced. AoB PLANTS adopts double-blind peer review using published criteria for acceptability as a basis for decision-making. Accepted papers are published shortly after acceptance together with referees' analyses using Stanford University Libraries High Wire Press H2O platform. Authors retain ownership of the copyright in their papers.

  10. Sensibilidade da rosa 'Osiana' ao etileno

    OpenAIRE

    Delaine Cristina Cordeiro; Fernando Luiz Finger; Joice Simone dos Santos; Juliane Karsten; José Geraldo Barbosa

    2011-01-01

    Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida) à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando expos...

  11. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  12. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    Directory of Open Access Journals (Sweden)

    Jesús Ballesteros

    2008-04-01

    Full Text Available O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  13. Diferentes metodologias aplicadas ao ensino de astronomia no Ensino Médio

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2009-03-01

    O presente trabalho de intervenção foi realizado junto à Escola Estadual Colònia dos Pescadores na cidade de Caraguatatuba, com très turmas do terceiro ano do Ensino Médio, envolvendo 119 alunos com idades entre 16 e 19 anos. A fase inicial foi composta de um questionário de vinte questíes dissertativas e objetivas, aplicado pelo professor titular da sala, que era o mesmo nas très turmas, para diagnosticar nos educandos os conceitos prévios sobre Astronomia e, partindo destes realizar um trabalho de intervenção nas classes envolvidas utilizando, em cada uma, metodologias diferentes: (A) sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervençíes necessárias; (B) de forma tradicional, com auxílio de multimídias para desenvolvimento das aulas e a terceira (C) tradicional, fazendo uso exclusivo de lousa e giz. Ao final do trabalho os alunos responderam novamente o questionário inicial para diagnosticar dentre as très metodologias utilizadas qual apresentou melhores aplicaçíes, os resultados iniciais foram comparados com os finais. Quando questionados a respeito do significado de Astronomia observou-se inicialmente que os acertos na turma A foram de 100%, turma B: 64%, turma C: 84%, após a intervenção os acertos foram: 100%, 97% e 85% respectivamente, demonstrando que houve um avanço significativo na turma B, a turma A manteve seu índice e a turma C evoluiu, porém não tanto quanto a B. Quando interrogados sobre quantos planetas vocè acha que existem em nosso Sistema Solar? os acertos foram: turma A: 39%, turma B: 48% e turma C: 46%, após o desenvolvimento do trabalho os acertos foram 94%, 97% e 90% respectivamente. Dentro das respostas obtidas observa-se que a metodologia tradicional com o auxílio de multimeios, aplicada na turma B, demonstrou melhores resultados, sendo a mais significativa. Outra conclusão muito importante é que apesar de o tema Astronomia ser amplamente

  14. ROBO-AO M DWARF MULTIPLICITY SURVEY

    Science.gov (United States)

    Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica

    2018-01-01

    We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.

  15. Deformable mirror designs for extreme AO (XAO)

    Science.gov (United States)

    Cavaco, Jeffrey; Wirth, Allan

    2014-08-01

    One of the science missions for the next generation of extremely large ground based telescopes (30-42m apertures) is the imaging and spectroscopy of exoplanets. To achieve that goal an Adaptive Optics (AO) subsystem with a very large number of corrected modes is required. To provide contrast ratios in the range of 10-9 or better for a 42m telescope an AO system with 25,000 to 60,000 channels will be needed. This is approximately an order of magnitude beyond the current state of the art. Adaptive Optics Associates Xinetics has developed the Photonex Module Deformable Mirror (DM) technology specifically to address the needs of extreme AO for high contrast applications. A Photonex Module is a monolithic block of electrostrictive ceramic in which a high density of individually addressable actuators are formed by screen printing of electrodes and partial wire saw cutting of the ceramic. The printed electrode structures also allow all electrical connections to be made at the back surface of the module via flex circuits. Actuator spacings of 1mm or less have been achieved using this approach. The individual modules can be edge butted and bonded to achieve high actuator count. The largest DMs fabricated to date have 4096 actuators in a 64X64mm array. In this paper the engineering challenges in extending this technology by a factor of ten or more in actuator count will be discussed. A conceptual design for a DM suitable for XAO will be presented. Approaches for a support structure that will maintain the low spatial frequency surface figure of this large (~0.6m) DM and for the electrical interface to the tens of thousands of actuators will be discussed. Finally, performance estimates will be presented.

  16. Estado nutricional materno, ganho de peso gestacional e peso ao nascer Maternal nutritional status, gestational weight gain and birth weight

    Directory of Open Access Journals (Sweden)

    Adriana Suely de Oliveira Melo

    2007-06-01

    Full Text Available INTRODUÇÃO: Tanto o estado nutricional materno como o ganho de peso gestacional vem sendo estudado em relação ao papel determinante que desempenham sobre o crescimento fetal e o peso ao nascer. O peso inadequado ao nascer é uma das grandes preocupações da saúde pública devido ao aumento da morbimortalidade no primeiro ano de vida e ao maior risco de desenvolver doenças na vida adulta, tais como a síndrome metabólica, nos casos de baixo peso, e diabetes e obesidade, nos casos de macrossomia. O objetivo deste trabalho foi descrever uma coorte de gestantes, classificando-as de acordo com o estado nutricional inicial, o ganho ponderal gestacional, a resistência nas artérias uterinas e o peso dos recém-nascidos. MÉTODOS: foi acompanhada, a cada quatro semanas gestacionais, uma coorte de 115 gestantes atendidas pelo Programa de Saúde da Família do município de Campina Grande, PB. O estado nutricional inicial foi determinado através do índice de massa corporal (kg/m² para a idade gestacional, e as gestantes classificadas de acordo com os critérios de Atalah. Na 20ª semana, foi estudada a resistência das artérias uterinas, através da dopplervelocimetria. RESULTADOS: o estado nutricional inicial mostrou uma alta prevalência de sobrepeso e obesidade (27%, e uma prevalência significante de desnutrição (23%. Um alto percentual de gestantes ganhou peso excessivo tanto no segundo (44% como no terceiro trimestre (45%. A distribuição do peso ao nascer, indicou uma incidência de 10% de baixo peso e de 9% de macrossomia. Observou-se ainda, uma alta prevalência de incisuras nas artérias uterinas.INTRODUCTION: Maternal nutritional status and gestational weight gain have been addressed because of their importance to fetal growth and birth weight. Inadequate birth weight is a major concern to public health given it has been associated with increasing morbidity-mortality during the first year of life and with increased risks of

  17. Epidemiologia da tricomoniose e sensibilidade ao metronidazol

    OpenAIRE

    Alves, Maria José Gonçalves

    2006-01-01

    A Trichomonas vaginalis é o agente etiológico da tricomoniose, a doença sexualmente transmissível (DST) não viral mais comum no mundo. Actualmente é sabido que promove a transmissão do vírus do HIV, é causa de baixo peso em bebés, bem como de nascimentos prematuros, predispõe mulheres a doença inflamatória pélvica atípica, neoplasia cervical e infertilidade. Acresce ao problema o facto de serem usadas metodologias de diagnóstico com baixa sensibilidade e ainda o aumento de c...

  18. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  19. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    OpenAIRE

    Mónica Brinquinho; Ana Andresa Sousa; Janine Resende; João Valente

    2017-01-01

    O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores ...

  20. O TEMA DA JUSTIFICAÇÃO NAS CARTAS AOS ROMANOS E AOS GÂLATAS

    Directory of Open Access Journals (Sweden)

    James N. F. Alisson

    1990-01-01

    Full Text Available Uma das dificuldades para entender a doutrina de Paulo sobre a justificação é o fato de esse tema constar em escritos que retomam a exposição anteriormente apresentada em forma oral à comunidade cristã da Galácia e de Roma. Ele escreve aos destinatários com a finalidade de esclarecer assunto anteriormente explicado. É o que se vê nas referências ao quérigma que recordam o primeiro anúncio da salvação em Cristo, já comunicado aos destinatários em outra ocasião. O uso freqüente da fórmula "acaso não sabeis?" é indício do conhecimento que os destinatários têm sobre o assunto.

  1. Estágio de mineralização dos terceiros molares e sua relação com a idade cronológica: uma amostra da população do Centro-Oeste do Brasil

    Directory of Open Access Journals (Sweden)

    Alyne de Carvalho GUNDIM

    Full Text Available INTRODUÇÃO: Nos últimos anos, alguns estudos foram conduzidos com o objetivo de avaliar a aplicabilidade da análise de desenvolvimento dos terceiros molares na estimativa da idade humana. No entanto, há escassez de trabalhos em amostras populacionais da região Centro-Oeste do Brasil.OBJETIVO: Avaliar a relação entre estágio de desenvolvimento dos terceiros molares inferiores e a idade cronológica de indivíduos da região Centro-Oeste do Brasil.MATERIAL E MÉTODO: Trata-se de um estudo observacional transversal, com uma amostra constituída por 120 prontuários de pacientes entre 5 e 22 anos de idade, dos gêneros masculino e feminino, atendidos entre os anos de 2007 e 2012 na nossa instituição. O estágio de desenvolvimento dos terceiros molares inferiores foi avaliado pelo método descrito por Nolla e relacionado à idade cronológica do indivíduo por meio de regressão linear, sendo considerados significantes valores de tendência linear entre 0 e 1.RESULTADO: Pode-se observar que tanto a amostra composta por pacientes do gênero masculino (R2 = 0,7495 quanto do feminino (R2 = 0,8507 apresentaram correlação linear entre o estágio de desenvolvimento dos terceiros molares inferiores e a idade cronológica. Notou-se, ainda, que os estágios de desenvolvimento coincidiram com idades semelhantes em ambos os gêneros.CONCLUSÃO: Há relação entre a idade cronológica e o estágio de desenvolvimento dos terceiros molares inferiores na amostra estudada. Estes dados sugerem que este tipo de análise deve ser individualizada, de acordo com as características populacionais da região.

  2. Fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes

    OpenAIRE

    Morais, Caroline Neves de

    2015-01-01

    O excesso de peso e o ganho ponderal estão associados a um conjunto complexo de fatores que atuam desde a vida fetal. O presente estudo teve como objetivo verificar os fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes. Trata-se de um estudo realizado com dados secundários de uma pesquisa de corte transversal que envolveu 967 mães e lactentes do estado de Pernambuco. Na caracterização do estado nutricional utilizou-se o índice de massa corporal para ...

  3. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  4. Nefrocalcinose associada ao uso de esteroide anabolizante

    Directory of Open Access Journals (Sweden)

    Weverton Machado Luchi

    2015-03-01

    Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.

  5. Escala de valores relativos ao trabalho : EVT

    Directory of Open Access Journals (Sweden)

    Porto Juliana Barreiros

    2003-01-01

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  6. Escala de valores relativos ao trabalho: EVT

    Directory of Open Access Journals (Sweden)

    Juliana Barreiros Porto

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  7. Análise comparativa entre os anestésicos locais Articaína 4% e Prilocaína 3% na extração de terceiros molares retidos em humanos - DOI: 10.4025/actascihealthsci.v26i2.1588 Comparative analysis between the local anesthesics Articaine 4% and Prilocaine 3% on human third molar removals - DOI: 10.4025/actascihealthsci.v26i2.1588

    Directory of Open Access Journals (Sweden)

    Josmar Mazucheli

    2004-04-01

    Full Text Available Os anestésicos locais são as drogas mais utilizadas na Odontologia. São utilizados com freqüência na clínica cirúrgica, sendo de grande ajuda para o cirurgião, visto que a dor tem sido descrita como uma experiência desagradável, tanto em nível sensorial quanto psicológico. O objetivo deste estudo foi adquirir mais conhecimento a respeito da articaína a 4% com adrenalina (Articaine®, além de compará-la clinicamente com a prilocaína 3% com felipressina (Prilonest®. Os anestésicos foram administrados em 21 cirurgias, nas quais, em 8, utilizou-se articaína e, em 13, prilocaína, para remoção de terceiros molares semi-retidos, superior e inferior. Como medicação pré-cirúrgica, foram administradas, uma hora antes, 4 mg de Dexametasona e, no pós-operatório, Dipirona 500 mg, 35 gotas, em caso de necessidade. Foram registrados tempo de latência, duração da cirurgia, duração de efeito do anestésico, efeitos colaterais e quantidade de analgésicos consumidos. Os dados referentes à articaína mostraram-se semelhantes aos encontrados na literatura.The local anesthesics are the most used drugs in Dentistry. They are frequently used in surgery, because pain has been described as an unpleasant experience, both on sensorial and psychological levels. The aim of this study was to obtain further knowledge about articaine 4% as well as to compare the effects of local anesthesics articaine with adrenaline 4% (Articaine® and prilocaine with felipressine 3% (Prilonest®. The anesthesics were used in 21 surgeries, 8 articaine and 13 prilocaine, to remove semi-retained eruption of upper and lower third molar. Pre-surgery medication was administrated one hour before: Dexamethasone 4 mg and 35 drops (Dipyrone 500 mg in post-surgery when needed. Onset of anesthesia, surgery duration, length of anesthesics effects and adverse reaction were observed, as well as the quantity of pain killers used. Data on articaine were similar to the ones

  8. Susceptibility of Aedes aegypti larvae to temephos and Bacillus thuringiensis var israelensis in integrated control Susceptibilidade de larvas de Aedes aegypti ao tratamento integrado com temephos e Bacillus thuringiensis var israelensis

    Directory of Open Access Journals (Sweden)

    Carlos Fernando S. de Andrande

    1991-06-01

    Full Text Available The susceptibility of field collected Aedes aegypti larvae was evaluated in terms of median lethal time (LT50 and final mortality, when treated with temephos, Bacillus thuringiensis var israelensis as well as mixtures of these two agents. Third instar larvae were shown to be more susceptible than early and late fourth instar ones to the entomopathogen. Survival of some individuals when exposed to temephos suggest possible resistance. Temporal synergism in early fourth instar larvae was detected when they were exposed to mixtures of Bti-temephos. The possibility of this integrated treatment is commented on.A susceptibilidade de larvas de Aedes aegypti coletadas no campo foi avaliada em termos do tempo letal mediano (TL50 e da mortalidade final, quando tratadas com temephos, Bacillus thuringiensis var israelensis ou misturas desses dois agentes. As larvas de terceiro estádio mostraram-se mais suceptíveis ao patógeno do que aquelas no início ou no fim do quarto estádio. A sobrevivência de alguns indivíduos aos tratamentos com temephos permite sugerir a possibilidade de resistência. Foi detectada a existência de sinergismo temporal, quando larvas no início do quarto estádio foram tratadas com as misturas do Bti com o temephos. A possibilidade do tratamento integrado é comentada.

  9. Diferentes Metodologias Aplicadas ao Ensino de Astronomia

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2007-08-01

    Espera-se que o educando ao final da educação básica, adquira uma compreensão atualizada das hipóteses, modelos e formas de investigação sobre a origem e evolução do Universo em que vive. O presente trabalho tem como principal objetivo compreender dentre três práticas pedagógicas adotadas no Ensino de Astronomia, na terceira série do Ensino Médio, da Escola Estadual Colônia dos Pescadores, qual melhor cumpre o papel de formação e aprendizagem para vida. A pesquisa preliminar foi através de um questionário onde o intuito foi diagnosticar o conhecimento já existente acerca do tema em questão. O questionário é composto de vinte questões dissertativas e objetivas, onde os educandos das três turmas envolvidas o responderam. Este trabalho utiliza as seguintes metodologias: a tradicional, onde o professor é um repassador de informações, fazendo uso exclusivo de lousa e giz; a segunda também de forma tradicional, porém com auxílio de multimídia para desenvolvimento das aulas e aterceira sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervenções necessárias. Ao final do trabalho os alunos responderão novamente o questionário inicial para diagnosticar dentre as três metodologias utilizadas qual apresentou melhor resultado. Os resultados preliminares obtidos, já podem ser observados e, dos 119 alunos entrevistados, as respostas obtidas são as mais diversas e evidenciam que a grande maioria nunca teve em sua vida escolar o tema Astronomia. Ao serem questionados se já haviam estudado Astronomia as respostas foram: turma A: sim 43%; turma B: sim: 21%; turma C: sim: 24%. Porém quando questionados a respeito do significado de Astronomia observou-se que: turma A: 100% de acertos; turma B: 64% acertos; turma C: 84% de acertos, demonstrando claramente a aprendizagem em diferentes esferas, não dependendo unicamente da escola. Até o presente momento, verificou-se que há interesse em

  10. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    Directory of Open Access Journals (Sweden)

    Mónica Brinquinho

    2017-06-01

    Full Text Available O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores pretendem chamar a atenção para o consumo destes fármacos, particularmente frequente em indivíduos jovens, praticantes de desporto amador.

  11. Acesso ao aborto e liberdades laicas

    Directory of Open Access Journals (Sweden)

    Roberto Arriada Lorea

    2006-12-01

    Full Text Available Enfrentar o tema do aborto no Brasil requer uma perspectiva laica, na medida em que a liberdade de consciência assegurada na Constituição Federal impõe ao Estado contemplar não apenas as diferentes visões oriundas de distintas religiões, mas, principalmente, assegurar o direito à diversidade existente no seio de uma mesma religião, garantindo o direito de divergir da hierarquia de sua própria igreja. Assim, não havendo obstáculo jurídico à descriminalização do aborto no país, resta aos legisladores reformar a lei vigente, para descriminalizar o aborto, atendendo os compromissos assumidos pelo Brasil perante organismos internacionais de proteção dos direitos humanos e assegurando a eficácia das liberdades laicas.In Brazil, face an issue like abortion requires a lay perspective considering that the freedom of conscience assured by the Federal Constitution lays upon the State the need to look not only at different views from different religions but specially assure the right to the existing diversity within the same religion, as well as, the right to diverge from the hierarchy of his/her own religion. Therefore there is no legal barrier for the decriminalization of abortion in the country. It is up to the legislators to reform the present law to decriminalize abortion, assuming the commitments made by Brazil upon international organizations for the protection of the human rights assuring the efficacy of lay liberties.

  12. Review of AO calibrations, or how to best educate your AO system

    Science.gov (United States)

    Kolb, Johann

    2016-07-01

    If the Real-Time Computer is the heart of an AO system, the Wavefront Sensor (WFS) its eyes, the Deformable Mirror (DM) its hands and the control strategy its nervous system, the sum of all those parts is made into a harmonious entity thanks to calibrations. This paper does not have the ambition to provide an overview of all the currently existing calibration strategies, but rather to focus on a few challenging problems and their recent evolution in the era of adaptive telescopes, mostly based on the experience of ESO's Adaptive Optics Instruments in general and the AO Facility in particular. Single most important calibration in post-focal AO system, the recording of the Interaction Matrix (IM) between WFS and DM has since long evolved to use fast modulation techniques, has shown to be feasible on-sky and is now almost free from measurements thanks to its pseudo-synthetic generation, quasi-mandatory solution in an adaptive telescope. Pseudo- because it requires an unprecedented knowledge of the components' characteristics, especially the WFS, DM and the optical registration between the two. Bigger telescopes and the use of Laser Guide Stars (LGS) also mean that the properties of the system will change in time and thus need to be constantly updated thanks to online diagnosis tools for spot size measurement, atmosphere monitoring, Wavefront Sensing and control optimization. New loops come into play like the one to minimize LGS Jitter and the one taking over the telescope active optics by means of offloading the DM low orders, and they all require calibration. More calibration means more time and one has to carefully balance the calibrations that require precious telescope night time, day time or for the best, no telescope time at all. Their importance sometimes underestimated, calibrations have repeatedly shown to be a vital part in the optimum functioning of present and future AO systems.

  13. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  14. A propaganda do crime em filmes policiais nazistas

    Directory of Open Access Journals (Sweden)

    Luiz Nazario

    2009-10-01

    Full Text Available Os crimes mais comuns nos filmes policiais nazistas eram a sedução de mulheres, a falsificação de valores, o roubo de documentos e de inventos alemães, a fraude que prejudicava o povo e, sobretudo, o furto de jóias. Os criminosos eram representados com características físicas semelhantes: adiposos, olhar mortiço e sensual, com bigode ornando lábios carnudos. Tais biótipos eram largamente associados aos judeus nas caricaturas antissemitas (nazistas e pré-­nazistas, amplamente difundidas nas mídias impressas do Terceiro Reich.

  15. Directly Imaging Planets with SCExAO: First Results

    Science.gov (United States)

    Currie, Thayne M.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kudo, Tomoyuki; Uyama, Taichi; Garcia, Eugenio

    2017-01-01

    We present the first science results from the newly commissioned Subaru Coronagraphic Extreme Adaptive Optics project, an experimental system dedicated to image faint jovian planets around nearby stars. SCExAO is now achieving true extreme AO capability. We describe the typical performance of SCExAO, the first images of benchmark exoplanets and planet-forming disks, and SCExAO’s first science results. Finally, we briefly chart the path forward for SCExAO to achieve its full scientific capability, including imaging mature planets in reflected light.

  16. Photon counting arrays for AO wavefront sensors

    CERN Document Server

    Vallerga, J; McPhate, J; Mikulec, Bettina; Clark, Allan G; Siegmund, O; CERN. Geneva

    2005-01-01

    Future wavefront sensors for AO on large telescopes will require a large number of pixels and must operate at high frame rates. Unfortunately for CCDs, there is a readout noise penalty for operating faster, and this noise can add up rather quickly when considering the number of pixels required for the extended shape of a sodium laser guide star observed with a large telescope. Imaging photon counting detectors have zero readout noise and many pixels, but have suffered in the past with low QE at the longer wavelengths (>500 nm). Recent developments in GaAs photocathode technology, CMOS ASIC readouts and FPGA processing electronics have resulted in noiseless WFS detector designs that are competitive with silicon array detectors, though at ~40% the QE of CCDs. We review noiseless array detectors and compare their centroiding performance with CCDs using the best available characteristics of each. We show that for sub-aperture binning of 6x6 and greater that noiseless detectors have a smaller centroid error at flu...

  17. A VIA DEMOCRÁTICA AO AUTORITARISMO

    Directory of Open Access Journals (Sweden)

    Paulo César Nascimento

    2013-09-01

    Full Text Available Este artigo analisa as teorias de Aristóteles, Tocqueville e Hannah Arendt a respeito de como alguns aspectos da democracia como a busca do igualitarismo e o voto majoritário podem conduzir ao despotismo. Examinando os casos da democratização da Rússia pós-comunista e o sistema político da Venezuela durante a presidencia de Hugo Chavez, o texto procura demonstrar a importância das idéias daqueles pensadores para a compreensão de regimes autoritários legitimados pelo voto popular. --- The democratic route of autoritarism This article reviews the theories of Aristotle, Tocqueville and Hannah Arendt with respect to some elements of democracy such as the pursue of egalitarianism and the reliance on the will of the majority that can lead to despotism. On the basis of post-communist Russia’s transition to democracy and Venezuela’s political system under the presidency of Hugo Chavez, the article shows the importance of those thinker’s insights to understand current authoritarian regimes which rely on popular vote. keywords: democracy, autoritarian regimes, voting.

  18. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  19. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  20. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  1. A formação do arte/educador que atua com ensino de arte na educação não formal: um estudo a partir de duas organizações do terceiro setor localizadas na região metropolitana do Recife

    OpenAIRE

    Patrícia de Freitas, Emília

    2011-01-01

    Este estudo teve como objetivo compreender o percurso formativo dos arte/educadores que desenvolvem o ensino de Arte nas organizações do Terceiro Setor. Duas organizações da Região Metropolitana do Recife (RMR) participaram deste estudo: o Grupo AdoleScER e o Movimento Pró-Criança. A partir dos estudos de Varela (1988) e Barbosa (1984) vimos que a formação do professor de arte já era uma preocupação das Escolinhas de Arte do Brasil e do Movimento das Escolinhas de Arte, onde, a partir da déca...

  2. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  3. WIYN active optics: a platform for AO

    Science.gov (United States)

    Code, Arthur D.; Claver, Charles F.; Goble, Larry W.; Jacoby, George H.; Sawyer, David G.

    1998-09-01

    The WIYN 3.5 meter telescope is situated on the southwest ridge of Kitt Peak yielding excellent atmosphere seeing conditions. As such, the telescope and enclosure design was directed towards exploiting this feature. The primary mirror was spun cast and figured by the Steward Observatory Mirror Laboratory and the secondary mirror by Contraves. In both cases the performance exceeded the design specifications. The borosilicate primary is actively temperature controlled to within 0.2 C of the desired temperature, typically 0.5 degrees C below the ambient air. The telescope structure is also temperature controlled and the enclosure is opened to the outside ion all sides, which all heat sources are vented to ducts carrying air downwind of the facility. The primary mirror is actively controlled for low order aberrations by 66 axial actuators which are adjusted open loop via force matrix look-up tables and closed loop via real-time wavefront curvature sensing measurements. The active optics also included real-time collimation and focus control. The telescope drive and guider are capable of providing tracking to a few hundredths of a second of arc. By employing active telescope control at this level, it is possible to maintain telescope and local wavefront distortion to a level where atmospheric effects dominate the image quality. Since a significant fraction of the power in the atmospheric disturbances is contained in image motion the first step in adaptive optics control will be simple tip tilt. Studies of higher order AO system are being carried out, as well as additional test characterizing the telescope and site. It is intended to continue such studies in an attempt to establish long term variances.

  4. Reviews Exhibitions: Collider: Step inside the World's Greatest Experiment Equipment: Hero Steam Turbine Classroom Video: Most of Our Universe is Missing Book: Serving the Reich Book: Breakthrough to CLIL for Physics Book: The Good Research Guide Apps: Popplet Web Watch Apps

    Science.gov (United States)

    2014-03-01

    WE RECOMMEND Collider: step inside the world's greatest experiment A great exhibition at the Science Museum in London Hero Steam Turbine Superb engine model gets up to 2500 rpm Most of Our Universe is Missing BBC video explores the dark truth Serving the Reich Science and morality in Nazi Germany The Good Research Guide A non-specialist book for teachers starting out in education research WORTH A LOOK Breakthrough to CLIL for Physics A book based on a physics curriculum for non-English students WEB WATCH Electric cycles online: patterns of use APPS The virtual laboratory advances personal skills

  5. Qualidade de vida de pacientes submetidos ao transplante cardíaco: aplicação da escala Whoqol-Bref

    Directory of Open Access Journals (Sweden)

    Maria Isis Freire de Aguiar

    2011-01-01

    Full Text Available FUNDAMENTO: O sucesso do transplante cardíaco significa garantir a sobrevida dos pacientes com cardiopatia e permitir-lhes desenvolver suas atividades diárias. O transplante cardíaco apresenta-se como a primeira opção de tratamento na falência cardíaca, representando um aumento de sobrevida e qualidade de vida dos transplantados. OBJETIVO: Avaliar a qualidade de vida de pacientes submetidos ao transplante cardíaco através da aplicação de uma escala padronizada (Whoqol-Bref. MÉTODOS: Estudo exploratório descritivo de abordagem quantitativa, realizado com 55 pacientes submetidos ao transplante cardíaco, em um período entre o terceiro e o 103º mês, que realizam acompanhamento na Unidade de Transplante e Insuficiência Cardíaca em um Hospital de Referência em Cardiologia na cidade de Fortaleza, CE. Os dados foram coletados no período de fevereiro a abril de 2009, por meio da aplicação de um questionário padronizado pela Organização Mundial da Saúde e utilização de dados constantes nos prontuários. RESULTADOS: Com relação ao domínio físico, 62,8% e 58,3% dos pacientes, dos sexos masculino e feminino, respectivamente, estão satisfeitos. No domínio psicológico, dentre pacientes do sexo masculino, 65,1% apresentam satisfação quanto à qualidade de vida e, no sexo feminino, 58,3% encontram-se satisfeitas. No domínio das relações sociais, observou-se que, no sexo masculino, 53,5% estão muito satisfeitos, e apresentou-se um nível de satisfação de 100% no sexo feminino. No domínio do meio ambiente, 65,1% do sexo masculino encontram-se satisfeitos, e no sexo feminino, 83,3% estão satisfeitas. CONCLUSÃO: O transplante cardíaco teve bastante influência na qualidade de vida dos pacientes transplantados, pois os resultados mostram-se estatisticamente significantes no pós-transplante.

  6. SCExAO: First Results and On-Sky Performance

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki

    2013-01-01

    We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.

  7. O perfil do empreendedor social e seu papel na continuidade de instituições do terceiro setor: o caso da Assistência Social Diocesana LeãoXIII de Passo Fundo – RS.

    Directory of Open Access Journals (Sweden)

    Ana Claúdia Machado Padilha

    2009-05-01

    Full Text Available O empreendedorismo tem sido abordado, cada vez mais, por organizações sem fins lucrativos que buscam excelência nas suas ações sociais. O estudo apresenta os resultados empíricos constituídos do perfil dos gestores da Assistência Social Diocesana Leão XIII, à luz dos conceitos do empreendedorismo social e os resultados alcançados ao longo do tempo na comunidade em que atua. Para isso, foram realizadas entrevistas com os três gestores e oito alunos da Escola Profissionalizante e aplicados questionários aos dez coordenadores dos núcleos e treze adolescentes assistidos pela Instituição. Na etapa da análise dos dados, foi utilizada a técnica de análise do conteúdo das respostas dos questionários e entrevistas segundo os critérios da literatura selecionada. Dentre os resultados significativos, percebeu-se que os gestores apresentaram um perfil alinhado ao sugerido pela literatura do empreendedorismo social, que converge para as ações pretendidas pela Instituição: trabalham em equipe; têm iniciativa para desenvolver as ações empreendedoras, apesar de não possuírem autonomia; são comprometidos com a causa social e indignam-se com as desigualdades sociais; são persistentes, responsáveis e têm senso de solidariedade.

  8. Acesso ao tratamento da diabetes na Bahia: por que se recorre ao judiciário?

    OpenAIRE

    Lisboa, Erick Soares

    2015-01-01

    A judicialização da saúde é um fenômeno importante, que tem motivado a realização de inúmeros estudos no país. A Constituição do país estabelece o direito de todos e o dever do Estado em prover acesso universal as ações e serviços de saúde. Ao longo dos 25 anos do SUS houve uma ampliação do acesso a medicamentos, e a cada ano, novos fármacos vem sendo lançados no Brasil pelas indústrias farmacêuticas. A judicialização do acesso a medicamentos tem causado impactos na estruturação, no financiam...

  9. O conceito de reflexão de Hegel como crítica aos conceitos de essência e de reflexão tradicionais

    Directory of Open Access Journals (Sweden)

    Christian Iber

    2017-02-01

    Full Text Available O presente artigo ilumina o específico do conceito de reflexão de Hegel em cinco momentos. Em um primeiro momento, delineia-se um esboço do conceito de reflexão na lógica da essência de Hegel. Em um segundo momento, o conceito de reflexão de Hegel é apresentado como estrutura lógica objetiva em contraste com a reflexão subjetiva da consciência e do entendimento, com a qual, ao mesmo tempo, o conceito de essência ontológica independente da reflexão é submetido a uma crítica. Do novo conceito de reflexão de Hegel resulta, em terceiro lugar, uma adaptação radical do círculo vicioso na teoria tradicional da reflexão da autoconsciência. Num quarto momento, lança-se um olhar sobre o conceito de reflexão anterior de Hegel como pensar do entendimento que separa, do qual o conceito de reflexão posterior se distingue. Por fim, apresenta-se, em quinto lugar, a lógica da reflexão de Hegel como crítica à fundação ontológica da reflexão em Schelling. O conceito de reflexão de Hegel se mostra, com isto, como crítica da metafísica ontológica tradicional e como fundação de uma metafísica da relacionalidade absoluta que supera a relatividade do pensar moderno do entendimento.

  10. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Law, Nicholas Michael; Baranec, Christoph; Morton, Timothy; Ziegler, Carl; Atkinson, Dani; Riddle, Reed

    2015-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets.We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys.Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss several KOIs of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are ``coincident multiple'' systems, with several transiting planets shared between the two stars. Finally, we will discuss and update the 98%-confidence evidence from our survey that third bodies in star/planet systems produce an excess of close-in giant planets.

  11. Passagem ao ato e acting-out: duas respostas subjetivas

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2010-08-01

    Full Text Available O presente artigo delimita o conceito de passagem ao ato em relação ao acting-out e distingue as respostas subjetivas que envolvem. A partir das distinções propostas por Lacan entre eles com base no conceito de objeto a, busca-se situar o sujeito em ambas as modalidades de ato, com os objetivos de submeter à discussão clínica as passagens ao ato discretas e de interrogar o papel de suplência que supostamente desempenham. Para tal, são retomados dois fragmentos de casos de anorexia discutidos na literatura psicanalítica; no primeiro, o objeto ao qual o sujeito se identifica é circunscrito, enquanto no segundo, trata-se do objeto posto em cena pelo sujeito.

  12. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF)

    OpenAIRE

    Audigé, L.; Slongo, T; Lutz, N.; Blumenthal, A.; Joeris, A

    2016-01-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more ...

  13. Niveles intelectuales y ansiedad en niños con intoxicación plúmbica crónica: Colegio "María Reiche". Callao-Perú, 2002

    Directory of Open Access Journals (Sweden)

    Julián Vega

    2005-06-01

    Full Text Available Objetivo: Determinar la asociación entre intoxicación plúmbica crónica y niveles intelectuales, y la asociación entre intoxicación plúmbica crónica y ansiedad, en niños del colegio "María Reiche"-Callao. Materiales y Métodos: Se realizó un estudio observacional transversal en 39 niños que participaron en el dosaje de plomo en sangre hecho por la Dirección General de Salud Ambiental en el año 2002. Se midió el coeficiente intelectual y determinó el nivel intelectual, y se aplicó la lista de chequeo de ansiedad. Se categorizó a los niños, según sus niveles de plomo en sangre, en no intoxicados (niveles o = 10 myg/dL. Se aplicó las pruebas chi-cuadrado y prueba t con un p <0,05. Resultados: El coeficiente intelectual de los niños intoxicados fue 85,51±12,56, los niveles de plomo fueron 26,54±9,42 myg/dL en los niños con nivel intelectual bajo (fronterizo e inferior. Los niveles intelectuales y las categorías de plomo en sangre se asociaron con un p=0,355. Los grados de ansiedad y las categorías de plomo en sangre se asociaron con un p=0,03. La distribución t encontró diferencia de medias entre los niveles de plomo en los grupos con ansiedad leve y marcada (p=0,024. Conclusiones: Se encontró asociación entre la intoxicación plúmbica crónica y el grado de ansiedad; sin embargo, no se encontró asociación entre los niveles intelectuales y la intoxicación plúmbica crónica.

  14. Avaliação ortopantomográfica das angulações mesiodistais de caninos, pré-molares e molares inferiores com e sem a presença dos terceiros molares Panoramic evaluation of the mesiodistal angulations of canine teeth, premolar and inferior molars with and without the presence of the third molars

    Directory of Open Access Journals (Sweden)

    Rodrigo Castellazzi Sella

    2009-12-01

    Full Text Available OBJETIVOS: comparar os valores médios normais das angulações mesiodistais dentárias, propostos por Ursi, em 1989, com as angulações mesiodistais de caninos, pré-molares e molares inferiores em indivíduos com e sem a presença dos terceiros molares inferiores e idades entre 18 e 25 anos. Além disso, foram comparados os valores das angulações mesiodistais desses dentes nessas duas situações. MÉTODOS: foram utilizadas 40 radiografias ortopantomográficas de indivíduos, de ambos os gêneros, que não receberam tratamento ortodôntico, divididos em dois grupos: Grupo I, constituído por 20 radiografias que não apresentavam os terceiros molares inferiores; e Grupo II, formado por 20 radiografias com os terceiros molares inferiores presentes. RESULTADOS E CONCLUSÕES: a análise dos resultados e a análise estatística permitiram concluir que ambos os grupos exibiram pré-molares e molares inferiores mais angulados em sentido mesial, quando comparados à oclusão normal. Por outro lado, a angulação mesiodistal de caninos inferiores mostrou-se semelhante àquela apresentada em casos de oclusão normal. Os dois grupos, quando comparados entre si, exibiram semelhantes valores angulares dos caninos, pré-molares e molares inferiores, de modo que a presença dos terceiros molares não exerceu influência sobre essas angulações mesiodistais dentárias.AIM: To compare the normal mean values of the mesiodistal axial angulation, proposed by Ursi in 1989, with the mesiodistal axial angulation of canine teeth, premolar and inferior molars in individuals with and without the presence of the third inferior molars and ages between 18 and 25 years. Besides, the values of the mesiodistal axial angulation of these teeth were compared in these two situations. METHODS: Forty panoramic x-rays were used from individuals of both genders that didn't receive orthodontic treatment, divided in two groups: Group I, constituted by 20 x-rays that didn't present

  15. Narrativas digitais sobre os exames de admissão ao ginásio: ego-documentos e cultura escrita na história do tempo presente

    Directory of Open Access Journals (Sweden)

    Cristiani Bereta da Silva

    2015-12-01

    Full Text Available A proposta deste artigo é discutir narrativas digitais escritas em primeira pessoa, tomadas em seu sentido mais amplo de ego-documentos. Foram analisados 12 blogs e 4 sites pessoais que trazem histórias escritas sobre os exames de admissão ao ginásio (que vigoraram no Brasil entre 1931 e 1971, bem como os comentários relativos a cada postagem. A análise das narrativas foi desenvolvida a partir de três eixos irredutivelmente articulados: o primeiro deles é metodológico e requer problematizar as possibilidades e limites de se explorar blogs e sites como fontes históricas adequadas para se compreender os fenômenos contemporâneos da memória, da narrativa e das temporalidades. O segundo eixo implica analisar as narrativas postadas nos blogs e sites como fenômenos que contribuem para dotar de inteligibilidade a história da cultura escrita no tempo presente. O terceiro eixo de análise impõe uma reflexão sobre os sentidos do passado e da memória nas escritas de si. As questões aqui levantadas lidam com os desafios sobre a significação e interpretação do tempo pelos sujeitos do presente. Se se considera que narrar a própria vida é uma necessidade transcultural relativa à significação da existência, é irrenunciável pensar nas mudanças operadas na experiência humana e sua relação com a historicidade depois que a hiperconectividade, possibilitada pela web 2.0, alterou significativamente os fluxos do tempo e do espaço.   Palavras-chave: Cultura escrita; Narrativas digitais; Exames de admissão ao ginásio.

  16. Characterizing and mitigating vibrations for SCExAO

    Science.gov (United States)

    Lozi, Julien; Guyon, Olivier; Jovanovic, Nemanja; Singh, Garima; Goebel, Sean; Norris, Barnaby; Okita, Hirofumi

    2016-07-01

    The Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) instrument, under development for the Subaru Telescope, has currently the fastest on-sky wavefront control loop, with a pyramid wavefront sensor running at 3.5 kHz. But even at that speed, we are still limited by low-frequency vibrations. The current main limitation was found to be vibrations attributed mainly to the rotation of the telescope. Using the fast wavefront sensors, cameras and accelerometers, we managed to identify the origin of most of the vibrations degrading our performance. Low-frequency vibrations are coming from the telescope drive in azimuth and elevation, as well as the elevation encoders when the target is at transit. Other vibrations were found at higher frequency coming from the image rotator inside Subaru's adaptive optics facility AO188. Different approaches are being implemented to take care of these issues. The PID control of the image rotator has been tuned to reduce their high-frequency contribution. We are working with the telescope team to tune the motor drives and reduce the impact of the elevation encoder. A Linear Quadratic Gaussian controller (LQG, or Kalman filter) is also being implemented inside SCExAO to control these vibrations. These solutions will not only improve significantly SCExAOs performance, but will also help all the other instruments on the Subaru Telescope, especially the ones behind AO188. Ultimately, this study will also help the development of the TMT, as these two telescopes share very similar drives.

  17. Management of the third sector: a social practice? Gestión del tercer sector: ¿una práctica social? Gestão do terceiro setor: uma prática social?

    Directory of Open Access Journals (Sweden)

    Alexandra Carla Aguiar Antunes Soares

    2010-03-01

    ógicos usados fueron de carácter cualitativo, con la utilización de entrevista estructurada como método de colecta de datos. El recorte adoptado privilegió el sector de la gestión, que surge como uno de los mayores desafíos vivenciados por las organizaciones del Tercer Sector. La muestra fue compuesta por 20 gerentes - 12 mujeres y 8 hombres -, con un mínimo de 3 años de trabajo efectivo en el puesto en las distintas áreas de actuación de organizaciones del Tercer Sector ubicadas en el municipio de Belo Horizonte. Sus resultados confirman que aspectos como voluntariado, aparcería, estatuto y la propia gestión son algunas de las transformaciones existentes en el contexto del Tercer Sector en los últimos años. Pero el destaque de esas transformaciones en el sector es la gestión, que se encuentra en un movimiento acelerado de búsqueda por la profesionalización. Para su efectividad y consolidación, es indispensable que la gestión sea concebida e idealizada bajo la perspectiva praxeológica ya que el área gerencial del Tercer Sector se ha mostrado una práctica social consolidada.Diante do crescimento do Terceiro Setor no cenário brasileiro e das transformações exigidas e ocorridas nos processos gerenciais e no âmbito de atuação dessas instituições, acredita-se que caracterizar suas práticas de gestão e a realidade dos gerentes como uma prática social acarretará uma melhor compreensão dos processos e dos papéis gerenciais, por meio dos quais ocorrem as transformações e profissionalização das organizações do Terceiro Setor na sociedade. Os procedimentos metodológicos usados foram de caráter qualitativo, com a utilização da entrevista estruturada como método de coleta de dados. O recorte adotado privilegiou o campo da gestão, que emerge como um dos maiores desafios vivenciados pelas organizações do Terceiro Setor. A amostra foi composta de

  18. Fatores maternos associados ao peso fetal estimado pela ultra-sonografia Maternal factors associated with fetal weight estimated by ultrasonography

    Directory of Open Access Journals (Sweden)

    Adriana Suely de Oliveira Melo

    2008-09-01

    Full Text Available OBJETIVO: avaliar o efeito de variáveis maternas, socioeconômicas e obstétricas, assim como a presença de incisuras na 20ª e na 24ª semana, sobre o peso fetal estimado no final da gravidez (36ª semana em gestantes atendidas pelo Programa Saúde da Família em uma cidade do interior do Nordeste do Brasil. MÉTODOS: estudo longitudinal incluindo 137 gestantes. As gestantes foram acompanhadas a cada quatro semanas para aferição das condições clínicas, socioeconômicas e obstétricas, incluindo o peso materno. As artérias uterinas foram avaliadas pelo Doppler na 20ª e 24ª semana, o peso fetal e o índice de líquido amniótico (ILA foram determinados na 36ª semana. O estado nutricional materno inicial foi determinado pelo índice de massa corpórea (IMC, classificando-se as gestantes como com baixo peso, eutróficas, com sobrepeso e obesas. O ganho ponderal durante a gestação foi avaliado de acordo com o estado nutricional inicial, sendo ao final do segundo e terceiro trimestre classificado em ganho ponderal insuficiente, adequado e excessivo. Foi realizada análise de variância para avaliar a associação do peso fetal estimado na 36ª semana com as variáveis preditoras, ajustada por regressão linear múltipla. RESULTADOS: observou-se associação entre peso fetal estimado na 36ª semana e idade da mãe (p=0,02, trabalho materno (p=0,02, estado nutricional inicial (p=0,04, ganho ponderal no segundo trimestre (p=0,01, presença de incisuras nas artérias uterinas (p=0,02 e ILA (p=0,007. Os principais fatores associados ao peso fetal estimado na 36ª semana, após a análise de regressão múltipla, foram: IMC no início da gravidez, ganho ponderal no segundo trimestre, ILA e tabagismo. CONCLUSÕES: o peso fetal no presente estudo associou-se positivamente ao estado nutricional materno inicial, ao ganho ponderal no segundo trimestre, ao volume do líquido amniótico e negativamente ao hábito de tabagismo.PURPOSE: to evaluate the

  19. A exposição ao risco das familias

    OpenAIRE

    dos Santos Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  20. Práticas educativas maternas e indicadores do desenvolvimento social no terceiro ano de vida Child-rearing practices and social development indicators in three-year-old children

    Directory of Open Access Journals (Sweden)

    Patrícia Alvarenga

    2009-01-01

    Full Text Available O objetivo deste estudo foi investigar as relações entre as práticas educativas maternas e indicadores dos problemas de externalização e da competência social em crianças aos 30 meses de vida. Participaram do estudo 23 díades mãe-criança. No 30º mês de vida da criança foi realizada uma observação da interação mãe-criança para a avaliação das práticas educativas maternas, dos problemas de externalização e da competência social das crianças. Os resultados apóiam a literatura que relaciona práticas de orientação, controle assertivo e envolvimento parental positivo à competência social, e práticas coercitivas e permissivas aos problemas de externalização. Discute-se a relevância das práticas educativas parentais para a compreensão do desenvolvimento social, enfatizando a importância de práticas menos referidas na literatura, como a autorização de autonomia, a intrusividade e o controle ambíguo.The present work aimed at investigating relations between maternal child-rearing practices, externalizing behavior problems and social competence indicators of thirty-month-old children. The study involved 23 child-mother dyads. In the child's thirtieth month after birth, an observation of mother-child interaction was performed in order to evaluate maternal child-rearing practices, externalizing behavior problems and child social competence. The results support the literature about social development that relates child-rearing practices such as guidance, assertive control and positive parental involvement to social competence, and coercive and permissive practices to externalizing behavior problems. The work discusses the relevance of parental child-rearing practices for the comprehension of the social development, emphasizing the importance of child-rearing practices, such as autonomy authorization, intrusiveness and ambiguous control.

  1. Adesão ao tratamento da ambliopia

    OpenAIRE

    Arakaki Mara Regina; Schellini Silvana Artioli; Heimbeck Felipe Jorge; Furuya Margareth Tiemi; Padovani Carlos Roberto

    2004-01-01

    OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...

  2. Violência relacionada ao trabalho: uma proposta conceitual

    OpenAIRE

    Oliveira,Roberval Passos de; Nunes,Mônica de Oliveira

    2008-01-01

    p. 22-34 O aumento de situações de violência no âmbito do trabalho vem se constituindo um importante problema de Saúde Pública, que tem impacto na dignidade e na qualidade de vida dos trabalhadores. Nessa perspectiva, este artigo tem como objetivo propor, a partir da discussão do fenômeno da violência e de sua faceta concernente ao trabalho, o conceito de violência relacionada ao trabalho, como referência para futuros estudos no campo da Saúde do Trabalhador. Trata-se de um artigo conceitu...

  3. High-Performance CCSDS AOS Protocol Implementation in FPGA

    Science.gov (United States)

    Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson

    2010-01-01

    The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.

  4. Do teatro grego ao teatro romano de Lisboa

    OpenAIRE

    Maciel, Manuel Justino

    2006-01-01

    A tipologia do teatro nasceu na Grécia e foi apropriada por Roma, com alterações significativas que constituem instrumento importante da investigação em História da Arte. Assim acontece com o teatro romano de Lisboa que, foi construído “ao modo grego”. Parece evidente que o Teatro foi adaptado para “espectáculos aquáticos”, embora o aprofundamento da reflexão exija a continuação de trabalhos arqueológicos, sob a Rua de São Mamede ao Caldas.

  5. Abuso sexual: um trajeto da fantasia ao real

    OpenAIRE

    Malgarim, Bibiana Godoi

    2015-01-01

    O presente trabalho visou apresentar a Dissertação de Mestrado realizada junto ao Programa de Pós-Graduação de Psicologia da Universidade do Vale do Rio dos Sinos, cujo título é Abuso Sexual: Um trajeto da fantasia ao real. O objetivo desta pesquisa foi compreender e interpretar a dinâmica das representações das relações objetais de duas pré-adolescentes encaminhadas por suspeita de abuso sexual, através de métodos projetivos, como o Rorschach e o HTP.

  6. O Significado de Saúde e Doença para o Aluno de Medicina ao longo da Graduação: Estudo Exploratório entre Alunos da Unifesp-EPM

    Directory of Open Access Journals (Sweden)

    Tatiana Gottlieb Lerman

    Full Text Available RESUMO No início da graduação, a compreensão sobre saúde e doença do aluno depende de seus conhecimentos e experiências prévias, bem como do grau de contato com a prática médica e a realidade que envolve esse tema. Neste estudo, pretende-se compreender qual é a visão de saúde e doença que permeia a mente dos futuros médicos e traçar que relações são estabelecidas entre a noção de saúde e doença com as experiências pessoais e profissionais do aluno ao longo da graduação. Foi realizado um estudo qualitativo, utilizando-se um questionário psicossocial e entrevista semiestruturada com alunos do primeiro, terceiro e sexto ano de um mesmo ano letivo da Universidade Federal de São Paulo (Unifesp-EPM. O material foi submetido à análise de conteúdo. As experiências e características pessoais de cada participante, assim como as experiências curriculares e extracurriculares e o currículo oculto influenciam tanto a visão que possuem de saúde e doença quanto a escolha profissional. Nota-se certo esfriamento na relação médico-paciente e uma postura de maior desconfiança em relação aos pacientes ao longo da graduação. Os alunos têm o conhecimento de uma visão mais global e humana dos pacientes, mas não conseguem colocá-la em prática. Observa-se que essa problemática está vinculada ao fato de terem dificuldade de entrar em contato com os aspectos emocionais despertados na relação médico-paciente.

  7. Nationalsozialistische Geschlechterideologie und Aktplastik im Dritten Reich

    OpenAIRE

    Herlem, Didier

    2014-01-01

    L'instrumentalisation de l'art par le National-Socialisme offre un exemple intéressant de transposition esthétique de l'événement contemporain. Il s'agissait pour le régime d'inverser le processus normal de cette transposition. L'art devait non plus refléter, mais contribuer à créer l'événement, devenant ainsi un élément-clé de la dynamique révolutionnaire nazie. La mise en œuvre de cette instrumentalisation et ses résultats sont analysés et exposés à partir de l'idéologie sexuelle nationale-...

  8. Slave Labor Camps of the Third Reich.

    Science.gov (United States)

    Stone, Adolf

    1983-01-01

    Describes the ground rules used by Nazi architects in choosing the sites for slave labor camps. While some, like Auschwitz, became extermination camps, others also produced armaments. One camp, Theresienstadt, became a "model" camp to show to reporters and Red Cross representatives. (CS)

  9. The Evolution of the Third Reich.

    Science.gov (United States)

    McCleary, George F., Jr.

    1995-01-01

    Presents a set of four maps illustrating changing German political borders. Includes the time period from 1933, when Hitler came to power, until the division of Germany in 1945. Includes a map showing the Allied Powers against Germany, nations allied with Germany, and neutral nations. (CFR)

  10. Electronic Combat Over the Third Reich

    Science.gov (United States)

    1988-04-01

    Mammut , Wassennann, aid Jagdschloss. The Freya was an early warning radar with a range of 87 NM (12:277). Window and chaff did not affect it at first...rmers. The British used the Mandrel and Moonshine to jam the Freya, Mammut , Wassermann, and Jagdschloss early warning radars. The No. 100 Group had...result of the "Post Mortem" exercise conducted after the war, the British found that the jamming against the Freya and Mammut radars was very effective

  11. Solar research in the Third Reich

    Science.gov (United States)

    Seiler, Michael P.

    Within the six years of the Second World War, German solar research succeeded in advancing from a mere provincial backwater to the forefront of this science. This has to be attributed to the joint effort of two very different men: Hans Plendl (1900-1991), a seasoned researcher who was a key figure in devising precision bombing aids for the Luftwaffe and who would eventually become Field Marshal Göring's Plenipotentiary for High Frequency Research before finally falling in disgrace, and Karl-Otto Kiepenheuer (1910-1975), a charismatic young astrophysicist, the son of a renowned publisher whose books were burned when the Nazi party came to power in 1933.

  12. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  13. Reptiles and Amphibians of Curaçao

    NARCIS (Netherlands)

    Rooij, de Nelly

    1922-01-01

    The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles

  14. Variability in olecranon AO fracture fixation: A radiological study ...

    African Journals Online (AJOL)

    Background: Tension Band Wire(TBW) fixation of olecranon fracture is a commonly used technique by orthopaedic surgeons. However surgeons do not strictly adhere to the AO standard. Objectives: To determine the use and variability of this technique by surgeons at the hospital. Design: A hospital based retrospective ...

  15. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  16. The Foraminifera of Piscadera Bay, Curaçao

    NARCIS (Netherlands)

    Hofker, J.

    1971-01-01

    Piscadera Bay is situated 4 km West of Willemstad, Curaçao, between two limestone hills which have a height of about 100 m. It is a drowned river system, the entrance of which is almost completely blocked by a bar of coral debris reaching to about 2 meters above sea level. The following parts may be

  17. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for

  18. Knowledge and attitudes toward epilepsy among primary, secondary and tertiary level teachers Atitude e percepção sobre epilepsia entre professores de primeiro, segundo e terceiro graus

    Directory of Open Access Journals (Sweden)

    Fábio Galvão Dantas

    2001-09-01

    édicos devem proporcionar um melhor conhecimento sobre epilepsia aos professores e campanhas educativas públicas devem também objetivar melhor esclarecimento sobre estas questões.

  19. Rinossinusite esfenoidal aguda e acometimento do terceiro par craniano: relato de caso e revisão de literatura Acute sphenoid rhinosinusitis and third cranial nerve involvement: case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Francini G.M. Pádua

    2003-06-01

    Full Text Available O seio cavernoso encontra-se adjacente ao seio esfenoidal e apresenta íntima relação com a artéria carótida interna e os nervos abducente, troclear, oculomotor e ramo oftálmico do nervo trigêmio. Como a parede do esfenóide é muito fina, o envolvimento de estruturas adjacentes se torna mais freqüente e perigoso quando este seio está acometido. O objetivo dos autores é relatar um caso de rinossinusite aguda complicada com o acometimento isolado de III par craniano e revisão da literatura. Paciente do sexo feminino, 53 anos, com cefaléia frontal há 30 dias antes da internação. Evoluiu com ptose palpebral esquerda associada à diplopia tendo sido diagnosticado acometimento isolado do nervo oculomotor secundário a uma rinossinusite esfenoidal aguda. Foi internada com antibioticoterapia endovenosa e submetida a cirurgia endoscópica dos seios paranasais, evoluindo com resolução total do quadro. A falha no diagnóstico acurado e no tratamento da rinossinusite esfenoidal pode levar a graves seqüelas neurológicas, sendo que o tratamento precoce e agressivo é crucial para a prevenção de complicações desastrosas. Em nossa experiência, a cirurgia endoscópica dos seios paranasais vem demonstrando ser uma abordagem segura e eficaz no tratamento das complicações de rinossinusites agudas.Cavernous sinus is located adjacent to sphenoidal sinus and presents close relationship with internal carotid artery and some important nerves (abducent, troclear, oculomotor and ophthalmic branch of the trigemic nerve. Since the sphenoid lateral wall is too thin, adjacent structure involvement is more frequent and dangerous when this sinus is disease. The purpose of this study is to report a case of an acute rhinosinusitis complicated with the involvement of the third cranial nerve. A 53-year-old woman was complaining about frontal headache one month before hospital admission. An acute sphenoiditis associated with exclusive involvement of

  20. Desafios para a maternidade no contexto da reprodução medicamente assistida: terceiro mês do bebê Challenges to motherhood in the context of assisted reproduction: infant's third month of life

    Directory of Open Access Journals (Sweden)

    Lia Mara Netto Dornelles

    2010-12-01

    Full Text Available O desgaste físico e emocional decorrente das técnicas de reprodução medicamente assistida, pode conferir à maternidade um caráter específico, com repercussões ainda pouco conhecidas. Por meio deste estudo com três mulheres que engravidaram por técnicas reprodutivas, buscou-se conhecer o processo de tornar-se mãe no contexto da reprodução medicamente assistida, com medidas coletadas aos três meses do bebê. Os resultados apontaram que a transição para a maternidade foi vivida por essas mulheres com sentimento de incapacidade de cuidar adequadamente de seu bebê e medo de que ele não sobrevivesse, sendo que o nascimento pré-termo, já temido desde a gestação, tornou real a possibilidade de perda do bebê e a vivência dessa etapa, um desafio. Entretanto, observou-se que superado esse período inicial, o medo da perda do bebê diminuiu, dando espaço para o estabelecimento da crença de que essas mães são capazes de garantir a sobrevivência de seus bebês.The physical and psychological stress produced by the assisted reproduction techniques (ART may affect parenthood in a special way, with unknown repercussions. This study aims at knowing the process of becoming a mother in three women who conceived through ART and whose babies were three months old. The results showed that the participants of this study went through the transition to parenthood feeling uncapable of taking care of their babies in an appropriate way and also frightened by the possibility of losing them. In this way, the premature birth of the baby, already antecipated during pregnancy, turned real this possibility and made this experience a challenge. However, it was observed that when the initial moments of fear were overcome the belief of being capable of keeping the baby alive emerged.

  1. Prevenção ao crime e teoria social

    OpenAIRE

    Sento-Sé, João Trajano

    2011-01-01

    O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime ...

  2. Avaliação radiográfica do comportamento dos terceiros molares inferiores em pacientes tratados ortodonticamente com e sem extrações de primeiros pré-molares Radiographic evaluation of the behavior of lower third molars in patients that were orthodontically treated with and without first premolars extractions

    Directory of Open Access Journals (Sweden)

    Reinaldo Roberto Hauy

    2007-12-01

    Full Text Available OBJETIVO: o presente trabalho objetivou avaliar as alterações ocorridas nas posições dos terceiros molares inferiores em pacientes tratados ortodonticamente com extrações dos primeiros pré-molares. METODOLOGIA: utilizou-se 80 ortopantomografias, obtidas no pré e pós-tratamento ortodôntico corretivo de 40 pacientes, divididos em dois grupos. O grupo 1 constou de 20 pacientes (13 femininos e 7 masculinos que se submeteram a tratamento ortodôntico com extrações de primeiros pré-molares. O grupo 2 foi constituído por 20 pacientes (13 femininos e 7 masculinos tratados ortodonticamente sem extrações. Foram estabelecidas medidas angulares, com o objetivo de avaliar as inclinações e medidas lineares, para analisar as modificações no sentido vertical dos terceiros molares. Todos os dados foram mensurados duas vezes, cujos valores médios foram submetidos dos testes t emparelhado e teste t independente. RESULTADOS: os resultados mostraram diferenças estatisticamente significantes (pAIM: The aim of this study is to evaluate the positional changes occurred with lower third molars in patients treated orthodontically with extractions of first premolars. METHODS: A total of 80 panoramic radiographs obtained at pre and post-treatment periods from 40 patients, were divided into 2 groups: group 1 were composed by 20 patients (13 female and 7 male that were submitted to orthodontic treatment with extraction of first premolars; group 2 were composed by 20 patients (13 female and 7 male that were submitted to orthodontic treatment without extractions. Angular measurements were established to evaluate the tipping and linear measurements were established to analyze the vertical changes of the lower third molars. All data were measured twice and averaged, then submitted to paired and unpaired test. RESULTS: Significant differences were found between the initial and final angular measurements of group 1 (p<0.01. CONCLUSIONS: It was concluded that

  3. Gerenciamento de Enfermagem e administração das organizações do Terceiro Setor Gerencia de Enfermería y la administración de las organizaciones del Tercer Sector Managment in Nursing and the administration of Third Sector organizations

    Directory of Open Access Journals (Sweden)

    Rosa Maria Ruthes

    2006-12-01

    Full Text Available Neste artigo de revisão bibliográfica procurou-se verificar a evolução do terceiro setor e as relações entre gerenciamento em enfermagem nestas organizações. Constata-se um crescimento deste setor na área de saúde, trazendo a ampliação do mercado de trabalho para enfermeiros. Assim, considera-se que é preciso alertar os enfermeiros a estarem preparados para a gestão nestas organizações, buscando seu desenvolvimento na gestão hospitalar. O terceiro setor vem sendo valorizado como forma de promoção social nos segmentos de saúde, educação, assistência social e outros, reunindo indivíduos e instituições de forma participativa.En este artículo de revisión bibliográfica se objectivó verificar la evolución del tercer sector y las relaciones entre gerenciamento en enfermería en estas organizacioneslas. Verificase un crescimiento de este sector en la area de salud, trayendo la ampliación en el mercado de trabajo para los enfermeros. Así, considerase que es necesario alertar a los enfermeros para supreparo para la gestión en estas organizaciones, buscando su desarrollo en la gestión hospitalaria. El tercer sector viene siendo valorado como forma de promoción social en la salud, educación, ayuda social y otros segmientos, juntando individuos y instituciones de una forma participativa.In this article of bibliographical revision it was aimed at verifying the evolution of the third sector and the relations between nursing management in that organizations. It is observed a growing of this sector in health area, bringing a market anplification in the work of the nurse. Thus, it is considered the need for warning the nurses to be prepared for the management in these organizations, seeking for development in hospital management. Third sector is being valued as a form of social promotion in the health, education, social assistance and others segments, congregating individuals and institutions in a participative form.

  4. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  5. Da esclerodermia ao síndrome de poems

    Directory of Open Access Journals (Sweden)

    Ana Sofia Montez

    2015-12-01

    Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite

  6. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  7. Atitudes dos profissionais de enfermagem relacionadas ao Processo de Enfermagem

    Directory of Open Access Journals (Sweden)

    Erika de Souza Guedes

    2012-10-01

    Full Text Available Os objetivos do estudo foram descrever a disposição sobre o Processo de Enfermagem (PE e a percepção de poder clínico dos profissionais de enfermagem; analisar associações entre atitudes relacionadas ao PE e variáveis selecionadas. Participaram 1.605 auxiliares de enfermagem e enfermeiros (86,9% mulheres, idade média 44,12 anos; DP=9,55. O escore médio no instrumento Posições sobre o Processo de Enfermagem (PPE foi 112,37 (DP=22,28 e no Power as Knowing Participation in Change Tool - versão brasileira (PKPCT foi 281,12 (DP= 38,72. Os escores nos instrumentos foram mais altos para enfermeiros quando comparados aos auxiliares. Houve correlação positiva moderada entre escores do PPE e PKPCT. Para os auxiliares houve associação entre os escores no PPE, sexo e pós-graduação; e entre percepção de poder e sexo. Para os enfermeiros houve associação entre PKPCT e cargo de chefia. Mais estudos devem ser desenvolvidos com vistas a identificar variáveis potencialmente associadas ao uso do Processo de Enfermagem na prática clínica.

  8. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  9. Entre a inclusão e a democracia digital: a atuação do Estado e do terceiro setor em comunidades pobres da região metropolitana do Recife | Between digital inclusion and digital democracy

    Directory of Open Access Journals (Sweden)

    Jonatas Ferreira

    2009-04-01

    Full Text Available Resumo A acumulação histórica de capitais econômicos e culturais vem determinando padrões diferenciados de acesso à revolução informacional. Em geral, esse problema tem sido tratado pelas políticas públicas a partir de uma série de conceitos que convergem para as idéias polares de ‘exclusão’ e ‘inclusão digital’. A partir dessa perspectiva, a solução do problema da desigualdade se apresenta como um percurso que os atores precisam fazer de um lugar vazio, de uma tabula rasa, para outro de prosperidade, numa clara atualização da visão dos atores em posição subalterna como seres faltantes.  Recentemente, surgiu uma proposta de estimular a democratização das tecnologias digitais não como forma de simplesmente suprir uma falta, mas como estratégia de empoderamento. Apesar disso, não há consenso com relação ao modo como a desigualdade digital deve ser tratada, se a partir de investimentos visando à inclusão, se a partir de investimentos que capacitem camadas pobres da população a interferir na vida social em sentido amplo. Com base em pesquisa realizada em 8 instituições, mapeamos iniciativas de inclusão digital e analisamos como essas duas visões se traduzem em sua prática. Palavras-chave inclusão digital; democracia; desigualdade Abstract The historical accumulation of economic and cultural capitals has been determining unequal patterns of access to the informational revolution. In general, public policies deal with this problem by recurring to concepts that converge to the polar ideas of “digital divide” and “digital inclusion”. From this perspective, the solution to the problem of social inequality is presented as the trajectory that social actors need to undertake from an empty space, from a tabula rasa, to another of prosperity – a clear actualization of the perception of social actors in a subaltern position as lacking beings. More recently, a proposal for stimulating the democratization

  10. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  11. Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

    Science.gov (United States)

    Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

    2017-01-01

    The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

  12. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  13. Análise da topografia axial dos terceiros molares inclusos através da radiografia panorâmica dos maxilares em relação à classificação de Winter = Molar analysis of the axial topography of third enclosed through the panoramic x-ray of the maxilares in relation to the classification de Winter

    Directory of Open Access Journals (Sweden)

    Cerqueira, Paulo Roberto Ferreira

    2007-01-01

    Full Text Available A radiografia panorâmica é um dos mais freqüentes exames complementares solicitados na clínica odontológica sendo de suma importância para avaliação das inclusões dentais e nos planejamentos cirúrgicos. O objetivo deste trabalho é analisar os terceiros molares inclusos através da radiografia panorâmica em relação a classificação de Winter (1926. Foram analisadas 200 radiografias selecionadas aleatoriamente de uma clínica particular de radiologia odontológica em Caruaru-PE, de pacientes numa faixa etária entre 18 e 30 anos de ambos os gêneros, no período de janeiro a junho de 2006. Das radiografias analisadas 58% (n = 116 eram do gênero feminino e 42% (n = 84 eram do gênero masculino. A média de idade foi de 22,4 anos e a maior freqüência foi o elemento 28, 26,5% (n = 164 do qual 26,5% (n = 69 eram do gênero masculino e 27,2% (n = 95 seguido do elemento 18, 24,1% (n = 163 ambos com a posição vertical mais freqüente

  14. Development of conditioned taste aversion to Mascagnia rigida in goats Desenvolvimento de condicionamento aversivo ao sabor de Mascagnia rigida em caprinos

    Directory of Open Access Journals (Sweden)

    Raquel Ribeiro Barbosa

    2008-12-01

    puderam ingerir folhas de M. rigida por 15 minutos, seguido pela administração de LiCl ou de água. O tempo de ingestão das folhas de M. rigida foi anotado. O condicionamento foi repetido diariamente até que os caprinos tratados com LiCl parassem de ingerir M. rigida. Nos 10º, 17º e 24º dias após o condicionamento, testes de extinção da aversão a M. rigida foram realizados nos caprinos usando provas de única escolha. Não houve diferença entre os dois grupos de tratamento no consumo de M. rigida no primeiro dia do condicionamento aversivo, mas os animais do grupo controle ingeriram quantidades crescentes da planta nos dias seguintes ao condicionamento. No segundo dia, cinco dos sete caprinos do grupo tratado com lítio não ingeriram as folhas, mas no terceiro dia, todos os caprinos tratados com lítio não ingeriram M. rigida. Esta aversão persistiu durante todos os dias avaliados. Isto indica que os caprinos podem ser facilmente condicionados utilizando o cloreto de lítio para produzir aversão à ingestão de M. rigida temporariamente.

  15. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  16. Data of evolutionary structure change: 1AO5B-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-2AGEX 1AO5 2AGE B X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  17. Data of evolutionary structure change: 1AO5A-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5A-2AGEX 1AO5 2AGE A X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  18. Probing circumplanetary disks with MagAO and ALMA

    Science.gov (United States)

    Wu, Ya-Lin

    2018-01-01

    The dedication of the Magellan Adaptive Optics (MagAO) on the 6.5 m Clay Telescope has opened a new era in high-contrast imaging. Its unique diffraction-limited wavelengths of 0.6 to 1 micron helps to probe circumplanetary disks by measuring the amount of dust reddening as well as by searching for the strongest gas accretion indicator H-alpha (0.65 micron). Using MagAO, I found that two wide-orbit planetary-mass companions CT Cha B and 1RXS 1609 B have a significant dust extinction of Av ~ 3 to 5 mag likely from their disks. For GQ Lup B, I found that it is actively accreting material from its disk and emitting strong H-alpha emission. My research with MagAO demonstrates that circumplanetary disks could be ubiquitous among young giant planets. I later carried out a survey using ALMA to image accretion disks around several wide planet-mass companions at 1.3 mm continuum and CO (2-1). This is the first systematic study aiming to measure the size, mass, and structure of planetary disks. However, except for FW Tau C (which was shown to actually be a low-mass star from the dynamical mass measurement) no disks around the companions were found in my ALMA survey. This surprising null result implies that circumplanetary disks are much more compact and denser than expected, so they are faint and optically thick in the radio wavelengths. Therefore, mid- to far-infrared may be more favorable to characterize disk properties. The MIRI camera on the JWST can test this compact optically-thick disk hypothesis by probing disk thermal emission between 10 and 25 micron.

  19. Identification of system misregistrations during AO-corrected observations

    Science.gov (United States)

    Béchet, C.; Thiébaut, É.; .; Tallon, M.; Kolb, J.; Madec, P.-Y.

    2011-09-01

    The E-ELT will be equipped with a deformable mirror inside the telescope. The performance of reconstruction and control depends on the calibration of the interaction matrix- or a model of the interaction matrix- , which characterizes the system and the relationship between the commands sent to the deformable mirrors (DM) and the wavefront sensors (WFS) slopes. Such a calibration will be more complex than for the current systems at the VLT since it will have to be at least partly measured on sky and for a much larger number of degrees of freedom (more than 5000). In addition, gravity or temperature variations for instance are likely to introduce slow evolution of the matching between the M4 Deformable mirror and the WFS geometry. This can occur during observations and therefore degrade the adaptive optics (AO) correction. To relax the need of frequent painful calibrations and to prevent a loss of performance due to misregistrations, we investigate how to track the evolution of the interaction matrix errors in closed-loop without introducing any degradation in the observations. This is done thanks to identification methods and optimization theory. First, we formally describe the problem and the difficulties of such an identification in closed-loop configuration. Then, we present 2 solutions, based on the optimization of the error of estimates of the WFS slopes, at the output of the closed-loop AO. The performance of the methods and their limitations are discussed formally and thanks to numerical simulations of a high order AO system. We finally explore to which extent these methods currently studied for the Adaptive Optics Facility (AOF) at the VLT can be applied to the E-ELT.

  20. Anemia e peso ao nascer Anemia and birthweight

    Directory of Open Access Journals (Sweden)

    Taqueco T Uchimura

    2003-08-01

    Full Text Available OBJETIVO: Verificar a influência do baixo peso ao nascer (BPN na anemia e desnutrição da criança, ao longo do primeiro ano de vida. MÉTODOS: A população amostral foi constituída por todas as crianças menores de um ano de idade atendidas nas unidades de saúde do Município de Maringá, PR, em 1998, num total de 587. Considerou-se baixo peso ao nascer, todas as crianças com peso OBJECTIVE: To verify the influence of Low Birthweight (LBW on child anemia and malnutrition during the first year of life. METHODS: Sample population included all children under one year seen at Health Units of the municipality of Maringá, southern Brazil, in 1998. Total sample size was 587 children. LBW was defined as birthweight below 2 500 g. The analysis of growth for the weigh-for-age and height-for-age indicators was based on NationalCenter for HealthSstatiscs standards. For anemia diagnosis, a biochemical hemoglobin concentration dosage, using HemoCue direct colorimetric method was employed. Children with [Hb] <11,0 g/dL were considered as anemic. RESULTS: Fifty-eight percent of the studied population were anemic, and 37 children (6.3% presented LBW. Anemia was more prevalent during the second semester of life (p=0.0093. Undernutrition, as indicated by the height-for-age indicator, was high especially for children aged 0-3 months with LBW. CONCLUSIONS: Although LBW rates among the studied population were similar to those of developed countries, we suggest the implementation of specific antenatal care for high-risk women, aiming at reducing LBW, an event that affects the child, hampering its growth and increasing the risk of anemia and its countless deleterious consequences.

  1. Child abuse: a common problem in Curaçao?

    Science.gov (United States)

    Klein, K; Boersma, A A; Meyboom-de Jong, B; de Bruijn, J

    2013-02-01

    To assess the prevalence of child abuse among high school students in Curacao. A questionnaire survey among high school students up to 17 years of age was conducted. The questionnaire was based on existing literature and validated questionnaires. The questionnaire used was analysed and adapted to the situation in Curaçao by a panel of experts on child abuse. The primary objective was to gain insight into the incidence, prevalence and various forms of child abuse among students in Curaçao. Five forms of child abuse are distinguished in the literature: physical abuse, emotional abuse, sexual abuse, neglect and exploitation. Furthermore, the degree of confidence of the students in general practitioners (GPs) as care providers in the field of child abuse was explored. Questionnaires from 545 of the 628 respondents were included. In total, 43% of the respondents had ever-experienced an event which could be defined as (a form of) child abuse. More than one-third of the respondents reporting child abuse ever had an experience that could be interpreted as physical abuse. More than 15% of the respondents reporting child abuse had experienced sexual abuse. Girls experienced significantly more sexual abuse than boys. Emotional abuse in the last year was experienced by 3% of the respondents. One per cent of the respondents ever-experienced neglect. According to most respondents, GPs were not seen as care providers in cases of child abuse; they believed that GPs were mainly to be consulted for illnesses or physical symptoms and not for forms of child abuse. The prevalence of ever-having-experienced a form of child abuse is estimated at 431 per 1000 students. Child abuse, particularly physical abuse, is common in Curaçao, and is probably comparable to other surrounding countries. General practitioners were not seen as care providers in identifying and reporting cases of child abuse according to most respondents.

  2. Assistência de enfermagem humanizada ao paciente em UTI

    OpenAIRE

    Vieira, Claudir Aparecido; Maia, Luiz Faustino dos Santos

    2013-01-01

    Hoje em dia a humanização é ponto de pauta nos encontros nacionais e internacionais da área da saúde. Assim, cada vez mais enfermeiros nas unidades de terapia intensiva tem se preocupado com a sua prática. O presente estudo foi desenvolvido com o objetivo de compreender, reconhecer e entender como o comportamento humanizado reflete ao paciente e identificar a percepção da equipe de enfermagem sobre o processo de humanização. Trata-se de uma pesquisa de revisão bibliográfica descritiva com aná...

  3. Resistencia ao brometo de etidio em aspergillus nidulans

    OpenAIRE

    Maria Elizabeth Scarazzatti Frau

    1985-01-01

    Resumo: O presente trabalho teve por objetivo isolar e ana-lisar geneticamente mutantes de Aspergillus nidulans resistentes ao Brometo de Etídio (BE), bem como estudar os efeitos da riboflavina em relação a toxicidade do BE. Foram isolados mutantes espontâneos e induzidos. Dos mutantes isolados espontaneamente apenas 3 continuaram a apresentar resistência, sendo 1 da linhagem A e 2 da linhagem biAl methGl. Os outros mutantes (16) foram obtidos por indução com luz ultravioleta. Destes apenas 9...

  4. Stream-Field Interactions in the Magnetic Accretor AO Piscium

    Science.gov (United States)

    Hellier, Coel; van Zyl, Liza

    2005-06-01

    UV spectra of the magnetic accretor AO Psc show absorption features for half the binary orbit. The absorption is unlike the wind-formed features often seen in similar stars. Instead, we attribute it to a fraction of the stream that overflows the impact with the accretion disk. Rapid velocity variations can be explained by changes in the trajectory of the stream depending on the orientation of the white dwarf's magnetic field. Hence, we are directly observing the interaction of an accretion stream with a rotating field. We compare this behavior to that seen in other intermediate polars and in SW Sex stars.

  5. Atenção ao Suicídio

    Directory of Open Access Journals (Sweden)

    Berenice Rheinreimer

    2015-11-01

    Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.

  6. Aspect-Oriented Business Process Modeling with AO4BPMN

    Science.gov (United States)

    Charfi, Anis; Müller, Heiko; Mezini, Mira

    Many crosscutting concerns in business processes need to be addressed already at the business process modeling level such as compliance, auditing, billing, and separation of duties. However, existing business process modeling languages including OMG's Business Process Modeling Notation (BPMN) lack appropriate means for expressing such concerns in a modular way. In this paper, we motivate the need for aspect-oriented concepts in business process modeling languages and propose an aspect-oriented extension to BPMN called AO4BPMN. We also present a graphical editor supporting that extension.

  7. O papel do leite ao longo do ciclo de vida

    OpenAIRE

    Lima, Joana Catarina Dinis

    2012-01-01

    Resumo da tese: A presença do leite nos guias alimentares denota a sua importância na alimentação humana. Contudo, não é consensual que este alimento deva fazer parte da nossa alimentação ao longo de todo o ciclo de vida. Sabe-se que cada espécie produz um tipo de leite diferente, com diversas moléculas bioativas e nutrientes que modulam o seu crescimento e desenvolvimento corporal. Recentemente, uma parte da fração proteica do leite tem sido apontada como tendo um possível efeito estimulante...

  8. Apple fruit copper amine oxidase isoforms: peroxisomal MdAO1 prefers diamines as substrates, whereas extracellular MdAO2 exclusively utilizes monoamines.

    Science.gov (United States)

    Zarei, Adel; Trobacher, Christopher P; Cooke, Alison R; Meyers, Ashley J; Hall, J Christopher; Shelp, Barry J

    2015-01-01

    4-Aminobutyrate (GABA) accumulates in apple fruit during controlled atmosphere storage. A potential source of GABA is the polyamine putrescine, which can be oxidized via copper-containing amine oxidase (CuAO), resulting in the production 4-aminobutanal/Δ(1)-pyrroline, with the consumption of O2 and release of H2O2 and ammonia. Five putative CuAO genes (MdAO genes) were cloned from apple (Malus domestica Borkh. cv. Empire) fruit, and the deduced amino acid sequences found to contain the active sites typically conserved in CuAOs. Genes encoding two of these enzymes, MdAO1 and MdAO2, were highly expressed in apple fruit and selected for further analysis. Amino acid sequence analysis predicted the presence of a C-terminal peroxisomal targeting signal 1 tripeptide in MdAO1 and an N-terminal signal peptide and N-glycosylation site in MdAO2. Transient expression of green fluorescent fusion proteins in Arabidopsis protoplasts or onion epidermal cells revealed a peroxisomal localization for MdAO1 and an extracellular localization for MdAO2. The enzymatic activities of purified recombinant MdAO1 and MdAO2 were measured continuously as H2O2 production using a coupled reaction. MdAO1 did not use monoamines or polyamines and displayed high catalytic efficiency for 1,3-diaminopropane, putrescine and cadaverine, whereas MdAO2 exclusively utilized aliphatic and aromatic monoamines, including 2-phenylethylamine and tyramine. Together, these results indicate that MdAO1 may contribute to GABA production via putrescine oxidation in the peroxisome of apple fruit under controlled atmosphere conditions. MdAO2 seems to be involved in deamination of 2-phenylethylamine, which is a step in the biosynthesis of 2-phenylethanol, a contributor to fruit flavor and flower fragrance. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  9. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  10. Titanium alloys (AoN) and their involvement in osseointegration.

    Science.gov (United States)

    Danza, Matteo; Zollino, Ilaria; Candotto, Valentina; Cura, Francesca; Carinci, Francesco

    2012-12-01

    Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. The expression levels of some bone-related (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analyzed using real time reverse transcription-polymerase chain reaction (real time RT-PCR). Real-time RT-PCR data showed that after 3 days of treatment with TiA4GR, the genes up-regulated were COL3A1, ALPL, SPP1, and RUNX2. Moreover, no difference in gene expression was noticed 4 days later. On the other hand, the genes that overexpressed after 3 days of treatment with AoN5GR were ALPL, SPP1, and RUNX2. In both cases, the expression of COL1A1 and SPARC was negatively regulated. Our data showed that both titanium surfaces led to osteoblasts recruitment, maturation, and differentiation, thus promoting osseointegration at the tissue-implant interface.

  11. Atribuições de significados ao transplante renal

    Directory of Open Access Journals (Sweden)

    Quintana, Alberto M.

    2011-01-01

    Full Text Available Este trabalho teve foco na investigação das atribuições de significados ao transplante renal de pacientes com Insuficiência Renal Crônica (IRC de um Hospital Universitário da Região Sul. Foi utilizado um método qualitativo e participaram doze pessoas na pesquisa. Os instrumentos utilizados foram a entrevista semidirigida e a autofotografia. Para a análise dos dados foi empregada a técnica de análise de conteúdo, o que permitiu que fossem construídas quatro categorias temáticas: a ansiedade da espera, os conflitos ante o doador, as expectativas em relação ao devir e a vida antes e depois do transplante. Constatou-se que a possibilidade deste traz consigo uma série de repercussões psíquicas devido o fato de ser visto como algo que restitui a vida, proporciona bem-estar e sentimento de liberdade, mesmo levando em consideração que ainda persistem os cuidados com o corpo, com a alimentação e com os remédios

  12. New Results from the AO327 Drift Pulsar Survey

    Science.gov (United States)

    Deneva, Julia S.; Stovall, K.; McLaughlin, M.; Bates, S.; Freire, P.; Martinez, J.; Jenet, F.; Bagchi, M.

    2014-01-01

    The Arecibo 327 MHz drift pulsar survey (AO327) has operated since 2010 and aims to cover the entire Arecibo sky (declinations of -1 to 38 degrees). We present details on the progress of the survey and a new set of discoveries over the past year. Phase 1 of AO327 targets declinations of -1 to 28 degrees and is 55% complete; Phase 2 will target declinations of 28 to 38 degrees. The survey is expected to be completed in 2017. Out of a total of 28 new pulsars, 12 were found in 2013, including three millisecond pulsars. PSR J2234+06 has a rotation period of 3.58 ms and is in a 32-day orbit in a binary system with a white dwarf companion. This pulsar is bright and a very stable rotator, making it suitable for inclusion in Pulsar Timing Arrays. The orbit of J2234+06 has an eccentricity of 0.13, which cannot be accounted for by stellar evolution but may be explained by an origin in a subsequently disrupted hierarchical triple, or by an exchange interaction. PSR J0509+08 has a period of 4.06 ms and is in a 4.9-day binary system with a white dwarf companion. This pulsar is also a candidate for inclusion in PTAs.

  13. UMA PROPOSTA DE ABORDAGEM AO PROBLEMA DE FLÁVIO JOSEFO APLICADA AO ENSINO MÉDIO

    OpenAIRE

    Márcia Erondina Dias de Souza

    2013-01-01

    Neste trabalho, apresentamos uma sequência didática de atividades elaboradas para um grupo de alunos do ensino médio, na faixa etária de 15 a 18 anos, tendo como principal objetivo estudar o problema proposto pelo matemático Flávio Josefo, nos meados do ano 64. Conta a lenda que um grupo de rebeldes, dentre eles Flávio Josefo, foi encurralado numa caverna pelo exército inimigo. Preferindo o suicídio à captura, os rebeldes decidiram formar um círculo e, contando ao longo dest...

  14. OBSOLESCÊNCIA PROGRAMADA E TEORIA DO DECRESCIMENTO VERSUS DIREITO AO DESENVOLVIMENTO E AO CONSUMO (SUSTENTÁVEIS)

    OpenAIRE

    Oliveira da Silva, Maria Beatriz Beatriz; UNiversidade Federal de Santa Maria (UFSM)

    2012-01-01

    Inspirado em um documentário intitulado “Prêt à Jeter”, este texto tem como objetivo central colocar em apreciação algumas reflexões acerca da obsolescência programada como uma das estratégias do modelo de desenvolvimento capitalista e ensaiar uma reposta às seguintes questões: para combater a obsolescência programada se faz necessária a defesa de uma “teoria do decrescimento”? Sendo a obsolescência programada uma das estratégias da sociedade de consumo, é possível combatê-la e, ao mesmo temp...

  15. Performance of the Sewage Treatment Plant of S˜ao Jo˜ao de Iracema (Brazil

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    2016-05-01

    Full Text Available Context: Some of the most important parameters measured in the sewage treatment plant –STP- are: organic matter, solids and faecal organisms. The objective of this work was to diagnose the performance of S˜ao Jo˜ao de Iracema STP for those parameters removal. Method: A batimetric survey of the anaerobic and facultative lagoons; the STP influent and effluent monitoring in three different climate seasons of 3-month long each were conducted by dissolved oxygen, pH, temperature, BOD, filtered BOD, COD, solids and coliforms measuring. Results: Sludge accumulations of 1.3 and 6.5% in the anaerobic and facultative lagoons were registered; average BOD removal was of 73.6%, smaller than the 80% recommended by Brazilian legislation; the average faecal coliform number on final effluent was of 9.55*106/100mL, above the per-missible limit of 1000/100mL. Conclusions: The STP needs to set-up a post treatment system that guarantees additional organic matter removal and fecal coliforms in order to adjust the effluent quality to the environmental legislation standards.

  16. Forma musical como um processo: do isomorfismo ao heteromorfismo

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2016-05-01

    Full Text Available Este artigo se propõe a analisar a questão da forma musical a partir do momento em que temos, no início do século XX, uma ruptura com sua predeterminação, passando a se configurar como o resultado de diferentes operações ou processos de composição. Neste contexto, abordamos a noção de forma estatística, ligada ao isomorfismo e à continuidade entre as diferentes escalas temporais presentes numa obra musical (MEYER-EPPLER, 2009 [1954]; STOCKHAUSEN 1959; EIMERT, 1959 e ao princípio do grau de mudança (STOCKHAUSEN, 1989b [1958]; KOENIG, 1963, 1965, bem como a noção da forma como uma emergência, ligada ao heteromorfismo e à descontinuidade entre as diversas escalas temporais (VAGGIONE, 1994, 2010. Para tanto, trazemos como fundamentação teórica o método alagmático e o princípio da individuação das formas de Gilbert Simondon (2005, assim como as características morfológicas perceptivas de saliência (saillance e pregnância (prégnance de René Thom (1988, 1990a, além de sua teoria das catástrofes (THOM, 1985. No contexto proposto, a fusão de timbres é pensada como um processo alagmático gerador de novas formas, sendo analisada a partir de diferentes possibilidades tais como por jitter (DUBNOV; TISHBY; COHEN, 1997, síntese granular, permeabilidade (LIGETI, 2010a [1958], micropolifonia (LIGETI, 2010c [1980] e convolução (ERBE, 1997; JAFFE, 1987; ROADS, 1993; VAGGIONE, 1996. Concluímos a respeito dos processos de fusão analisados não apenas considerando-os isoladamente, mas como operações que propiciam o nascimento da forma musical, afirmando o pensamento da forma como um processo e não como algo definido a priori.

  17. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  18. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  19. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Cenir Gonçalves Tier; Valéria Lerch Lunardi; Silvana Sidney Costa Santos

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar ...

  20. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Tier, Cenir Gonçalves; Lunardi, Valéria Lerch; Santos, Silvana Sidney Costa

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edg...

  1. Empreendedorismo: do ensino básico ao ensino superior

    OpenAIRE

    Gonçalves, Vitor

    2009-01-01

    A Sociedade da Informação exige cada vez mais indivíduos com capacidade e espírito empreendedor. Embora seja visto como uma resposta ao problema do desemprego através da promoção do auto-emprego, o empreendedorismo deve assumir uma semântica mais abrangente. Não basta correr o risco e criar empresas, é necessário procurar fazê-lo com responsabilidade, competência e excelência. Mas, essa atitude empreendedora não é apenas apanágio dos gestores ou empresários, terá de ser também uma necessi...

  2. MODERNIDADE E LIBERTAÇÃO: DOIS DESAFIOS AO CRISTIANISMO

    Directory of Open Access Journals (Sweden)

    . Editorial

    1987-01-01

    Full Text Available A recente Assembléia Geral da Sociedade de Teologia e Ciências da Religião (SOTER, reunida em Belo Horizonte de 6 a 9 de julho passado, dedicou boa parte de seus trabalhos ao "debate em torno da Modernidade em relação com as preocupações da Teologia da Libertação no Brasil". Está mais uma vez relançada a sempre conflitiva questão da relação entre Cristianismo e Modernidade, só que agora percebida num Continente que não simplesmente goza de algumas luzes da Modernidade, como também sofre efeitos perversos deste processo histórico.

  3. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  4. Sophia, Mésseder e um Timor contado aos jovens

    OpenAIRE

    Albuquerque, Pedro; Azevedo, Fernando; Vergopolan, Roseli

    2015-01-01

    Devido a sucessivos e quase ininterruptos períodos bélicos e de ocupação, a fragilidades socioeconómicas e à ausência de um ensino sistematizado numa língua oficial, a produção literária timorense escrita revela-se bastante modesta. Apesar de a literatura timorense ter assistido ao despertar do género romanesco - sendo Luís Cardoso o mais proeminente escritor de Timor -, a invenção literária dedicada a um público mais jovem é praticamente inexistente. Ainda assim, os jovens timorenses, que tê...

  5. MODULACIÓN CONTEXTUAL EN LA EXTINCIÓN: RECUPERACIÓN DE UNA AVERSIÓN CONDICIONADA AL SABOR EN UN TERCER CONTEXTO/CONTEXTUAL MODULATION OF EXTINCTION: RECOVERY OF TASTE-AVERSION CONDITIONING IN A THIRD CONTEXT/ MODULAÇÃO CONTEXTUAL NA EXTINÇÃO: RECUPERAÇÃO DE UMA AVERSÃO CONDICIONADA AO SABOR EM UM TERCEIRO CONTEXTO

    Directory of Open Access Journals (Sweden)

    Rodolfo Bernal-Gamboa

    2011-12-01

    Full Text Available Este experimento se diseñó para evaluar la renovación ABC con un procedimiento de condicionamiento de aversión al sabor (CAS en tres fases: adquisición, extinción y prueba. Durante la adquisición, 15 ratas Wistar, asignadas a los grupos ABC y ABB, tuvieron acceso a una solución con sacarosa y posteriormente recibieron una inyección de cloruro de litio (LiCl en el Contexto A. En la extinción, ambos grupos bebieron la solución con sacarosa sin la administración del LiCl en el Contexto B. En la prueba, los grupos tuvieron acceso a la solución con sacarosa sin administrarles LiCl en el contexto de extinción para el grupo ABB, y en un tercer contexto para el grupo ABC. Los resultados mostraron la recuperación de la aversión condicionada al sabor únicamente en el grupo ABC.

  6. Mood changes in the course of preparation for the Brazilian university admission exam - a longitudinal study Alterações de humor ao longo da preparação para o vestibular - um estudo longitudinal

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Monteiro Peluso

    2010-03-01

    Full Text Available OBJECTIVE: Academic examinations are an important source of stress for students. This study is intended to assess senior high school students' mood changes during the preparation for a very important academic examination, the Brazilian university admission examination. METHOD: Positive and Negative Affect Schedule - Expanded Form was used to assess the students three times in the course of the months preceding the examination. RESULTS: ANOVA for repeated measures showed that Negative Affect increased as the examination approached, and that this increment was already present months before the examinationtookplace. Asingle conditionallyindependent random effect model showed that time spent studying was associated with fluctuations in mood. CONCLUSION: Teenagers, in preparation for a very important examination, may present mood disturbances associated with both the proximity of the examination and their study load months before the examination actually takes place. Other stressing factors may play a role in these findings and should be further investigated.OBJETIVO: Exames acadêmicos são uma fonte importante de estresse para estudantes. Este estudo teve como objetivo avaliar alterações de humor em estudantes de terceiro ano do Ensino Médio ao longo da preparação para um exame acadêmico de grande importância, o vestibular. MÉTODO: Positive and Negative Affect Schedule - Expanded Form foi utilizado para avaliar os estudantes três vezes ao longo dos meses antecedendo o exame. RESULTADOS: ANOVA para medidas repetidas mostrou que o afeto negativo aumentou com a aproximação do exame e que esse aumento já estava presente meses antes dele acontecer. Um modelo de efeitos aleatórios com independência condicional mostrou que o tempo de estudo estava associado às flutuações de humor. CONCLUSÃO: Adolescentes em preparação para exames muito importantes podem apresentar um distúrbio de humor associado à proximidade do exame e à quantidade

  7. HST and Keck AO Images of Vortices on Jupiter

    Science.gov (United States)

    de Pater, Imke; Wong, M.; Luszcz-Cook, S.; Adamkovics, M.; Marcus, P.; Asay-Davis, X.; Conrad, A.; Go, C.

    2009-09-01

    Observations of Jupiter were conducted in April 2006 and May 2008 with both HST (250-890 nm) and the 10-m Keck telescope. On Keck we used the near-infrared camera NIRC2, coupled to the AO system, at 1.2 to 5 micrometers. At 5 um we are sensitive to Jupiter's thermal emission in cloud-free regions of the atmosphere, while at 1.2 um we see reflected sunlight from hazes and clouds in the troposphere-stratosphere. All small ovals (i.e., all except for Oval BA and the GRS) appear to be surrounded by bright rings at 5 mu, with typical brightness temperatures of 225-250 K, and hence probing depths to 2.5-4 bar. We argue that the small vortices are columnar structures, extending down into the water cloud. Air is rising along the center of these vortices, and descending around the outer periphery; the storm systems are likely fueled by the latent heat released from the water cloud. The descending part of the vertical circulation in the larger ovals is within the ovals, likely at the location of the red ring in Oval BA, which may indicate the maximum radial distance where such return flows can take place. On 19 July 2009, amateur observer Anthony Wesley (Australia) reported a dark spot/streak on Jupiter, near a southern latitude of 56 deg, which he attributed to an impact (analogous to the SL9 impact on Jupiter). We are scheduled to observe Jupiter with the Keck AO system on 24 July 2009 UT; if observations are successful, we will report preliminary results.

  8. Comportamento do gramado submetido aos herbicidas clethodim e sethoxydim.

    Directory of Open Access Journals (Sweden)

    Cleber D. de G. Maciel

    2007-06-01

    Full Text Available O principal fator do custo de manutenção de um gramado é o corte na altura adequada. O crescimento vegetativo e reprodutivo do gramado formado com grama-batatais (Paspalum notatum Flügge, submetido às doses de clethodim e sethoxydim foi avaliado em dois experimentos conduzidos no campus urbano da Escola Superior de Agronomia de Paraguaçu Paulista-ESAPP (SP, em gramado já estabelecido. Foi utilizado o delineamento experimental de blocos casualizados com seis tratamentos e quatro repetições, representados por clethodim nas subdoses de 0,0000; 0,0037; 0,0075; 0,0150; 0,0300 e 0,0600 kg i.a. ha-1, assim como pelo sethoxydim a 0,0000; 0,0156; 0,0312; 0,0625; 0,1250 e 0,2500 kg i.a. ha-1. O clethodim e sethoxydim, aos 7 DAA, intoxicaram as plantas a partir das doses de 0,0300 e 0,1250 kg ha-1, respectivamente. Os sintomas de intoxicação, aos 49 DAA, praticamente desapareceram para todos os tratamentos. O teor de clorofila nas folhas não apresentou diferenças significativas entre as subdoses de clethodim e sethoxydim em relação à testemunha, em nenhuma das épocas estudadas. Houve redução progressiva da altura média e no número de inflorescências do gramado em função do incremento das doses de clethodim e sethoxydim. Estes herbicidas apresentam viabilidade na redução vegetativa e reprodutiva da espécie P. notatum, sendo o sethoxydim mais seletivo em relação à preservação das características visuais do gramado

  9. Estilos de Aprendizagem versus Treinamento Vivencial ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Luciano Munck

    2010-04-01

    Full Text Available O objetivo deste estudo foi analisar a relação entre estilos individuais de aprendizagem e o treinamento vivencial ao ar livre. Os treinamentos vivenciais tiveram como técnicas o arvorismo, dinâmicas de grupo e paintball. Para alimentar a análise, foram aplicados dois instrumentos de pesquisa a cento e cinco participantes dos treinamentos: o Learning Style Inventory (LSI e um questionário para identificação da satisfação. A coleta de dados foi realizada nos próprios locais de treinamento, sendo a identificação dos estilos de aprendizagem realizada antes, e a da satisfação, depois dos treinamentos. Os dados evidenciaram que o estilo de aprendizagem predominante entre os participantes da pesquisa foi o estilo acomodador(24,8%. A satisfação foi predominantemente alta, com 100% das respostas variando entre mais ou menos satisfeito e muito satisfeito (arvorismo P=0,006. Os dados da pesquisa demonstraram fraca influência dos estilos individuais de aprendizagem na maior ou menor satisfação para com os treinamentos recebidos. Em suma, concluiu-se que os treinamentos vivenciais ao ar livre possuem características que proporcionam alta satisfação para diferentes habilidades e estilos de aprendizagem. Informação essa que deveria ser levada em consideração por gestores e líderes no momento de planejar e estruturar programas de treinamento e desenvolvimento para seus colaboradores.

  10. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at the university hospitals in Bern and Lausanne (Switzerland). Patient charts were retrospectively reviewed and fractures were classified from standard radiographs. Results - Of 2,292 upper extremity fractures in 2,203 children and adolescents, 26% involved the humerus and 74% involved the forearm. In the humerus, 61%, and in the forearm, 80% of single distal fractures involved the metaphysis. In adolescents, single humerus fractures were more often epiphyseal and diaphyseal fractures, and among adolescents radius fractures were more often epiphyseal fractures than in other age groups. 47% of combined forearm fractures were distal metaphyseal fractures. Only 0.7% of fractures could not be classified within 1 of the child-specific fracture patterns. Of the single epiphyseal fractures, 49% were Salter-Harris type-II (SH II) fractures; of these, 94% occurred in schoolchildren and adolescents. Of the metaphyseal fractures, 58% showed an incomplete fracture pattern. 89% of incomplete fractures affected the distal radius. Of the diaphyseal fractures, 32% were greenstick fractures. 24 Monteggia fractures occurred in pre-school children and schoolchildren, and 2 occurred in adolescents. Interpretation - The pattern of pediatric fractures in the upper extremity can be comprehensively described according to the PCCF. Prospective clinical studies are needed to determine its clinical relevance for treatment decisions and

  11. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the lower extremities of a representative population of children classified according to the PCCF. Patients and methods - We included patients up to the age of 17 who were diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at either of 2 tertiary care university hospitals in Switzerland. Patient charts were retrospectively reviewed. Results - More lower extremity fractures occurred in boys (62%, n = 341). Of 548 fractured long bones in the lower extremity, 25% involved the femur and 75% the lower leg. The older the patients, the more combined fractures of the tibia and fibula were sustained (adolescents: 50%, 61 of 123). Salter-Harris (SH) fracture patterns represented 66% of single epiphyseal fractures (83 of 126). Overall, 74 of the 83 SH patterns occurred in the distal epiphysis. Of all the metaphyseal fractures, 74 of 79 were classified as incomplete or complete. Complete oblique spiral fractures accounted for 57% of diaphyseal fractures (120 of 211). Of all fractures, 7% (40 of 548) were classified in the category "other", including 29 fractures that were identified as toddler's fractures. 5 combined lower leg fractures were reported in the proximal metaphysis, 40 in the diaphysis, 26 in the distal metaphysis, and 8 in the distal epiphysis. Interpretation - The PCCF allows classification of lower extremity fracture patterns in the clinical setting. Re-introduction of a specific code for toddler's fractures in the PCCF should be considered.

  12. Hipometilação do LINE-1 está Associada ao Risco de Doença Cardíaca Coronariana na População Chinesa

    Directory of Open Access Journals (Sweden)

    Li Wei

    2014-06-01

    Full Text Available Fundamentos: O nível de metilação global do ADN de leucócitos no sangue tem sido associado ao risco de doença arterial coronariana (DAC, com resultados inconsistentes em diferentes populações. Faltam dados semelhantes da população chinesa, onde diferentes fatores genéticos, de estilo de vida e ambientais podem afetar a metilação do ADN e sua relação com o risco de DCC. Objetivos: Analisar se a metilação global está associada ao risco de doença coronariana na população chinesa. Métodos: Foram incluídos um total de 334 casos de DCC e 788 controles saudáveis. A metilação global do ADN de leucócitos de sangue foi estimada por meio da análise das repetições do LINE-1 usando pirosequenciamento de bissulfito. Resultados: Em uma análise inicial restrita aos controles o nível do LINE-1 diminui significativamente com a idade avançada, colesterol total elevado, e diagnóstico de diabetes. Na análise de caso-controle, a redução da metilação do LINE-1 foi associada ao aumento do risco de DCC, tendo a análise por quartil revelado uma odds ratio (IC 95% de 0,9 (0,6-1,4, 1,9 (1,3-2,9 e 2,3 (1,6 3.5 para o terceiro, segundo e primeiro (o mais baixo quartil (P da tendência < 0,001, respectivamente, em comparação com o quarto (o mais alto quartil. A metilação inferior (< mediana do LINE-1 esteve associada a 2,2 vezes (IC 95% = 1,7-3,0 o aumento de risco de doença coronariana. As estimativas de risco de DCC menores relacionadas com o LINE-1 tenderam a ser mais fortes entre os indivíduos com maior tercil de homocisteína (P interação = 0,042 e naqueles com diagnóstico de hipertensão arterial (P interação = 0,012. Conclusão: A hipometilação do LINE-1 está associada ao risco de doença coronariana na população chinesa. Fatores de risco de DCC potenciais tais como a idade avançada, colesterol total elevado, e diagnóstico de diabetes podem ter impacto na metilação global do ADN, exercendo, portanto, o seu

  13. Prevalência da colonização vaginal e anorretal por estreptococo do grupo B em gestantes do terceiro trimestre Prevalence of vaginal and anorectal colonization by group B streptococcus in pregnant women in the last three months of gestation

    Directory of Open Access Journals (Sweden)

    Cláudio Beraldo

    2004-08-01

    Full Text Available OBJETIVOS: estudar a prevalência da colonização por estreptococo do grupo B em gestantes do terceiro trimestre, atendidas em um hospital regional, e avaliar a associação da colonização com as variáveis maternas demográficas e clínicas. MÉTODOS: no período de 8 de outubro de 2002 a 26 de março de 2003, foi realizado um estudo transversal (de prevalência com 309 gestantes no terceiro trimestre. Amostras de secreção vaginal e anorretal foram coletadas e testadas para identificação presuntiva do estreptococo do grupo B. Foram incluídas as gestantes com gestação maior ou igual a 36 semanas datadas por ultra-sonografia e excluídas as que se recusaram a participar, as em uso de antibioticoterapia e as que haviam sido submetidas a exame ginecológico pelo período mínimo de 24 horas antes da coleta. As gestantes foram caracterizadas por variáveis demográficas (raça, idade, grau de escolaridade, renda familiar e número de gestações e clínicas (idade gestacional, ocorrência de infecção urinária durante a gestação atual, ruptura prematura de membranas e tempo de bolsa rota, febre materna intraparto, corioamnionite, líquido amniótico com mecônio, via de parto utilizada, febre materna pós-parto e endometrite. RESULTADOS: das gestantes, 46 estavam colonizadas pelo estreptococo do grupo B, sendo que 26 (56,5% tiveram a cultura vaginal positiva, 8 (17,4% a cultura anorretal positiva e 12 (26,5% tiveram tanto a cultura vaginal como a retal positivas. Nenhuma das variáveis analisadas neste estudo foi estatisticamente significativa quanto à colonização pelo estreptococo do grupo B. Os resultados obtidos foram submetidos à análise bivariada pelo teste do chi2 e teste exato de Fisher quando apropriado. CONCLUSÃO: a taxa de prevalência da colonização vaginal e anorretal pelo estreptococo do grupo B em gestantes no terceiro trimestre, foi de 14,9%. Não houve associação entre fatores de risco (primigestação, idade

  14. Duas grandes transformações ao mesmo tempo: atitudes em relação à alimentação e ao corpo em gestantes adolescentes

    OpenAIRE

    Carolina Marques Oliboni

    2014-01-01

    Introdução - Adolescência e gestação são caracterizadas por intensas transformações relacionadas ao corpo, e ocorrendo concomitantemente podem potencializar riscos para o surgimento de problemas com a imagem corporal, atitudes alimentares disfuncionais e comportamentos de risco para transtornos alimentares. Objetivo - Avaliar as atitudes em relação à alimentação, ao peso e ao corpo de um grupo de adolescentes grávidas. Métodos - Uma amostra de adolescentes grávidas (n=67) foi avaliada por mei...

  15. A contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle: um estudo sobre duas empresas de grande porte do setor automotivo

    OpenAIRE

    Quintairos, Paulo César Ribeiro; Andrade, Alequexandre Galvez de; Oliveira, Edson Aparecida de Araújo Querido

    2011-01-01

    A contabilidade gerencial é uma importante ferramenta para o planejamento e controle das organizações, pois integra medidas financeiras e não financeiras. O conjunto dessas informações forma um sistema integrado cuja finalidade é avaliar o alinhamento da produção de uma empresa aos seus objetivos estratégicos. Neste trabalho será apresentado um estudo sobre o uso da contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle de duas empresas de grande porte do setor automob...

  16. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford

    2012-10-01

    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como

  17. Robo-AO KP: A new era in robotic adaptive optics

    Science.gov (United States)

    Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy

    2016-01-01

    Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.

  18. Adesão de pessoas com diabetes mellitus tipo 2 ao tratamento medicamentoso

    OpenAIRE

    BOAS, Lilian Cristiane Gomes-Villas; Foss-Freitas, Maria Cristina; Pace, Ana Emilia

    2014-01-01

    Estudo seccional de abordagem quantitativa que objetivou avaliar a adesão ao tratamento medicamentoso entre pessoas com diabetes mellitus, e sua relação com variáveis clínicas, de tratamento e controle metabólico. A amostra constituiu-se de 162 pessoas com diabetes mellitus tipo 2 em seguimento ambulatorial. Para a coleta dos dados, foram utilizadas a Medida de Adesão aos Tratamentos e a consulta aos prontuários dos participantes. Obteve-se elevada adesão ao tratamento medicamentoso. Para um ...

  19. COMO ENTENDER E ATENDER AOS DIREITOS DAS MINORIAS?

    Directory of Open Access Journals (Sweden)

    Maria Cristina Alves Delgado de Ávila

    2014-05-01

    Full Text Available No âmbito do Estado Democrático de Direito, um Governo representa a maioria. Conforme os ditames da Constituição Federal de 1988 – CRFB/88 -, a maioria pode organizar-se e decidir sobre os assuntos públicos de um determinado Estado. Dentro da idéia de maioria, tem-se o grupo que, em certo momento, encontra-se no poder com o direito de liderar os demais indivíduos ocupantes de um território. A minoria é o oposto. Para garantir a harmonia social, a maioria não tem o direito de oprimir a minoria e não deve retirar os direitos e as liberdades fundamentais de um grupo minoritário ou mesmo de um indivíduo. Ao contrário, a maioria deve garantir o pluralismo cultural de um povo dentro de um território. Partindo da hermenêutica dos direitos das minorias, pretende-se responder a pergunta como entender e atender a estes direitos.

  20. Subsunção do trabalho imaterial ao capital

    Directory of Open Access Journals (Sweden)

    Eleutério F. S. Prado

    Full Text Available O presente artigo examina a transformação do modo de produção capitalista que acompanha a expansão do trabalho imaterial como fonte de geração de riqueza efetiva. Essa avaliação é feita no interior da teoria do valor-trabalho e da crítica da economia política. Para tanto, interroga, primeiro, o verdadeiro impacto da informatização na natureza capitalista dos processos produtivos atualmente em andamento, principalmente nos países centrais. Compara, depois, as principais características da indústria taylorista com as características marcantes da indústria pós-taylorista. Ao final, conclui que uma transformação importante do sistema capitalista está em curso: a grande indústria, tal como foi caracterizada por Marx em O Capital, não predomina mais nos países do centro do sistema, pois o que aí prevalece agora é a pós-grande indústria.

  1. Touraine, Burawoy, Gramsci: do social ao político

    Directory of Open Access Journals (Sweden)

    Leonardo Mello e Silva

    Full Text Available O ensaio empreende uma discussão da proposta da sociologia pública de Michael Burawoy, nos anos 2000, a partir da confrontação com a intervenção sociológica de Alain Touraine, formulada nos anos 1970. Pontos de contato são detectados no que diz respeito à relação entre pesquisador e pesquisado, como atores sociais. Problemas e limitações, tanto da intervenção sociológica quanto da sociologia pública, são elencados, trazendo-se como apoio exemplos extraídos de trabalho de campo próprio. O texto vale-se também da inspiração de Antonio Gramsci e sua concepção da relação entre senso comum e intelectuais. Ao invés de um juízo conclusivo, propõe-se um diálogo entre os autores, todos preocupados, à sua maneira, com o destino público ou cívico do conhecimento obtido sobre o mundo social.

  2. ROTEIRO DE VIAGEM AO PAÍS DE LACAN

    Directory of Open Access Journals (Sweden)

    Laéria Fontenele

    2015-12-01

    Full Text Available Grande leitor e crítico da cultura de seu tempo e um dos nomes de maior destaque da psicanálise contemporânea, Slavoj Žižek desfaz a fábula segundo a qual ler Lacan é um trabalho árduo e difícil que seria apenas privilégio dos especialistas em psicanálise e, com isso, brinda o seu leitor com um envolvente passeio pelo país de Lacan. De origem eslovena, e quase eleito presidente de seu país, Slavoj Žižek é autor de diversos livros - dentre os quais os instigantes ensaios “Hegel, o mais sublime dos histéricos” e “Eles não sabem o que dizem” -, a maioria publicada em por volta de trinta idiomas. É ele reconhecido como sendo um profundo conhecedor de Hegel e Karl Marx; apaixonado leitor de Sigmund Freud e de Jacques Lacan; crítico contundente das ideologias totalitárias, espírito cultivado por sua filia às múltiplas artes – sendo, inclusive, especialista na cinematografia de Alfred Hitchcock. Os traços de sua erudição e sensibilidade para com as artes, se refletem e particularizam, também, o seu estilo de escrever, o qual se encontra muito bem representado no modo como urdiu esse seu novo livro. “Como ler Lacan” nos ensina a adotar um método especial para orientar em uma tal empreitada. Žižek advoga que, para lermos Lacan, devemos aplicar o mesmo método empregado pela psicanálise para ler e interpretar o texto que resulta do trabalho inconsciente. Mas há uma condição para esse emprego: abandonar o vício de querer entender, pois, assim como o inconsciente, Lacan não deve ser compreendido e sim lido, pois, conforme ele mesmo já nos advertira, o pior destino a que podemos ser conduzidos é o destino que nos leva à compreensão. Só assim será fácil ler Lacan, mais do que, amiúde, se imagina. Muitas introduções ao seu ensino foram publicadas, algumas delas marcadas por rigor conceitual, outras resultaram em versões grosseiras de sua letra. Sem desmerecer as boas introduções a Lacan

  3. Das portarias aos bloquinhos: arte e apoio institucional ao Projeto Mais Médicos para o Brasil

    Directory of Open Access Journals (Sweden)

    Heloísa Germany

    Full Text Available Este ensaio apresenta experiências vivenciadas por uma artista visual integrante da equipe de Apoio Institucional do Ministério da Educação para o Projeto Mais Médicos para o Brasil (PMMB, uma proposta interministerial que aproxima de forma significativa processos de trabalho e formação relacionados à saúde e à educação. Por meio do que Roland Barthes chama de obtuso e por meio de uma metodologia hifográfica, investe-se na leveza e reinvenção de ações no campo da Saúde Coletiva na interface das artes como processos educativos sensíveis experimentados ao longo de dois anos junto com o PMMB. Por meio de pequenos blocos de anotações produzidos individualmente e por um coletivo de apoiadores, delineia-se um processo singular e sensível, contribuindo na discussão sobre o fortalecimento das coletividades, das redes de Atenção Básica, da formação para o Sistema Único de Saúde e da composição de olhares poético-políticos acerca do PMMB.

  4. Um conceito reinterpretado ao longo do século: do intelectual individualista de Durkheim ao intelectual coletivo de Bourdieu

    Directory of Open Access Journals (Sweden)

    Ione Ribeiro Valle

    2017-10-01

    Full Text Available Para contribuir com o debate sobre os intelectuais recorremos a dois sociólogos, distanciados um do outro cerca de um século: Émile Durkheim (1858-1917 e Pierre Bourdieu (1930-2002. O primeiro preconiza a relação entre uma “moral individualista” e o papel do intelectual. Esta reflexão integra o conjunto de suas apostas na coesão social e na moral laica, indispensáveis à promoção do progresso e da ordem nas sociedades em processo crescente de diferenciação. A perspectiva de Bourdieu volta-se à necessidade de “reinventar uma espécie de intelectual coletivo segundo o modelo do que foram os enciclopedistas”. Segundo ele, um novo desafio se impõe ao intelectual coletivo: mobilizar a ciência, e a sociologia em particular, na luta contra os usos abusivos da própria ciência e da autoridade científica. As ideias destes pensadores oferecem chaves de leitura que inspiram o desenvolvimento de uma sociologia histórica voltada à educação no pensamento social brasileiro.

  5. LA AUTONOMÍA DE LA PERSONA FRENTE AL DERECHO A LA VIDA NO INCLUYE EL DERECHO A SER MUERTO POR UN TERCERO: LA SOLICITUD DE ASISTENCIA AL SUICIDIO Y EL CASO DE DIANE PRETTY A AUTONOMIA DA PESSOA FRENTE AO DIREITO À VIDA NÃO INCLUI O DIREITO A SER MORTO POR UM TERCEIRO: A SOLICITAÇÃO AO SUICÍDIO ASSISTIDO E O CASO DE DIANE PRETTY A PERSON'S AUTONOMY VIS-À-VIS THE RIGHT TO LIFE DOES NOT INCLUDE THE RIGHT TO BE KILLED BY A THIRD PERSON: ASSISTANCE REQUEST TO COMMIT SUICIDE AND DIANE PRETTY'S CASE

    Directory of Open Access Journals (Sweden)

    Ángela Vivanco Martínez

    2002-01-01

    Full Text Available La autora, en la presente monografía, analiza las resoluciones pronunciadas por la House of Lords y por la Corte Europea de Derechos Humanos en el caso de Diane Pretty, ciudadana inglesa fallecida en mayo de 2002 quien, a causa de una enfermedad degenerativa e incurable, pretendió se reconociera inmunidad a su marido en caso de prestarle asistencia para suicidarse. Los fallos examinados rechazaron la solicitud de la recurrenteNa presente monografia a autora analisa as decisões emanadas pela Câmara do Lordes e Corte Européia de Direitos Humanos no caso Diane Pretty, cidadã inglesa falecida em maio de 2002 que em decorrência de enfermidade degenerativa incurável, pretendeu fosse reconhecida imunidade a seu marido para que a auxiliasse a suicidarse. As decisões recusaram a solicitação da recorrenteThe author of this monograph analyses the resolutions pronounced by the House of Lords and by the European Court of Human Rights in the case of Diane Pretty, an English citizen who died in may 2002. Because of a degenerative and incurable disease she pretended her husband be granted immunity if he helped her to commit suicide. The verdicts which were examined rejected her request

  6. Da Ruptura ao Acontecimento: Bachelard, Canguilhem e Foucault

    Directory of Open Access Journals (Sweden)

    Gabriela Menezes Jaquet

    2017-02-01

    Full Text Available Este artigo tem por objetivo propor uma problematização da concepção de acontecimento tal como é pensada, em seus contornos gerais, na filosofia francesa contemporânea e, mais especificamente, pela história da ciência. Nosso enfoque será a compreensão das abordagens de Gaston Bachelard, Georges Canguilhem e Michel Foucault principalmente no que tange às noções de ruptura epistemológica e de ideologia científica em sua articulação com as características do acontecimento pensado por Foucault, partimos, portanto, de concepções de história que, apesar das concordâncias, também acabam por se diferenciar: uma, a história descontinuísta das rupturas epistemológicas, outra, a história arqueológica dos acontecimentos. Para explicarmos a diferença deste nível acontecimental, será necessário compreendermos a visada singular de Foucault em relação à ciência, que é questionada (e criticada de forma a atentar para outro nível: o do saber que aqui exploraremos a partir do conceito de limiar. Igualmente quanto ao estatuto de científico, abordaremos o posicionamento crítico de Canguilhem em relação à Bachelard sobre os desdobramentos de uma razão pensada historicamente, através de sua história dos conceitos. Tendo em vista estas considerações poderemos compreender não só a especificidade do trabalho de cada um destes autores, mas visualizar o que a categoria de acontecimento pôde, via Foucault, trazer de novo para a história da ciência.

  7. As hérnias medem-se aos palmos?

    Directory of Open Access Journals (Sweden)

    Cátia Pereira

    2016-06-01

    Full Text Available Apresenta-se o caso de uma doente do sexo feminino com 74 anos, autónoma, com antecedentes patológicos de obesidade, diabetes mellitus tipo 2, hipertensão arterial e doença osteoarticular degenerativa, que recorreu à urgência por infeção respiratória inferior. Negava sintomas gastrointestinais ou antecedentes cirúrgicos. Ao exame objetivo, destacava-se a presença de uma hérnia umbilical volumosa não dolorosa à palpação, mas que condicionava a sua mobilidade, sendo impossível a redução do conteúdo herniário. Após insistência na anamnese, a doente referiu o seu aparecimento na infância, na altura com recusa em efetuar a sua correção cirúrgica, tendo sido perdido o seu seguimento posteriormente. A radiografia e a tomografia computorizada abdominais mostraram um colo herniário de seis centímetros de diâmetro e herniação de praticamente todo o intestino delgado e parte do cólon, sem evidência de encarceramento (Figuras 1 e 2. Apesar de décadas de evolução condicionarem um progressivo e forte impacto nas atividades da vida diária, a doente não procurou os cuidados de saúde por esse motivo, mantendo a sua decisão e sendo encaminhada para a consulta externa. As complicações herniárias abdominais incluem a obstrução intestinal e a temida emergência cirúrgica da hérnia encarcerada, não se desprezando a morbilidade inerente, bem evidente neste caso.1-2

  8. O sindicalismo mineiro frente aos desafios dos anos 90

    Directory of Open Access Journals (Sweden)

    Antônio Carvalho Neto

    2000-12-01

    Full Text Available O que se analisa neste artigo é como os sindicatos dos bancários, metalúrgicos e trabalhadores em telecomunicações têm negociado o (desemprego, a demanda por qualificação e a remuneração variável. Foram tabuladas/analisadas 3.569 cláusulas de acordos coletivos, e realizadas 26 entrevistas com dirigentes sindicais e empresariais em três Estados (RJ, SP e MG. Os resultados indicam que as mudanças organizacionais foram incomparavelmente mais negociadas no setor metalúrgico do ABC. A flexibilização da jornada foi trocada pela redução (da jornada sem redução de salário nos setores metalúrgicos paulistas, mas não em Minas Gerais. No setor bancário, houve poucos resultados nas negociações sobre jornada. As negociações em torno da remuneração variável vinculada às metas das empresas aconteceram nos setores metalúrgicos, e não nos setores de serviços. As entrevistas apontam para um sindicalismo mais propositivo, no sentido de uma intervenção negociada, predisposição que não é correspondida pelos empresários, grosso modo. O Estado, que poderia utilizar seu poder regulador para induzir os empresários a negociarem nessa direção não tem produzido resultados satisfatórios. Conclui-se que não há maturidade empresarial no Brasil que permita ao Estado ausentar-se das relações de trabalho.

  9. Suscetibilidade de Oligonychus yothersi (Acari: Tetranychidae ao fungo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Oliveira Renato Cassol de

    2002-01-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis é uma importante atividade econômica no Sul do Brasil. Com o aumento de consumo nos anos oitenta, cresceram também as áreas de monocultura, gerando condições favoráveis para o aumento populacional de insetos e ácaros fitófagos, entre eles o ácaro vermelho Oligonychus yothersi. Este estudo avaliou a suscetibilidade do ácaro vermelho O. yothersi a vários isolados do fungo Beauveria bassiana. O experimento foi conduzido em Cascavel, PR. Discos foliares de erva-mate (2,2 cm² foram previamente infestados com 20 fêmeas adultas. Alíquotas de 1 mL de cada suspensão de conídios dos diferentes isolados de B. bassiana, ajustadas na concentração de 1,0x10(8 conídios mL-1 foram pulverizadas, separadamente, sobre um conjunto de 5 discos. Os discos foliares foram mantidos flutuando em água destilada, em caixas plásticas (3 cm de diâmetro, sob condições controladas. Diariamente, os ácaros mortos foram transferidos para câmara úmida, para confirmação de mortalidade causada pelo fungo. A mortalidade total variou entre 77 e 98% (6 dias após a aplicação, não permitindo diferenciar os isolados quanto à virulência (P>0,05. Já a mortalidade confirmada variou entre 19 e 75%, permitindo diferenciá-los (P<0,05. O ácaro vermelho O. yothersi foi suscetível, em diferentes níveis, aos isolados de B. bassiana testados.

  10. Associação entre o padrão de atividade física materna, ganho ponderal gestacional e peso ao nascer em uma coorte de 118 gestantes no município de Campina Grande, Nordeste do Brasil Association between maternal physical activity, gestational weight gain and birth weight in a cohort of 118 pregnant women in Campina Grande, Northeast of Brazil

    Directory of Open Access Journals (Sweden)

    Jousilene de Sales Tavares

    2009-01-01

    Full Text Available OBJETIVO: Esta pesquisa estudou o efeito da atividade física sobre o ganho ponderal e peso ao nascer em gestantes do Programa Saúde da Família no município de Campina Grande, (PB. MÉTODOS: Realizou-se um estudo de coorte abrangendo 118 gestantes, entre 2005 e 2006. A avaliação do estado nutricional inicial seguiu os critérios de Atalah e o ganho ponderal materno foi avaliado de acordo com o Institute of Medicine. Analisou-se o padrão de atividade física de acordo com o medidor de estimativa de gasto calórico total (METs e sua associação com o ganho ponderal e o peso ao nascer. RESULTADOS: o padrão de atividade física predominante na 16ª semana foi o leve, alcançando 85,6% das gestantes. Observou-se uma redução importante do nível de atividade física com a evolução da gestação, com 98,3% das gestantes sendo consideradas sedentárias na 24ª semana e 100% na 32ª semana. No momento da captação, cerca de 50% das gestantes eram eutróficas, 23% com baixo peso e as demais com sobrepeso/obesidade. No segundo e no terceiro trimestres, aproximadamente 45% das gestantes ganharam peso excessivo. A distribuição do peso ao nascer mostrou um predomínio do peso adequado (85,6%, e uma alta prevalência de macrossomia (8,5%. Dentre os desfechos avaliados, foi observada associação apenas entre os valores de METs da 24ª.semana e o ganho ponderal materno no segundo trimestre gestacional (p=0,045. CONCLUSÃO: Todas as gestantes estavam sedentárias no terceiro trimestre; observou-se uma associação entre o padrão de atividade física e o ganho ponderal materno no segundo trimestre, mas não houve associação deste padrão com o peso ao nascer.OBJECTIVE: This survey evaluated the effects of physical activity on gestational weight gain and birth weight of pregnant women attended by the Family Health Program in Campina Grande, Northeast of Brazil. METHODS: A cohort study enrolling 118 pregnant women was conducted between 2005 and

  11. Patterns of Impairments in AOS and Mechanisms of Interaction between Phonological and Phonetic Encoding

    Science.gov (United States)

    Laganaro, Marina

    2012-01-01

    Purpose: One reason why the diagnosis of apraxia of speech (AOS) and its underlying impairment are often debated may lie in the fact that most patients do not display pure patterns of AOS. Mixed patterns are clearly acknowledged at other levels of impairment (e.g., lexical-semantic and lexical-phonological), and they have contributed to debate…

  12. SCExAO as a precursor to an ELT exoplanet direct imaging instrument

    Science.gov (United States)

    Jovanovic, Nemanja; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; Singh, Garima; Vievard, Sebastien; Kudo, Tomoyuki; Garrel, Vincent; Norris, Barnaby; Tuthill, Peter; Stewart, Paul; Huby, Elsa; Perrin, Guy; Lacour, Sylvestre

    2013-12-01

    The Subaru Coronagraphic Extreme AO (SCExAO) instrument consists of a high performance Phase Induced Amplitude Apodisation (PIAA) coronagraph combined with an extreme Adaptive Optics (AO) system operating in the near-infrared (H band). The extreme AO system driven by the 2000 element deformable mirror will allow for Strehl ratios>90% to be achieved in the H-band when it goes closed loop. This makes the SCExAO instrument a powerful platform for high contrast imaging down to angular separations of the order of 1 lambda/D and an ideal testbed for exploring coronagraphic techniques for ELTs. In this paper we report on the recent progress in regards to the development of the instrument, which includes the addition of a visible bench that makes use of the light at shorter wavelengths not currently utilized by SCExAO and closing the loop on the tip/tilt wavefront sensor. We will also discuss several exciting guest instruments which will expand the capabilities of SCExAO over the next few years; namely CHARIS which is a integral field spectrograph as well as VAMPIRES, a visible aperture masking experiment based on polarimetric analysis of circumstellar disks. In addition we will elucidate the unique role extreme AO systems will play in enabling high precision radial velocity spectroscopy for the detection of small companions.

  13. The nature of ethnic identity among the people of Curaçao

    NARCIS (Netherlands)

    Dijs, N.M. van der

    2011-01-01

    This qualitative research explores the nature of ethnic identity among the people of Curaçao. The questions that are of fundamental interest to this study are: how do the people of Curaçao perceive themselves ethnically, how do they experience their sense of belonging to an ethnic group and what

  14. About the malacological subdivision of Curaçao; a review

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1990-01-01

    Burrington Baker (1924) states that Curaçao can be divided into three distinct faunal areas. Stock (1977) mentions the occurrence of three subspecies of hadziid amphipods almost exclusively confined to different parts of Curaçao. The results of a study of the distribution on this island of various

  15. Use of AO PSF models for the Study of Resolved Stellar Populations

    NARCIS (Netherlands)

    Deep, A.; Fiorentino, G.; Jolissaint, L.; Tolstoy, E.; Clénet, Y.; Conan, J.-M.; Fusco, Th.; Rousset, G.

    2010-01-01

    The full scientific exploitation of AO images to study resolved stellar populations is still in a nascent stage. This requires pushing to the faint limits and carrying out deep and accurate crowded field photometry and astrometry. The main complexity of AO images is that the correction is never

  16. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  17. Propostas de mudanças ao basquete no sertão cearense: dando voz aos praticantes

    Directory of Open Access Journals (Sweden)

    Bérgson Nogueira de Oliveira

    2017-06-01

    Full Text Available Objetivo: o presente artigo tem como objetivo compreender as percepções de mudanças sociais atribuídas pelos praticantes de basquete em um município do sertão cearense, destacando neste contexto, as suas representações sociais acerca do papel social desta prática esportiva. Método: foram entrevistados cinco sujeitos do sexo masculino que praticam a modalidade há mais de dez anos no contexto do sertão cearense e que estudaram em escolas públicas. Para a construção das informações, utilizamos a entrevista semi-estruturada, seguida por um roteiro composto por temas, que foi adaptado de um estudo realizado por Santos (2004. As análises dos dados se deu a partir da Análise de Conteúdo do tipo Análise Temática, em que foram elaboradas categorias, a partir do material das entrevistas. Resultados: as representações de mudança dos sujeitos indicam o incentivo do basquete nas escolas; criação de projetos sociais; investimento na infraestrutura esportiva; bem como o fomento à criação de competições. Conclusão: conclui-se que a falta de apoio, de forma geral, dificulta a inserção de novos praticantes para essa modalidade. Nesse sentido, entende-se que são necessários mais incentivos ao esporte, pois se trata de um pilar na formação humana e possibilita o seu trabalho, não apenas no alto rendimento, mas também em dimensões de lazer, participação, educação, inclusão social entre outros aspectos.

  18. Sobre a domiciliaçao dos triatomineos

    Directory of Open Access Journals (Sweden)

    Mário B. Aragão

    1981-06-01

    Full Text Available Foram reunidos resultados de testes de precipitina feitos com o conteúdo do tubo digestivo de triatomineos. €ssas informações foram discutidas com base nas proporções de sangue de mamíferos e de ave, encontradas e em diversas observações relativas às espécies de vertebrados a que os triatomíneos estão associados na natureza. O estudo englobou as seguintes espécies: Belminus peruvianus, Panstrongylus geniculatus, Panstrongilus herreri, Panstrongylus megistus, Psammolestes tertius, Rhodnius neglectus, Rhodnius prolixus,Triatoma arthurneivai, Triatoma dimidiata,Triatoma infestans, Triatoma protracta, Triatoma rubrovaria e Triatoma sórdida. As seguintes conclusões puderam ser obtidas: 1 - As espécies que, nos biótopos artificiais, se alimentam principalmente de sangue humano, na natureza, são as mais ecléticas. Sugam mamífero, ave e animais de sangue-frio, mas apresentam marcada preferência por sangue de mamífero. 2 - As espécies que, nos biótopos artificiais, são encontradas com maior freqüência associadas a aves, na natureza ou preferem sangue de ave ou não tem predileção nítida por ave ou mamífero. 3 - As espécies associadas a animais de sangue frio ou restritas a um único grupo de mamíferos, podem colonizar nos domicílios desde que eles sejam previamente colonizados pelo hospedeiro. 4 - Não foram encontrados indícios de que alguma espécie esteja se adaptando aos domicílios. Todos os triatomineos ditos domiciliários já possuíam, na natureza, atributos que permitiam a vida em novos biótopos, habitados ou pelo homem ou por animais domésticos.

  19. Um sopro de Luz e Letra em meio ao caos

    Directory of Open Access Journals (Sweden)

    Marcelo Tomazi

    2009-06-01

    Full Text Available Enquanto compreende avanços científicos, o homem busca compreender a si mesmo. Partindo da citação de Carl Sagan, vemos que a Arte é um dos caminhos para a humanização, e os vínculos entre ciência (tecnologia e arte são cada vez mais estreitos. Um dos artistas que melhor trabalham dentro do nicho conhecido como “arte tecnológica” é Eduardo Kac. Sua trajetória inicial é apresentada aqui, dos “holopoemas” à “arte da telepresença”. Vemos o artista-teórico completo, profundo conhecedor da história da arte eletrônica. O livro Luz & letra: ensaios de arte, literatura e comunicação, sua obra de referência, é apresentado em essência, situando-se sua importância. É uma das poucas obras no Brasil a discutir, pela ótica de quem fez parte, eventos ligados ao advento da arte tecnológica nos anos 1980.In our quest to understand scientific advances, we seek to understand ourselves. Employing Carl Sagan's insight as a departure point, we see that art is one of the paths for humanization and that the links between science (technology and art are increasingly narrow. One of the artists who best works within the realm known as “art and technology” is Eduardo Kac. This essay explores Kac's early artworks, starting with “holopoems” and arriving at “telepresence art”, and especially his texts. We see a complete artist-theorist, with an unrivaled knowledge of electronic art and literature, in part because his theorizing emerges from having actively participated in the creation of the events he refers to. Of special interest is Kac's book Light & letter: essays in art, literature, and communication, which collects his writings of the 1980s. This is a fundamental work and mandatory reference for the study of the experimental art and literature of the period.

  20. Aldehyde oxidase (AO) in the root nodules of Lupinus albus and Medicago truncatula: identification of AO in meristematic and infection zones.

    Science.gov (United States)

    Fedorova, Elena; Redondo, Francisco J; Koshiba, Tomokazu; Pueyo, José J; de Felipe, M Rosario; Lucas, M Mercedes

    2005-05-01

    Phytohormones are involved in the organogenesis of legume root nodules. The source of the auxin indole-3-acetic acid (IAA) in nodules has not been clearly determined. We studied the enzyme aldehyde oxidase (AO; EC 1.2.3.1), that catalyzes the last step of IAA biosynthesis in plants, in the nodules of Lupinus albus and Medicago truncatula. Primordia and young lupin nodules and mature M. truncatula nodules showed AO activity bands after native polyacrylamide gel electrophoresis. Gel activity analyses using indole-3-aldehyde as substrate indicated that the nodules of white lupin and M. truncatula have the capability to synthesize IAA via the indole-3-pyruvic acid pathway. Immunolocalization and in situ hybridization experiments revealed that AO is preferentially expressed in the meristematic and the invasion zones in Medicago nodules and in the lateral meristematic zone of Lupinus nodules. High IAA immunolabeling was also detected in the meristematic and invasion zones. Low expression levels and no AO activity were detected in lupin Fix- nodules that displayed restricted growth and early senescence. We propose that local synthesis of IAA in the root nodule meristem and modulation of AO expression and activity are involved in regulation of nodule development.

  1. O direito fundamental ao conteúdo do próprio trabalho: uma reconstrução normativa do direito ao trabalho

    Directory of Open Access Journals (Sweden)

    Leonardo Vieira Wandelli

    2016-12-01

    Full Text Available Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas como necessidade radical, tendente à transformação da institucionalidade vigente, mas também como direito positivado em um amplo leque de normas internacionais e nacionais, que contempla diversas dimensões normativas atualmente exigíveis. Propõe-se que, no centro desse direito, está um direito fundamental ao conteúdo do próprio trabalho, que determina juridicamente as condições da atividade e da organização do trabalho. Recente estudo adotado pelo Alto Comissariado em Direitos Humanos da Organização das Nações Unidas (ONU sobre o direito ao trabalho reforça essa compreensão. Palavras-chave: Direitos humanos. Direitos fundamentais. Direito ao trabalho. Psicodinâmica do trabalho. Direito do trabalho.

  2. Silagem de cereais de inverno submetidos ao manejo de duplo propósito Silage of winter cereals submitted to double purpose management

    Directory of Open Access Journals (Sweden)

    Gilmar Roberto Meinerz

    2011-10-01

    Full Text Available Esta pesquisa foi conduzida com o objetivo de avaliar a silagem de 12 genótipos de seis espécies de cereais de inverno de duplo propósito (forragem e grãos, submetidos ao corte na região da Depressão Central do Rio Grande do Sul. As espécies e os genótipos testados foram: trigo BRS 277, BRS Guatambu, BRS Tarumã, BRS Umbu; aveia-preta Agro zebu, UPFA 21 -Moreninha e Comum; aveia-branca UPF 18; centeio BR 1 e BRS Serrano; Cevada BRS Marciana; e triticale BRS 148. Os genótipos foram submetidos a três cortes com o objetivo de simular o pastejo, conforme manejo indicado para duplo propósito. Após o terceiro corte, permitiu-se o desenvolvimento das culturas para a ensilagem. As silagens foram feitas em silos experimentais de PVC quando as forrageiras atingiram o estádio fenológico de grão pastoso. O delineamento experimental foi o inteiramente casualizado, com 12 tratamentos (genótipos e três repetições (parcelas. Foram determinadas a produção de matéria seca e a composição estrutural do material ensilado, o valor nutritivo e os parâmetros fermentativos das silagens. O centeio BR 1 e a aveiabranca UPF 18 apresentaram as maiores produções de matéria seca. O trigo BRS Umbu produziu silagem com maior participação de grãos e valor nutritivo mais elevado. Todos os genótipos apresentaram condições satisfatórias para a ensilagemThe objective of this research was to evaluate the silage of 12 genotypes of six species of double purpose winter cereals (forage and grains submitted to harvest at Depressão Central region of Rio Grande do Sul state. Species and genotypes tested were: BRS 277, BRS Guatambu, BRS Tarumã and BRS Umbu wheat; Agro Zebu, UPFA 21 - Moreninha and Commom black-oat; UPF 18 white oat; BR 1 and BRS Serrano rye; BRS Marciana barley; and BRS 148 triticale. Genotypes were submitted to tree harvests with the objective to simulate grazing, according to double purpose management. After the third harvest, the

  3. Avaliação da qualidade de vida e vulnerabilidade ao estresse no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Fernanda Ottati

    2013-05-01

    Full Text Available O conceito de Qualidade de Vida é usado para medir as condições de vida de um ser humano, já a palavra vulnerabilidade refere-se à chance das pessoas estarem expostas ao adoecer. Objetivou-se analisar possíveis relações entre percepção de qualidade de vida e a vulnerabilidade ao estresse no trabalho em enfermeiros, técnicos e auxiliares de enfermagem que atuam na UTI e no setor de emergência de um hospital público. Utilizou-se o instrumento de qualidade de vida da Organização Mundial da Saúde, WHOQOL-Bref e a Escala de Vulnerabilidade ao Estresse no Trabalho. Encontrou-se, em relação ao setor de trabalho, diferença significativa apenas para Qualidade de vida total. Portanto pode-se afirmar que os profissionais que atuam na UTI possuem maior percepção de qualidade de vida quando comparados aos do SUS. Na correlação entre os dois instrumentos, o domínio meio ambiente do WHOQOL-Bref correlacionou-se negativa e significativamente com todos os fatores da EVENT, indicando que a percepção da pessoa em relação aos diversos aspectos do meio em que vive tem relação com a vulnerabilidade ao estresse.

  4. The relationship between low birth weight and exposure to inhalable particulate matter Relación entre el bajo peso al nacer y la exposición a partículas inhalables Relação entre baixo peso ao nascer e exposição ao material particulado inalável

    Directory of Open Access Journals (Sweden)

    Alfésio Luiz Ferreira Braga

    2013-06-01

    tercer trimestre aumentaban el riesgo gestacional de bajo peso al nacer en un 26% (OR = 1,26; IC95%: 1,14-1,40, en comparación con el primer cuartil. El mismo efecto se observó en los trimestres restantes. Este efecto fue observado incluso en partículas con concentraciones que están dentro de los estándares del aire.Em todo o mundo a poluição atmosférica é um problema de saúde pública. Os efeitos adversos relacionados aos poluentes atmosféricos estão fortemente associados com doenças respiratórias e cardiovasculares e, em menor grau, com os resultados adversos da gravidez. O objetivo do trabalho foi avaliar a relação entre PM10 e baixo peso ao nascer no Município de Santo André, São Paulo, Brasil. Foram incluídos no estudo recém-nascidos de mães residentes em Santo André (2000-2006. A Agência Ambiental do Estado de São Paulo forneceu dados diários de PM10. Realizou-se análise descritiva e de regressão logística. A prevalência de baixo peso ao nascer foi de 5,9%. Observou-se uma relação dose-resposta entre as concentrações de PM10 e baixo peso ao nascer. As concentrações de PM10 no quartil mais alto (37,50µg/m³ no terceiro trimestre gestacional aumentaram o risco de baixo peso ao nascer em 26% (OR = 1,26; IC95%: 1,14-1,40 quando comparadas com o primeiro quartil. O mesmo efeito foi observado nos demais trimestres. Esse efeito foi verificado mesmo com as concentrações de partículas dentro dos padrões de qualidade do ar.

  5. Potencialidades e espaços ao empreendedorismo

    Directory of Open Access Journals (Sweden)

    Adriano Lago

    2008-01-01

    Full Text Available A criação de negócios é apontada como uma das causas da prosperidade de um local, região, estado ou de um país. É neste sentido que o empreendedorismo tem recebido destaque nos últimos anos, como promotor de novos negócios. Captar, descrever e analisar o fenômeno do empreendedorismo é, portanto, necessário para o desenho de ações de promoção do desenvolvimento. Assim, o presente estudo aborda o empreendedorismo na piscicultura, tomando como base três casos analisados: uma propriedade com rizipiscicultura, uma com piscicultura de ciclo completo inclusive com frigorífico, e outra onde a piscicultura desenvolve-se através de um pesque-pague, com vistas a proporcionar o turismo rural. Para fins de pesquisa, entrevistaram-se os proprietários de cada estabelecimento na busca dos dados necessários para a construção de uma abordagem consistente da temática proposta, ou seja, identificar a presença do empreendedorismo e suas características particulares em cada propriedade analisada. Verificou-se que determinadas características empreendedoras são comuns aos três casos analisados: habilidade para identificar oportunidades; busca de conhecimento de sua área de atuação; senso de organização; disposição para tomar decisões; capacidade de liderança; talento para empreender; otimismo e tino empresarial; ser estrategista, além do dinamismo. Portanto, foi possível observar que o perfil empreendedor dos proprietários de cada negócio tornou possível a transformação de idéias e problemas em oportunidades reais de negócio.Abstract The business opening is indicated as one of the prosperity causes of a country, state, region or local. It’s in this context that the entrepreneurship has received attention along the last years as new business promoter. This way, to study and promote development actions it’s necessary, firstly, to get, to describe and to analyze the entrepreneurship phenomenon by itself. So, this study

  6. Physiological and haematological response of Oreochromis niloticus (Osteichthyes: Cichlidae exposed to single and consecutive stress of capture - DOI: 10.4025/actascianimsci.v26i4.1719 Resposta fisiológica e hematológica de Oreochromis niloticus (Osteichthyes: Cichlidae exposto ao estresse único e consecutivo de captura - DOI: 10.4025/actascianimsci.v26i4.1719

    Directory of Open Access Journals (Sweden)

    Karina Ribeiro

    2004-04-01

    Full Text Available This work is a sequence of studies on tropical fish of economic importance that evaluated the effects of two different stress of handling on the physiology and haematology of Oreochromis niloticus L. acclimated for 10 days before the essay. The stress consisted in net capture of all fish from each aquarium for 30s emersion. Fish exposed to single stress (SS the samples were collected in the times 0, 10, 20, 30, 40, 50, 60, 120, 180, 240 and 300min. after stress. In the consecutive stress (CS the samples were collected in the times 0; 15min. after the first stress; 15min. after the second stress; 15min. after the third stress and 15, 30, 45, 60, 120, 180 e 240min. after the fourth stress totalizing four stimuli every 60min. Fish exposed to SS showed increased cortisol and glucose concentrations at 60min. as well as in the leucocytes number and hematocrit at 50min. after stress. Cortisol did not alter in fish exposed to CS, but glucose increased 15min. after the third stress. On the other hand, CS provoked reduction in the leucocytes number and later hematocrit increasing. Neutrophilia and lymphopenia were related to SS and CS.Este trabalho é seqüência de estudos com peixes tropicais de importância econômica avaliando os efeitos de dois tipos de estresse sobre a fisiologia e hematologia de O. niloticus L, aclimatados durante 10 dias antes do experimento. O estresse consistiu na captura de todos os peixes do aquário com rede e emersão por 30 s. Nos animais submetidos ao estímulo único de captura (EU as amostras foram coletadas nos tempos 0, 10, 20, 30, 40, 50, 60, 120, 180, 240 e 300min. após o estresse. No estímulo consecutivo (EC as amostras foram coletadas nos tempos 0; 15min. após o primeiro estresse; 15min. após o segundo estresse; 15min. após o terceiro estresse e 15, 30, 45, 60, 120, 180 e 240min. após o quarto estresse totalizando quatro estímulos a cada 60min. Os peixes expostos ao EU apresentaram aumento nas concentra

  7. Anatomia foliar comparativa das cultivares de Nicotiana tabacum L. (Solanaceae sensível e tolerante ao ozônio Comparative leaf anatomy of Nicotiana tabacum L. (Solanaceae cultivars sensitive and tolerant to ozone

    Directory of Open Access Journals (Sweden)

    Andrea Nunes Vaz Pedroso

    2008-03-01

    Full Text Available O ozônio troposférico causa necroses foliares em Nicotiana tabacum. Cultivares de tabaco são muito utilizadas como bioindicadoras de ozônio, em programas de biomonitoramento da qualidade do ar. Dentre elas destacam-se as cultivares Bel-W3 (sensível e Bel-B (tolerante. Este estudo teve como objetivo verificar se as duas cultivares apresentam variações na estrutura foliar que possam ajudar a explicar a diferença na sensibilidade ao ozônio que ambas apresentam. Em plantas que cresceram em ambiente isento de poluentes aéreos foram coletadas folhas do terceiro nó e que foram processadas segundo técnicas usuais empregadas em anatomia vegetal. Realizaram-se análises quantitativas e qualitativas dos tecidos foliares. A cultivar Bel-W3, quando comparada à Bel-B, apresentou menor densidade estomática na superfície abaxial e maior espessura do mesofilo. Qualitativamente as células de ambas cultivares mostraram aspecto sadio, com os vacúolos ocupando praticamente todo o volume celular. A cultivar sensível apresentou visivelmente mais espaços intercelulares, câmaras estomáticas maiores e estômatos ligeiramente salientes em ambas superfícies foliares. Tais características, que facilitam a entrada e a difusão dos poluentes na folha, podem explicar, do ponto de vista estrutural, a maior sensibilidade da cultivar Bel-W3.Tropospheric ozone produces symptoms such as leaf injury in Nicotiana tabacum. Tobacco cultivars are often used as ozone indicators in air-quality biomonitoring programs. Bel-W3 (sensitive and Bel-B (tolerant cultivars are better known. The aim of this study was to verify if the two cultivars show variation in leaf structure that may help to explain differences in ozone sensitivity. Expanded leaves from plants growing in pollutant-free air were collected, processed according to the usual techniques of plant anatomy, and analyzed quantitatively and qualitatively. The sensitive cultivar showed lower stomatal density on the

  8. Contribuição ao estudo da Tripanosomiase Americana

    Directory of Open Access Journals (Sweden)

    Bichat de Almeida Rodrigues

    1942-01-01

    ano (época do estío. 6 Em plena mata, n’uma toca de tamanduá (T. tetradactylus foram encontradas larvas, ninfas e adultos de P. geniculatus. A casa situada mais próximo desse foco, foi a que apresentou maior infestação (22 exemplares e exclusiva para essa espécie. Em uma toca de macaco da noite (P. flavus, foi encontrada uma larva de Triatomídeo. Este foco também ficava próximo à casa acima referida. Em toca de P. flavus foi também achado um exemplar adulto de Panstrongylus refotuberculatus. 7 Amostras de S. cruzi isoladas de animais silvestres, mostraram fraco poder infectante. A amostra isolada do cão, embora infectando facilmente os animais de laboratório, pelos estudos biométricos feito por DIAS e FREITAS, afasta-se das amostras humanas típicas. 8 São discutidos os resultados acima referidos e, pelos hábitos dos transmissores, pela predominância de depositários silvestres do parasito, conclue-se pela natureza silvestre da Tripanosomiase Americana no local estudado. Se bem que não tenham sido verificadas infecções humanas, dado o encontro de um cão parasitado – infecção esta que se pode ter verificado pelo meio normal da transmissão da moléstia – admite-se a possibilidade do aparecimento de casos humanos nessa região. Ressalta-se a confirmação que tais resultados parecem trazer á hipótese de CARLOS CHAGAS, que pensava ser esta doença primitivamente silvestre, com posterior adaptação aos animais domésticos e ao homem.1 The epidemiology of Chagas’ disease was studied for the first time in a systematized work, in a district of the region of the Amazon estuary, whose ecological conditions differ from those encountered in other zones where similar researches have been made. 2 At the place chosen for the studies – Aurá – a locality about 10 kms from Belem (State of Pará, no human infection by S. cruzi has been found, either by blood examination or xenodiagnosis, both having been tried on all the inhabitants (117 people

  9. CLASSICAL AREAS OF PHENOMENOLOGY: Correcting dynamic residual aberrations of conformal optical systems using AO technology

    Science.gov (United States)

    Li, Yan; Li, Lin; Huang, Yi-Fan; Du, Bao-Lin

    2009-07-01

    This paper analyses the dynamic residual aberrations of a conformal optical system and introduces adaptive optics (AO) correction technology to this system. The image sharpening AO system is chosen as the correction scheme. Communication between MATLAB and Code V is established via ActiveX technique in computer simulation. The SPGD algorithm is operated at seven zoom positions to calculate the optimized surface shape of the deformable mirror. After comparison of performance of the corrected system with the baseline system, AO technology is proved to be a good way of correcting the dynamic residual aberration in conformal optical design.

  10. Lesão de mancha branca associada ao tratamento ortodôntico

    OpenAIRE

    Tambelli, Bianca

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária O desenvolvimento de lesões de mancha branca em indivíduos submetidos ao tratamento ortodôntico com aparatologia fixa constitui um problema clínico importante. A inadequada higiene oral cria condições adicionais propícias ao aumento significativo da placa bacteriana ao redor dos suportes dos aparelhos fixos, fator este responsável pe...

  11. Genetic gain prediction of the third recurrent selection cycle in a popcorn population = Predição de ganhos genéticos para o terceiro ciclo de seleção recorrente em uma população de milho pipoca

    Directory of Open Access Journals (Sweden)

    Fabrício Santana Santos

    2008-12-01

    Full Text Available Although Brazil has reduced its importation of popcorn grain in recent years, the availability of improved varieties is still rare. In order to improve a popcorn population and to estimate the prediction of genetic gains, the third cycle of intrapopulation recurrent selection was carried out. One hundred ninety two half-sib families were obtained from the second cycle of the UNB-2U population and tested in a randomized complete block design with tworeplications within sets in two locations. The presence of statistical significance for sets for grain yield, poorly husked ear and broken plants proved the efficiency and the necessity for the use of the hierarchical statistical model by sets. Except for the poorly husked ear, there was significance for families within sets for the other evaluated traits, showing that there was sufficient geneticvariability for exploitation in future cycles. Although the heritability for popping expansion was higher than for grain yield, the predicted genetic gain for the latter was superior to poppingexpansion because of the higher magnitude of the genetic standard deviation for grain yield. It is expected that in the fifth recurrent cycle, the first popcorn variety with yellow grains may bereleased for Rio de Janeiro State.Embora o Brasil tenha reduzido a importação de grãos de milho pipoca, a disponibilidade de variedade melhorada ainda é rara no país. Com o objetivo de melhorar a população UNB-2U de milho pipoca e estimar apredição de ganhos genéticos, implementou-se o terceiro ciclo de seleção recorrente intrapopulacional. Cento e noventa e duas famílias de meios-irmãos foram obtidas e avaliadas em delineamento de blocos casualizados, com duas repetições, dentro de “sets” em dois locais. A presença de significância para “sets”, para produção de grãos, espigas mal empalhadas e plantas quebradas, comprovou a eficiência do uso do modelo estatístico hierarquizado por “sets”. Com

  12. Diagnóstico do controle e perfil de sensibilidade de nematódeos de ovinos ao albendazol e ao levamisol no norte de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Eduardo R. Duarte

    2012-02-01

    Full Text Available A resistência anti-helmíntica é um dos principais entraves para o controle da verminose em ruminantes e a presença de nematódeos multiresistentes pode inviabilizar a atividade em uma determinada área. Neste trabalho o objetivo foi avaliar a eficácia anti-helmíntica do levamisol e do albendazol em rebanhos ovinos do norte de Minas Gerais. O teste foi realizado em dez propriedades, onde foram selecionados três grupos de 12 borregos cada. Dois desses grupos foram tratados respectivamente com levamisol (5 mg/kg pc ou albendazol (10 mg/kg pc e o terceiro grupo não foi tratado. Fezes foram coletadas antes do tratamento e no sétimo dia após, para a realização do teste de redução de ovos por grama de fezes. Foi realizado o cultivo de larvas provenientes dos grupos avaliados para a identificação dos principais gêneros de nematódeos gastrintestinais antes e após os tratamentos. Para todos os rebanhos avaliados no norte de Minas Gerais, o levamisol apresentou eficácia anti-helmíntica elevada, variando de 90% a 100%. Apenas para um rebanho o albendazol seria efetivo e para seis propriedades as eficácias dessa droga foram inferiores a 80%, sendo considerada insuficientemente ativa. Após as coproculturas foram identificadas, em maior ocorrência, larvas dos gêneros Haemonchus e Trichostrongylus. O gênero Haemonchus foi o mais prevalente mesmo após o tratamento dos ovinos. Ressalta-se neste estudo a importância do teste de eficácia in vivo para a escolha das bases anti-helmínticas nas propriedades, pois foi observado que o perfil de susceptibilidade variou entre os diferentes rebanhos.

  13. Percepção do consumidor frente aos riscos associados aos alimentos, sua segurança e rastreabilidade

    Directory of Open Access Journals (Sweden)

    Juliana Cunha de Andrade

    2013-09-01

    mostrou relevante nos três grupos, pois esta deve contribuir para o recolhimento mais eficiente de produtos, caso seja necessário. No entanto, sob a ótica do consumidor, a rastreabilidade leva ao aumento dos preços, embora aumente a confiança em relação à segurança dos alimentos. Muitas das preocupações dos consumidores refletem as informações publicadas em revistas e jornais, como o caso da crença de que hormônios são utilizados na cadeia da carne de frango. Indústria e varejistas devem incrementar a comunicação de informações científicas sobre a segurança dos alimentos, contribuindo, assim, na educação do consumidor.

  14. Reliability and Reproducibility of the OTA/AO Classification for Humeral Shaft Fractures

    NARCIS (Netherlands)

    K.C. Mahabier (Kiran); E.M.M. van Lieshout (Esther); B.C. van der Schaaf (Boyd); G.R. Roukema (Gert); B.J. Punt (Bas); M.H.J. Verhofstad (Michiel); D. den Hartog (Dennis); H.W. Bolhuis (Hugo); P.K. Bos (Koen); M.W.G.A. Bronkhorst (Maarten); M.M.M. Bruijninckx (Milko); P.Th. den Hoed (Pieter); B.J. Dwars (Boudewijn); J.C. Goslings (Carel); R. Haverlag (Robert); M.J. Heetveld (Martin); A.J.H. Kerver (Albert J.H.); K.A. Kolkman (Karel); K. Leenhouts (Kees); R. Onstenk (Ron); H. Poeze; R.W. Poolman (Rudolf); W.H. Roerdink (Herbert); J.B. Sintenie (Jan Bernard); N.M.R. Soesman (Nicolaj); F.H.W.M. van der Heijden (Frank); P. van der Zwaal (Peer); J.P. van Dijk (Johannes); H.P.W. van Jonbergen; E.J.M.M. Verleisdonk (Egbert); J.P.A.M. Vroemen (Jos); M. Waleboer (Marco); W.P. Zuidema (Wietse)

    2017-01-01

    textabstractObjectives: This study aimed to determine interobserver reliability and intraobserver reproducibility of the OTA/AO classification for humeral shaft fractures, and to evaluate differences between fracture types, fracture groups, and surgical specializations. Methods: Thirty observers (25

  15. Additions to the marine algal flora of Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Stegenga, H.; Vroman, M.

    1988-01-01

    Nine species of benthic marine algae are reported from the Caribbean island of Curaçao for the first time: Chlorophyta: Derbesia marina and Trichosolen longipedicellata; Phaeophyta: Ectocarpus rhodochortonoides, Feldmannia elachistaeformis, Hecatonema floridanum, Herponema tortugense and Sphacelaria

  16. Tense, But in the Mood: Diachronic Perspectives on the Representation of Time in Ao

    National Research Council Canada - National Science Library

    Coupe, Alexander R

    2013-01-01

    印度東北部的Ao 語呈現一些從類型學的角度來說很有意思的特徵,我們從這些特徵可以看到Ao 語時標誌歷史發展的一些線索。作者認為Ao 語原來有二元的語氣系統:實然 (realis) 和非實然 (irrealis),前者無標誌,後者有標誌。Ao 語把其中兩個名物化標誌的作用延伸到標記時的不同範疇,而原來的無標誌的實然範疇卻...

  17. Ciberespaço cubano: uma forma de resistência ao poder e à censura

    Directory of Open Access Journals (Sweden)

    Lia Hecker Luz

    2011-01-01

    Full Text Available A entrada do corpo e da vida nos cálculos do poder corresponde ao que Foucault chamou de biopolítica. Entretanto, o próprio Foucault intuiu que aquilo mesmo que o poder investia – a vida – era o que doravante ancoraria a resistência a ele. Assim, ao poder sobre a vida deveria responder a potência da vida, capaz de operar uma resistência possível ao sequestro da vida pelo poder. Apoiando-nos no pensamento de Lévy, levantamos a hipótese, a partir da análise do blog Generación Y, de que a blogosfera cubana é uma expressão micropolítica de resistência ao poder, de biopotência da multidão.

  18. Bicolumnar 90–90 plating of AO 13C type fractures

    National Research Council Canada - National Science Library

    Cemal Kural; Ersin Ercin; Mehmet Erkilinc; Evren Karaali; Mustafa Gokhan Bilgili; Suleyman Altun

    2017-01-01

    Objective: The aim of this study was to evaluate functional results and complication rate of patients who underwent medial-dorsolateral plating for intra-articular distal humeral fracture (Müller AO type 13C). Methods...

  19. Evolução do carcinoma colorretal, comparando doentes com idades acima e abaixo de 40 anos, quanto à diferenciação tumoral e ao estádio do tumor Colorectal cancer evolution, comparing patients yourger and older than 40 years old, according to tumoral differentiation and tumor stage

    Directory of Open Access Journals (Sweden)

    Luis Roberto Manzione Nadal

    2009-09-01

    Full Text Available OBJETIVO: A incidência elevada do carcinoma colorretal o torna problema de saúde pública no nosso país. Os poucos trabalhos na literatura, bem como as dúvidas relacionando a idade com a evolução da doença, estimularam-nos a realizar esse trabalho para conhecer as divergências quanto à diferenciação tumoral e o estádio na evolução dessa neoplasia, comparando doentes com idades acima e abaixo de 40 anos. MÉTODO: Comparar 205 doentes de adenocarcinoma colorretal com idades acima e abaixo de 40 anos quanto ao tempo de sintomas, história familiar, localização do tumor, estádio do tumor, diferenciação, morte operatória, local de metástases e mortalidade até 3 anos. RESULTADOS: Eram 20 no grupo mais jovem e 185 entre os mais idosos. Não houve diferença em relação ao sexo, ao tempo de início de sintomas, à história familiar, ao local de tumor no cólon, ao estádio, ao aparecimento de recidivas, à mortalidade operatória e à sobrevivência até o terceiro ano pós-operatório. No grupo mais jovem os tumores foram mais indiferenciados e as metástases abdominais predominaram. No grupo mais velho houve maior incidência de metástases hepáticas e pulmonares. CONCLUSÃO: Os resultados obtidos nas condições de execução do presente estudo, em que comparamos doentes portadores de adenocarcinoma colorretal com idades acima e abaixo de 40 anos, permitiram concluir que os tumores foram mais indiferenciados entre os mais jovens embora a evolução pós-tratamento tenha sido semelhante.OBJECTIVE: High incidence of colorectal carcinoma turns it into a public health problem in our country. A few articles, as well as some doubts about patients age and disease evolution, made us study these features to know about tumor cells differentiation and tumor staging in the post-operative follow-up, comparing patients younger and older than 40 years old. METHOD: Comparison of 205 colorectal carcinoma patients younger and older than 40

  20. Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses

    Directory of Open Access Journals (Sweden)

    Restle João

    2001-01-01

    Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.

  1. Resistência de genótipos de batata ao pulgão Potato genotypes resistance to the green peach aphid Myzus persicae

    Directory of Open Access Journals (Sweden)

    Fernando M. Lara

    2004-12-01

    Full Text Available Avaliou-se a resistência (e antibiose de genótipos de batata, comerciais e em fase de melhoramento, ao pulgão Myzus persicae, em ensaios efetuados com plantas em vasos, sem chance de escolha, em Jaboticabal (SP. Foram efetuados seis experimentos, utilizando-se um total de 16 genótipos, a saber: 'Achat', 'Apuã', 'Aracy', 'Aracy Ruiva', 'Bintje', 'Ibitu Açu', 'Itararé', 'N 140-201', 'NYL 235-4', '288.719-13', '288.764-26', '288.776-3', '288.776-6', '288.794-19', '288.801-6' e '288.814-7'. Em cada experimento foram utilizadas combinações variadas dos mesmos. Nos dois primeiros experimentos as plantas foram infestadas com 30 pulgões adultos por planta, distribuídos em três folhas, com três avaliações realizadas em semanas subseqüentes à infestação, contando-se o número de indivíduos por planta. O terceiro experimento foi conduzido aprisionando-se duas fêmeas adultas no interior de pequenas gaiolas fixadas na face abaxial dos folíolos, em número de dez por planta, avaliando-se a reprodução do pulgão após sete dias, em dois plantios. No quarto experimento efetuou-se a infestação da planta com 15 pulgões, avaliando-se o crescimento da população na planta toda durante três semanas consecutivas. No quinto experimento foi avaliada a descendência de uma única fêmea adulta por folíolo e no sexto experimento avaliou-se o peso dos pulgões aos sete dias de vida. Os tricomas glandulares presentes nos folíolos e a funcionalidade dos mesmos também foram avaliados. A cultivar 'Ibitu Açu' apresentou elevado grau de antibiose a M. persicae; os genótipos '288.776-3' e '288.794-19' também apresentaram esse tipo de resistência, em grau moderado; '288.719-13' e '288.764-26' foram resistentes ao pulgão, provavelmente devido à presença de tricomas glandulares funcionais, dos tipos A e B, em seus folíolos (antixenose; entre os mais suscetíveis destacaram-se 'Bintje' e '288.801-6'.Potato genotypes and clones were evaluated

  2. Attitude toward contraception and abortion among Curaçao women. Ineffective contraception due to limited sexual education?

    NARCIS (Netherlands)

    Brink, M.J.; Boersma, A.A.; Meyboom-deJong, B; Bruijn, de J.G.M.

    2011-01-01

    Background In Curaçao is a high incidence of unintended pregnancies and induced abortions. Most of the induced abortions in Curaçao are on request of the woman and performed by general practitioners. In Curaçao, induced abortion is strictly prohibited, but since 1999 there has been a policy of

  3. Te Ao Kori as Expressive Movement in Aotearoa New Zealand Physical Education Teacher Education (PETE): A Narrative Account

    Science.gov (United States)

    Legge, Maureen

    2011-01-01

    A unique aspect of Aotearoa/New Zealand physical education is the inclusion of Maori culture in the form of te ao kori. Te ao kori translates to mean the world of movement and is represented by the interpretation of indigenous movement, games and pastimes. Participation in te ao kori means the sports-based normative frame of reference for physical…

  4. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): Genotoxicity and sub-chronic studies

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  5. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): genotoxicity and sub-chronic studies.

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  6. Fatores associados ao baixo peso ao nascimento entre adolescentes no Sudeste do Brasil Factors associated with low birth weight among adolescents in the Brazil Southeast region

    Directory of Open Access Journals (Sweden)

    Fernanda Garanhani Castro Surita

    2011-10-01

    Full Text Available OBJETIVOS: Conhecer a prevalência e alguns fatores associados ao baixo peso ao nascer entre gestantes adolescentes. MÉTODOS: Estudo de corte transversal, realizado entre outubro de 1994 a dezembro de 2009, com os partos ocorridos em uma maternidade de Campinas, utilizando informações coletadas em uma Ficha Obstétrica Informatizada. Foram selecionados os casos de partos entre adolescentes e, posteriormente, separados em dois grupos com e sem baixo peso ao nascer. Foram calculados o risco relativo e o intervalo de confiança (IC de 95% para as variáveis independentes (fatores de risco, e calculou-se o teste do Χ2 para comparação dos resultados perinatais. Assumiu-se nível de significância de 5%. RESULTADOS: No período ocorreram 24.000 partos no Centro de Atenção à Saúde da Mulher (CAISM, com 2.404 em 2.357 adolescentes (10,02%, sendo a frequência de baixo peso ao nascer de 15,1%. A gestação neste grupo foi recorrente em 294 (8,2%. A idade menor que 15 anos, anemia, tabagismo e hipertensão não se associaram ao baixo peso ao nascer. O antecedente de aborto e a associação com lúpus eritematoso sistêmico elevaram o risco de baixo peso ao nascer. A necessidade de cesariana e o Apgar menor que sete também foram mais prevalentes entre as adolescentes com baixo peso ao nascer, e 85% das adolescentes realizaram menos de seis consultas durante o pré-natal. CONCLUSÕES: A prevalência de baixo peso ao nascer é maior entre as adolescentes do que na população geral. Também chamou a atenção o grande número de adolescentes com menos de seis consultas durante o pré-natal. O antecedente de aborto e a presença de lúpus eritematoso sistêmico foram fatores de risco para ocorrência de baixo peso ao nascer em gestantes adolescentes.PURPOSES: To determine the rate of low birth weight and some of the risk factors associated with this event among adolescents. METHODS: A cross-sectional study conducted between October 1994 and

  7. Functional analysis of AoAtg11 in selective autophagy in the filamentous fungus Aspergillus oryzae.

    Science.gov (United States)

    Tadokoro, Takayuki; Kikuma, Takashi; Kitamoto, Katsuhiko

    2015-07-01

    Autophagy is a highly conserved cellular degradation process in eukaryotes and consists of both non-selective and selective types. Selective autophagic processes include pexophagy, mitophagy, and the cytoplasm-to-vacuole targeting (Cvt) pathway of yeast, in which particular vacuolar proteins, such as aminopeptidase I (Ape1), are selectively transported to vacuoles. Although selective autophagy has been mainly studied in the yeasts Saccharomyces cerevisiae and Pichia pastoris, there is evidence for selective autophagy in filamentous fungi; however, the details are poorly understood. In S. cerevisiae, Atg11 is a selective autophagy-specific protein that recognizes and transports substrates to the pre-autophagosomal structure (PAS). Here, we first identified an ATG11 homologue in the filamentous fungus Aspergillus oryzae and analyzed the localization of the corresponding protein, designated AoAtg11, fused to enhanced green fluorescent protein (EGFP). Imaging analysis revealed that AoAtg11-EGFP was localized to PAS-like structures. We next constructed an Aoatg11 disruptant of A. oryzae and showed that AoAtg11 is involved in pexophagy and mitophagy. In addition, AoAtg11 was found to be dispensable for non-selective autophagy and for transporting AoApe1 to vacuoles. Taken together, these results suggest that AoAtg11 is a selective autophagy-specific protein in A. oryzae, and has distinct molecular functions from that of S. cerevisiae Atg11. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  8. History of the AO and its global effect on operative fracture treatment.

    Science.gov (United States)

    Matter, P

    1998-02-01

    In 1958 a group of Swiss general and orthopaedic surgeons established the AO (Arbeitsgemeinschaft für Osteosynthesefragen) or the Association of the Study of Internal Fixation (ASIF) to strive to transform the contemporary treatment of fractures in Switzerland. This association was revolutionary in development of instruments and implants for operative fracture treatment. The first instructional course for teaching the use of these instruments and implants occurred in Davos, Switzerland, in the newly founded Laboratory of Experimental Surgery in 1960. Through a process of internal quality control (AO documentation) the clinical success of these new techniques and implants became evident. Operative fracture treatment gained acceptance throughout Europe and finally worldwide. AO/International (AOI) was founded in 1972 to expand education and the teaching programs for surgeons and operating personnel on an international basis. In 1984, the AO/ASIF Foundation was created with an AO Board of Trustees comprising 90 leading trauma surgeons from throughout the world. Continuous research, implant and instrument development, clinical documentation, and multifaceted educational opportunities are coordinated by the AO/ASIF Foundation to maintain its position as the international authority in the treatment of trauma. The medical community recognizes today the enormous positive global effect that this respected and ever changing organization has had by continually improving operative fracture treatment.

  9. Building a reliable, scalable and affordable RTC for AO instruments on ELTs

    Science.gov (United States)

    Gratadour, Damien; Sevin, Arnaud; Perret, Denis; Brule, Julien

    2013-12-01

    Addressing the unprecedented amount of computing power needed by the ELTs AO instruments real-time controllers (RTC) is one of the key technological developments required for the design of the next generation AO systems. Throughput oriented architectures such as GPUs, providing orders of magnitude greater computational performance than high-end CPUs, have recently appeared as attractive and economically viable candidates since the fast emergence of devices capable of general purpose computing. However, using for real-time applications a I/0 device which cannot be scheduled nor controlled internally by the operating system but is sent commands through a closed source driver comes with a number of challenges. Building on the experience of almost real-time end-to-end simulations using GPUs, and relying on the development of the COMPASS platform, a unified and optimized framework for AO simulations and real-time control, our team has engaged into the development of a scalable, heterogeneous GPU-based prototype for an AO RTC. In this paper, we review the main challenges arising when utilizing GPUs in real-time systems for AO and rank them in terms of impact significance and available solutions. We present our strategy, to mitigate these issues including the general architecture of our prototype, the real-time core and additional dedicated components for data acquisition and distribution. Finally, we discuss the expected performance in terms of latency and jitter on the basis of realistic benchmarks and focusing on the dimensioning of the MICADO AO module RTC.

  10. Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item

    Directory of Open Access Journals (Sweden)

    Malvina Thais Pacheco Rodrigues

    2013-06-01

    Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.

  11. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited].

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-05-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered.

  12. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-01-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered. PMID:28663890

  13. Canine malignant peripheral nerve sheath tumor involving nerve roots of the third lumbar spinal cord segmentTumor maligno da bainha de nervo periférico envolvendo raízes nervosas do terceiro segmento medular lombar em um cão

    Directory of Open Access Journals (Sweden)

    Elisângela Olegário da Silva

    2012-12-01

    Full Text Available Malignant peripheral nerve sheath tumors (MPNST involving spinal nerve roots are uncommon in dogs. A nine-year old, intact, mixed-breed dog, demonstrated clinical signs of incoordination in the pelvic limbs and micturition for approximately one week. Clinical examination revealed proprioceptive deficits and bilateral patellar hyperreflexia. During exploratory celiotomy a mass was observed adhered to the lumbar vertebral segments. Medical therapy was initiated, but neurological signs were progressive, and the owner opted for euthanasia. Gross examination showed that the mass in the abdominal cavity was attached to the lumbar segments L3 and L4, causing bone lysis in L3, but showed no tumor invasion into the spinal canal. Microscopic features were characterized by prominent proliferation of ovoid and fusiform cells with poorly defined cytoplasm arranged in interlacing bundles and concentric whorls. The cells were embedded in a delicate to moderate collagenous stroma and moderate anisokariose and high mitotic activity were noted. The immunohistochemical assay showed positive staining for GFAP, S-100 protein and vimentin, and negative staining for factor VIII, ?-actin and citokeratine. The definitive diagnosis of malignant peripheral nerve sheath tumor was made on the basis of the histological and immunohistochemical findings. Tumores malignos da bainha de nervo periférico (TMBNP em raízes nervosas espinhais são incomuns em cães. Relata-se o caso de um cão, sem raça definida, nove anos de idade, não castrado, com histórico de incoordenação em membros pélvicos e retenção urinária há aproximadamente uma semana. Ao exame clínico constatou-se déficit proprioceptivo e hiperreflexia patelar bilaterais. Durante a celiotomia exploratória constatou-se uma massa intensamente vascularizada e aderida aos segmentos vertebrais lombares. Estabeleceu-se plano terapêutico e o animal foi tratado com fluidoterapia, anti-inflamatório e analg

  14. Por que as pessoas recorrem ao Judiciário para obter o acesso aos medicamentos? O caso das insulinas análogas na Bahia

    OpenAIRE

    Lisboa, Erick Soares; Souza, Luis Eugenio Portela Fernandes de

    2017-01-01

    Resumo As insulinas análogas são alvo de controvérsias quanto à sua superioridade terapêutica em relação às humanas. Talvez, em parte, devido a isso, são objetos frequentes de ações judicias. A judicialização da saúde tem sido muito estudada, mas pouco se sabe sobre os motivos que levam as pessoas a recorrerem ao Judiciário para obter acesso a medicamentos no SUS. Sendo assim, o presente estudo tem por objetivo analisar os motivos que levaram as pessoas a recorrerem ao Judiciário para obter o...

  15. Cuidados pré-natais e puerperais às gestantes de um centro de saúde de Minas Gerais quanto ao risco de pré-eclâmpsia: aspectos clínicos, nutricionais e terapêuticos

    Directory of Open Access Journals (Sweden)

    Patrick Leonardo Nogueira da Silva

    2017-10-01

    Full Text Available Introdução: A pré-eclâmpsia é uma condição específica da gestação que envolve a falência de diversos órgãos e está associada à hipertensão, à retenção generalizada de líquido (edema e à proteinúria. Trata-se de uma patologia obstétrica que surge após a vigésima semana de gestação, sendo mais frequente no terceiro trimestre, e que se estende até o puerpério. Objetivo: Avaliar os aspectos clínicos, nutricionais e terapêuticos nos cuidados pré-natais e puerperais às gestantes de um centro de saúde de Minas Gerais quanto ao risco de pré-eclâmpsia. Método: Trata-se de um estudo descritivo, exploratório, documental, com abordagem quantitativa realizado em um centro de saúde, em que a amostra foi composta por 36 mulheres em acompanhamento pré-natal e puerperal. Foi utilizado um questionário semiestruturado como instrumento de coleta de dados. Utilizou-se, ainda, o prontuário clínico de atendimento ambulatorial e o cartão da gestante para a captação dos dados. O tratamento estatístico se deu por meio de epidemiologia descritiva simples não paramétrica e não probabilística. Resultados: Houve prevalência de gestantes jovens; com idade entre 18-24 anos; primigestas; sem acompanhamento puerperal, antecedentes familiares e pessoais de doença hipertensiva. Houve predomínio de quatro refeições diárias com restrições hipersódicas. Apenas 10,8% utilizavam plantas medicinais, faziam uso de polifarmácia devido à sintomatologia múltipla da gestação, e manifestavam condutas quanto ao tratamento de modo a gerar falhas e comprometer a evolução gestacional. Conclusão: Há falhas no acompanhamento profissional à gestante em nível de Atenção Primária à Saúde, principalmente no que diz respeito à terapêutica, de modo a comprometer a qualidade da gravidez.

  16. Dynamic SPECT of the brain using a lipophilic technetium-99m complex, PnAO

    DEFF Research Database (Denmark)

    Holm, S; Andersen, A R; Vorstrup, S

    1985-01-01

    The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-......AO has a high yet incomplete brain extraction yielding a flow dominated initial distribution with limitations mentioned.......The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-99......m PnAO was injected i.v. as a bolus of 15 to 25 mCi. The distribution was followed over 10-sec intervals using a highly sensitive, rapidly rotating SPECT (Tomomatic 64) and compared to 133Xe flow maps. Upon arrival of the PnAO bolus to the brain, a high uptake was found in brain tissue with high...

  17. Production of Alginate Oligosaccharides (AOS as Prebiotic Ingredients through by Alginate lyase enzyme

    Directory of Open Access Journals (Sweden)

    Fahriza Sri Afni

    2017-04-01

    Full Text Available Prebiotics is indigestible foods that can not be digested but can stimulate the growth and activity of bacteria in the digestive tract effecting human health. Alginate oligosaccharides (AOS can be used as a source of prebiotic. That compounds can be produced enzymatically by cutting long chain alginates using alginate lyase. The aim of this study was to produce alginate lyase enzyme then producing Alginate oligosaccharides (AOS as a prebiotic ingredients. The alginate lyase enzyme can be produced from Bacillus megaterium bacteria using a discontinuous fermentor. The enzyme was  optimum temperature of 45°C and an optimum pH of 7.0. Alginate oligosaccharides production was performed with the addition of different enzyme concentrations 25, 50, 75, and 100 U. The result of the addition of enzyme (25, 50,75 U showed that the value of polymerization degrees (DP were between 4-5. However, the addition of enzyme (100 U was in the range of  DP 3-4. Bacterial probiotic growth test results of Bifidobacteria and Lactobacillus showed that 1% added AOS media were able to increase the growth of probiotic bacteria compared to themedia without addition of AOS. The addition Alginate lyase activity of 50 U in AOS production is the best treatment of both probiotic bacteria.

  18. Morfologia e Crescimento dos 6 aos 10 anos de idade em Viana do Castelo, Portugal

    Directory of Open Access Journals (Sweden)

    Luis Paulo Rodrigues

    2008-09-01

    Full Text Available Ao longo de quatro anos, o Estudo Morfofuncional da Criança Vianense observou 1911 crianças entre os 6e os 10 anos de idade, resultando em 4064 observações individuais(2054 de raparigas, 2006 de rapazes.Os resultados encontrados nos indicadores morfológicos simples(altura, peso, pregas adiposas, diâmetros ósseos e perímetros muscularese no somatótipo, são descritos normativamente (valores percentílicose comparados com outros estudos nacionais e internacionais. As crianças vianenses demonstraram possuir uma estatura média ligeiramente superior às reportadas nos estudos portugueses e um ritmo de crescimento diferente das norte-americanas; peso semelhante ao das congéneres nacionais mas inferior ao das EUA; valores de pregas adiposas geralmente inferiores aos encontrados em Portugal e EUA; perímetros musculares e diâmetros ósseos semelhantes aos seus pares portugueses; e uma tendência para o aumento, com a idade, do ectomorfismo nos rapazes e do endomorfismo em ambos os sexos. Este panorama parece indicar que as crianças vianenses apresentam características de aptidão morfologia que estão longe de espelhar as preocupações internacionais nesta matéria.

  19. Relationship between winter AO/NAO and temperature in China: intraseasonal and interdecadal variations

    Science.gov (United States)

    Ren, Hong-Li; Zuo, Jinqing; Li, Weijing

    2017-04-01

    In this study, we focus on the intraseasonal and interdecadal variations in the relationship between winter AO/NAO (Arctic Oscillation / North Atlantic Oscillation) and surface air temperature (SAT) in China. On one hand, our results show that there is an intraseasonal contrast in impacts of AO/NAO on SAT in the central-southern China between early and mid-late winter. The linkage between AO and central-southern China SAT strongly depends on the AO-associated changes in Middle-East Jet Stream (MEJS) and the AO-MEJS relationship is significantly different between early and mid-late winter. On the other hand, our results also clearly show that inter-decadal changes have occurred in the relationship between the winter NAO and southern China surface air temperature anomalies in the past decades. A weak in-phase relationship occurred before the early 1970s, but a significant out-of-phase relationship dominated during 1979-1998, though it has been clearly weaker from the late 1990s onwards. Observational evidence shows that such interdecadal variations are mainly related to variations in the spatial pattern and amplitude of the NAO. The eastward shift and amplitude intensification of the NAO favored a north-south Asian dipole structure of circulation anomalies, which tended to produce cold SAT anomalies in central-southern China in the positive NAO phase and warm in the negative NAO phase.

  20. Toward an experimental validation of new AO concepts for future E-ELT instrumentation

    Science.gov (United States)

    El Hadi, K.; Fusco, T.; Le Roux, B.

    2012-07-01

    For the last few years, LAM has been carrying out several R&D activities in Adaptive Optics (AO) instrumentation for Extremely Large Telescopes (ELTs). In the European ELT framework, a multi-purpose AO bench is developed to allow the experimental validation of new instrumental concepts dedicated to the next generation of ELTs. It is based on the use of a Shack-Hartmann wave-front sensor in front of a 140 actuators micro-deformable mirror (Boston Micromachines), dedicated to “low orders” modes, while a Pyramid wave-front sensor (PWFS) will be combined to a Liquid Crystal Spatial Light Modulator for “high orders” correction. Both systems could be merged in a two stages AO concept allowing to study the coupling of a telescope pre-correction using a dedicated large M4 deformable mirror and a post focal high order AO system. Analysis and optimisation of the spatial and temporal splits of the AO correction between the two systems is therefore essential. Finally, we will use the world’s fastest and most sensitive camera system OCAM (developed at LAM) coupled with the pyramid , to demonstrate the concept of a fast and hyper-sensitive PWFS (up to 100x100 sub-pupils) dedicated to the first generation instruments for ELTs.

  1. Cantaria em louvação ao dia do Barroco Mineiro e homenagem ao poeta e ensaísta Affonso Ávila

    Directory of Open Access Journals (Sweden)

    Cristina Ávila

    2013-12-01

    Full Text Available É com profunda comoção que, em nome de minha família, agradeço a prestigiosa homenagem concedida pela Pontifícia Universidade Católica de Minas Gerais – PUCMinas e pela Assembleia Legislativa do Estado de Minas Gerais ao reconhecido e saudoso poeta e ensaísta do Barroco Mineiro, Affonso Ávila. O convite para a participação neste debate acadêmico, feito ao próprio homenageado pela Prof. Dra. Melânia da Silva Aguiar, foi recebido por ele com enorme entusiasmo, mas quis o destino que ele se fosse antes da data prevista. Como historiadora da arte e cultura estou presente apenas para contemplar alguns aspectos de sua obra, especialmente no que se refere aos estudos de Barroco, mas não posso substituir o depoimento do ensaísta que seria, com certeza, bem mais interessante.

  2. Práticas educativas maternas e paternas aos 24 e aos 72 meses de vida da criança

    Directory of Open Access Journals (Sweden)

    Angela Helena Marin

    Full Text Available Este estudo investigou as práticas educativas indutivas, coercitivas e de não interferência maternas e paternas aos 24 e 72 meses de vida da criança. Participaram 24 mães e pais de um único filho/a, que responderam uma entrevista para avaliação dessas práticas. Análises estatísticas revelaram que as mães foram significativamente mais indutivas que os pais aos 24 meses, mas aos 72 meses não houve diferenças. Enfatiza-se que as mães tendem a conversar mais com seus filhos/as, expressar sentimentos, opiniões, estabelecer limites e elogiar comportamentos adequados. As mães também apresentaram médias mais elevadas no total de práticas relatadas, o que pode ser explicado pelo papel predominante que ainda exercem na socialização infantil, embora os pais venham participando mais da educação dos filhos/as.

  3. Estudo in vitro da resistência ao cisalhamento da colagem direta de tubos ortodônticos em molares In vitro study of shear bond strength in direct bonding of orthodontic molar tubes

    Directory of Open Access Journals (Sweden)

    Célia Regina Maio Pinzan Vercelino

    2011-06-01

    Full Text Available INTRODUÇÃO: apesar da colagem direta despender menor tempo clínico, com maior preservação da integridade gengival, ainda hoje se observa uma alta incidência de bandagem dos molares. Portanto, torna-se interessante a idealização de recursos para o aumento da eficiência desse procedimento para dentes submetidos a maiores impactos mastigatórios, como, por exemplo, os molares. OBJETIVO: esse estudo teve o propósito de avaliar se a resistência à adesão com a aplicação de uma camada de resina adicional na região oclusal da interface tubo/dente aumenta a qualidade do procedimento de colagem direta de tubos em molares. MÉTODOS: selecionou-se uma amostra composta por 40 terceiros molares inferiores, que foram aleatoriamente divididos em 2 grupos: Grupo 1 - colagem direta convencional, seguida pela aplicação de uma camada de resina na oclusal da interface tubo/dente; e Grupo 2 - colagem direta convencional. O teste de resistência ao cisalhamento foi realizado 24 horas após a colagem, utilizando-se uma máquina de ensaio universal, operando a uma velocidade de 0,5mm/min. Os resultados foram analisados por meio do teste t independente. RESULTADOS: os valores médios obtidos nos testes de cisalhamento foram: 17,08MPa para o Grupo 1 e 12,60MPa para o Grupo 2. O Grupo 1 apresentou uma resistência ao cisalhamento estatisticamente significativa mais alta do que o Grupo 2. CONCLUSÃO: a aplicação de uma camada adicional de resina na oclusal da interface tubo/dente aumenta a qualidade da adesão do procedimento de colagem direta de tubos ortodônticos em molares.OBJECTIVE: Although direct bonding takes up less clinical time and ensures increased preservation of gingival health, the banding of molar teeth is still widespread nowadays. It would therefore be convenient to devise methods capable of increasing the efficiency of this procedure, notably for teeth subjected to substantial masticatory impact, such as molars. This study was

  4. Up-Regulated Expression of AOS-LOXa and Increased Eicosanoid Synthesis in Response to Coral Wounding

    Science.gov (United States)

    Lõhelaid, Helike; Teder, Tarvi; Tõldsepp, Kadri; Ekins, Merrick; Samel, Nigulas

    2014-01-01

    In octocorals, a catalase–like allene oxide synthase (AOS) and an 8R-lipoxygenase (LOX) gene are fused together encoding for a single AOS-LOX fusion protein. Although the AOS-LOX pathway is central to the arachidonate metabolism in corals, its biological function in coral homeostasis is unclear. Using an acute incision wound model in the soft coral Capnella imbricata, we here test whether LOX pathway, similar to its role in plants, can contribute to the coral damage response and regeneration. Analysis of metabolites formed from exogenous arachidonate before and after fixed time intervals following wounding indicated a significant increase in AOS-LOX activity in response to mechanical injury. Two AOS-LOX isoforms, AOS-LOXa and AOS-LOXb, were cloned and expressed in bacterial expression system as active fusion proteins. Transcription levels of corresponding genes were measured in normal and stressed coral by qPCR. After wounding, AOS-LOXa was markedly up-regulated in both, the tissue adjacent to the incision and distal parts of a coral colony (with the maximum reached at 1 h and 6 h post wounding, respectively), while AOS-LOXb was stable. According to mRNA expression analysis, combined with detection of eicosanoid product formation for the first time, the AOS-LOX was identified as an early stress response gene which is induced by mechanical injury in coral. PMID:24551239

  5. Physical properties of the Algol-type eclipsing binary AO Ser

    Science.gov (United States)

    Chehlaeh, N.; Lampens, P.; Mkrtichian, D.; Van Cauteren, P.; Vermeylen, L.; Komonjinda, S.

    2017-09-01

    We present the results of a combined analysis of photometric time series and spectroscopic observations for the semi-detached eclipsing binary AO Ser aimed to study physical parameters of the system. New CCD photometric light curves in the B and V bands and radial velocities of AO Ser are presented. The Wilson-Devinney technique was used to simultaneously analyze the light and radial velocity curves for determining a new set of the system’s parameters. The solution shows that AO Ser is a semi-detached eclipsing binary system with a mass ratio of 0.183 ± 0.003, an inclination of 89.42 ± 0.04 degrees and a secondary star’s temperature of 4900 K.

  6. A Arqueologia do cuidado: da prática ao discurso

    Directory of Open Access Journals (Sweden)

    Sidi Askofare

    2006-06-01

    Full Text Available A noção de cuidado, assimilada há muito tempo ao tratamento e, então, ao conceito de terapêutica, retorna, logo depois, nos estudos, pesquisas e reflexões nas ciências humanas. Mas, daí em diante, está emancipado de suas aderências e conotações médicas por serem demasiadamente redutoras. O presente artigo propõe uma arqueologia (no sentido foucaultiano do cuidado &– de suas origens animais às suas formas culturalmente e historicamente definidas &– e põe em evidência a subversão que produz no campo do cuidado &– das práticas aos discursos &– a emergência e a dominação do discurso da ciência.

  7. O Ocaso da Utopia Telecomunicacional: regular para quem no tocante ao Direito Fundamental à Privacidade?

    Directory of Open Access Journals (Sweden)

    Conselho Editorial

    2014-05-01

    Full Text Available O presente estudo figura como introdução à Revista de Direito, Estado e Telecomunicações do Grupo de Estudos em Direito das Telecomunicações da Universidade de Brasília, abordando sinteticamente a estrutura, conteúdo e política editorial da revista. Em acréscimo, o texto analisa os principais acontecimentos do setor no Brasil, bem como normas e julgados relativos ao ano de 2013, para registro das principais discussões político-jurídicas do setor de telecomunicações brasileiro referentes ao ano anterior ao da publicação.

  8. Sensibilidade de laranjeiras-doces ao deficit hídrico

    OpenAIRE

    Ramos, Yuri Caires; Mourão Filho, Francisco de Assis Alves; Stuchi, Eduardo Sanches; Sentelhas, Paulo Cesar; Fadel, André Luiz

    2016-01-01

    Resumo: O objetivo deste trabalho foi avaliar a sensibilidade ao deficit hídrico de 17 seleções de laranja-doce enxertadas sobre tangerineira 'Sunki', ao longo de cinco safras. Empregou-se um modelo agrometeorológico de penalização da produtividade pelo deficit hídrico, tendo-se avaliado a relação entre os valores estimados e observados. As seleções podem ser classificadas como de alta, média e baixa sensibilidade ao deficit hídrico, classificação que é inédita para as condições brasileiras. ...

  9. ESTUDO DE PROBLEMAS DE ENFERMAGEM REFERENTES AO CABELO E COURO CABELUDO EM PACIENTES HOSPITALIZADOS

    Directory of Open Access Journals (Sweden)

    Maria Romana Friedlander

    Full Text Available A autora procurou identificar os tipos e os problemas de enfermagem referentes ao cabelo e couro cabeludo, apresentados por pacientes internados em clínicas médicas e cirúrgicas gerais de um hospital governamental de ensino. Identificou 4 classes de problemas: estado de limpeza, lesões, infestações e penteação. Cada classe foi subdividida em graus os quais foram denominados tipos de problemas. A proporção de problemas por paciente encontrada foi 0,80 e a proporção de pacientes com problemas foi 58%. Foram também estudadas algumas condições que podem intervir no cuidado ao cabelo e ao couro cabeludo e foram obtidas informações sobre hábitos e costumes apresentados pelos pacientes.

  10. A Exposição ao Risco das Famílias

    OpenAIRE

    Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  11. Obtenção de plantas de feijão-caupi resistentes ao Cowpea severe mosaic virus e ao Cowpea aphid-borne mosaic virus

    Directory of Open Access Journals (Sweden)

    Gislanne Brito Barros

    2013-06-01

    Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.

  12. Fatores associados ao tempo de espera e ao acesso ao transplante renal em Belo Horizonte, Minas Gerais, Brasil Factors associated with waiting time and access to kidney transplants in Belo Horizonte, Minas Gerais State, Brazil'

    Directory of Open Access Journals (Sweden)

    Elaine Leandro Machado

    2012-12-01

    Full Text Available O objetivo deste artigo foi analisar os fatores associados ao acesso ao transplante renal com doador vivo e cadáver em Belo Horizonte, Minas Gerais, Brasil. Foi realizado um estudo de coorte não concorrente com pacientes inscritos na lista de espera por transplante renal, entre 2000 e 2004, os quais foram acompanhados até o transplante, óbito, exclusão ou permanência na fila de espera ao fim do estudo em 31 de dezembro de 2005. Utilizou-se o modelo de Cox para riscos competitivos. Dos 835 pacientes, 22,7% foram transplantados. Apresentaram menor risco de transplante por doador cadáver e vivo os pacientes com maior tempo em diálise e tipo sanguíneo O. Observou-se menor risco de transplante intervivos para residentes em uma área de alto risco à saúde e portadores de diabetes. A maior disparidade de acesso foi para transplante renal intervivos, uma vez que não houve diferenças sociodemográficas significativas para transplante por doador cadáver. Pode-se inferir que o sistema de alocação de órgãos contribuiu para amenizar desigualdades sociodemográficas, sendo as questões clínicas mais relevantes no acesso ao transplante com doador cadáver.The objective of this study was to analyze factors associated with access to kidney transplants from living and cadaver donors in Belo Horizonte, Minas Gerais State, Brazil. The authors conducted a non-concurrent cohort study of patients on the waiting list for kidney transplants from 2000 to 2004 and followed until transplantation, death, exclusion, or continued presence on the line at the end of the study on December 31, 2005. The Cox model was used for competing risks. Of the 835 patients, 22.7% were transplanted. Lower risk of transplantation from living donors and cadavers was observed in patients with more time on dialysis and blood type O. Lower risk of transplantation from living donors was observed in residents in a high health risk area and in recipients with diabetes. The

  13. Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Santos Saldanha

    Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.

  14. Novel algorithm implementations in DARC: the Durham AO real-time controller

    Science.gov (United States)

    Basden, Alastair; Bitenc, Urban; Jenkins, David

    2016-07-01

    The Durham AO Real-time Controller has been used on-sky with the CANARY AO demonstrator instrument since 2010, and is also used to provide control for several AO test-benches, including DRAGON. Over this period, many new real-time algorithms have been developed, implemented and demonstrated, leading to performance improvements for CANARY. Additionally, the computational performance of this real-time system has continued to improve. Here, we provide details about recent updates and changes made to DARC, and the relevance of these updates, including new algorithms, to forthcoming AO systems. We present the computational performance of DARC when used on different hardware platforms, including hardware accelerators, and determine the relevance and potential for ELT scale systems. Recent updates to DARC have included algorithms to handle elongated laser guide star images, including correlation wavefront sensing, with options to automatically update references during AO loop operation. Additionally, sub-aperture masking options have been developed to increase signal to noise ratio when operating with non-symmetrical wavefront sensor images. The development of end-user tools has progressed with new options for configuration and control of the system. New wavefront sensor camera models and DM models have been integrated with the system, increasing the number of possible hardware configurations available, and a fully open-source AO system is now a reality, including drivers necessary for commercial cameras and DMs. The computational performance of DARC makes it suitable for ELT scale systems when implemented on suitable hardware. We present tests made on different hardware platforms, along with the strategies taken to optimise DARC for these systems.

  15. Deep-water sponges (Porifera) from Bonaire and Klein Curaçao, Southern Caribbean.

    Science.gov (United States)

    Van Soest, Rob W M; Meesters, Erik H W G; Becking, Leontine E

    2014-10-29

    Four submersible dives off the coast of Bonaire (Caribbean Netherlands) and Klein Curaçao (Curaçao) to depths of 99.5-242 m, covering lower mesophotic and upper dysphotic zones, yielded 52 sponge specimens belonging to 31 species. Among these we identified 13 species as new to science. These are Plakinastrella stinapa n. sp., Pachastrella pacoi n. sp., Characella pachastrelloides n. sp., Geodia curacaoensis n. sp., Caminus carmabi n. sp., Discodermia adhaerens n. sp., Clathria (Microciona) acarnoides n. sp., Antho (Acarnia) pellita n. sp., Parahigginsia strongylifera n. sp., Calyx magnoculata n. sp., Neopetrosia dutchi n. sp., Neopetrosia ovata n. sp. and Neopetrosia eurystomata n. sp. We also report an euretid hexactinellid, which belongs to the rare genus Verrucocoeloidea, recently described (2014) as V. liberatorii Reiswig & Dohrmann. The remaining 18 already known species are all illustrated by photos of the habit, either in situ or 'on deck', but only briefly characterized in an annotated table to confirm their occurrence in the Southern Caribbean. The habitat investigated-steep limestone rocks, likely representing Pleistocene fossil reefs--is similar to deep-water fossil reefs at Barbados of which the sponges were sampled and studied by Van Soest and Stentoft (1988). A comparison is made between the two localities, showing a high degree of similarity in sponge composition: 53% of the present Bonaire-Klein Curaçao species were also retrieved at Barbados. At the level of higher taxa (genera, families) Bonaire-Klein Curaçao shared approximately 80% of its lower mesophotic and upper dysphotic sponge fauna with Barbados, despite a distance between them of 1000 km, indicating high faunal homogeneity. We also preliminarily compared the shallow-water (euphotic) sponge fauna of Curaçao with the combined data available for the Barbados, Bonaire and Klein Curaçao mesophotic and upper dysphotic sponges, which resulted in the conclusion that the two faunas show only

  16. Adesão ao Tratamento em Gestação de Alto Risco

    Directory of Open Access Journals (Sweden)

    Fabíola Langaro

    Full Text Available No Brasil, aproximadamente 15% das gestações são de alto risco, sendo os diagnósticos de diabetes gestacional e hipertensão as causas mais frequentes dessa condição. Para a efetividade dos tratamentos indicados nesses casos, bem como alcance de desfechos favoráveis, é essencial a adesão da paciente às recomendações fornecidas pelas equipes de saúde, o que torna fundamental a avaliação desse indicador. A pesquisa apresentada avaliou a adesão de participantes de um programa de atendimento interdisciplinar a gestantes de alto risco desenvolvido em um hospital geral privado por meio de três instrumentos: Questionário Morisky-Green de adesão ao uso de medicação, Questionário de Adesão ao Tratamento e Pergunta descritiva de avaliação qualitativa. Durante oito meses, 83 gestantes responderam aos questionários, que possibilitaram identificar níveis de adesão ao longo do tempo de participação no programa, situações de não adesão mais frequentes, bem como variáveis que interferem nas medidas de adesão ao uso de medicação e ao tratamento global. Considera-se que os índices levantados são passíveis de uso como indicadores clínicos e gerenciais, possibilitando a comprovação da efetividade e melhoria constante das rotinas de saúde. Tais mecanismos são úteis para definição de protocolos, discussão de casos clínicos e mesmo para feedbackàs próprias pacientes.

  17. Ressalto no canto posteromedial do joelho relacionado ao músculo sartório

    Directory of Open Access Journals (Sweden)

    Marcello Henrique Nogueira-Barbosa

    2011-06-01

    Full Text Available As causas da síndrome de ressalto no joelho relatadas com maior frequência são relacionadas a anormalidades meniscais, ao tendão do músculo bíceps femoral e aos tendões grácil e semitendíneo. Neste trabalho é descrito um caso de ressalto no canto posteromedial relacionado à junção miotendínea do músculo sartório em um paciente do sexo masculino, de 58 anos de idade, com hiperextensão do joelho.

  18. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  19. The Ashkenazi Jews of Curaçao, a trading minority

    Directory of Open Access Journals (Sweden)

    Eva Abraham-Van der Mark

    2000-07-01

    Full Text Available First describes the early Sephardi presence in Curaçao, the arrival of the Ashkenazi in the 20th c., and the relations between these 2 groups. Author goes on to discuss the Ashkenazis' economic success and the exodus of the 1980s. She asks whether the success and the exodus can be attributed to the characteristics of the group itself or whether conditions and developments in Curaçao account for economic fortune and the departure of the Ashkenazi.

  20. A MEMÕRIA DE JESUS E A MANVFESTAÇAO DO PAI NO QUARTO EVANGELHO

    Directory of Open Access Journals (Sweden)

    Johan Konings

    1988-01-01

    Full Text Available Não somos os primeiros a constatar que as cristologias narrativas pouco se inspiram no Quarto Evangelho (QE, tanto na atual teologia latino-americana como na europeia, de E. Schillebeeckx, por exemplo. Entretanto, as cristologias especulativas usam amplamente pelo menos o prólogo de João como ponto de partida para suas especulações. Será que este tratamento faz jus ao QE, ou repousa num preconceito espiritualista com relação ao evangelho que Clemente de Alexandria chamou de "espiritual"?

  1. [Study on Provenance of Kraak Porcelains from "Nan'ao I" Shipwreck].

    Science.gov (United States)

    Du, Jing-nan; Chen, Yue; Li, Nai-sheng; Ming, Chao-fang; Zhu, Jian; Luo, Wu-gan

    2015-06-01

    The "Kraak Porcelain" was a kind of Blue and White Porcelain which exported from China to Europe in Ming and Qing period. The study of Kraak Porcelain is a focus issue in international field of porcelain research. In 2007, the discovery of "Nan'ao I" Shipwreck of Ming Dynasty and the porcelains loaded in it, provided precious materials for the research on Kraak Porcelain. In this paper, we explored the provenance of 10 Kraak Porcelain samples from Nan'ao I, using both traditional visual method and WDXRF.

  2. Resistência ao Consumo em um Circuito Urbano de Parkour

    Directory of Open Access Journals (Sweden)

    Tatiana Maria Bernardo da Silva

    2011-08-01

    Full Text Available A partir de uma pesquisa alinhada ao método etnográfico, o presente trabalho tem por objetivo investigar os valores e as práticas de resistência ao consumo adotadas pelos membros de um circuito urbano de parkour no Rio de Janeiro. Confiando em uma abordagem indutiva e interpretativa amparada por um estudo empírico de base qualitativa, foram exploradas quatro categorias de análise: (1 a resistência como valor essencial; (2 um percurso de doação; (3 o consumo aprisiona; e (4 mobilização social e resistência.

  3. COMPORTAMENTO ÉTICO E CRÍTICA AO PRECONCEITO BURGUÊS

    OpenAIRE

    Carli, Ranieri

    2014-01-01

    Este artigo procura delinear os componentes mais elementares de uma ética marxista, para então focar na lacuna que há entre o preconceito, que se atém àquilo que existe de particular e imediato no homem, e o comportamento de natureza essencialmente ética, que se eleva à generalidade. A intenção é demonstrar como o preconceito limita-se ao chão raso do cotidiano, ao passo que, no polo oposto, a ética supera-o, purificando o homem singular rumo à universalidade genérica. Enfim, tomaremos alguns...

  4. Posicionamentos skinnerianos quanto ao uso do controle aversivo pelas agências de controle

    OpenAIRE

    Bruna Del Giudice Machado Godinho

    2011-01-01

    O campo de estudo, denominado controle aversivo, é constituído pelas contingências de reforçamento negativo e de punição positiva e negativa. O uso do controle aversivo tem sido alvo de muitas críticas dentro da comunidade científica. As críticas às contingências aversivas, normalmente, são dirigidas aos subprodutos emocionais que se mostram prejudiciais às pessoas controladas e ao poder positivamente reforçador que essas contingências exercem sobre os controladores. Por isso, Skinner normalm...

  5. Perfil das atitudes de formandos em enfermagem frente aos transtornos mentais no Brasil, Chile e Peru

    OpenAIRE

    Luiz Jorge Pedrão; Sueli Aparecida Frari Galera; Maria Concepcion Pezo Silva; Angelica Cazenave Gonzalez; Moacyr Lobo da Costa Júnior; Souza,Maria Conceição Bernardo de Mello e; Gricelda Uceda Senmache

    2005-01-01

    Este estudo teve por objetivo traçar um perfil de atitudes de formandos em enfermagem frente aos transtornos mentais em três culturas diferentes: Brasil, Chile e Peru. Para isso foi utilizada a escala de opiniões sobre a doença mental. Os resultados mostraram diferenças estatisticamente significantes no nível de 5% nos fatores autoritarismo, ideologia de higiene mental, restrição serial e visão minoritária, favoráveis aos estudantes brasileiros. No fator etiologia interpessoal, os resultados ...

  6. Características individuais e contextuais associadas ao bullying entre escolares no Brasil

    OpenAIRE

    Catarina Machado Azeredo

    2015-01-01

    O bullying escolar é um importante problema de saúde pública que vem sendo extensivamente estudado em países de alta renda. Nos países de baixa e média renda, características individuais e contextuais associadas ao bullying são pouco conhecidas. A presente tese é composta por três estudos. O estudo 1 objetivou realizar revisão sistemática sobre fatores contextuais associados ao bullying escolar. A busca utilizou as bases de dados MEDLINE, PsychInfo, Web of Knowledge e SciELO. Trinta e um estu...

  7. Adesão ao tratamento clínico no transtorno de personalidade borderline

    OpenAIRE

    Tanesi,Patrícia Helena Vaz; Yazigi,Latife; Fiore,Maria Luiza de Mattos; Pitta,José Cássio do Nascimento

    2007-01-01

    Adesão é um comportamento complexo, envolve desde pequenas recusas ao tratamento até o uso inadequado dos serviços de saúde e abandono do tratamento. O presente trabalho é um estudo qualitativo com seis pacientes com transtorno de personalidade borderline sobre adesão ao tratamento, utilizando análise qualitativa em entrevista aberta, questionário psicossocial, classificação diagnóstica pela SCID I e II e acompanhamento clínico. Os resultados mostraram que impulsividade, manipulação, dissocia...

  8. Ein Volk, ein Reich, ein Führer / Mihkel Raud

    Index Scriptorium Estoniae

    Raud, Mihkel, 1969-

    2004-01-01

    Autori hinnangul näitab natsisümboolika müük Tallinna vanalinnas ja natsistliku retoorika kasutamine poliitilistes kampaaniates, et suur osa Eesti inimesi ei näe selles midagi taunimisväärset ning isegi samastub sellega

  9. Critique of the Millennial Elements of the Third Reich

    Directory of Open Access Journals (Sweden)

    Antoniu Alexandru FLANDORFER

    2015-12-01

    Full Text Available The totalitarian regimes installed in Europe during the last century, besides the myriad of victims they produced, they alternatively implemented a highly refined coercive system with ideological usages. The latter aimed at installing terror in order to consolidate its absolute power by transforming the collective mind. In this respect, in a first process of alienation, the totalitarian utopias condensed the society, and then they were present in the atomization of each individual. The human archetype became the societal prototype ideologically reported to both the new man preached by Marxism and fascism and also to the Übermensch created by the National Socialism. Within the totalitarian political imaginary, we can detect an immutable hypostasis aloof from human condition, under the auspices of the laws of nature inherent to Neo- Darwinism in the case of fascism and National Socialism, and also of the laws of History when we refer to the communist Marxism. Both paradigms are expressed as pretexts for the totalitarian manipulation, demagogically shown as “ideological recipes” (Hannah Arendt generating evolution and progress. The collective imaginary shaped by the totalitarian myth was reproduced from the aspiration of modernism, according to Roger Griffin, transgressing the cultural dimension into a bio-political one, in Bolshevism and in fascism and Nazism as well. Thus, the cleavage between the two dimensions, the cultural and the socio – political one, will be done through the millennial myth expressed in the collective mind by means of utopian endeavour of creating a “new world”.

  10. The Prussian Academy of Sciences during the Third Reich

    Science.gov (United States)

    Notzoldt, Peter; Walther, Peter Th.

    2004-01-01

    In 1933, the Prussian Academy of Sciences and Humanities was an exclusive learned society, out of touch with modern methods and funding, which had also failed to re-establish itself as a "centre of research". During the Nazi regime, it was at best peripherally involved in the restructuring of German academia. While some of its members…

  11. Wilhelm Reich, das Schreiben, meine Neurose und ich

    Directory of Open Access Journals (Sweden)

    Jan Decker

    2011-05-01

    Full Text Available Der Prosaiker, Dramatiker und Hörspielautor Jan Decker reflektiert in diesem Essay über Bedingungen und Widerstände des literarischen Schreibens. Dabei geht es weniger um poetologische Verfahren als vielmehr um ein Hinterfragen der Bedingungen und Dispositionen, die einen Menschen dazu verleiten, einen literarischen Text dort entstehen zu lassen, wo sich ein Selbstempfinden und die Welt berühren. Ein Bogen wird gespannt, der über die Erotik und Körperlichkeit des Schreibakts hinweg letztlich dazu führt, die »Ursprungsneurose« als das zu pflegende Enigma des Autors zu erkennen.

  12. Neither rich nor sexy; Weder reich noch sexy

    Energy Technology Data Exchange (ETDEWEB)

    Meyer, Jens-Peter

    2010-11-23

    The solar thermal industry must work on its image if it wants to keep up with photovoltaic conversion. Also, specific research is still required. These issues, among others, were discussed at the Eurosun Conference at Graz, Austria. (orig.)

  13. The Third Reich’s Macroeconomic Policies: Enablers of Genocide

    Science.gov (United States)

    2012-06-08

    year plan was the understanding that Germany, as a self- sufficient nation required the ability to produce its own food supply. Overpopulated and......and other raw materials. These embargoes were due to Japan’s aggression throughout Asia . However, such embargoes were nothing new in U.S./Japanese

  14. [German neurology and neurologists during the Third Reich: the aftermath].

    Science.gov (United States)

    Martin, M; Fangerau, H; Karenberg, A

    2016-08-01

    The article discusses the consequences for neurology as a discipline which resulted from neurologists' participation in the crimes committed under National Socialism (NS). Chronologically, the current literature distinguishes mainly four overlapping stages: (1) a first phase was characterized by legal persecution and "denazification", which was also the time of the Nuremberg doctors' trial in which no neurologists were on trial. A detailed documentation of the trial for the German medical profession was published by Alexander Mitscherlich. (2) In the subsequent practice of wide amnestying and reintegration of former Nazi followers during the 1950s, neurologists were no exception as its elite continued in their positions. The year 1953 was the year of the Lisbon scandal, when chiefly Dutch representatives protested against the participation of Julius Hallervorden in the International Congress of Neurology. The newly founded societies, the German Society for Neurology (Deutsche Gesellschaft für Neurologie, DGN) and the German Society for Psychiatry and Neurology (Deutsche Gesellschaft für Psychiatrie und Neurologie, DGPN), unanimously supported their member. (3) The next period was characterized by a nascent criticism of the prevailing attitude of covering up the crimes committed by physicians during the Nazi period. The discovery of incriminating brain sections at various Max Planck Institutes brought neurology to the focus of the debate. (4) Since the 1980s and 1990s historians (of medicine) have been systematically examining medicine's Nazi past in a professional way, which resulted in a noticeable increase of knowledge. Additionally, a new generation of scholars provoked a change of mind insofar as they recognized medicine's responsibility for the crimes committed between 1933 and 1945. We expect that future historical research will further elucidate the history of neurology during the NS regime and have consequences for our current understanding of research ethics.

  15. Finasteride-associated male infertility Infertilidade masculina associada ao uso de finasterida

    Directory of Open Access Journals (Sweden)

    Sidney Glina

    2004-01-01

    Full Text Available Finasteride is a potent and specific inhibitor of the 5alpha-reductase enzyme in men. Clinical studies have shown that finasteride 1mg/day is effective for promoting hair growth in men with male pattern hair loss. However, there is a concern about the use of finasteride, especially in young fertile patients, because of its action on testosterone metabolism. This paper describes 3 cases of young patients who had very poor seminal quality during finasteride treatment (1 mg/day, and their seminal quality greatly improved after cessation of finasteride treatment. Two of them presented with a left varicocele and the other was obese. We hypothesize that finasteride may not dramatically change the spermatogenesis process in healthy men, but in patients with conditions related to infertility, an amplification of the negative influence of finasteride could occur. Future studies should be done to clarify the extent of the effect of finasteride in patients fertility problems.A finasterida é um potente e específico inibidor da enzima 5alfa-redutase em homens. Estudos clínicos demonstraram que finasterida 1mg/dia diminui a progressão da queda e aumenta o crescimento do cabelo em homens que sofrem de queda de cabelo hereditária. Por sua influência no metabolismo dos andrógenos existe uma preocupação a respeito do seu uso, principalmente em pacientes em idade fértil. Neste trabalho são descritos 3 casos de pacientes jovens, que apresentaram piora do espermograma durante o uso continuado de finasterida 1mg revertida após a suspensão do mesmo. Dois deles tinham varicocele unilateral e o terceiro era obeso. Aparentemente o tratamento com finasterida promoveu alteração significativa na qualidade seminal. Pode-se especular que talvez a finasterida por si só não traga alteração para a espermatogênese como reportado por Overstreet et al. (1999, mas que em pacientes de risco com possíveis causas de infertilidade associadas, possa ocorrer a

  16. Doença periodontal materna como fator associado ao baixo peso ao nascer Maternal periodontal disease as a factor associated with low birth weight

    Directory of Open Access Journals (Sweden)

    Simone Seixas da Cruz

    2005-10-01

    Full Text Available OBJETIVO: Estudos recentes têm apresentado evidências de que a doença periodontal em gestantes pode ser um dos determinantes do baixo peso ao nascer. Realizou-se estudo para verificar a existência de associação entre doença periodontal materna e baixo peso ao nascer. MÉTODOS: Estudo do tipo caso-controle com 302 mulheres, sendo 102 mães de nascidos vivos de baixo peso (grupo caso e 200 mães de nascidos vivos com peso normal (grupo controle. A existência de associação entre doença periodontal e baixo peso ao nascer foi avaliada mediante modelo multivariado de regressão logística, considerando outros fatores de risco para o baixo peso. RESULTADOS: Ambos os grupos de mães eram comparáveis no que se refere a idade, altura, peso pré-gestacional, tabagismo, alcoolismo, doenças prévias, estado civil, situação socioeconômica, número de escovações e uso de fio dental, número de refeições diárias, e visitas ao dentista. A doença periodontal foi diagnosticada em 57,8% das mães do grupo caso e 39,0% do grupo controle. A análise de regressão logística indicou associação positiva entre doença periodontal e baixo peso ao nascer (ORbruto=2,15; IC 95%: 1,32-3,48, especialmente entre as mães com escolaridade menor ou igual a quatro anos (ORajustada=3,98; IC 95%: 1,58-10,10. CONCLUSÕES: A doença periodontal é um possível fator de risco para o baixo peso ao nascer.OBJECTIVE: Recent studies have presented evidence that periodontal disease in pregnant women may be a determining factor for low birth weight. The present investigation was carried out to verify whether or not there is an association between maternal periodontal disease and low birth weight. METHODS: This was a case-control study on 302 women, of whom 102 were the mothers of live newborns of low weight (case group and 200 were the mothers of live newborns of normal birth weight (control group. The existence of an association between periodontal disease and low

  17. Perfil de clientes colostomizados inscritos em programa de atenção aos estomizados

    National Research Council Canada - National Science Library

    Mara Rúbia Violin; Thais Aidar de Freitas Mathias; Taqueco Teruya Uchimura

    2008-01-01

    ..., exploratório, de natureza quantitativa, foi o de identificar o perfil do paciente colostomizado, inscrito no Programa de Atenção ao Estomizado – PAE, da 15ª Regional de Saúde do Paraná...

  18. Rituais aos Mortos da Tradi��o do Batuque e do Candombl�

    OpenAIRE

    de Oliveira, Ricardo Moreira

    2013-01-01

    Resumo: este artigo se prop�e apresentar os rituais dedicados aos mortos na tradi��o do Batuque afro-riograndense, do Candombl� e os raros templos Egungun do Brasil, bem como os procedimentos de desenlace de iniciados nos cultos de matriz africana referidos. Palavras-chave: Egun. Antepassados. Axex�. Aressum. Morte.

  19. Eu gosto da escola: um estudo sobre o apego ao ambiente escolar

    Directory of Open Access Journals (Sweden)

    Pollyana Verissimo de Araújo

    Full Text Available Resumo O presente artigo teve como objetivo analisar o nível de apego dos alunos ao ambiente escolar. Para tanto, adotou-se a perspectiva da relação pessoa-ambiente que busca contribuir para a vertente institucional da psicopedagogia. Participaram do estudo 200 alunos do ensino médio, com idade média de 15,15 (DP=0,98, igualmente distribuídos entre escolas públicas e privadas de uma capital nordestina. Estes responderam à Escala Apego ao Lugar, além de questões sociodemográficas. As análises indicaram que o nível de apego à escola foi considerável em relação ao esperado, evidenciando uma diferença significativa do nível de apego ao lugar em função do tipo de sistema de ensino (t(191 = -2,205; p≤0,03, com destaque para a escola privada (M= 3,36; DP= 0,603. Com base nesses resultados, foi possível discutir a necessidade de desenvolver estratégias voltadas para promoção de identidade com a escola, percepção da escola como comunidade e atitudes positivas frente à escola.

  20. General cognitive distortions and body satisfaction : Findings from the Netherlands and Curaçao

    NARCIS (Netherlands)

    Dijkstra, Pieternel; Barelds, Dick; Van Brummen-Girigori, Odette

    2017-01-01

    The present study examined ten cognitive distortions, as assessed by the Cognitive Distortions Scale (CDS), and their relations to body satisfaction among young women living in The Netherlands (n = 152) and Curaçao (a former colony of the Netherlands; n = 160). Findings showed that, in general,

  1. High prevalence of dermal parasites among coral reef fishes of Curaçao

    NARCIS (Netherlands)

    Bernal, M.A.; Floeter, S.R.; Gaither, M.R.; Longo, G.O.; Morais, R.; Ferreira, C.E.L.; Vermeij, M.J.A.; Rocha, L.A.

    2016-01-01

    During expeditions to Curaçao in August and October of 2013, a large number of fish infected with dermal parasites was observed. Infected individuals presented black spots and white blemishes on their skin and fins that were easily observed by divers, and which have been associated with infections

  2. On the radulae and spines of some Polyplacophora and Archaeogastropoda from Curaçao

    NARCIS (Netherlands)

    Righi, Gilberto

    1968-01-01

    During her stay at Curaçao from December 1965 to March 1966 Prof. Dr. DIVA DINIZ CORRÊA collected several groups of marine invertebrates. I should like to thank her for having entrusted me with the Polyplacophora and Archaeogastropoda for further study of radulae and spines.

  3. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    2014-12-17

    Dec 17, 2014 ... In this study, the performance of different aluminium hydroxide–based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and ...

  4. Molecular Evidence for Dissemination of Unique Campylobacter jejuni Clones in Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Duim, B.; Godschalk, P.C.R.; Braak, N. van den; Dingle, K.E.; Dijkstra, J.R.; Leyde, E.; Plas, J. van der; Colles, F.M.; Endtz, H.P.; Wagenaar, J.A.; Maiden, M.C.J.; Belkum, A. van

    2003-01-01

    Campylobacter jejuni isolates (n = 234) associated with gastroenteritis and the Guillain-Barré syndrome (GBS) in the island of Curaçao, Netherlands Antilles, and collected from March 1999 to March 2000 were investigated by a range of molecular typing techniques. Data obtained by pulsed-field gel

  5. A new species of the Rodent Baiomys from Aruba and Curaçao

    NARCIS (Netherlands)

    Husson, A.M.

    1960-01-01

    In his paper on the mammals of the islands of Aruba, Curaçao, and Bonaire (situated off the north coast of Venezuela), WAGENAAR HUMMELINCK (1940 a, p. 69) mentioned a juvenile specimen of a cricetine rodent which was identified by Mr. M. A. C. HINTON and Mr. R. W. HAYMAN as probably belonging to the

  6. Exposição ao vivo no tratamento de agorafobia: relato de caso

    Directory of Open Access Journals (Sweden)

    Gustavo J. Fonseca D'El Rey

    Full Text Available Relato de caso, em que a Exposição ao Vivo foi utilizada no tratamento de paciente com diagnóstico de agorafobia. O tratamento foi realizado em doze sessões, apresentando êxito no uso dessa técnica comportamental.

  7. Aluminium hydro(oxide)–based (AO) adsorbent for defluoridation of ...

    African Journals Online (AJOL)

    In this study, the performance of different aluminium hydroxide.based adsorbents was compared in terms of fluoride adsorption capacity, potential for repetitive regeneration, surface acidity and surface site concentrations. The adsorbents were aluminium hydro(oxide) (AO), activated alumina (AA), and pseudoboehmite (PB).

  8. Long-term functional outcome of mandibular reconstruction with stainless steel AO reconstruction plates

    NARCIS (Netherlands)

    van Minnen, B; Nauta, JM; Vermey, A; Bos, RRM; Roodenburg, JLN

    Mandibular continuity defects are usually reconstructed with bone grafts. However, factors associated with the tumour and the patient can still be reasons to choose reconstruction plates. The aim of this study was to find out the results of mandibular reconstructions with stainless steel AO

  9. The groundwater quality of Aruba, Bonaire and Curaçao: a hydrogeochemical study

    NARCIS (Netherlands)

    Sambeek, M.H.G. van; Eggenkamp, H.G.M.; Vissers, M.J.M.

    2000-01-01

    Groundwater resources on the Caribbean Islands of Aruba, Bonaire and Curaçao are limited and of poor quality. The groundwater of the islands is brackish, due to both seawater mixing and the semi-arid climate of the islands.Two hundred and thirty water samples were collected to relate chemical

  10. Social behavior of the Paguridae and Diogenidae of Curaçao

    NARCIS (Netherlands)

    Hazlett, Brian A.

    1966-01-01

    1. The social behavior patterns of twelve species of hermit crabs found in the waters around Curaçao, N.A. are described. All species showed marked similarity in their aggressive displays, the most common of which are movements of the appendages, called here the ambulatory raise and cheliped

  11. Do afro-americanismo ao caucasianismo: um convertido discute o cristianismo ocidental

    Directory of Open Access Journals (Sweden)

    Edison Minami

    2015-04-01

    Foi a partir dessas ideias de fundo que iniciei a leitura do livro de Alex e Donna Jones, Não tem preço. O livro – na verdade são dois textos, um do marido e outro da esposa – relatos da conversão de dois afro-americanos pentecostais ao catolicismo.

  12. Eutrophication threatens Caribbean seagrasses – An example from Curaçao and Bonaire

    NARCIS (Netherlands)

    Govers, L.L.; Lamers, L.P.M.; Bouma, T.J.; de Brouwer, J.H.F.; van Katwijk, M.M.

    2014-01-01

    Seagrass beds are globally declining due to human activities in coastal areas. We here aimed to identify threats from eutrophication to the valuable seagrass beds of Curaçao and Bonaire in the Caribbean, which function as nursery habitats for commercial fish species. We documented surface- and

  13. The complexity of national identity Construction in Curaçao, Dutch Caribbean

    Directory of Open Access Journals (Sweden)

    Rose Mary Allen

    2010-10-01

    Full Text Available Curaçao, one of the five islands of the Dutch Caribbean federation called the Netherlands Antilles, currently stands at a crossroad of constitutional reform. In the context of these changes at the political level, it is logical that national identities are being redefined and repositioned. The developments in the fashioning of national identities in Curaçao deserve attention locally but also regionally. How do people in Curaçao construct national identities in daily life? How is a national collective constructed on the one hand, and how are differences with other collectivities constructed on the other hand? The historical context of constitutional changes that have occurred over the years is considered as well as an examination of the present discourse on constitutional reform. These identity issues are then placed within a wider Caribbean context.  Resumen: La complejidad de la construcción de la identidad nacional en Curaçao,en el Caribe holandés Curaçao, una de las cinco islas de la federación caribeña neerlandesa llamada Antillas Holandesas, se encuentra hoy en día en una encrucijada de reformas constitucionales. En el contexto de estos cambios a nivel político, es lógico que las identidades nacionales sean redefinidas y reposicionadas. Los desarrollos en la formulación de identidades nacionales en Curaçao merecen atención local, y también regional. ¿Cómo construye la gente en Curaçao identidades nacionales en la vida cotidiana? ¿Cómo, por un lado, se construye el colectivo nacional y, por otro, cómo se construyen las diferencias con otras colectividades? En este análisis se estudia el contexto histórico de los cambios constitucionales que han ocurrido en el curso del tiempo y se realiza igualmente una revisión del actual discurso sobre la reforma constitucional. Estos problemas de identidad son analizados entonces en un contexto caribeño más amplio.

  14. Improved tilt sensing in an LGS-based tomographic AO system based on instantaneous PSF estimation

    Science.gov (United States)

    Veran, Jean-Pierre

    2013-12-01

    Laser guide star (LGS)-based tomographic AO systems, such as Multi-Conjugate AO (MCAO), Multi-Object AO (MOAO) and Laser Tomography AO (LTAO), require natural guide stars (NGSs) to sense tip-tilt (TT) and possibly other low order modes, to get rid of the LGS-tilt indetermination problem. For example, NFIRAOS, the first-light facility MCAO system for the Thirty Meter Telescope requires three NGSs, in addition to six LGSs: two to measure TT and one to measure TT and defocus. In order to improve sky coverage, these NGSs are selected in a so-called technical field (2 arcmin in diameter for NFIRAOS), which is much larger than the on-axis science field (17x17 arcsec for NFIRAOS), on which the AO correction is optimized. Most times, the NGSs are far off-axis and thus poorly corrected by the high-order AO loop, resulting in spots with low contrast and high speckle noise. Accurately finding the position of such spots is difficult, even with advanced methods such as matched-filtering or correlation, because these methods rely on the knowledge of an average spot image, which is quite different from the instantaneous spot image, especially in case of poor correction. This results in poor tilt estimation, which, ultimately, impacts sky coverage. We propose to improve the estimation of the position of the NGS spots by using, for each frame, a current estimate of the instantaneous spot profile instead of an average profile. This estimate can be readily obtained by tracing wavefront errors in the direction of the NGS through the turbulence volume. The latter is already computed by the tomographic process from the LGS measurements as part of the high order AO loop. Computing such a wavefront estimate has actually already been proposed for the purpose of driving a deformable mirror (DM) in each NGS WFS, to optically correct the NGS spot, which does lead to improved centroiding accuracy. Our approach, however, is much simpler, because it does not require the complication of extra DMs

  15. Resistência ao clopidogrel: prevalência e variáveis associadas

    Directory of Open Access Journals (Sweden)

    Fabrício Braga da Silva

    Full Text Available FUNDAMENTO: A dupla terapia antiagregante plaquetária com ácido acetilsalicílico e clopidogrel é pedra angular do tratamento de pacientes submetidos a angioplastia com implante de stents coronarianos. Todavia, parte desses pacientes, a despeito do uso de aspirina e clopidogrel, não se encontram eficazmente antiagregados, fenômeno conhecido como resistência aos antiagregantes plaquetários. A sua prevalência, assim como as condições a ela relacionadas são desconhecidas em nosso meio. OBJETIVO: Determinar a prevalência de resistência ao clopidogrel, assim como as variáveis a ela relacionadas. MÉTODOS: Pacientes admitidos para angioplastia eletiva em uso crônico de aspirina e clopidogrel entre janeiro de 2007 e janeiro de 2010. Uma hora após o procedimento, foi medida a agregação plaquetária utilizando a agregometria óptica com difosfato de adenosina 5 µmoles/l como agonista. Nesse momento, em um coorte transversal, determinou-se a prevalência de resistência ao clopidogrel, definida com um valor de agregação plaquetária > 43% e um modelo de regressão logística às variáveis a ela relacionadas. RESULTADOS: Foram analisados 205 pacientes (66,4 ± 11anos, 61,5% masculino. A prevalência de resistência ao clopidogrel foi 38,5% (IC95% 31,9 - 45,2%. O valor da glicemia (OR = 1,014 IC95% 1,004 - 1,023, infarto do miocárdio prévio (OR = 2,320 IC95% 1,1103 - 4,892 e a resposta terapêutica à aspirina (OR = 1,057 IC95% 1,017 - 1,099 foram as variavéis de associação independente à resistência ao clopidogrel. CONCLUSÃO: A prevalência de resistência ao clopidogrel foi alta. Glicemia, infarto agudo do miocárdio prévio e a resposta ao ácido acetilsalicílico foram variáveis a ela relacionadas. A melhor compreensão desse fenômeno se faz necessária frente às novas propostas de antiagregantes plaquetários.

  16. CONTRIBUIÇÃO AO ENTENDIMENTO DA SENSIBILIDADE AMBIENTAL AO DERRAMAMENTO DE ÓLEO NO LITORAL DE MARICÁ NO ESTADO DO RIO DE JANEIRO

    Directory of Open Access Journals (Sweden)

    Érika Cardoso da Silva Baptista

    2016-01-01

    Full Text Available Desastres associados ao transporte marinho e terrestre de hidrocarbonetos causam sérios impactos aos ambientes costeiros, afetando a fauna e a flora marinha, além de prejudicar diversas atividades econômicas, inclusive àquelas tradicionais, como é o caso da pesca artesanal. Assim, faz-se necessário conhecer a geologia e a geomorfologia da costa, em especial as praias devido à elevada dinâmica e vulnerabilidade desses ambientes. A construção de megaempreendimentos na zona costeira e o tráfego de navios petroleiros e pequenas embarcações, ou mesmo a implantação de dutos, localizados junto à linha de costa, representam uma ameaça ao equilíbrio dos ecossistemas. Para tal, foram analisados diversos aspectos da geomorfologia costeira de Maricá, para posterior identificação do grau de sensibilidade deste litoral a eventos de derramamento de óleo, a partir do Índice de Sensibilidade Ambiental (ISA proposto pelo Ministério do Meio Ambiente. O litoral de Maricá, ao longo de 34 km de extensão entre Itaipuaçú (no extremo oeste e Ponta Negra (a leste, apresenta quatro áreas distintas quanto à sensibilidade à poluição decorrente de derramamento de óleo, sendo: ISA1, para as áreas de costões rochosos localizados nas extremidades leste e oeste deste litoral; ISA4, para a quase totalidade das praias, formadas por areias quartzosas grossa e média, exceto o extremo-oeste de Itaipuaçú, que possui areia muito grossa e cascalhos sendo, portanto, representada pelo ISA5; e ISA10, para as lagoas costeiras e canais na retaguarda das barreiras arenosas, sujeitas à contaminação por meio dos canais e por transposição por grandes ondas de tempestades. Os índices compreendem os extremos dessa classificação, devido à grande variedade de elementos na paisagem costeira de Maricá e mostra a elevada sensibilidade deste litoral, frente à ameaça de desastres causados por derramamento de óleo.

  17. Controle dos recursos locals através da contabilidade pública: a transformalçao do processo do antigo ao novo regime

    OpenAIRE

    Campos Luceno, María Soledad

    2012-01-01

    Durante muito  tempo, a precariedade firlanceira do Eslado colidia com a prosperidade dos recursos locais. Isto se viu agravado no ultimo périodo do Antigo Regime com a perda das colonias, principal fonte de ingressos do Estado, assim como pelos conflitos bélicos nos que o pais esteve imerso, que aumentaram os gastos. Esta situaçao levou a que os distintos governos que se sueederam na Espallha desde a metade do seculo XVII ate o final do XIX. tivessem um objetivo comun, o comtrole dos recurso...

  18. Resistência de Eleusine indica aos inibidores de ACCase Eleusine indica resistance to ACCase inhibitors

    Directory of Open Access Journals (Sweden)

    R.A. Vidal

    2006-01-01

    Full Text Available Dentre as causas da ineficácia no controle de plantas daninhas destaca-se a resistência delas aos herbicidas. Os objetivos deste trabalho foram avaliar a suspeita de resistência de Eleusine indica a inibidores de acetil-CoA carboxilase (ACCase e investigar a ocorrência de resistência cruzada entre os inibidores de ACCase. Biótipo de Eleusine indica originado do Mato Grosso com suspeita de resistência aos herbicidas inibidores de ACCase foi avaliado em casa de vegetação na sua suscetibilidade para diversos produtos do grupo dos ariloxifenoxipropionatos e cicloexanodionas. Estudos de resposta à dose confirmaram que o biótipo era 18 vezes mais insensível ao sethoxydim do que biótipo suscetível nunca aspergido com herbicidas. Também se constatou resistência cruzada ao fenoxaprop, cyhalofop, propaquizafop e butroxydim. Não se observou resistência cruzada aos produtos fluazifop, haloxyfop, quizalofop e clethodim.Among the causes for weed control inefficacy, the worst one is resistance to herbicides. The objectives of this work were to evaluate an Eleusine indica biotype suspected of resistance to ACCase inhibitors and to investigate the occurrence of cross- resistance to several ACCase inhibitors. One biotype of Eleusine indica originated from Mato Grosso with suspected resistance to ACCase inhibitors was evaluated in a greenhouse in relation to its susceptibility to several products of the ariloxyphenoxypropionate and cyclohexanedione groups. Studies on dose response confirmed that the suspected biotype was 18 times more insensitive to sethoxydim than the susceptible biotype that had never been treated with herbicides. Cross-resistance was confirmed for fenoxaprop, cyhalofop, propaquizafop and butroxydim. No cross-resistance was observed with fluazifop, haloxyfop, quizalofop, and clethodim.

  19. Estudo clínico e histológico das pálpebras e conjuntiva hígidas submetidas ao tratamento tópico com soluções anestésicas em coelhos Clinical and histological evaluation of healthy eyelid and conjunctiva subject to local treatment with anesthetic solutions in rabbits

    Directory of Open Access Journals (Sweden)

    A.V.C. Amaral

    2013-02-01

    Full Text Available Avaliaram-se as apresentações comerciais de colírios anestésicos aplicados em 63 coelhos da raça Nova Zelândia, distribuídos em três grupos (G1, G2 e G3 de 21 animais cada e que receberam instilação de uma gota em cada olho seis vezes ao dia. Os animais do G1 foram tratados com colírio de cloridrato de proparacaína a 0,5%; os do G2, com colírio de cloridrato de tetracaína a 1% associado à fenilefrina a 0,1%; e os do G3, com solução fisiológica. Cada grupo foi subdividido em três subgrupos com sete animais cada, os quais foram tratados por três, sete e 15 dias. No final de cada tratamento, dois animais de cada subgrupo foram sacrificados para exame histológico de fragmentos retirados da conjuntiva, da terceira pálpebra e das pálpebras. Observou-se, ao exame clínico, episclerite em graus diversos em 100% dos animais do G1, no terceiro, sétimo e 15º dia, e em apenas 17,8% nos do G2, nestes mesmos dias. Ao exame microscópico, observaram-se aumento do número de células califormes, proliferação de folículos linfoides, aumento do número de eosinófilos e aumento do espaço intersticial nas pálpebras dos animais do G1. Pôde-se concluir que o colírio de tetracaína a 1% associado à fenilefrina a 0,1% promoveu maior toxicidade à conjuntiva ocular e às pálpebras de coelhos quando comparado ao colírio de proparacaína a 0,5%.This work aimed to evaluate commercial presentations of anesthetic eye drops in sixty three New Zealand rabbits which were separated equally in three groups (G1, G2 and G3. The G1 group was treated with 0.5% proparacaine chloridrate eye drop, G2 group with 1% tetracaine chloridrate associated with 0.1% phenylephrine eye drop and G3 group with 0.9% physiologic solution eye drop. All of them received one drop in each eye six times a day. Each group was subdivided into three subgroups (seven rabbits, which are treated for 3, 7 and 15 days. At the end of each treatment, two animals in each subgroup

  20. Prevalência e fatores associados ao consumo de frutas, legumes e verduras entre adolescentes de escolas públicas de Caruaru, PE Prevalence and factors associated with the consumption of fruit and vegetables by adolescents in public schools in Caruaru, Pernambuco state

    Directory of Open Access Journals (Sweden)

    Ludmila Correa Muniz

    2013-02-01

    Full Text Available Trata-se de um estudo transversal de base escolar que avaliou a prevalência e fatores associados ao consumo diário de frutas, legumes e verduras (FLV entre adolescentes de escolas públicas de Caruaru (PE. Para avaliar os fatores associados ao consumo diário de FLV, realizou-se análise multivariável e hierarquizada, por regressão de Poisson, com variáveis sociodemográficas no primeiro nível, comportamentais no segundo e alimentares no terceiro. Os resultados mostraram que, dos 600 adolescentes entrevistados, 10% informaram não consumir frutas e 30,7% não consomem legumes/verduras. A prevalência de consumo diário de frutas foi 32,9% e de legumes/verduras 29%. Apenas 6,5% dos adolescentes consomem ambos os alimentos diariamente. Somente o consumo diário de legumes/verduras apresentou diferença segundo sexo (maior nas meninas. O consumo diário de frutas foi 63% maior entre residentes da zona urbana. Não ingerir álcool esteve associado com maior consumo de frutas, mas não com o de legumes/verduras. O consumo diário de frutas e legumes/verduras foi 2,4 vezes maior entre adolescentes que consomem arroz e feijão diariamente. O consumo diário de FLV entre adolescentes caruaruenses é inferior ao recomendado, estando associado ao sexo, zona de residência, consumo de álcool e de arroz e feijão.This is a cross-sectional school-based study that evaluated the prevalence and associated factors of the daily intake of fruit and vegetables by adolescents at public schools in Caruaru, Pernambuco. Poisson regression with a hierarchical model, including sociodemographic variables in the first hierarchical level, behavioral variables in the second and diet-related variables in the third was used to assess the factors associated with fruit and vegetable intake. The results showed that of the 600 adolescents interviewed, 10% reported never eating fruit and 30.7% mentioned not eating vegetables. Prevalence of fruit intake was 32.9% and

  1. Fatores associados aos tratamentos inadequados em grupo de portadores de tuberculose multirresistente

    Directory of Open Access Journals (Sweden)

    Barroso Elizabeth Clara

    2003-01-01

    Full Text Available INTRODUÇÃO: A tuberculose multirresistente é uma ameaça ao controle da tuberculose em todo o mundo. Tratamento inadequado é freqüentemente apontado como fator de risco para tuberculose multirresistente. OBJETIVO: Identificar fatores associados ao tratamento inadequado em portadores de tuberculose multirresistente. MÉTODO: Foram levantados e identificados os testes de sensibilidade para tuberculose, realizados no Laboratório Central do Estado do Ceará de 1990 a 1999. Foi realizado um estudo retrospectivo e prospectivo, em grupo de portadores de tuberculose multirresistente, comparando as características dos pacientes com tratamento adequado com as dos com tratamentos inadequados. Foi considerado multirresistente o bacilo resistente a pelo menos rifampicina + isoniazida e utilizado o método das proporções. RESULTADOS: Dos 1.500 testes de sensibilidade realizados, 266 eram multirresistentes. Destes, identificaram-se apenas 153 pacientes, dos quais 19 foram excluídos, restando, no estudo, 134 pacientes. Pela análise univariada os fatores associados significativamente ao tratamento inadequado foram: não-adesão ao tratamento, pobreza extrema, intolerância medicamentosa, falha no atendimento, falta de medicação, dois ou mais tratamentos anteriores, lesões radiológicas bilaterais e grandes cavidades pulmonares. Foi encontrada ainda associação (p < 0,001 de alcoolismo e/ou tabagismo com a não-adesão. Na análise multivariada, permaneceram associados ao tratamento inadequado: dois ou mais tratamentos anteriores (p < 0,0001, OR = 5,9; IC 95%: 2,5-13,7, grandes cavidades pulmonares (p < 0,0217, OR = 2,7; IC 95%: 1,2-6,1 e lesões radiológicas bilaterais (p < 0,0226, OR = 3,2; IC 95%: 1,4-7,4. CONCLUSÃO: Neste estudo, observou-se que os fatores associados aos tratamentos inadequados são de grande abrangência. Deve existir uma tentativa para controlar melhor a doença, principalmente nos pacientes em retratamento e nos portadores

  2. The Effectiveness of a Mixed-Mode Survey on Domestic Violence in Curaçao: Response and Data Quality

    Science.gov (United States)

    van Wijk, Nikil; de Leeuw, Edith; de Bruijn, Jeanne

    2015-01-01

    To collect reliable statistical data on domestic violence in Curaçao, we conducted a large-scale quantitative study (n = 816). To meet with the special needs of the population and topic, we designed a tailored mixed-mode survey to assess the prevalence of domestic violence in Curaçao and its health consequences. Great care was taken to reduce…

  3. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao

    NARCIS (Netherlands)

    Stock, Jan H.

    1992-01-01

    STOCK, J. H. 1992. A new species of Hemicyclops (Crustacea, Copepoda, Poecilostomatoida, Clausidiidae) associated with hermit crabs in Curaçao. Stud. Nat. Hist. Caribbean Region 71, Amsterdam 1992: 69-78. Hemicyclops geminatus n. sp. is described from the upper infralittoral zone of Curaçao

  4. Truncus arteriosus operado aos 28 anos: importância do diagnóstico diferencial

    Directory of Open Access Journals (Sweden)

    Lilian Maria Lopes

    2011-08-01

    Full Text Available Descrevemos um caso de adulto de 28 anos com suspeita de cardiopatia congênita desde o nascimento, não tratada na infância por opção da família. Aos 27 anos, foi feito diagnóstico de atresia pulmonar com comunicação interventricular e colaterais sistêmico-pulmonares, sendo contraindicada a cirurgia. Uma nova reavaliação em nosso serviço demonstrou tratar-se de um truncus arteriosus atípico. O fato de um tronco arterial comum com shunt esquerda-direita ter sido visualizado ao ecocardiograma foi um dado crucial para a indicação de novo cateterismo, abrindo perspectiva de correção cirúrgica. No momento, o paciente encontra-se bem, com 7 anos de evolução pós-operatória.

  5. As resistências ao poder em Michel Foucault The resistance to power in Michel Foucault

    OpenAIRE

    Guilherme Castelo Branco

    2001-01-01

    Ainda pouco estudada, a última fase do pensamento de Michel Foucault traz contribuições inegáveis ao debate ético e político de nossa época, sobretudo por enfatizar o papel do indivíduo e das coletividades nas lutas de transformação das estruturas de poder ora vigentes. Os modos de ser das lutas de resistência, sua importância no quadro referencial do último Foucault, revelam uma dimensão política antes insuspeitada em sua obra. Essa dimensão, para além da analítica do poder, concede aos pequ...

  6. Escala multidimensional aplicada aos estudos de apreciação musical

    Directory of Open Access Journals (Sweden)

    Raquel Cocenas da Silva

    2009-08-01

    Full Text Available A escala multidimensional (MDS provém de uma família de técnicas de análise de proximidade de dados, obtida por meio do julgamento do participante que compara vários estímulos em vários traços, concomitantemente. A análise dos julgamentos de proximidade produz um espaço em que pontos representam a relação entre os estímulos em um espaço euclidiano. O ordenamento dos estímulos ao longo das dimensões neste espaço permite que inferências possam ser feitas sobre o universo perceptual subjacente ao grupo de pesquisa. A literatura mostra que a MDS vem ampliando o estudo da música e a mensuração de suas propriedades estruturais.

  7. A amizade para Foucault: resistências criativas face ao biopoder

    Directory of Open Access Journals (Sweden)

    Hélio Rebello Cardoso Jr.

    2009-04-01

    Full Text Available O artigo trabalha a noção de amizade em Foucault como um modo de vida que se opõe ao processo de normalização empreendido pelo biopoder. Inicia com uma caracterização acerca do Estado Moderno. Logo após, aborda a historicidade dos processos de subjetivação e de como a atitude frente a estes implica estados de maior autonomia ou sujeição. Em seguida, aborda a amizade como resistência à normalização, situando-a em relação ao prazer e à sexualidade. Por fim, discute o papel da filosofia no processo de constituição da amizade, particularmente quanto à possibilidade de pensá-la por meio de uma teoria das relações.

  8. Evolução da temperatura ambiente em construções sujeitas ao fogo

    OpenAIRE

    Inácio, Pedro Jorge Rita Ledo

    2011-01-01

    Dissertação para a obtenção do Grau de Mestre em Engenharia Civil A perda de bens materiais e de vidas humanas em situações de incêndio tem sido ao longo dos tempos uma preocupação crescente, promovendo assim o conceito de segurança contra incêndio e de diversos mecanismos associados à sua prevenção ou limitação dos danos causados. Um incêndio é algo difícil de prever, assim como a sua consequência nos elementos de construção. Dessa forma, ao longo das ultimas décadas, os elementos d...

  9. Do mundano ao sagrado: o papel da efervescência na teoria moral durkheimiana

    Directory of Open Access Journals (Sweden)

    Raquel Andrade Weiss

    2013-12-01

    Full Text Available Meu objetivo neste artigo é discutir o significado do conceito de efervescência na obra durkheimiana e apontar o papel que esse processo desempenha em relação à sua teoria moral. De modo geral, a argumentação versa em torno da articulação de três pressupostos estruturais da teoria moral durkheimiana, quais sejam, 1 a vinculação entre sagrado e ideal moral, 2 a concepção acerca da natureza humana como sendo essencialmente dual e 3 a proposta normativa de Durkheim de institucionalização de uma moralidade laica. Ao final, proponho ao leitor uma reflexão sobre a pertinência de sua defesa de um "sagrado laico" a partir dos desafios morais que caracterizam o mundo contemporâneo.

  10. Associação entre indicadores de risco ao desenvolvimento infantil e estado emocional materno

    OpenAIRE

    Flores,Mariana Rodrigues; Souza,Ana Paula Ramos de; Moraes,Anaelena Bragança de; Beltrami,Luciane

    2013-01-01

    OBJETIVO: analisar a associação entre os estados emocionais maternos depressivo e ansioso, combinados ou de modo isolado, em relação à presença de risco ao desenvolvimento infantil na faixa etária de 0 a 4 meses. MÉTODO: trata-se de estudo observacional, analítico e de coorte. Para a obtenção dos dados foram utilizados os Inventários de Beck de Depressão e de Ansiedade e analisada a interação mãe-bebê a partir do protocolo de índices de risco ao desenvolvimento infantil em uma amostra de 182 ...

  11. Contribuições ao dimensionamento de torres eólicas de concreto.

    OpenAIRE

    Paulo Vitor Calmon Nogueira da Gama

    2015-01-01

    O trabalho dedica-se ao estudo das torres eólicas protendidas de concreto, com a finalidade de promover a discussão sobre os critérios de dimensionamento, tema de grande relevância na atualidade. Para tal, foi considerada uma torre eólica de 100 m de altura provida de turbina de 5 MW, cujas ações foram obtidas da literatura. O carregamento de vento ao longo da torre foi tratado como estático equivalente de acordo com disposições normativas, através de uma forma simplificada para a adoção de u...

  12. Resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado

    Directory of Open Access Journals (Sweden)

    W. M. Souza

    Full Text Available A resistência ao cisalhamento de lajes nervuradas unidirecionais de concreto armado sem estribos nas nervuras ainda gera controvérsias quando sua estimativa não considera a contribuição da capa monolítica. Visando contribuir para o melhor entendimento do comportamento destas lajes, foram confeccionados em laboratório 8 painéis de lajes nervuradas unidirecionais de concreto armado onde as principais variáveis foram a distância entre as nervuras e a espessura da capa. Foram avaliadas as recomendações normativas da NBR 6118, ACI 318 e EUROCODE 2 para as resistências últimas destas lajes. Os resultados experimentais mostraram que houve acréscimo de resistência ao cisalhamento com o aumento da espessura da capa, resultando também em maiores deformações nas armaduras e em flechas mais elevadas.

  13. O exercício do estudar nos cursinhos destinados aos concursos públicos

    Directory of Open Access Journals (Sweden)

    Leonardo Del Puppo Luz

    2008-06-01

    Full Text Available O artigo discute o processo de produção da subjetividade contemporânea elaborado sobre o Estudar em alunos de cursinhos destinados aos concursos públicos. Procura-se discutir as tecnologias de poder, sobretudo na relação saber-poder, engendradas nestes "ambientes educacionais", já que tais construções sobre o Estudar produzem e perpetuam a manifestação de conceitos absolutos e verdadeiros de se pensar o estudo por meio de técnicas e procedimentos de funcionamentos ideais e idealizados. Busca-se problematizar este modelo homogêneo baseado no tecnicismo do estudar e nas falas sobre o verdadeiro visando colocar em análise o estereótipo do "fracasso" atrelado aos alunos vinculados a estes locais.

  14. Analyses of Alternatives (AoAs): Toward a More Rigorous Determination of Scope

    Science.gov (United States)

    2014-03-11

    Inappropriate Treatment of Time Constraints ..................................................... 7  Inappropriate Focus on Existing C/CSS and/or...several reasons why AoAs may be improperly scoped. Inappropriate Treatment of Time Constraints In the first section, we noted the recent trend...Type Memorandum DTM 10-017). Washington, DC: Author. Retrieved from http://www.hsdl.org/?view&did=728880 United States Air Force Office of

  15. Subordinate but proud: Curaçao's free blacks and mulattoes in the eighteenth century

    Directory of Open Access Journals (Sweden)

    Wim Klooster

    1994-07-01

    Full Text Available Focuses on the socio-economic position of free non-whites in 18th-c. Curaçao. The manumission rate was relatively high and consequently a large group of free non-whites was created. Blacks and mulattoes enjoyed religious freedom as well as considerable economic freedom. Their growing numbers and social and economic assertiveness alarmed the whites, who gradually admitted the most successful mulattoes in their circles.

  16. Caminhoneiros de rota curta e sua vulnerabilidade ao HIV, Santos, SP

    Directory of Open Access Journals (Sweden)

    Villarinho Luciana

    2002-01-01

    Full Text Available OBJETIVO: Descrever a vulnerabilidade, de caminhoneiros de rota curta, à transmissão sexual do HIV e da Aids. MÉTODOS: Foram entrevistados 279 caminhoneiros com vínculo de trabalho na cidade de Santos, SP, em locais de concentração na área portuária e suas proximidades, sindicatos e associações, recrutados pela amostragem do tipo "bola-de-neve". Foram realizadas entrevistas utilizando perguntas abertas e fechadas sobre questões sociodemográficas, práticas sexuais, uso de drogas, conhecimento sobre o HIV e a Aids, contato prévio com programas de prevenção à Aids em Santos, percepção de sua vulnerabilidade ao HIV e à Aids. Foi realizada análise descritiva da amostra, e apresentados relatos para ilustrar algumas situações de vulnerabilidade. RESULTADOS: Do total de 279 caminhoneiros entrevistados, 93% declararam ter parceira fixa, 40% referiram manter relações sexuais com parceiras casuais, e 19% referiram manter relações sexuais com parceiras freqüentes. A principal situação de vulnerabilidade ao HIV ocorre devido ao uso inconsistente do preservativo, interligado ao vínculo estabelecido com cada parceira. O tempo fora de casa parece não ser o principal fator para situações de vulnerabilidade, conforme demonstram estudos com caminhoneiros de rota longa. CONCLUSÕES: A cultura "machista" e os papéis tradicionais masculinos são emblemáticos entre os caminhoneiros de rota curta. Certamente é necessário investir mais na prevenção nessa categoria profissional. A prevenção em locais de trabalho parece promissora, pois permite entender melhor seu universo, propiciando intervenções educativas adequadas a essa categoria profissional.

  17. Do corpo histérico ao "corpus" teórico

    Directory of Open Access Journals (Sweden)

    Francisco Ramos de Farias

    1992-09-01

    Full Text Available Este estudo aborda a maneira pela qual Freud, de forma original, efetuou uma leitura no corpo-sintoma da histérica e construiu uma clínica inédita destinada ao tratamento das neuroses. Esta clínica, fundada na transferência, é suportada pelo edifício teórico que tem o inconsciente e a sexualidade como paradigmas.

  18. Diversity and spatial heterogeneity of mangrove associated sponges of Curaçao and Aruba

    OpenAIRE

    Hunting, E.R.; van Soest, R.W.M.; Van der Geest, H. G.; Vos, A; Debrot, A.O.

    2008-01-01

    Sponges are major epibionts of mangrove roots in the Caribbean. Mangrove sponge communities in the Caribbean mainly consist of species that are typical to this habitat and community compositions often differ from those found on coral reefs nearby. Heterogeneity in species distributions between locations and within locations between roots is often reported. This study quantifi es the diversity and abundance of mangrove associated sponges in the inner bays of Curaçao and Aruba and correlates va...

  19. Análise de fatores associados ao significado do trabalho

    Directory of Open Access Journals (Sweden)

    Sergio Hideo Kubo

    2012-12-01

    Full Text Available O trabalho tem sido visto não somente como forma de obter a renda, mas também como atividade que proporciona realização pessoal, status social e possibilidade de estabelecer e manter contatos interpessoais, entre outros. Nesta pesquisa, teve-se como objetivo investigar os fatores que influenciam e conferem sentido ao trabalho, como centralidade do trabalho, normas da sociedade e objetivos e resultados valorizados. Na centralidade do trabalho, procurou-se investigar o grau de importância do trabalho dentro do contexto das diversas áreas da vida das pessoas, como família, lazer, religião e vida comunitária. Em normas da sociedade, foram analisados os pontos mais significativos no tocante ao que a sociedade deveria proporcionar ao indivíduo, assim como o que o indivíduo deveria fazer em prol da sociedade. Nos objetivos e resultados valorizados, foi pesquisado o que as pessoas buscam com o trabalho. A partir da pesquisa na literatura, foi elaborado um modelo inicial que, não se mostrando satisfatório segundo critérios estatísticos, foi substituído por outro que apresentou significância estatística e boa aderência aos dados. O modelo escolhido foi o que melhor goodness-of-fit apresentou, quando se utilizou modelagem de equações estruturais pelo método partial least square. O estudo revelou que o significado do trabalho se reflete, na ordem, na centralidade do trabalho, nos objetivos e resultados valorizados e, por último, nas normas sociais.

  20. Perícia contábil: uma ferramenta de combate ao crime organizado

    Directory of Open Access Journals (Sweden)

    IDALBERTO JOSÉ DAS NEVES JÚNIOR

    2011-11-01

    Full Text Available No Brasil e no mundo, devido principalmente à ausência do Estado no cumprimento do seu papel de garantidor da lei e da ordem, as organizações criminosas cresceram significativamente, e as suas ações passaram a ocorrer de formas planejadas e estratégicas. Para combatê-las e reprimi-las, a Perícia Contábil, materializada nos laudos periciais elaborados pelos peritos criminalistas, surge como importante ferramenta de Inteligência. Nesse contexto, o objetivo desta pesquisa foi identificar a relevância da Perícia Contábil como meio de prova para a solução de controvérsias relativas ao crime organizado. Para tanto, houve a realização de pesquisa de campo por meio de questionário aplicado aos Delegados, Escrivães e Agentes de Polícia das divisões da Diretoria de Combate ao Crime organizado – DCOR do Departamento de Polícia Federal. Também, houve a utilização de técnicas de estatística multivariada de análise de cluster para o estudo dos registros (K-Means clusters do software SPSS, que resultou na formação de dois agrupamentos. Considerando a pesquisa de campo e o referencial teórico, verificou-se que a Perícia Contábil, no limite de suas atribuições, é um relevante meio de prova para a solução de controvérsias relativas ao crime organizado.

  1. Avaliação da sensibilidade da goiabeira 'Pedro Sato' ao ozônio

    Directory of Open Access Journals (Sweden)

    Regina Maria de Moraes

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a sensibilidade da goiabeira 'Pedro Sato' ao ozônio (O3, em comparação à cultivar Paluma, descrita como sensível. Oito plantas de cada cultivar foram submetidas separadamente a ar filtrado e a ar filtrado + O3, cinco horas por dia, durante quatro dias. Foram avaliadas fotossíntese (Asat, injúrias foliares visíveis e concentração de antocianinas e taninos. Plantas das duas cultivares também foram expostas, durante três meses, a condições ambientais em local contaminado por O3, tendo-se avaliado fotossíntese, injúrias foliares e crescimento. Plantas fumigadas com O3 apresentaram redução de Asat e da atividade fotoquímica, além de manifestação de injúrias foliares. 'Paluma' apresentou maior redução de Asat, injúrias foliares mais severas e redução de taninos. Quando exposta ao ambiente contaminado, 'Paluma' apresentou trocas gasosas mais altas, mas apresentou redução de Asat 30 dias antes que 'Pedro Sato'. O crescimento não foi afetado em 'Pedro Sato', cujas injúrias foliares tiveram menor incidência, severidade e precocidade do que em 'Paluma'. A menor taxa de crescimento de 'Paluma' indica maior sensibilidade ao O3. Apesar de responder com menor intensidade ao estresse induzido pelo O3, a cultivar Pedro Sato não pode ser considerada tolerante, pois apresenta danos fotoquímicos, injúrias foliares e alterações nos conteúdos de metabólitos secundários quando exposta a esse poluente.

  2. Potencial de fertilizantes e corretivos no aporte de micronutrientes ao solo

    OpenAIRE

    Vinícius Gedeão Bezerra de Carvalho; Clístenes Williams Araújo do Nascimento; Caroline Miranda Biondi

    2012-01-01

    Fertilizantes e corretivos, ao serem aplicados nos solos, fornecem micronutrientes como impurezas residuais da sua fabricação, os quais podem ser importantes fontes para as culturas. Em decorrência disso, o objetivo deste trabalho foi quantificar os teores dos micronutrientes Zn, Cu, Fe, Mn e Ni em fertilizantes e corretivos comercializados no Nordeste brasileiro, visando avaliar o potencial desses insumos no fornecimento indireto de micronutrientes às culturas agrícolas. Os insumos analisado...

  3. Do valor intrínseco e de sua aplicabilidade ao meio ambiente

    Directory of Open Access Journals (Sweden)

    Tânia Ap. Kuhnen

    2004-01-01

    Full Text Available O tema deste estudo é a teoria do valor sagrado da vida e sua aplicabilidade às questões de ética prática, mais especificamente ao meio ambiente. O objetivo geral consiste em apontar os limites da concepção de Dworkin sobre a teoria do sagrado, quando aplicada ao meio ambiente, e a solução que Singer oferece para a atribuição de valor ao mesmo. Justifica-se esse trabalho em decorrência da importância de se discutir, a partir da análise dessas teorias filosóficas, questões vinculadas ao estabelecimento de um princípio ético que, além de englobar, no campo da ação moral, todos os seres sencientes, envolva também o meio ambiente como um todo. Além disso, o tema que aqui se desenvolve é uma contribuição do raciocínio filosófico-teórico para a discussão de problemas relevantes no campo da ética prática. Esse estudo ainda se justifica por abordar a questão da linha moral divisória entre os seres que são ou não incluídos na comunidade moral, o que representa outro problema que concerne à ética. As diferentes formas de classificação não foram capazes de incluir todos os seres vivos no âmbito da comunidade moral. Há sempre exclusões, as quais tendem a diminuir com o surgimento de teorias éticas inovadoras, dentre elas as que serão abordadas a seguir.

  4. Clinical use of AO three-dimensionally preformed titanium mesh plates for orbital fractures

    Directory of Open Access Journals (Sweden)

    Ming Chen

    2015-01-01

    Full Text Available AIM:To evaluate the accuracy and practicability of three-dimensionally preformed Arbeitsgemeinschaft Osteosynthese AO titanium mesh plates for orbital fractures.METHODS:Forty-seven patients with isolated blow-out orbital fractures were included in this study. Fracture locations were as follows: floor/medial wall(n=26, 55%, medial wall(n=12, 26%, and floor(n=9, 19%. The floor fractures were exposed by a standard transconjunctival approach, whereas a combined transcaruncular transconjunctival approach was used in patients with medial wall fractures with temporary dissection of inferior oblique muscle. A three-dimensionally preformed AO titanium mesh plate was selected according to the size of the defect previously measured on the preoperative computed tomographic scan examination and fixed at the inferior orbital rim with 2 screws. The accuracy of plate positioning of the reconstructed orbit was assessed on the postoperative computed tomography(CTscan. The practicability of clinical use of AO three-dimensionally preformed titanium mesh plates was assessed on the preoperative and postoperative clinical data.RESULTS: Postoperative orbital CT scan showed an anatomic three-dimensional placement of the orbital mesh plates in all of the patients. All patients had a successful treatment outcome without clinical complications. 40 patients(87%had a successful enophthalmos correction. 25 patients(86%had a successful recovery from diplopia.CONCLUSION: Three-dimensionally preformed AO titanium mesh plates for orbital fracture reconstruction results in an accurate anatomic restoration of the bony orbital contour with a high rate of success to correctenophthalmos and diplopia.

  5. Software interativo: ecocardiografia na avaliaçao da hipertensao arterial

    Directory of Open Access Journals (Sweden)

    Fábio Abdalla Segamarchi

    Full Text Available A hipertensao arterial é uma doença muito prevalente, evoluindo com lesoes em órgaos-alvo, alta morbidade e mortalidade. A avaliaçao das repercussoes cardíacas pela ecocardiografia tem papel importante na conduçao clínica dos indivíduos hipertensos, e suas imagens podem ser utilizadas como ferramenta para o ensino. OBJETIVOS: Desenvolver e avaliar um software, construído com base em imagens ecocardiográficas, abordando de forma ilustrativa e interativa a estrutura e funçao cardíacas normais,bem como as alteraçoes induzidas pela hipertensao arterial. MÉTODOS: Foram selecionadas imagens ecocardiográficas de indivíduos normais e com comprometimento cardíaco determinado pela hipertensao (hipertrofia ventricular esquerda, miocardiopatia dilatada e infarto do miocárdio. Com estas imagens foi construído um software no programa multimídia Flash, que foi avaliado por estudantes de Medicina (n=38 e Enfermagem (n=18, também submetidos a pré- e pós-teste. RESULTADOS: Os alunos consideraram o software útil, atraente e adequado as atuais metodologias educacionais proativas,promovendo ganho de conhecimento na compreensao do comprometimento cardíaco na hipertensao arterial. Conclusao: O software foi bem avaliado e considerado útil na aquisiçao de conhecimento numa área específica mais prevalente do comprometimento da saúde do adulto.

  6. Fatores associados ao sedentarismo no lazer em idosos, Campinas, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Maria Paula do Amaral Zaitune

    2007-06-01

    Full Text Available O objetivo deste estudo foi conhecer a prevalência de sedentários no lazer (que referem não praticar nenhum exercício físico no lazer ao menos uma vez por semana em idosos de Campinas, São Paulo, Brasil, segundo fatores demográficos e sócio-econômicos, outros comportamentos relacionados à saúde e à presença de morbidades. Trata-se de um estudo transversal, de base populacional, com amostragem em múltiplos estágios. A análise dos dados levou em conta o desenho amostral. A prevalência de sedentários foi 70,9%, sendo que as razões de prevalências foram significativamente maiores que um para os idosos de menor renda (1,31: 1,11-1,55, tabagistas (1,39: 1,23-1,57, com transtorno mental comum (1,20: 1,04-1,39 e do sexo feminino (1,16: 1,00-1,35. A prevalência de caminhada foi 23,5%, seguida por ginástica ou musculação (3,8% e por natação ou hidroginástica (3,6%. Os resultados apontam para a necessidade do desenvolvimento de ações globais com respeito aos comportamentos relacionados à saúde. Atenção especial deve ser dada aos idosos do sexo feminino, àqueles com transtorno mental comum e aos de menor nível sócio-econômico a fim de garantir eqüidade em relação às práticas de promoção da saúde.

  7. Adherencia a tratamientos en pacientes con factores de riesgo cardiovascular Aderência ao tratamento em pacientes com fatores de risco cardiovascular Adherence to treatments in patients with cardiovascular risk factors

    Directory of Open Access Journals (Sweden)

    INNA ELIDA FLÓREZ TORRES

    Full Text Available Objetivo: Describir los factores que influyen en la adherencia a los tratamientos en pacientes con factores de riesgo de enfermedad cardiovascular de un hospital de tercer nivel de la ciudad de Cartagena, Colombia. Metodología: Estudio descriptivo-metodológico, realizado con 293 pacientes inscritos en los programas de hipertensión y diabetes. Se aplicó el instrumento diseñado por Bonilla y De Reales para evaluar los factores que influyen en la adherencia a los tratamientos, al cual se le realizaron pruebas de validación que arrojaron una buena confiabilidad dada por un alfa de Cronbach de 0,79 para la calificación total del instrumento y un coeficiente de correlación test-retest (Sperman, estadísticamente significativo. Resultados: Globalmente, el 88% de los pacientes se encontró en la categoría sin riesgo de no adherirse a los tratamientos, un 12%, en riesgo moderado. Conclusiones: los factores que favorecieron la adherencia, fueron la disponibilidad de recursos económicos para satisfacer las necesidades básicas, redes de apoyo familiares y un sistema y equipo de salud organizado. El riesgo moderado de no adherencia, se relacionó con las intervenciones del equipo de salud, entre éstas, falta de orientaciones sobre la forma de ajustar los horarios de los medicamentos, carencia de recomendaciones escritas sobre el tratamiento, confusión por cambios del médico, y percepción de gravedad de la enfermedad. Estos hallazgos apoyan la necesidad de implementar procesos de formación e investigación a nivel institucional y académico que preparen a los profesionales en el abordaje de la problemática de la no adherencia en enfermedades crónicas.Objetivo: Descrever os fatores que influenciam na aderência aos tratamentos em pacientes com fatores de risco de doença cardiovascular de um hospital de terceiro nível da cidade de Cartagena, Colômbia. Metodologia: Estudo descritivo-metodológico, realizado com 293 pacientes inscritos nos

  8. Optimal control strategy to reduce the temporal wavefront error in AO systems

    Science.gov (United States)

    Doelman, Niek J.; Hinnen, Karel J. G.; Stoffelen, Freek J. G.; Verhaegen, Michel H.

    2004-10-01

    An Adaptive Optics (AO) system for astronomy is analysed from a control point of view. The focus is put on the temporal error. The AO controller is identified as a feedback regulator system, operating in closed-loop with the aim of rejecting wavefront disturbances. Limitations on the performance of feedback regulator systems are discussed. The concept of optimal control is proposed to minimise the temporal error. The issue of closed-loop feedback controller design is made transparent by using the principle of Internal Model Control. The central issue in reducing the temporal wavefront is the design of a feedforward prediction filter. In three separate tests - a numerical simulation example, measured data from an AO test bench and open-loop telescope data - the advantage of optimal control over the common approach of integral control is demonstrated. Optimal control of the temporal error yields a smaller temporal error, enables a longer integration time in the wavefront sensor, or the use of fainter natural guide stars.

  9. Do modernismo ao alívio pós-moderno

    Directory of Open Access Journals (Sweden)

    Simone Regina Dias

    2003-06-01

    Full Text Available Ao traçar um mapeamento dos elementos fundantes da grande crise mundial que se instaurou desde 1789, no livro Crítica e crise, Reinhart Koselleck sustenta: Pertence à natureza da crise que uma decisão esteja pendente mas ainda não tenha sido tomada. Também reside em sua natureza que a decisão a ser tomada permaneça em aberto. Portanto, a insegurança geral de uma situação crítica é atravessada pela certeza de que, sem que se saiba ao certo quando ou como, o fim do estado crítico se aproxima. A solução possível permanece incerta, mas o próprio fim, a transformação das circunstâncias vigentes — ameaçadora, temida ou desejada —, é certo. A crise invoca a pergunta ao futuro histórico. As constatações de Koselleck apontam para o reconhecimento de um estado de crise permanente do mundo. Isto é, um olhar focado em determinado momento da história poderia extrair, em tempos diversos, um quadro em que se detecta a crise, um estado de incertezas.

  10. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    2013-04-01

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  11. Dificuldades vividas por pessoas trans no acesso ao Sistema Único de Saúde

    Directory of Open Access Journals (Sweden)

    Pablo Cardozo Rocon

    Full Text Available Resumo Objetivou-se discutir as dificuldades de pessoas trans moradoras da região metropolitana da Grande Vitória/ES em acessarem os serviços de saúde no SUS. Utilizou-se uma abordagem qualitativa por meio de entrevistas semiestruturadas com 15 pessoas trans. Os resultados apontaram o desrespeito ao nome social, a discriminação e o diagnóstico no processo transexualizador como principais limitações no acesso ao sistema de saúde. Afirma-se que o diagnóstico contribui para ocultar a responsabilidade da heteronormatividade e do binarismo de gênero pela marginalização social das pessoas trans. Conclui-se que é necessário modificar o diagnóstico em sua função, já que a existência de uma patologia prévia não é requisito para acessar o SUS. Aponta-se, também, a importância de elaborar programas de educação e campanhas permanentes sobre o direito de acesso ao sistema de saúde livre de discriminação e com uso do nome social.

  12. Simulated Guide Stars: Adapting the Robo-AO Telescope Simulator to UH 88”

    Science.gov (United States)

    Ashcraft, Jaren; Baranec, Christoph

    2018-01-01

    Robo-AO is an autonomous adaptive optics system that is in development for the UH 88” Telescope on the Mauna Kea Observatory. This system is capable of achieving near diffraction limited imaging for astronomical telescopes, and has seen successful deployment and use at the Palomar and Kitt Peak Observatories previously. A key component of this system, the telescope simulator, will be adapted from the Palomar Observatory design to fit the UH 88” Telescope. The telescope simulator will simulate the exit pupil of the UH 88” telescope so that the greater Robo-AO system can be calibrated before observing runs. The system was designed in Code V, and then further improved upon in Zemax for later development. Alternate design forms were explored for the potential of adapting the telescope simulator to the NASA Infrared Telescope Facility, where simulating the exit pupil of the telescope proved to be more problematic. A proposed design composed of solely catalog optics was successfully produced for both telescopes, and they await assembly as time comes to construct the new Robo-AO system.

  13. Currículo universitário: do México ao Brasil neoliberais

    Directory of Open Access Journals (Sweden)

    Dostoiewski Mariatt de Oliveira Champangnatte

    2016-03-01

    Full Text Available Resumo O objetivo deste estudo foi discutir e comparar percepções e ações curriculares de professores universitários mexicanos e brasileiros. Contextualizando as realidades socioeconômicas dos dois países e, principalmente, as políticas governamentais voltadas ao ensino superior, observa-se, nas várias falas dos professores, uma abordagem simplista de currículo, significando-o apenas como preocupações de conteúdos administrados em disciplinas e planos de ensino. Aspectos da realidade social, política e econômica são desatrelados do pensamento e prática curriculares, onde o maior objetivo se tornou a adequação ao mercado de trabalho. Nota-se, direta e indiretamente, influências do pensamento e práticas neoliberais no posicionamento desses professores tanto quanto ao currículo como com a própria funcionalidade do ensino superior, refletindo e reproduzindo, em seus discursos e práticas, as políticas governamentais neoliberais vigentes.

  14. Improvement of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens

    Directory of Open Access Journals (Sweden)

    Tao He

    2015-12-01

    Full Text Available AIM:to observe the effect of modified surgery of small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens.METHODS:The study included 37 patients(37 eyeswho could not be performed the regular implantation of posterior chamber intraocular lens for the rupture of posterior capsule or for the zonular dialysis caused by trauma, congenital or surgery. Bausch & lomb Akreos Adapt AO fordable intraocular lens, VE22000 implantation device were applied in this study. Regular 2.4mm transparent cornea incision and pocket-like sclera incision were made. The intraocular lens were transscleral sulcus fixed by 10/0 prolene suture and the suture was buried within the scleral incision.RESULTS:The intraocular lenses were all well posited and the postoperative visual acuity(VAwas improved in all patients. Three eyes(8%were≥0.8 while 18 eyes(49%>0.4~≤0.6 and the remaining 16(43%were ≤ 0.4 at 3mo after surgery.Cornea astigmatism was 1.73D±1.22D and 1.62±1.34D before and after surgery, no statistic significance was observed(PCONCLUSION:The modified surgery of 2.4mm small incision transscleral sulcus fixation of Akreos Adapt AO foldable intraocular lens has the following advantages such as:good visual results, less postoperative astigmatism, small surgery incision, steady intraocular lens, less manipulation, less complication and more effective.

  15. Atendimento domiciliar ao idoso: problema ou solução?

    Directory of Open Access Journals (Sweden)

    Ciro Augusto Floriani

    Full Text Available O atendimento domiciliar ao idoso tem se tornado um importante instrumento de assistência nos últimos anos, tanto nos países desenvolvidos quanto nos países em desenvolvimento. Vários aspectos éticos, sociais e operacionais têm sido negligenciados e a literatura nacional é escassa em relação a esta temática. A partir de revisão bibliográfica em atendimento domiciliar, este artigo enfoca, do ponto de vista bioético, os potenciais problemas advindos com a implantação dessa crescente e importante modalidade de atendimento. Conclui ser necessário um maior direcionamento ético na implantação do atendimento domiciliar, com políticas de proteção ao paciente, à família e ao cuidador, visando a aperfeiçoar a qualidade dos programas oferecidos.

  16. Escala de atitudes face ao lazer em adolescentes e jovens adultos

    Directory of Open Access Journals (Sweden)

    Teresa Freire

    2007-04-01

    Full Text Available Atualmente, o lazer e as atitudes face ao lazer têm sido alvo de interesse na investigação psicológica, concretamente no domínio da Psicologia Social. O objetivo do presente estudo foi adaptar a escala Leisure Attitude Scale de Raghb e Beard, construída para avaliar as atitudes face ao lazer em função das três componentes de atitude (cognitiva, afetiva e comportamental para a população de estudantes, adolescentes e jovens adultos portugueses. Participaram no estudo 462 sujeitos (57,8% do sexo feminino e 42,2% do sexo masculino, com uma média de idades de 19,97 (desvio padrão de 4,85. Os resultados obtidos confirmam a estrutura e as características psicométricas da versão original, refletindo valores largamente aceitáveis de fidelidade (consistência interna e validade (validade de conteúdo quer para a escala total quer para as várias sub-escalas (cognitiva, afetiva e comportamental. Conclui-se pela adequação da escala na medida das atitudes face ao lazer, no contexto português.

  17. Physical Growth and Nutritional Status among Ao Naga Children of Nagaland, Northeast India

    Directory of Open Access Journals (Sweden)

    Temsumongla Longkumer

    2013-01-01

    Full Text Available The present study was carried out on 571 Ao Naga children including 289 boys and 282 girls aged 8 to 15 years from Mokokchung town, Nagaland. This study tried to find out the physical growth according to the height and weight and nutritional status according to the body mass index (BMI following the classification by Cole et al. Our study revealed that the girls were taller than boys till 13 years and the boys became taller thereafter. As for weight, the girls were heavier during 10 to 14 years. The mean height and weight increased as the age advanced in both boys and girls. The prevalence of underweight was 30.12% and the prevalence of overweight was 2.28% among the Ao Naga children, and the girls were found to have a higher prevalence of overweight and the boys had a higher prevalence of underweight. This revealed that both underweight and overweight coexisted among the Ao Naga children from Mokokchung town, although the prevalence of overweight was not high.

  18. Desempenho escolar da criança vitimizada encaminhada ao fórum judicial

    Directory of Open Access Journals (Sweden)

    Paulo Celso Pereira

    Full Text Available O objetivo do estudo foi caracterizar o desempenho escolar da criança vítima de violência doméstica atendida no Fórum Judicial. Participaram do estudo 20 crianças vitimizadas comparadas com seus pares da mesma sala de aula, mesmo sexo e mesma faixa etária, mas sem histórico de violência doméstica, suas respectivas mães e professoras. As crianças responderam ao Teste de Desempenho Escolar, Inventário de Estilos Parentais e ao Teste de Raven (Escala Especial e apresentaram o caderno escolar. As mães responderam a uma entrevista e a Escala de Táticas de Conflitos Revisada (CTS-2. As professoras apresentaram sua opinião sobre o desempenho acadêmico dos participantes. Os dados obtidos mostraram que a criança vitimizada tem desempenho escolar inferior ao grupo controle. Os resultados da CTS-2 indicaram que a maioria das crianças vitimizadas estava exposta à violência conjugal. O estudo mostrou que, além da violência doméstica direta e indireta, tais crianças estavam expostas a outros fatores de risco, tais como, pobreza, baixa escolaridade materna e uso de álcool e/ou droga por familiares.

  19. Reconhecimento dos aspectos tacêsicos para o cuidado afetivo e de qualidade ao idoso hospitalizado

    Directory of Open Access Journals (Sweden)

    Teresa Cristina Gioia Schimidt

    Full Text Available Verificar os aspectos tacêsicos importantes para serem observados ao tocar o idoso. Estudo de campo, qualitativo e exploratório desenvolvido com 117 graduandos e profissionais de saúde participantes da capacitação em comunicação não verbal em gerontologia. Os resultados revelam que a maioria conseguiu identificar, pelo menos, um fator de atenção que precisa ser respeitado ao tocar o idoso. Os discursos permitiram a construção de nove categorias apontando condições necessárias ao cuidado afetivo e de qualidade prestado no âmbito da tacêsica; quais sejam: autorização para que o toque ocorra; localização do toque; intensidade do toque; condição do idoso; intencionalidade e tipo de toque; duração do toque; sexo e idade de quem toca e quem é tocado; frequência do toque e características das mãos que tocam. O tocar faz parte do cotidiano dos profissionais da saúde e expressa zelo e sentimentos consequentemente, revela a qualidade da assistência prestada.

  20. Transtorno afetivo bipolar: perfil farmacoterapêutico e adesão ao medicamento

    Directory of Open Access Journals (Sweden)

    Adriana Inocenti Miasso

    2012-06-01

    Full Text Available Este estudo teve como objetivos verificar a adesão de portadores de transtorno afetivo bipolar (TAB à terapêutica medicamentosa e identificar possíveis causas de adesão e não adesão ao medicamento de acordo com o perfil farmacoterapêutico. Trata-se de estudo transversal, descritivo, realizado em Núcleo de Saúde Mental de um município do interior paulista. Participaram do estudo 101 pacientes com TAB. Para coleta dos dados, utilizou-se a entrevista estruturada e o teste de Morisky-Green e, para a análise dos mesmos, o programa Statistical Package for the Social Science. Os resultados mostraram que a maioria (63% dos sujeitos investigados não adere ao medicamento. Apesar de não ter ocorrido diferenças significativas entre o grupo de aderentes e não aderentes, para as variáveis investigadas, foi possível verificar a utilização de polifarmacoterapia e regimes terapêuticos complexos no tratamento do TAB. Permanece como desafio a implementação de estratégias que possam melhorar, na prática, a adesão de pacientes ao tratamento medicamentoso.

  1. O ser-coronariopata: entree o viver autêntico e as amarras ao cotidiano

    Directory of Open Access Journals (Sweden)

    Lucia de Fatima da Silva

    Full Text Available Estudo fenomenológico, cujo objeto é o sentido atribuído pelos coronariopatas às suas experiências vivenciadas. Das entrevistas foram extraídas as significações: temer a morte e o retorno dos sintomas agudos; perceber a transformação na vida social, profissional e sexual; sentir-se vigiado; conformar-se com a nova condição e sentir tristeza e inconformação. Estas significações subsidiaram a análise compreensiva a qual, respaldada na obra Ser e tempo de Martin Heidegger, permitiu captar o sentido nelas velado. Os coronariopatas desvelaram-se existentes inautênticos ao temerem "algo", prenderem-se à tagarelice e ao vigor de ter sido. Ainda, transcendem ao existir autêntico quando angustiam-se, assumindo a coronariopatia como possibilidade de ser-no-mundo; embora fracassem nesta tarefa e voltem às amarras do cotidiano. O estudo reflete a necessidade de privilegiar a dimensão existencial na assistência à saúde e na formação dos profissionais, além da compreensão do outro como esteio para o cuidar.

  2. Profilaxia das úlceras associadas ao estresse Prophylaxis of ulcers associated with stress

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Pompilio

    2010-06-01

    Full Text Available INTRODUÇÃO: As úlceras da mucosa gastroduodenal que aparecem após graves insultos têm sido chamadas de úlceras associadas ao estresse ou, mais genericamente, de "doença mucosa associada ao estresse" (DMAE. São conhecidas desde a Antiguidade e apesar de relacionarem-se com altos índices de morbidade e mortalidade, esquemas de profilaxia no intuito de minimizar seus riscos, só foram introduzidos recentemente. Os inibidores da bomba de prótons têm desempenhado papel importante nesse cenário. MÉTODOS: O presente artigo é uma breve revisão sobre seu uso dentro do contexto clínico da profilaxia do sangramento gastrointestinal relacionado ao estresse.INTRODUCTION: Gastroduodenal mucosal ulcers that appear after severe insults have been called ulcers associated with stress or, more generally, "mucosal disease associated with stress" (DMAE. Are known since antiquity and although linked with high morbidity and mortality, prevention schemes in order to minimize their risk, were introduced only recently. The proton pump inhibitors have played an important role in this scenario. METHODS: This article is a brief review of its use within the clinical context of prophylaxis of gastrointestinal bleeding due to stress.

  3. Ausência de expectativa de suporte para o cuidado aos idosos da comunidade

    Directory of Open Access Journals (Sweden)

    Déborah Cristina de Oliveira

    2016-06-01

    Full Text Available RESUMO Objetivo: identificar fatores associados à ausência de expectativa de suporte para o cuidado aos idosos da comunidade. Método: foram utilizados parte dos dados do estudo multicêntrico "Fragilidade em Idosos Brasileiros", pesquisa quantitativa, epidemiológica e transversal desenvolvida no período de 2008 a 2009. Foram realizadas análises de comparação e regressão dos dados de 671 idosos. Resultados: a avaliação da expectativa de suporte para o cuidado aos idosos mostrou-se um bom indicador de risco para ausência de expectativa de suporte em mulheres, idosos que residiam sozinhos e com percepção ruim da própria saúde. Conclusão: conclui-se que é preciso refletir sobre o sistema de suporte oferecido aos idosos no Brasil, visto que o perfil destes que estão em risco é cada vez maior na população. Ressalta-se também a importância da inserção de métodos subjetivos para avaliação da percepção dos idosos sobre suporte para o cuidado.

  4. O DUALISMO DO SER ÓRFICO NA EPÍSTOLA DE PAULO AOS ROMANOS

    Directory of Open Access Journals (Sweden)

    Roger Ribeiro da Silva

    2010-01-01

    Full Text Available Este trabalho consiste na comparação de fragmentos de textos encontrados na obra de Platão e na Epístola aos Romanos atribuída à Paulo. Retirados de inúmeros textos atribuídos a Platão, estes fragmentos tiveram confirmados indícios da teologia órfica pelo professor Alberto Bernabé Pajares. E ao aplicar a Metodologia de Analise do Discurso Teológico, desenvolvido especificamente para este trabalho, e comparado os resultados individuais, encontramos pontos de encontro entre as duas teologias, a Órfica e a Paulina, acentuando o que tange a crença no Dualismo do Ser. A problemática levantada neste trabalho se refere a como a representação1 da alma unida ao corpo, encontrada em escritos paulinistas, apresenta indícios de contatos com fundamentos órficos no berço do cristianismo.

  5. O enfermeiro frente ao desmame precoce na consulta de enfermagem à criança

    Directory of Open Access Journals (Sweden)

    Caroline Aparecida Coutinho Monteschio

    2015-10-01

    Full Text Available RESUMOObjetivo:analisar a atuação do enfermeiro frente ao desmame precoce em crianças menores de 6 meses de idade.Método:estudo descritivo de abordagem qualitativa. Participaram do estudo enfermeiros que realizavam consulta de enfermagem à criança de maneira programática em unidades de saúde da família em Cuiabá-MT. Os dados foram coletados nos meses de janeiro e fevereiro de 2012, por meio da observação participante da consulta de enfermagem. Para análise dos dados foi utilizada a análise de conteúdo.Resultados:os enfermeiros, na maioria das vezes, utilizaram estratégias apropriadas para o manejo dos problemas mais comuns na amamentação, apesar de algumas condutas não terem, ainda, evidência científica comprovada, quanto aos benefícios e/ou prejuízos à sua prática.Conclusão:os enfermeiros abordaram aspectos importantes do aleitamento materno durante as consultas e trabalharam em prol da promoção e do resgate ao aleitamento materno exclusivo.

  6. Diabetes Mellitus: desafios relacionados ao autocuidado abordados em Grupo de Apoio Psicológico

    Directory of Open Access Journals (Sweden)

    Nunila Ferreira de Oliveira

    2011-04-01

    Full Text Available O objetivo foi identificar os sentimentos dos usuários associados ao diagnóstico do Diabetes Mellitus (DM, as dificuldades inerentes ao controle glicêmico e estratégias de enfrentamento adotadas diante das demandas impostas pela doença. Estudo qualitativo realizado com grupo de pessoas acompanhadas por equipe multiprofissional de um centro de pesquisa e extensão universitária de Ribeirão Preto, SP, Brasil. Quatro sessões grupais que constituíram o corpus da pesquisa, foram audiogravadas e transcritas. A análise temática originou as categorias: sentimentos despertados a partir do diagnóstico do DM; dificuldades no controle da doença e estratégias de enfrentamento. Os resultados evidenciaram diferentes modos de lidar com os desafios suscitados pela doença no cotidiano, que influenciam diretamente na adesão ao tratamento e constituem elementos relevantes para o planejamento de intervenções mais efetivas.

  7. Jovens no trânsito: do sentido do dirigir ao desenvolvimento de consciência

    Directory of Open Access Journals (Sweden)

    Sonia Chébel Mercado Sparti

    2008-12-01

    Full Text Available Introdução: a complexa situação relativa à circulação humana tem suscitado muitas indagações. O advento do automóvel, ao lado das dimensões positivas, também trouxe consigo um conjunto de graves problemas, destacando-se pela sua magnitude e importância, os acidentes de trânsito. Objetivo: esta pesquisa buscou conhecer como a reflexão sobre o sentido do dirigir possibilita o desenvolvimento de consciência de jovens universitários/as. Metodologia: foram utilizadas duas Entrevistas Reflexivas, realizadas de maneira Coletiva, com dez universitários/as da PUC-São Paulo/campus Sorocaba, seguidas de devolução (com pré-análise dos dados. A opção pela Entrevista Reflexiva deveu-se, dentre outros fatores, ao seu caráter de intervenção, uma vez que a escuta atenta e respeitosa pode ser um momento de ajuda. A Grounded Theory foi utilizada para a organização dos dados. Resultados: este procedimento reflexivo possibilitou a compreensão dos aspectos positivos e negativos relativos à circulação humana e levantou fatores indicativos de prevenção: afirmações categóricas a respeito das próprias habilidades ao volante cederam lugar ao reconhecimento de que ainda há espaço para seu aperfeiçoamento; o olhar relativo ao outro foi se modificando, de maneira a considerá-lo parceiro, e não adversário; a preservação da vida sendo considerada um valor, em direção a um que fazer mais prudente, no espaço compartilhado do trânsito. Conclusão: estes resultados ratificam a proposta de que é possível (e desejável pensar a educação para o trânsito na perspectiva do desenvolvimento de consciência.

  8. Seca da semente de café ao sol Effect of sunlight on coffee seed viability

    Directory of Open Access Journals (Sweden)

    Oswaldo Bacchi

    1955-01-01

    Full Text Available O presente trabalho diz respeito a estudos realizados com o objetivo de observar a influência da luz solar sôbre a capacidade germinativa da semente despolpada de café e verificar, portanto, a possibilidade de se efetuar a seca desta semente exclusivamente ao sol. Além de um ensaio preliminar, foram efetuados mais outros dois, compreendendo, ao todo, duas secas ao sol, duas em um secador a baixa temperatura (±28°C, uma a sombra e uma em um secador a alta temperatura (±40°C. Pelas correlações entre as porcentagens de germinação e de umidade, que foram estabelecidas após diferentes períodos de secagem, foram tiradas as duas seguintes conclusões, que são as principais com relação ao objetivo dêstes ensaios : 1 Os raios solares são prejudiciais à capacidade germinativa da semente de café; sua nocividade acha-se, porém, intimamente ligada ao teor de umidade na semente. 2 À vista da conclusão acima, verifica-se que a semente despolpada de café e, muito provavelmente, também a não despolpada, podem ser perfeitamente sêcas a pleno sol sem que haja prejuízo para sua vitalidade, uma vez que sejam recolhidas antes que o seu teor de umidade caia abaixo do ponto crítico de 8% - 9%.In this paper the author deals with the question related to the coffee seed drying, with special attention to the effect of the sun radiations on seed viability. Based on the results obtained, the following conclusions were drawn : (a The sun rays have no specific influence on the viability of hulled coffee seed ; their effect is indirect and related to loss of moisture by the seed. (b Coffee seed can be dried in the sunlight without loss of viability if the water content does not drop under 8% to 9%. Below this critical level seed germination falls rapidly. (c The moisture content of coffee seed dried „in the sun may fall to about 7% in a short time with the consequent injury to viability. (d Under most conditions in the state of São Paulo

  9. Forma clínica e fatores de risco associados ao estrabismo na binocularidade visual

    Directory of Open Access Journals (Sweden)

    Maria Nice Araujo Moraes Rocha

    2016-02-01

    Full Text Available RESUMO Objetivo: Identificar e analisar fatores de risco associados ao estrabismo, dados oftalmológicos e antecedentes pessoais e familiares. Métodos: Estudo prospectivo, descritivo e analítico realizado com 240 pacientes que consultaram pela primeira vez nos ambulatórios de estrabismo. Foram avaliadas a frequência e associação entre estrabismo, dados de exames oftalmológicos e antecedentes pessoais e familiares para identificação dos fatores de risco. Resultados: Observou-se maior prevalência de estrabismo em mulheres (56,96% em relação aos homens (43,02%. A faixa etária mais atendida no ambulatório de estrabismo foi composta de crianças até 15 anos de idade (83,54%. Encontrou-se mais esotropia (55,27% que exotropia (42,20% e parcela menor de estrabismo vertical isolado (2,53%. A prematuridade foi associada ao estrabismo convergente (p=0,023 e não ao divergente (p=0,086. O diabetes mellitus materno foi associado à esotropia (p=0,024 e exotropia (p=0,036 no filho, mas a hipertensão arterial materna, uso de medicamentos para hipertensão e diabetes durante a gravidez e drogas ilícitas não foram estatisticamente significativos. Pacientes com paralisia cerebral tiveram mais associação com exotropia (p=0,008 que esotropia (p=0,019. Malformações congênitas, consanguinidade entre os pais e traumas oculares não apresentaram associação estatisticamente significativa para o estrabismo. A maioria dos pacientes com estrabismo apresentou boa acuidade visual corrigida e fundoscopia normal. Na análise de proporções a hipermetropia foi mais frequente na esotropia (68,7%. Conclusão: Os fatores de riscos internos e externos podem interferir na formação e desenvolvimento do olho na fase de plasticidade ocular, com prejuízo da binocularidade visual, podendo resultar em estrabismo. Há divergências com relação aos fatores de risco realmente associados e mais estudos são necessários para a identificação.

  10. Alterações reprodutivas em ratos machos expostos perinatalmente aos frutos da Solanum lycocarpum

    Directory of Open Access Journals (Sweden)

    Aline Schwarz

    2009-04-01

    Full Text Available Ratas prenhes foram tratadas do dia 06 da gestação (GD 06 ao dia 07 pós-natal (PND 07 com frutos verdes secos e moídos da Solanum lycocarpum (10% na ração. Após nascimento das ninhadas, foi avaliado na prole masculina adulta aos 60 e 90 dias de vida, o número de espermátides e a produção espermática diária nos testículos e o tempo de trânsito espermático no epidídimo. A exposição não foi capaz de promover alterações na produção espermática diária (DSP e no número de espermátides produzidas pelo testículo dos ratos expostos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação. Não foram observadas alterações no tempo de trânsito espermático na cabeça do epidídimo, porém, foi constatado menor número de espermatozóides no corpo/cauda do epidídimo nos machos experimentais com 90 dias de vida, provavelmente resultante do menor tempo de trânsito espermático observado no corpo/cauda do epidídimo aos PND 90. Estes dados sugerem que a exposição de ratos aos frutos verdes da S. lycocarpum durante a gestação e início da lactação, não foi suficiente para promover alterações na produção mas sim no trânsito espermático, indicando possível alteração no eixo hormônio liberador das gonadotrofinas hipotálamo-hipófise-gônada

  11. Expressao genica associada ao estresse oxidativo no coracao de camundongo apos isquemia intestinal

    Directory of Open Access Journals (Sweden)

    Frederico Somaio Neto

    2014-03-01

    Full Text Available FUNDAMENTO: O fenômeno da isquemia e reperfusão intestinal é um evento frequente na clínica e está associado a repercussões deletérias em órgãos a distância, em especial ao coração. OBJETIVO: Investigar a expressão gênica do estresse oxidativo e defesa antioxidante no coração de camundongos isogênicos, submetidos a isquemia e reperfusão intestinal (IR. MÉTODOS: Doze camundongos (C57BL/6 foram distribuídos em dois grupos: Grupo IR (GIR com 60 min de oclusão da artéria mesentérica superior, seguidos de 60 min de reperfusão. Grupo Controle (GC submetidos a anestesia e a laparotomia sem o procedimento de IR observados por 120 min. As amostras de intestino e coração foram processadas pelo método (RT-qPCR / Reverse transcriptase - quantitative Polymerase Chain Reaction para determinar a expressão gênica de 84 genes relacionados ao estresse oxidativo ("t" de Student, p < 0,05. RESULTADOS: Observou-se no tecido intestinal (GIR uma expressão significantemente aumentada em 65 (74,71% genes em relação ao tecido normal (GC, e 37 (44,04% genes estiveram hiperexpressos (maior que três vezes o limiar permitido pelo algoritmo. No tocante aos efeitos da I/R intestinal a distância no tecido cardíaco verificou-se a expressão significantemente aumentada de 28 genes (33,33%, mas somente oito genes (9,52% se hiperexpressaram três vezes acima do limiar. Quatro (7,14% desses oito genes se expressaram simultaneamente nos tecidos intestinal e cardíaco. No GIR notaram-se cardiomiócitos com núcleos de menor tamanho, picnóticos, ricos em heterocromatina e raros nucléolos, indicando sofrimento cardíaco. CONCLUSÃO: A I/R intestinal promoveu a hiperexpressão estatisticamente significante de oito genes associados ao estresse oxidativo a distância no tecido miocárdico.

  12. Would be the photon a composed particle? / Sobre a possibilidade da quantiza\\c{c}\\~ao dos fluxos de campo na radia\\c{c}\\~ao eletromagn\\'etica

    CERN Document Server

    Duarte, Celso de Araujo

    2013-01-01

    Here it is made a comparative analysis between the classical and the quantum expressions for the energy of electromagnetic radiation (ER). The comparison points to the possibility of the quantization of the magnetic and the electric field fluxes in the ER. ----- Apresenta-se uma an\\'alise comparativa entre as express\\~oes cl\\'assica e qu\\^antica para a energia da radia\\c{c}\\~ao eletromagn\\'etica (RE). A compara\\c{c}\\~ao nos aponta para a possibilidade de haver uma quantiza\\c{c}\\~ao dos fluxos dos campos magn\\'etico e el\\'etrico na RE.

  13. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22

    Directory of Open Access Journals (Sweden)

    Bhave Mrinal

    2009-03-01

    Full Text Available Abstract Background Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22, a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Findings Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. Conclusion TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  14. A Tn5051-like mer-containing transposon identified in a heavy metal tolerant strain Achromobacter sp. AO22.

    Science.gov (United States)

    Ng, Shee Ping; Davis, Belinda; Palombo, Enzo A; Bhave, Mrinal

    2009-03-07

    Achromobacter sp. AO22 (formerly Alcaligenes sp. AO22), a bacterial strain isolated from a lead-contaminated industrial site in Australia, was previously found to be resistant to moderate to high levels of mercury, copper and other heavy metals. However, the nature and location of the genetic basis for mercuric ion resistance in this strain, had not been previously identified. Achromobacter sp. AO22 contains a functional mer operon with all four essential genes (merRTPA) and shows >99% DNA sequence identity to that of Tn501. The mer operon was present on a transposon, designated TnAO22, captured by introducing a broad-host-range IncP plasmid into Achromobacter sp. AO22 and subsequently transferring it to E. coli recipients. The transposition frequency of TnAO22 was 10-2 to 10-3 per target plasmid transferred. Analysis of TnAO22 sequence revealed it belonged to the Tn21 subgroup of the Tn3 superfamily of transposons, with the transposition module having >99% identity with Tn5051 of a Pseudomonas putida strain isolated from a water sample in New York. TnAO22 is thus a new variant of Tn5051 of the Tn3 superfamily and the transposon and its associated mercury resistance system are among the few such systems reported in a soil bacterium. Achromobacter sp. AO22 can thus be exploited for applications such as in situ mercury bioremediation of contaminated sites, or the mobile unit and mer operon could be mobilized to other bacteria for similar purposes.

  15. Estudo laboratorial de teste de resistência ao tracionamento da resina composta fotopolimerizável Fill Magic® destinada à colagem de braquetes para tracionamento ortodôntico de dentes retidos Laboratorial study to test traction resistance of Fill Magic® light-cured resin intended for orthodontic traction of unerupted teeth

    Directory of Open Access Journals (Sweden)

    Felipe Ladeira Pereira

    2006-02-01

    Full Text Available OBJETIVO: Avaliar a resistência à tração de duas resinas utilizadas para colagem de acessórios para tracionamento dentário. METODOLOGIA: o presente estudo comparou a adesividade e praticidade de duas resinas destinadas ao tracionamento ortodôntico de dentes impactados: a Concise® da 3M®, presente no mercado há alguns anos e tida como referência na realização deste procedimento; e a Fill Magic® da Vigodent®, cuja técnica é julgada mais simples pelo fabricante. Foram incluídos 40 terceiros molares em corpos de prova e estes divididos em dois grupos de 20, um para cada resina. Uma vez colados os braquetes, os corpos de prova foram submetidos à força de tração horizontal (10 de cada grupo e vertical (10 de cada grupo, até que os braquetes se soltassem. Os valores obtidos na máquina universal de ensaios foram registrados e comparados por meio de médias para que fosse possível estabelecer as vantagens e desvantagens de cada resina. RESULTADO E CONCLUSÃO: apesar dos valores obtidos com a resina Fill Magic® terem sido menores que os da resina Concise®, comprovou-se que eles são suficientes para a realização do tracionamento ortodôntico.AIM: comparisson of two composite adhesives used for orthodontic traction procedures. METHODS: this article compared the bonding capability and practice of two resins for direct orthodontic traction: the 3M®'s Concise®, been sold in the market for a few years and the reference for this kind of procedure; and Vigodent®'s Fill Magic®, which technique is much simpler according to the manufacturer. Forty third molars were included into acrylic resin and divided in two groups of 20, one for each resin. Once the brackets were bonded, the specimens were submitted to horizontal force (10 of each group and vertical (10 of each group, till the bracket got lost. The score obtained in the universal testing machine were recorded and compared by the average to set the advantages and disadvantages of

  16. Medicina moderna: rumo à prevenção, à cura, ao bem-estar e à longevidade

    OpenAIRE

    Ajai Singh

    2010-01-01

    A medicina moderna tem realizado muitas coisas nos campos de doenças infecciosas e de emergências para assistir a cura. Na maior parte dos outros campos, ela visa, sobretudo, ao controle, que é outro nome para o tratamento paliativo. A farmacologia, na qual se inclui a psicofarmacologia, é igualmente dirigida ao controle e ao alívio. Está na hora de profissionais da área e pesquisadores voltarem-se decisivamente para a prevenção e para a cura. Ademais, o outro grande desafio da medicina moder...

  17. Trabalho experimental de combate ao acaro rajado Tetranychus urticae Koch, 1836 com formulações aplicadas por "electrodyn"

    OpenAIRE

    Arashiro,F.Y.; Silva, J. M.; Sugamara,C. A.; Motta, R; Raizer,A.J.; MARICONI,F.A.M.

    1987-01-01

    O presente trabalho teve como objetivo o combate experimental ao ácaro rajado Tetranyohus urtioae Koch, 1836 em cultura de algodão. Dois produtos, mediante pulverização eletrodinâmica, foram experimentados: bromopropilato e bifentrina, o primeiro em duas dosagens e o segundo, em três. Aos dias da aplicação, a bifentrina mostra os melhores resultados, embora não se diferencie es tatisticamente do bromopropilato. Aos 09 dias, os melhores são as duas dosagens mais fortes da bifentrina apesar de ...

  18. Evolução temporal dos estádios do câncer de mama ao diagnóstico em um registro de base populacional no Brasil central Temporal evolution of breast cancer stages in a population-based cancer registry in the Brazilian central region

    Directory of Open Access Journals (Sweden)

    Edesio Martins

    2009-05-01

    Full Text Available OBJETIVO: Analisar a mudança temporal do estádio clínico do câncer de mama ao diagnóstico em mulheres residentes em Goiânia entre 1989 e 2003. MÉTODOS: estudo retrospectivo, utilizando-se a base de dados do Registro de Câncer de Base Populacional de Goiânia. As variáveis estudadas foram: idade, diagnóstico histológico, localização do tumor, tipo histológico e estádio clínico da doença. O período estudado foi dividido em três quinquênios: de 1989 a 1993, de 1994 a 1998 e de 1999 a 2003. Utilizou-se o teste Z para comparação das frequências da extensão ao diagnóstico por quinquênio. RESULTADOS: foram identificados 3.204 casos de câncer de mama. A média de idade foi de 56 anos (dp±16 anos. Quanto ao estádio da doença, evidenciou-se que 45,6% dos casos eram localizados na mama, com aumento de 19,2% entre o primeiro e o terceiro quinquênio (pPURPOSE: To analyze the temporal changes of breast cancer staging at diagnosis among women living in Goiânia, Goiás, Brazil, between 1989 and 2003. METHODS: Retrospective and descriptive study in which the cases were identified from the Population-Based Cancer Registry of Goiânia for the period from 1989 to 2003. The variables studied were age, diagnostic method, topographic sublocation, morphology and breast cancer staging. Frequency analyses were carried out on the variables and means, and the medians for the age were determined. The SPSS® 15.0 software was used for statistical analyses. RESULTS: A total of 3,204 breast cancer cases were collected. The mean age was 56 years (sd±16 years. With regard to clinical staging, 45.6% of the cases were found to be localized in the breast, with an increased rate of 19.25% between the first and the third five-year period (p<0.001; CI 95%=0.14-0.23 and 10.2% of cases were with distant metastases. However, a reduction of 17.74% for metastatic cases in the same interval (p<0.001 e CI 95%=0.14-21 was observed. The in situ case rate was 0

  19. Alteração das características biológicas dos biótipos de azevém (Lolium multiflorum ocasionada pela resistência ao herbicida glyphosate Change in the biological characteristics of ryegrass (Lolium multiflorum biotypes caused by resistance to the herbicide glyphosate

    Directory of Open Access Journals (Sweden)

    L. Vargas

    2005-03-01

    Full Text Available A resistência de biótipos de azevém ao herbicida glyphosate está alterando o manejo da vegetação de cobertura do solo em pomares de maçã. O objetivo deste trabalho foi determinar a dose de glyphosate necessária para reduzir 50% do acúmulo de matéria seca (GR50, a resposta do biótipo resistente e sensível a herbicidas graminicidas e o acúmulo de matéria seca destes biótipos durante o ciclo. Para isso, foram conduzidos três experimentos. No primeiro, os tratamentos constaram de doses crescentes de glyphosate aplicadas sobre plantas dos biótipos resistente e sensível para determinar o GR50. No segundo experimento, os tratamentos constaram de doses dos herbicidas glyphosate, haloxyfop-r, diclofop, fluazifop-p, fenoxaprop-p e paraquat. No terceiro experimento, sementes dos biótipos resistente e sensível foram semeadas em recipientes com capacidade para 10 L e as plantas originadas delas foram colhidas quinzenalmente, para determinação da matéria seca da parte aérea, radicular e total. Como resultados, foi obtido GR50 de 287,5 e de 4.833,5 g e.a. ha-1 de glyphosate para os biótipos sensível e resistente, respectivamente, e verificou-se que existem diferenças significativas na resposta dos biótipos aos herbicidas graminicidas, dependendo da dose utilizada. Além disso, o biótipo sensível evidenciou maior capacidade de acúmulo de matéria seca e produção de sementes. Constatouse, assim, fator de resistência (FR de 16,8 e que o mecanismo de resistência provoca alterações nas características biológicas do biótipo resistente e afeta a sensibilidade deste aos herbicidas graminicidas.The identification of ryegrass biotypes resistant to glyphosate is causing changes in weed management in apple orchards. Three experiments were carried out to determine the GR50 of the biotypes, to grass herbicides and dry matter accumulation. The first experiment tested different rates of glyphosate. Their effects on GR50 dry matter

  20. Cyberbullying – do diagnóstico de necesidades à construçao de um manual de formaçao.

    Directory of Open Access Journals (Sweden)

    Teressa Pessoa

    2011-01-01

    Full Text Available O impacto do cyberbullying na sociedade e junto das crianças e jovens, tão mais complexo quanto mais sofisticadas as ferramentas tecnológicas disponíveis, tem chamado a atenção para a importância, a nível internacional, da definição de estratégias de prevenção e intervenção junto de potenciais agentes educativos, isto é, para o desenvolvimento de uma proposta, com dimensão europeia, de Cyber- Training.Neste trabalho após uma breve apresentação do projectoCyberTraining: A Researchbased Training Manual On Cyberbullying1 dar-se-á a conhecer o processo de desenvolvimento de um manual de formação baseado numa investigação a nível europeu suportada na plataforma Moodle e, nesta, pela ferramenta Fórum. Através de uma análise de necesidades junto de formadores e do estudo, junto de especialistas, do estado de arte no domínio a nível de diferentes países, é mostrado todo um percurso inovador de construção colaborativa de conhecimento relativamente ao conceito cyberbullying assim como relativamente ao desenvolvimento de práticas de formação ou cybertraining.----------------------------------------------------------------The impact of the cyberbullying on society and among children and young people, revealed as ever more complex as more sophisticated technological tools becomeavailable, has called attention to the importance, at the international level, of a definition of strategies for prevention and intervention among potential educational agents, i.e. to develop a proposal for Cyber-Training, with a European dimension.In this paper, after a brief presentation of the European project CyberTraining: A Researchbased Training Manual on Cyberbullying, an account will be given of the process of developing a training manual based on research at European level supported in the Moodle platform, and within this, by the Forum tool. By means of a needs analysis among trainers and analysis by experts of the state of the art in

  1. Relative importance of the AO, NAO and Aleutian Low in predicting regional climate change

    Science.gov (United States)

    Paeth, H.; Rauthe, M.; Hense, A.

    2003-04-01

    In recent years, several observational and climate model studies have drawn a picture of Northern Hemisphere circulation modes which are largely sensitive to the greenhouse forcing with implications for regional climate change. The dominant candidates are the Arctic Oscillation (AO), the North Atlantic Oscillation (NAO) and the Aleutian Low (AL). Here, we consider all these modes equally and try to get insight into their relative importance with respect to temperature and rainfall variability over the Northern Hemisphere. The relative importance of AO, NAO and AL time series is determined by stepwise multiple regression with cross validation at every grid point of the globe. This tool is appropriate to sort the predictors - AO, NAO and AL - by their relative contribution to temperature and rainfall predictability and to evaluate the predictability with respect to an independent control data set. This allows to cut off the number of predictors as soon as the mean square error between the multiple regression model and the control data set is increasing. For better reliability of our results, the procedure is applied many times with 100 permutations. This part is based on the NCEP reanalysis data set. For estimating future temperature and rainfall anomalies, a broad model intercomparison study has been carried out, including most state-of-the-art models of the international modeler community. For each circulation mode superensemble-mean time series under greenhouse-gas (GHG) only and GHG plus sulphate aerosol conditions are determined respectively. Concerning annual-mean temperature, the total explained variance by an optimal number of predictors amounts to 60% over northern Europe, Siberia and North America. At most grid points of the Northern Hemisphere, the AO is the most prominent mode, also in the European-Atlantic sector where the NAO is supposed to be the main player. In the North Pacific sector and in some regions of the low latitudes the AL is dominating. The

  2. A contribution to our knowledge of Leonurus L., i-mu-ts'ao, the Chinese motherwort.

    Science.gov (United States)

    Hu, S

    1976-01-01

    This article deals with the ethnobotanical aspects of the Chinese motherwort. Since time immemorial the Chinese people have used various parts of motherwort to meet different physical needs. By the time a written language was developed and the medical uses were recorded. , motherwort was treated as an article of superior quality. At present, under the name of i-mu-ts'ao, the plant is used for improving bloodflow both by official physicians and herbal practitioners throughout the country as well as by villagers in isolated areas. According to Chinese classical literature on materia medica, the early uses were limited to the parts of the plant which met the most obvious needs of the prehistorical people in their struggle for existence-food and pain reliever. Evidently, in their search for food, the ancient people found that the four nutlets contained in the dry and spinose calyx of the Chinese motherwort resemble the seasame seed in size and oil content. They gathered them and used them for food in similar manner as with the sesame. Consequently, they discovered the good effects to the eyesight, the improvement of strength, and the uplift of spirit. These discoveries led to the use of the seed of the species as an eye medicine for improving the eyesight, and as a tonic for the increase of strength and the elevation of spirit. Contagious skin diseases caused serious problems for the ancient people. The use of the leafy shoot for a bath to release the discomfort of itches and shingles was also recorded in the 42-word first medicinal record of the species in the earliest known Chinese materia medica-the Shen-nung pen-ts'ao-ching. Translators of the Chinese classics have included the records of i-mu-ts'ao. According to my knowledge, these works are all partial translations with the selections of the medicinal properties and the omissions on the methods of preparation. They have the outline and abandon the details. Consequently most of them are not clear. In order to

  3. Ansiedade ao tratamento odontológico em atendimento de urgência

    Directory of Open Access Journals (Sweden)

    Kanegane Kazue

    2003-01-01

    Full Text Available OBJETIVO: Avaliar a freqüência de pacientes com ansiedade ou medo do tratamento odontológico em um setor de urgência. MÉTODOS: Participaram do estudo 252 pacientes, com 18 anos ou mais, que compareceram ao setor de urgência de uma faculdade de odontologia, de São Paulo, SP, entre agosto e novembro de 2001. Para avaliar a ansiedade, foram utilizadas a Modified Dental Anxiety Scale (MDAS, e a Escala de Medo de Gatchel. O grupo estudado respondeu a questões sobre: tempo decorrido desde a última visita ao dentista e desde o início dos sintomas, escolaridade, renda familiar e história prévia de trauma. Os resultados foram analisados pelos testes estatísticos (chi2 e Teste Exato de Fisher. RESULTADOS: Foram identificados 28,2% de indivíduos com algum grau de ansiedade, segundo a MDAS, na qual as mulheres foram consideradas mais ansiosas que os homens (chi2=0,01; e 14,3% de pacientes com alto grau de medo segundo a Escala de Medo de Gatchel. Em 44,4% da amostra a demora para procura de alívio dos sintomas foi > sete dias. Mulheres ansiosas procuraram atendimento mais rapidamente e em maior número. Experiência traumática anterior ocorreu em 46,5% dos pacientes ansiosos. Não foi possível relacionar escolaridade e renda familiar com ansiedade e/ou medo. CONCLUSÕES: Pacientes ansiosos, com destaque para as mulheres, são freqüentes no atendimento odontológico de urgência. Experiência prévia traumática mostrou-se importante para o desenvolvimento da ansiedade em relação ao atendimento odontológico.

  4. Proteinorraquia total: variações relacionadas ao sexo e à idade

    Directory of Open Access Journals (Sweden)

    A. Spina-França

    1963-03-01

    Full Text Available Foi estudada a proteinorraquia total de 1.011 pacientes com LCR normal para investigar a influência da idade e do sexo. O método empregado para a determinação da concentração protêica foi o turbidimétrico do ácido tricloracético. A influência do fator etário foi estudada entre 3 meses e 70 anos de idade. Os resultados permitiram verificar que a concentração protêica do LCR é maior entre 3 e 6 meses de idade. Entre 1 e 40 anos de idade os valores médios são próximos entre si, situando ao redor de 16 e 18 mg por 100 ml. A partir de 40 anos de idade verifica-se tendência para ser progressivamente maior a proteinorraquia total. Essa tendência se acentua com o avançar da idade. Em relação ao sexo, foi verificado que a proteinorraquia total tende a ser maior no homem do que na mulher. A diferença entre as médias encontradas para os homens e mulheres foi estatisticamente significante. Êsses dados confirmam observações anteriores, caracterizando-os em relação ao método empregado para a determinação da concentração protêica do LCR.

  5. Da casa ao hotel: entre a hospitalidade e a economia do turismo

    Directory of Open Access Journals (Sweden)

    Felipe José Comunello

    2015-01-01

    Full Text Available O município de São Joaquim, na região serrana de Santa Catarina, tem sido destacado pela imprensa escrita e televisiva nacional como a cidade mais fria do Brasil, ao longo dos últimos vinte anos. Em pesquisa realizada para tese de doutorado, identifiquei que muitas proprietárias de pousadas, as “pousadeiras” como elas mesmas se chamam, começaram abrigando turistas em dificuldades em dias de frio intenso, quando não há hotéis e pousadas suficientes na cidade. A partir disso, elas acreditaram ser possível transformar suas casas em pousadas, tendo diante de si um problema também compartilhado com os profissionais do turismo, a chamada sazonalidade dos turistas. Tal fato provoca dúvidas sobre a sustentação econômica das pousadas e inquietação aos profissionais quanto ao sucesso econômico do turismo. Nesse artigo, isso é analisado tendo como referência uma proposta de parceria recebida por meus interlocutores por parte da operadora de turismo CVC e da empresa de eventos da RBS, afiliada da Rede Globo em Santa Catarina. A discussão é em torno de questões a partir de uma antropologia da hospitalidade. A análise sugere que essa parceria ameaça uma ordem moral estabelecida com base em determinados valores de hospitalidade para com estranhos, principalmente o aquecimento perante o frio.

  6. AO3D: A Monte Carlo code for modeling of environmental light propagation

    Energy Technology Data Exchange (ETDEWEB)

    Bates, David E. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)], E-mail: bates@higp.hawaii.edu; Porter, John N. [Hawaii Institute of Geophysics and Planetology, School of Ocean and Environmental Technology, University of Hawaii, 2525 Correa Road, Honolulu, HI 96822 (United States)

    2008-07-15

    A Monte Carlo radiative transfer program (Atmosphere-Ocean 3-Dimensional, AO3D) for modeling the coupled atmosphere-ocean environment has been developed. The code allows for the specification of optical properties for the atmosphere, land and ocean. Light rays are tracked as they pass between the atmosphere and the ocean, reflect off the ocean surface, the ocean floor, and off land, or are absorbed. In this version the polarization of light rays is not considered. The optical properties of each horizontally homogeneous layer within the atmosphere and ocean can be set on a layer-by-layer basis with a choice of phase functions, absorption and scattering coefficients, and index of refraction. A wind-dependent Cox and Munk ocean surface realization (with whitecaps) is implemented to model refraction and reflection from surface waves. Either spherical- or flat-Earth models can be used, and all refraction and reflection are accounted for. The AO3D model has been tested by parts, and as a whole by comparison with single- and total-scattering calculations from other radiative transfer codes. Comparisons with Monte Carlo calculations by Adams and Kattawar (agreement in TOA radiance within the published precision {approx}2%), MODTRAN4 (agreement in spherical-shell atmosphere (SSA) sky radiance within about 2%) and Coupled DIScrete Ordinate Radiative Transfer (COART) (agreement in plane-parallel (PP) sky radiance within 2%) are shown. Sun photometer measurements (including large air mass values) at the Mauna Loa Observatory are compared to AO3D simulations (for a spherical Earth) and suggest that a thin aerosol layer was present above the observatory at the time of the measurements.

  7. Treatment of AO/OTA 31-A3 intertrochanteric femoral fractures with a percutaneous compression plate

    Directory of Open Access Journals (Sweden)

    Fei Luo

    2014-01-01

    Full Text Available OBJECTIVE: AO/OTA 31-A3 intertrochanteric femoral fractures have completely different fracture line directions and biomechanical characteristics compared with other types of intertrochanteric fractures. The choice of the fixation method has been a focus of dispute among orthopedic trauma surgeons. The purpose of this study was to review the outcomes of these fractures treated with a percutaneous compression plate at our institute. METHOD: Seventeen patients with AO/OTA 31-A3 intertrochanteric femoral fractures were treated with a percutaneous compression plate at our institute from January 2010 to December 2011. The clinical data and imaging results were retrospectively analyzed. RESULTS: The medical complication of popliteal vein thrombosis occurred in one patient. Sixteen patients were followed up for 12 to 21 months. Two patients had malunion and mild pain. Fracture collapse occurred in two patients, with one having head penetration. These two patients had moderate pain. There were no occurrences of nonunion or reoperation. The mean Harris hip score obtained during the last follow-up was 84.1 (61-97. Patients with a poor quality of reduction were more likely to have pain results (p = 0.001. A trend existed toward the presence of a poor quality of reduction (p = 0.05 in patients with a collapse of fracture. Patients with poor preoperative mobility were more likely to have a lower Harris hip score (p = 0.000. CONCLUSION: The percutaneous compression plate is an alternative device for the treatment of AO/OTA 31-A3 intertrochanteric femoral fractures. Good fracture reduction and an ideal placement position of the neck screw are important in the success of the device.

  8. Adesão ao tratamento no transtorno bipolar Compliance to treatment in bipolar disorder

    Directory of Open Access Journals (Sweden)

    Aida Santin

    2005-01-01

    Full Text Available O transtorno bipolar (TB é uma doença crônica, recorrente, presente em 1,5% da população, estando associada a altas taxas de mortalidade e prejuízos socioeconômicos. O lítio, a carbamazepina e o ácido valpróico são os estabilizadores de humor mais usados. Em tratamentos prolongados, como é o caso do TB, a má-adesão dos pacientes é uma das maiores dificuldades. Verifica-se que fatores ligados ao paciente, aos medicamentos e aos médicos possam ser responsáveis pela baixa adesão. A psicoeducação, a terapia cognitivo-comportamental e a terapia focada na família são estratégias propostas para o aumento da adesão.Bipolar disorder (BD is a chronic and recurrent illness that occurs in 1,5% of the population. This illness is associated with high rates of mortality and social/economic burden. Lithium, carbamazepine and valproic acid are the most used mood stabilizers. In long term treatments, as in BD, one of the main difficulties is the patient's adherence. It appears that factors associated to the patient, drug and the physician are responsible for the low adherence. The use of psycho-education, cognitive-behavioral therapy and focused family therapy have been put forward as a means to increase adherence.

  9. Desempenho de bezerros aleitados com soro de queijo em associação ao colostro

    Directory of Open Access Journals (Sweden)

    Renata Nayhara de Lima

    2012-08-01

    Full Text Available O objetivo deste trabalho foi avaliar o desempenho de bezerros mestiços, aleitados com soro de queijo em associação ao colostro. Foram utilizados 24 bezerros Holandês x Zebu, distribuídos em delineamento inteiramente casualizado, com três tratamentos e oito repetições. Os tratamentos consistiram de: leite integral, 50% de leite integral + 50% de soro de queijo, e 30% de colostro + 70% de soro de queijo. O desenvolvimento dos bezerros foi avaliado até os 60 dias de idade, por meio de pesagens semanais e mensurações corporais. Para a estimativa de consumo, foram feitas medições diárias de consumo da dieta sólida, pelo método oferta/sobra. O desempenho econômico foi avaliado pelo cálculo de indicadores de custos e receitas, e de medidas de resultados econômicos. Não houve influência da dieta líquida sobre o consumo de matéria seca e sobre as médias de medidas corporais dos bezerros. Foram observadas diferenças significativas no ganho de peso dos animais na segunda e na quarta semanas de vida. A dieta com colostro apresentou o maior lucro adicional em comparação ao tratamento controle. A associação do soro de queijo ao colostro é a opção mais vantajosa economicamente, já que a substituição de 100% do leite por esses subprodutos não prejudicou o desempenho dos animais.

  10. Gastrite hemorrágica por alergia ao leite de vaca: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Machado Rodrigo Strehl

    2003-01-01

    Full Text Available OBJETIVO: descrever dois lactentes com gastrite hemorrágica, devido à alergia ao leite de vaca. DESCRIÇÃO DOS CASOS: ambos os pacientes apresentavam hematêmese, vômitos e desnutrição. Os pacientes apresentavam infiltrado eosinofílico em mucosa gástrica biopsiada e resolução dos sintomas após o início de dieta com exclusão da proteína do leite de vaca. COMENTÁRIOS: gastrite hemorrágica devido à alergia ao leite de vaca é um diagnóstico incomum. Até o momento foram relatados 10 pacientes com gastrite alérgica, e as principais manifestações clínicas são vômitos, desnutrição, anemia e hematêmese. A gastrite por alergia ao leite de vaca pode apresentar-se em diferentes graus de gravidade, e pode ser subdiagnosticada em muitos pacientes. A menos que o tratamento correto seja iniciado, o paciente desenvolverá desnutrição protéico-calórica grave e anemia. Doença alérgica do trato gastrointestinal superior deve ser considerada em todos os lactentes com vômitos recorrentes, particularmente se complicado com hematêmese. O diagnóstico de gastrite alérgica é clínico, auxiliado pela endoscopia e anatomia patológica.

  11. Direito ao aborto, gênero e a pesquisa jurídica em direitos fundamentais

    OpenAIRE

    Azevedo, André Freire

    2017-01-01

    Resumo A partir de um retrato da situação atual do abortamento inseguro e de uma breve reconstrução das lutas feministas pela descriminalização do aborto no Brasil, o trabalho discute o papel do constitucionalismo democrático no reconhecimento de novos sujeitos de direitos sexuais e reprodutivos. Recorremos ao fundamento político-filosófico dos direitos sexuais e reprodutivos para apontar que sua regulamentação jurídica só tem validade se os “sujeitos de direitos” construídos e pressupostos p...

  12. Abordagem ao Doente “ABCDE”. Biomecânica do Trauma

    OpenAIRE

    Amaral, T

    2013-01-01

    Apresentação na qual é efectuada uma caracterização epidemiológica do Trauma comparando a distribuição bimodal vs trimodal assim como a causa e local de morte. De seguida são definidos cuidados emergentes a nível pré-hospitalar e as competências indispensáveis à práxis por parte do Enfermeiro. Por último reflectimos de que forma a abordagem e o assegurar do continuum de cuidados desde o pré-hospitalar à UCI (com passagem no SU) contribuem para a melhoria dos cuidados ao doente politraumatizad...

  13. AIDS e religiosidade: influências intersubjetivas aos acometidos pela epidemia

    OpenAIRE

    Silva, Paulo Emanuel

    2009-01-01

    Nos dias atuais, apesar de todas as informações inerentes aos mais diversos tipos de doenças, algumas delas ainda são motivos de angústia, receios e preconceitos. Na antiguidade, a lepra e a peste e, a partir do século XIX, o câncer, a sífilis e a tuberculose permeavam as mentalidades e marcavam seus portadores, uma vez que os significados das doenças iam além de seus diferentes sintomas. Algo semelhante vem ocorrendo no mundo contemporâneo no que diz respeito à Síndrome da Imu...

  14. Educação: pensadores ao longo da história: Seymour Papert

    OpenAIRE

    Sousa, João Sérgio de Pina Carvalho (Ed.); Meirinhos, Manuel; Patrício, Maria Raquel; Gonçalves, Vitor

    2016-01-01

    Seymour Aubrey Papert (1928-2016) natural de Pretória, África do Sul, faleceu aos 88 anos nos Estados Unidos da América. Matemático de renome mundial, pioneiro da inteligência artificial e da computação educacional, foi docente do MIT Media Lab. Este poster evidencia os principais fundamentos teóricos e práticos da sua obra pedagógica, a atualidade da sua pedagogia e as suas implicações na educação. info:eu-repo/semantics/publishedVersion

  15. Future use of silicon photomultipliers for K AOS at MAMI and P¯ANDA at FAIR

    Science.gov (United States)

    Achenbach, P.; Lorente, A. Sanchez; Majos, S. Sánchez; Pochodzalla, J.

    2009-10-01

    A characterization of scintillating fibres with silicon photomultiplier read-out was performed in view of their possible application in fibre tracking detector systems. Such a concept is being considered for the K AOS spectrometer at the Mainz Microtron MAMI and as a time-of-flight start detector for the hypernuclear physics programme at the P¯ANDA experiment of the FAIR project. Results on particle detection efficiency and time resolution are discussed. In summary, the silicon devices are very suitable for the detection of the low light yield from scintillating fibres insofar a trigger scheme is found to cope with the noise rate characteristics.

  16. Concepções de mulheres sobre a terminologia relativa ao aparelho reprodutor feminino

    OpenAIRE

    Celina Deves Marques

    2005-01-01

    Esta é uma pesquisa qualitativa fenomenológica com embasamento filosófico na fenomenologia da percepção de Merleau-Ponty. Tem como propósito conhecer as concepções das mulheres sobre a terminologia relativa ao aparelho reprodutor feminino. Os sujeitos do estudo foram 10 mulheres não-gestantes, não-puérperas e não-nulíparas usuárias do Programa de Saúde da Família (PSF) Jenor Jarros. O instrumento de pesquisa utilizado foi entrevista semi-estruturada no qual perguntava-se sobre o significado d...

  17. On random walk de Lévy aplicado aos mapas de variâncias

    Science.gov (United States)

    Klafke, J. C.

    2003-08-01

    Uma pergunta que surge ao nos confrontarmos com os mapas de variâncias, ou s-Maps [Klafke, J. C. "Estudo da Difusão Caótica em Ressonâncias Asteroidais", Tese de Doutorado, IAG/USP, 2002] diz respeito ao conteúdo físico de tais representações do espaço de fase. Ou seja, o que representa as variâncias das ações obtidas para uma determinada condição inicial e como relacioná-las com o tempo de difusão das órbitas, supondo-se que estas de fato estejam envolvidas em um processo difusivo? Para discutirmos essa questão, lançamos mão da modelagem dos processos estocásticos subjacentes às variâncias determinadas e implementamos uma série de simulações do tipo Monte Carlo a partir das informações registradas nos s-Maps calculados para algumas ressonâncias asteroidais bem estudadas (p.ex. 3: 1, 2: 1 e 3: 2). Para tanto, temos usado uma função de densidade de probabilidade gaussiana ao definir os n passos que permitirão estabelecer uma relação direta entre o Mapa de Difusão e o Mapa de Variâncias. Contudo, os resultados obtidos até agora tem subestimado o tempo de difusão esperado para os fenômenos conhecidos. Tal se deve ao fato de que, no processo difusivo real, é possível existirem passos de comprimento consideravelmente maiores que a média estabelecida pelas distribuições gaussiana ou normal, sobretudo quando se cruza uma região caótica. Neste trabalho, apresentamos os resultados comparativos de simulações de Monte Carlo com base no random walk de Lévy [Klafter, J. et al. 2002. "Beyond Brownian motion", Phys. Today, Feb, 33-39.], o qual possibilita passos esporádicos de comprimento acima do valor médio (saltos) permitindo estabelecer uma escala de tempo mais próxima da esperada para a difusão.

  18. Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor

    Science.gov (United States)

    2016-03-10

    AFRL-AFOSR-VA-TR-2016-0126 DURIP 09) AN ATOMIC OXYGEN FLUX MONITOR FOR USE IN THE SEARCH FOR NEW AND BETT Malcolm Beasley LELAND STANFORD JUNIOR UNIV...Grant # FA9550-01-1-0433 M. R. Beasley, PI Stanford University Project Title: Atomic Oxygen (AO) and Nitrogen (AN) In-situ Flux Sensor...with its ability to achieve controlled layer-by-layer growth on the atomic level. In the case of oxides and nitrides, one problem has been the lack

  19. Translation between the Neer- and the AO/OTA-classification for proximal humeral fractures

    DEFF Research Database (Denmark)

    Brorson, Stig; Eckardt, Henrik; Audigé, Laurent

    2013-01-01

    The reporting and interpretation of data from clinical trials of proximal humeral fractures are hampered by the use of two partly incommensurable fracture classification systems: the Neer classification and the AO/OTA classification. It remains difficult to interpret and generalize results......, to conduct prognostic studies, and to obtain consensus on treatment recommendations when concise definitions and a common 'fracture language' are lacking. Thus, we compared both classifications systems using primary data from large clinical studies to assess how thoroughly both systems conveyed clinically...

  20. Peru: cultivo de coca, cocaína e combate ao narcotráfico

    Directory of Open Access Journals (Sweden)

    Marcelo Santos

    2010-06-01

    Full Text Available O artigo apresenta uma breve análise sobre a atual situação dos cultivos de coca, produção de cocaína e combate ao narcotráfico no Peru.