WorldWideScience

Sample records for terbium 167

  1. Lattice dynamics of terbium

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden; Nicklow, R.M.

    1969-01-01

    Abstract only given substantially as follows. Neutron diffraction results are presented for the phonon dispersion relation of terbium......Abstract only given substantially as follows. Neutron diffraction results are presented for the phonon dispersion relation of terbium...

  2. Lattice dynamics of terbium

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden; Nicklow, R.M.

    1970-01-01

    The frequency-wave-vector dispersion relation for the normal modes of vibration of terbium at room temperature has been measured by means of slow-neutron inelastic scattering techniques. The triple-axis spectrometer at the Oak Ridge high flux isotope reactor was used, mostly in the constant-Q mode...

  3. Elastic properties of terbium

    DEFF Research Database (Denmark)

    Spichkin, Y.I.; Bohr, Jakob; Tishin, A.M.

    1996-01-01

    The temperature dependence of the Young modulus along the crystallographic axes b and c (E(b) and E(c)), and the internal friction of a terbium single crystal have been measured. At 4.2 K, E(b) and E(c) are equal to 38 and 84.5 GPa, respectively. The lattice part of the Young modulus and the Debye...... temperature has been calculated. The origin of the Young modulus anomalies arising at the transition to the magnetically ordered state is discussed....

  4. Terbium oxide at high pressures

    International Nuclear Information System (INIS)

    Dogra, Sugandha; Sharma, Nita Dilawar; Singh, Jasveer; Bandhyopadhyay, A.K.

    2011-01-01

    In this work we report the behaviour of terbium oxide at high pressures. The as received sample was characterized at ambient by X-ray diffraction and Raman spectroscopy. The X-ray diffraction showed the sample to be predominantly cubic Tb 4 O 7 , although a few peaks also match closely with Tb 2 O 3 . In fact in a recent study done on the same sample, the sample has been shown to be a mixture of Tb 4 O 7 and Tb 2 O 3 . The sample was subjected to high pressures using a Mao-Bell type diamond anvil cell upto a pressure of about 42 GPa with ruby as pressure monitor

  5. Luminescent properties of terbium complex with phenylanthranilic acid

    International Nuclear Information System (INIS)

    Alakaeva, L.A.; Kalazhokova, I.A.; Naurzhanova, F.Kh.

    1990-01-01

    Existence of terbium luminescence reaction in complex with phenanthranilic acid (FAA) is ascertained. The optimal conditions of terbium complexing with FAA are found. The ratio of components in the complex is 1:1. The influence of foreign rare earth in terbium luminescence intensity in complex with FAA is studied

  6. Fine structure studies of terbium atoms

    International Nuclear Information System (INIS)

    Abhay Kumar; Bandyopadhyay, Krishnanath; Niraj Kumar

    2012-01-01

    Terbium (Z = 65) is a typical rare-earth element. Fine structure of spectural lines of terbium (Tb) are presented using the laser optogalvanic spectroscopic technique. Altogether eighty transitions in the 5686-6367 A range have been observed in the fine structure spectrum of 159 Tb. Wavelengths of all the observed transitions have been determined. Out of 80 transitions of Tb, a total of 59 transitions are being reported for the first time. Classifications of 39 new transitions have been provided using the known energy levels, Doppler-limited optogalvanic spectroscopic technique is employed to study the fine structure (fs) 159 Tb. (author)

  7. Semiconductor composition containing iron, dysprosium, and terbium

    Science.gov (United States)

    Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.

    2017-09-26

    An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.

  8. Critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1968-01-01

    The inelasticity of the critical scattering of neutrons in terbium has been measured above the Neél temperature at the (0, 0, 2−Q) satellite position. The results show that dynamic slowing down of the fluctuations does occur in a second‐order phase transition in agreement with the general theory...

  9. Magneto-elastic interactions in terbium

    DEFF Research Database (Denmark)

    Jensen, J.

    1971-01-01

    . These calculations agree semi-quantitatively with the results of experimental measurements. The author has examined the extent to which this simple picture is applicable to explain the magnon-phonon interactions in terbium, which have been observed at finite wave vectors by inelastic neutron scattering...

  10. Nuclear magnetic resonance in ferromagnetic terbium metal

    International Nuclear Information System (INIS)

    Cha, C.L.T.

    1974-01-01

    The magnetic properties of terbium were studied by the method of zero field nuclear magnetic resonance at 1.5 to 4 and 85 to 160 0 K. Two unconventional experimental techniques have been employed: the swept frequency and the swept temperature technique. Near 4 0 K, triplet resonance line structures were found and interpreted in terms of the magnetic domain and wall structures of ferromagnetic terbium. In the higher temperature range, temperature dependence of the resonance frequency and the quadrupole splitting were measured. The former provides a measurement of the temperature dependence of the magnetization M, and it agrees with bulk M measurements as well as the latest spin wave theory of M(T) (Brooks 1968). The latter agrees well with a calculation using a very general single ion density matrix for collective excitations (Callen and Shtrikman 1965). In addition, the small temperature-independent contribution to the electric field gradient at the nucleus due to the lattice and conduction electrons was untangled from the P(T) data. Also an anomalous and unexplained relaxation phenomenon was also observed

  11. Production and separation of terbium-149 and terbium-152 for targeted cancer therapy

    International Nuclear Information System (INIS)

    Sarkar, S.; Leigh, J.

    1997-01-01

    This work reports the production and separation of useful quantities of 149 , 152 Tb from natural neodymium ( nat Nd) and 141 Pr for in vitro studies by bombarding the targets with 12 C projectiles. The physical, chemical and nuclear properties of radionuclides determine their efficacy in therapy and diagnosis. Tb-149 is an alpha-emitter with a half-life of 4.1h and 152 Tb is a positron emitter with a half-life of 17.5 h. Both of the isotopes have suitable gamma emission with good branching ratio suggesting their application to diagnosis apart from therapy. Alpha-emitters are effective in controlling cancer because of their short range and high Relative Biological Effectiveness. Long-lived positron emitters are effective in studying physiological function in positron emission tomography other than therapy. The aim of this work is to optimise the production and carrier free separation of terbium. Because of the presence of other stable isotopes in nat Nd, a number of other lanthanides are produced by secondary reactions during the production of terbium. In order to remove the secondary products, α-hydroxyisobutyric acid of pH 5 was used as eluent. satisfactory separation of terbium was achieved and demonstrate that useful quantities of 144,152 Tb can be produced by Tandem accelerator from 141 Pr and nat Nd targets

  12. Improved terbium-doped, lithium-loaded glass scintillator fibers

    International Nuclear Information System (INIS)

    Spector, G.B.; McCollum, T.; Spowart, A.R.

    1993-01-01

    An improved terbium-doped, 6 Li-loaded glass scintillator has been drawn into fibers. Tests indicate that the neutron detection response of the fibers is superior to the response with fibers drawn from the original terbium-doped glass. The new fibers offer less attenuation (1/e length of ∝40 cm) and improved gamma ray/neutron discrimination. The improved fibers will be incorporated in a scintillator fiber optic long counter for neutron detection. (orig.)

  13. Raman spectroscopy study of the doping effect of the encapsulated terbium halogenides on single-walled carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Kharlamova, M.V.; Kramberger, C.; Mittelberger, A. [University of Vienna, Faculty of Physics, Vienna (Austria)

    2017-04-15

    In the present work, the doping effect of terbium chloride, terbium bromide, and terbium iodide on single-walled carbon nanotubes (SWCNTs) was compared by Raman spectroscopy. A precise investigation of the doping-induced alterations of the Raman modes of the filled SWCNTs was conducted. The shifts of the components of the Raman modes and modification of their profiles allowed concluding that the inserted terbium halogenides have acceptor doping effect on the SWCNTs, and the doping efficiency increases in the line with terbium iodide, terbium bromide, and terbium chloride. (orig.)

  14. Magnetoresistance in terbium and holmium single crystals

    International Nuclear Information System (INIS)

    Singh, R.L.; Jericho, M.H.; Geldart, D.J.W.

    1976-01-01

    The longitudinal magnetoresistance of single crystals of terbium and holmium metals in their low-temperature ferromagnetic phase has been investigated in magnetic fields up to 80 kOe. Typical magnetoresistance isotherms exhibit a minimum which increases in depth and moves to higher fields as the temperature increases. The magnetoresistance around 1 0 K, where inelastic scattering is negligible, has been interpreted as the sum of a negative contribution due to changes in the domain structure and a positive contribution due to normal magnetoresistance. At higher temperatures, a phenomenological approach has been developed to extract the inelastic phonon and spin-wave components from the total measured magnetoresistance. In the temperature range 4--20 0 K (approximately), the phonon resistivity varies as T 3 . 7 for all samples. Approximate upper and lower bounds have been placed on the spin-wave resistivity which is also found to be described by a simple power law in this temperature range. The implications of this result for theoretical treatments of spin-wave resistivity due to s-f exchange interactions are considered. It is concluded that the role played by the magnon energy gap is far less transparent than previously suggested

  15. 167th Airlift Wing > Home

    Science.gov (United States)

    flight-related information.(Call 911 for emergencies) MID AIR COLLISION AVOIDANCE (MACA) INFO Note: The page on a full 8.5" x 11" sheet. 167 AW MACA Pamphlet - April 2017 167AW MACA Document - April 2017 167AW MACA Poster - Coming Soon featured Links mission Posted 02/09/2017 Freedom of

  16. Fabricating Bis(phthalocyaninato) Terbium SIM into Tetrakis(phthalocyaninato) Terbium SMM with Enhanced Performance through Sodium Coordination.

    Science.gov (United States)

    Chen, Yuxiang; Liu, Chao; Ma, Fang; Qi, Dongdong; Liu, Qingyun; Sun, Hao-Ling; Jiang, Jianzhuang

    2018-04-23

    The non-peripherally substituted 1,4,8,11,15,18,22,25-octa(butoxy)-phthalocyanine-involved unsymmetrical heteroleptic bis(phthalocyaninato) terbium double-decker, Tb(Pc){H[Pc(α-OC 4 H 9 ) 8 ]} (Pc=unsubstituted phthalocyanine) (1), was revealed to exhibit typical single ion magnet (SIM) behavior with effective energy barrier, 180 K (125 cm -1 ), and blocking temperature, 2 K, due to the severe deviation of the terbium coordination polyhedron from square-antiprismatic geometry. Fabrication of this double-decker compound into the novel tetrakis(phthalocyaninato) terbium pseudo-quadruple-decker Na 2 {Tb(Pc)[Pc(α-OC 4 H 9 ) 8 ]} 2 (2) single molecule magnet (SMM) not only optimizes the coordination polyhedron of terbium ion towards the square-antiprismatic geometry and intensifies the coordination field strength, but more importantly significantly enhances the molecular magnetic anisotropy in the unsymmetrical bis(phthalocyaninato) double-decker unit, along with the change of the counter cation from H + of 1 to Na + of 2, leading to an significantly enhanced magnetic behavior with spin-reversal energy barrier, 528 K (367 cm -1 ), and blocking temperature, 25 K. The present result is surely helpful towards developing novel tetrapyrrole lanthanide SMMs through rational design and self-assembly from bis(tetrapyrrole) lanthanide single ion magnet (SIM) building block. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Infrared X-ray and thermal analysis of terbium soaps

    International Nuclear Information System (INIS)

    Mehrotra, K.N.; Sharma, N.

    1996-01-01

    Terbium sops (laureate, myristate and palmitate) were synthesized by direct metathesis of corresponding potassium soap with an aqueous solution of terbium nitrate. The physico-chemical characteristics of soaps in solid state were investigated by IR spectra, X-ray diffraction patterns and TGA measurements. The IR results revealed that the fatty acids exist in dimeric state through hydrogen bonding while the soaps possess partial ionic character. The X-ray analysis showed that the soaps have double layer structure with molecular axes slightly inclined to the basal plane. The thermal analysis suggested that the decomposition of soaps occur in two steps. The energy of activation, order of reaction and various kinetic parameters (i.e. frequency factor, entropy of activation and free energy) for the thermal decomposition of soaps were evaluated. (author). 26 refs, 4 figs, 4 tabs

  18. Terbium and dysprosium complexes luminescence at low temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Meshkova, S B; Kravchenko, T B; Kononenko, L.I.; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Fiziko-Khimicheskij Inst.

    1979-01-01

    The variation is studied of the luminescence intensity of terbium and dysprosium complexes used in the analysis as solutions are cooled down to the liquid nitrogen temperature. Three groups of methods have been studied: observation of fluorescence of aqueous solutions, precipitate and extract suspensions in organic solvents. The brightest luminescence and greatest increase in luminescence intensity are observed at freezing of complex solvents with 1,2-dioxybenzene-3,5-disulfonic acid (DBSA) and iminodiacetic acid (IDA) and DBSA+EDTA, as well as in the case of benzene extracting of complexes with phenanthroline and salicylic acid. Otherwise the intensity increases 2-14-fold and for the complex of terbium with acetoacetic ester 36-fold.

  19. Interaction of terbium group metal oxides with carbon

    International Nuclear Information System (INIS)

    Vodop'yanov, A.G.; Baranov, S.V.; Kozhevnikov, G.N.

    1990-01-01

    Mechanism of carbothermal reduction of terbium group metals from oxides is investigated using thermodynamic and kinetic analyses. Interaction of metal oxides with carbon covers dissociation of metal oxides and reduction by carbon monoxide, which contribution into general reduction depends on CO pressure. Temperatures of reaction beginning for batch initial components at P=1.3x10 -4 and P CO =0.1 MPa and of formation of oxycarbide melts are determined

  20. Highly n -doped graphene generated through intercalated terbium atoms

    Science.gov (United States)

    Daukiya, L.; Nair, M. N.; Hajjar-Garreau, S.; Vonau, F.; Aubel, D.; Bubendorff, J. L.; Cranney, M.; Denys, E.; Florentin, A.; Reiter, G.; Simon, L.

    2018-01-01

    We obtained highly n -type doped graphene by intercalating terbium atoms between graphene and SiC(0001) through appropriate annealing in ultrahigh vacuum. After terbium intercalation angle-resolved-photoelectron spectroscopy (ARPES) showed a drastic change in the band structure around the K points of the Brillouin zone: the well-known conical dispersion band of a graphene monolayer was superposed by a second conical dispersion band of a graphene monolayer with an electron density reaching 1015cm-2 . In addition, we demonstrate that atom intercalation proceeds either below the buffer layer or between the buffer layer and the monolayer graphene. The intercalation of terbium below a pure buffer layer led to the formation of a highly n -doped graphene monolayer decoupled from the SiC substrate, as evidenced by ARPES and x-ray photoelectron spectroscopy measurements. The band structure of this highly n -doped monolayer graphene showed a kink (a deviation from the linear dispersion of the Dirac cone), which has been associated with an electron-phonon coupling constant one order of magnitude larger than those usually obtained for graphene with intercalated alkali metals.

  1. High-pressure liquid chromatography of trace elements: Determination of terbium in terbium doped gadolinium oxide sulphide phosphors

    International Nuclear Information System (INIS)

    Mazzucotelli, A.; Dadone, A.; Frache, R.; Baffi, F.; Genoa Univ.

    1982-01-01

    A detailed study of isocratic and gradient elution separations of lanthanides has been carried out. Analyses of industrially and scientifically interesting products such as luminescent phosphors have been carried out by gradient elution with DL-2-hydroxyisobutyric acid. The determination of small amounts of terbium in gadolinium oxide sulphide phosphors is described in which an HCl solution was eluted through a stainless steel column packed with microparticulate silica, with bonded cation-exchange groups. Complete separation of gadolinium and terbium is achieved. Detection is with a variable wavelength detector following post-column complex formation with 4-(2-pyridylazo)-resorcinol monosodium salt. Results obtained on test solutions show good reproducilbity and sensitivtiy and the method may be considered sufficiently reliable to be used in routine quality control procedures. (orig.)

  2. Terbium nitrate luminescence quenching by eosin in he presence of lithium perchlorate in sulfolane solutions

    International Nuclear Information System (INIS)

    Ostakhov, S.S.; Kolosnitsyn, V.S.; Krasnogorskaya, N.N.; Kazakov, V.P.

    2000-01-01

    Quenching of terbium nitrate luminescence by anionic dye, eosin, in the presence of lithium perchlorate in sulfolane solutions was studied. Temperature dependence of terbium nitrate luminescence in sulfolane solutions in the presence of perchlorate anions were considered. The values of energy required for water molecular substitution in Tb 3+ ion coordination sphere for solvent molecule in electrolyte solution were ascertained [ru

  3. Luminescent determination of trace amounts of terbium using diantipyrylmethane and salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Tishchenko, M A; Gerasimenko, G I; Poluehktov, N S [AN Ukrainskoj SSR, Odessa. Inst. Obshchej i Neorganicheskoj Khimii

    1978-01-01

    To elucidate the possibility of using pyrazolone-5-diantipyril-methane (DAM) derivative for determination of terbium microimpurities, the conditions have been studied of luminescent determination of terbium in complex compounds containing an ion of rare-earth element, diantipyrilmethane, and salicylic acid (Sal.). The ratio between the components in the complex REE-DAM-Sal is 1:1:3. La, Y, Gd do not affect the luminescence intensity of terbium complex. A luminescent method of determining terbium traces in highly pure oxides of lanthanum, gadolinium, lutetium, and yttrium has been developed in which suspensions of complex precipitation are used. The amount of terbium determined in oxide of lanthanum, gadolinium, and lutetium is (1-5)x10/sup -6/% and (2-3)x10/sup -5/% in yttrium oxide.

  4. Low-temperature thermal conductivity of terbium-gallium garnet

    International Nuclear Information System (INIS)

    Inyushkin, A. V.; Taldenkov, A. N.

    2010-01-01

    Thermal conductivity of paramagnetic Tb 3 Ga 5 O 12 (TbGG) terbium-gallium garnet single crystals is investigated at temperatures from 0.4 to 300 K in magnetic fields up to 3.25 T. A minimum is observed in the temperature dependence κ(T) of thermal conductivity at T min = 0.52 K. This and other singularities on the κ(T) dependence are associated with scattering of phonons from terbium ions. The thermal conductivity at T = 5.1 K strongly depends on the magnetic field direction relative to the crystallographic axes of the crystal. Experimental data are considered using the Debye theory of thermal conductivity taking into account resonance scattering of phonons from Tb 3+ ions. Analysis of the temperature and field dependences of the thermal conductivity indicates the existence of a strong spin-phonon interaction in TbGG. The low-temperature behavior of the thermal conductivity (field and angular dependences) is mainly determined by resonance scattering of phonons at the first quasi-doublet of the electron spectrum of Tb 3+ ion.

  5. Investigation of terbium scandate as an alternative gate dielectric in fully depleted transistors

    OpenAIRE

    Roeckerath, M.; Lopes, J. M. J.; Durgun Özben, E.; Urban, C.; Schubert, J.; Mantl, S.; Jia, Y.; Schlom, D.G.

    2010-01-01

    Terbium scandate thin films were deposited by e-gun evaporation on (100) silicon substrates. Rutherford backscattering spectrometry and x-ray diffraction studies revealed homogeneous chemical compositions of the films. A dielectric constant of 26 and CV-curves with small hystereses were measured as well as low leakage current densities of < 1 nA/cm(2). Fully depleted n-type field-effect transistors on thin silicon-on-insulator substrates with terbium scandate gate dielectrics were fabricated ...

  6. Detection of Bacterial Endospores in Soil by Terbium Fluorescence

    Directory of Open Access Journals (Sweden)

    Andrea Brandes Ammann

    2011-01-01

    Full Text Available Spore formation is a survival mechanism of microorganisms when facing unfavorable environmental conditions resulting in “dormant” states. We investigated the occurrence of bacterial endospores in soils from various locations including grasslands (pasture, meadow, allotment gardens, and forests, as well as fluvial sediments. Bacterial spores are characterized by their high content of dipicolinic acid (DPA. In the presence of terbium, DPA forms a complex showing a distinctive photoluminescence spectrum. DPA was released from soil by microwaving or autoclaving. The addition of aluminium chloride reduced signal quenching by interfering compounds such as phosphate. The highest spore content (up to 109 spores per gram of dry soil was found in grassland soils. Spore content is related to soil type, to soil depth, and to soil carbon-to-nitrogen ratio. Our study might provide a basis for the detection of “hot spots” of bacterial spores in soil.

  7. {alpha}-particle induced reactions on yttrium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, S.; Kumar, B.B. [School of Studies in Physics, Vikram University, Ujjain-456010 (India); Rashid, M.H. [Variable Energy Cyclotron Center, 1/AF, Bidhan Nagar, Calcutta (India); Chintalapudi, S.N. [Inter-University Consortium for DAE Facilities, 3/LB, Bidhan Nagar, Calcutta (India)

    1997-05-01

    The stacked foil activation technique has been employed for the investigation of {alpha}-particle induced reactions on the target elements yttrium and terbium up to 50 MeV. Six excitation functions for the ({alpha},xn) type of reactions were studied using high-resolution HPGe {gamma}-ray spectroscopy. A comparison with Blann{close_quote}s geometric dependent hybrid model has been made using the initial exciton number n{sub 0}=4(4p0h) and n{sub 0}=5(5p0h). A broad general agreement is observed between the experimental results and theoretical predictions with an initial exciton number n{sub 0}=4(4p0h). {copyright} {ital 1997} {ital The American Physical Society}

  8. α-particle induced reactions on yttrium and terbium

    International Nuclear Information System (INIS)

    Mukherjee, S.; Kumar, B.B.; Rashid, M.H.; Chintalapudi, S.N.

    1997-01-01

    The stacked foil activation technique has been employed for the investigation of α-particle induced reactions on the target elements yttrium and terbium up to 50 MeV. Six excitation functions for the (α,xn) type of reactions were studied using high-resolution HPGe γ-ray spectroscopy. A comparison with Blann close-quote s geometric dependent hybrid model has been made using the initial exciton number n 0 =4(4p0h) and n 0 =5(5p0h). A broad general agreement is observed between the experimental results and theoretical predictions with an initial exciton number n 0 =4(4p0h). copyright 1997 The American Physical Society

  9. Cerium(terbium, erbium)chloride-choline chloride aqueous systems

    International Nuclear Information System (INIS)

    Gajfutdinova, R.K.; Zhuravlev, E.F.; Bikbaeva, G.G.; Domrachev, V.N.; Vanskova, G.I.

    1985-01-01

    To clarify the effect of rare earth nature on mutual solubility of rare earth salts and amines the solubility of solid phases in the systems, consisting of choline chloride, water and cerium, terbium, erbium chlorides, has been studied. It is established, that solubility isotherms of all the systems, testify to the formation of new solid phases of the composition: Ce(Tb, Er)xCl 3 x2C 5 H 14 ONClx3H 2 O. Individuality of new solid phases is proved by DTA method, the composition is confirmed by chemical analysis and data of PMR spectra, for choline chloride and its complexes with rare earth chlorides of the given composition PMR and IR spectra are studied

  10. Spectrofluorimetric determination of cefixime using terbium-danofloxacin probe

    Directory of Open Access Journals (Sweden)

    Jamshid L Manzoori

    2014-04-01

    Full Text Available Objective(s:Cefixime (Cfx, is a semi-synthetic third-generation oral cephalosporin antibiotic that is prescribed for the treatment of susceptible infections. There are some procedures for the determination of Cfx in pharmaceutical formulations and biological samples. Herein a spectrofluorimetric method was proposed for Cfx determination based on the fluorescence quenching of terbium-danofloxacin (Tb3+-Dano in the presence of Cfx. Materials and Methods: Cfx was detected based on fluorescence quenching of terbium-danofloxacin (Tb3+-Dano in the presence of Cfx with maximum excitation and emission wavelengths at 347 nm and 545 nm, respectively. The quenched fluorescence intensity of Tb3+- Dano system is proportional to the concentration of Cfx. The optimum conditions for the determination of Cfx were studied. Results: The maximum response was achieved under optimum conditions of [Tris buffer]= 0.008 mol/l (pH 6.5, [Tb3+]=1×10-4 mol/l  and [Dano]=1×10-4 mol/l. The developed method was evaluated in terms of accuracy, precision and limit of detection. The linear concentration ranges for quantification of Cfx were 8.8×10-8-8.8×10-7 mol/l and 1.1×10-7-8.8×10-7 mol/l in standard and human serum samples with the detection limits (S/N=3 of 2.8×10-8 mol/l and 3.9×10-8 mol/l, respectively. The Cfx was determined in pharmaceutical tablets and spiked serum samples and the results were satisfactory.   Conclusion: This method is simple, practical and relatively interference-free for determination of Cfx in pharmaceutical tablets and serum samples.

  11. 46 CFR 167.43-1 - Application.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 167.43-1 Section 167.43-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Work Vests § 167.43-1 Application. (a) Provisions of this subpart shall apply to all vessels inspected and...

  12. 19 CFR 122.167 - Aviation smuggling.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Aviation smuggling. 122.167 Section 122.167... TREASURY AIR COMMERCE REGULATIONS Penalties § 122.167 Aviation smuggling. (a) Civil penalties. Any aircraft.... More severe penalties are provided in 19 U.S.C. 1590 if the smuggled merchandise is a controlled...

  13. 46 CFR 167.20-1 - Construction.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Construction. 167.20-1 Section 167.20-1 Shipping COAST... Requirements, Construction and Arrangement of Nautical School Ships § 167.20-1 Construction. Except as otherwise provided by law or regulations in this subpart, the following standards for construction are...

  14. Optical properties of phosphorescent nano-silicon electrochemically doped with terbium

    Energy Technology Data Exchange (ETDEWEB)

    Gelloz, Bernard [Nagoya University, Furo-cho, Chikusa-ku, Nagoya, Aichi 464-8603 (Japan); Mentek, Romain; Koshida, Nobuyoshi [Tokyo University A and T, 2-24-16 Nakacho, Koganei, Tokyo 184-8588 (Japan)

    2012-12-15

    Hybrid thin films consisting of oxidized nano-silicon doped with terbium have been fabricated. Nano-silicon was formed by electrochemical etching of silicon wafers. Terbium was incorporated into nano-silicon pores by electrochemical deposition. Different oxidizing thermal treatments were applied to the films. The samples treated by high-pressure water vapor annealing (HWA) exhibited strong blue emission with a phosphorescent component, as previously reported by our group. The low temperature (260 C) HWA also led to strong emission from Tb{sup 3+} ions, whereas typical high temperature (900 C) treatment generally used to activate Tb{sup 3+} ions in silicon-based materials led to less luminescent samples. Spectroscopic and dynamic analyses suggest that terbium was incorporated as a separate oxide phase in the pores of the porous nano-silicon. The PL of the terbium phase and nano-silicon phase exhibit different temperature and excitation power dependences suggesting little optical or electronic interaction between the two phases. The luminescence of terbium is better activated at low temperature (260 C) than at high temperature (900 C). The hybrid material may find some applications in photonics, for instance as a display material. (copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  15. Wobbling mode in 167Ta

    International Nuclear Information System (INIS)

    Hartley, D. J.; Ludington, A.; Pifer, R.; Seyfried, E. P.; Vanhoy, J. R.; Janssens, R. V. F.; Carpenter, M. P.; Lauritsen, T.; McCutchan, E. A.; Zhu, S.; Riedinger, L. L.; Darby, I. G.; Riley, M. A.; Aguilar, A.; Wang, X.; Chiara, C. J.; Chowdhury, P.; Lakshmi, S.; Tandel, S. K.; Tandel, U.

    2009-01-01

    The collective wobbling mode, the strongest signature for the rotation of a triaxial nucleus, has previously been seen only in a few Lu isotopes in spite of extensive searches in nearby isotopes. A sequence of transitions in the N=94 167 Ta nucleus exhibiting features similar to those attributed to the wobbling bands in the Lu nuclei has now been found. This band feeds into the πi 13/2 band at a relative energy similar to that seen in the established wobbling bands and its dynamic moment of inertia and alignment properties are nearly identical to the i 13/2 structure over a significant frequency range. Given these characteristics, it is likely that the wobbling mode has been observed for the first time in a nucleus other than Lu, making this collective motion a more general phenomenon.

  16. Monoxides of small terbium clusters: A density functional theory investigation

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, G. L.; Yuan, H. K., E-mail: yhk10@swu.edu.cn; Chen, H.; Kuang, A. L.; Li, Y.; Wang, J. Z.; Chen, J. [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China)

    2014-12-28

    To investigate the effect of oxygen atom on the geometrical structures, electronic, and magnetic properties of small terbium clusters, we carried out the first-principles calculations on Tb{sub n}O (n = 1-14) clusters. The capping of an oxygen atom on one trigonal-facet of Tb{sub n} structures is always favored energetically, which can significantly improve the structural stability. The far-infrared vibrational spectroscopies are found to be different from those of corresponding bare clusters, providing a distinct signal to detect the characteristic structures of Tb{sub n}O clusters. The primary effect of oxygen atom on magnetic properties is to change the magnetic orderings among Tb atoms and to reduce small of local magnetic moments of the O-coordinated Tb atoms, both of which serve as the key reasons for the experimental magnetic evolution of an oscillating behavior. These calculations are consistent with, and help to account for, the experimentally observed magnetic properties of monoxide Tb{sub n}O clusters [C. N. Van Dijk et al., J. Appl. Phys. 107, 09B526 (2010)].

  17. Solar Thermochemical Hydrogen Production via Terbium Oxide Based Redox Reactions

    Directory of Open Access Journals (Sweden)

    Rahul Bhosale

    2016-01-01

    Full Text Available The computational thermodynamic modeling of the terbium oxide based two-step solar thermochemical water splitting (Tb-WS cycle is reported. The 1st step of the Tb-WS cycle involves thermal reduction of TbO2 into Tb and O2, whereas the 2nd step corresponds to the production of H2 through Tb oxidation by water splitting reaction. Equilibrium compositions associated with the thermal reduction and water splitting steps were determined via HSC simulations. Influence of oxygen partial pressure in the inert gas on thermal reduction of TbO2 and effect of water splitting temperature (TL on Gibbs free energy related to the H2 production step were examined in detail. The cycle (ηcycle and solar-to-fuel energy conversion (ηsolar-to-fuel efficiency of the Tb-WS cycle were determined by performing the second-law thermodynamic analysis. Results obtained indicate that ηcycle and ηsolar-to-fuel increase with the decrease in oxygen partial pressure in the inert flushing gas and thermal reduction temperature (TH. It was also realized that the recuperation of the heat released by the water splitting reactor and quench unit further enhances the solar reactor efficiency. At TH=2280 K, by applying 60% heat recuperation, maximum ηcycle of 39.0% and ηsolar-to-fuel of 47.1% for the Tb-WS cycle can be attained.

  18. Autofluorescence-Free Live-Cell Imaging Using Terbium Nanoparticles.

    Science.gov (United States)

    Cardoso Dos Santos, M; Goetz, J; Bartenlian, H; Wong, K-L; Charbonnière, L J; Hildebrandt, N

    2018-04-18

    Fluorescent nanoparticles (NPs) have become irreplaceable tools for advanced cellular and subcellular imaging. While very bright NPs require excitation with UV or visible light, which can create strong autofluorescence of biological components, NIR-excitable NPs without autofluorescence issues exhibit much lower brightness. Here, we show the application of a new type of surface-photosensitized terbium NPs (Tb-NPs) for autofluorescence-free intracellular imaging in live HeLa cells. The combination of exceptionally high brightness, high photostability, and long photoluminecence (PL) lifetimes for highly efficient suppression of the short-lived autofluorescence allowed for time-gated PL imaging of intracellular vesicles over 72 h without toxicity and at extremely low Tb-NP concentrations down to 12 pM. Detection of highly resolved long-lifetime (ms) PL decay curves from small (∼10 μm 2 ) areas within single cells within a few seconds emphasized the unprecedented photophysical properties of Tb-NPs for live-cell imaging that extend well beyond currently available nanometric imaging agents.

  19. Folate Receptor Targeted Alpha-Therapy Using Terbium-149

    CERN Document Server

    Müller, Cristina; Haller, Stephanie; Dorrer, Holger; Köster, Ulli; Johnston, Karl; Zhernosekov, Konstantin; Türler, Andreas; Schibli, Roger

    2014-01-01

    Terbium-149 is among the most interesting therapeutic nuclides for medical applications. It decays by emission of short-range α-particles (Eα = 3.967 MeV) with a half-life of 4.12 h. The goal of this study was to investigate the anticancer efficacy of a 149Tb-labeled DOTA-folate conjugate (cm09) using folate receptor (FR)-positive cancer cells in vitro and in tumor-bearing mice. 149Tb was produced at the ISOLDE facility at CERN. Radiolabeling of cm09 with purified 149Tb resulted in a specific activity of ~1.2 MBq/nmol. In vitro assays performed with 149Tb-cm09 revealed a reduced KB cell viability in a FR-specific and activity concentration-dependent manner. Tumor-bearing mice were injected with saline only (group A) or with 149Tb-cm09 (group B: 2.2 MBq; group C: 3.0 MBq). A significant tumor growth delay was found in treated animals resulting in an increased average survival time of mice which received 149Tb-cm09 (B: 30.5 d; C: 43 d) compared to untreated controls (A: 21 d). Analysis of blood parameters rev...

  20. Characterization of antibody-chelator conjugates: Determination of chelator content by terbium fluorescence titration

    Energy Technology Data Exchange (ETDEWEB)

    Brandt, K.D.; Schnobrich, K.E.; Johnson, D.K. (Abbott Laboratories, Department 90M, Abbott Park, IL (United States))

    1991-01-01

    Fluorescence titrations were performed by adding varying mole ratios of terbium(III) to antibody conjugates formed by benzyl isothiocyanate derivatives of three different polyaminopolycarboxylate chelators (NTA, EDTA, and DTPA) and the results compared to values for average chelator content obtained by cobalt-57 binding assays. For two different murine monoclonal antibodies, the average chelator content obtained by terbium fluorescence titration correlated closely with that measured by the cobalt-57 binding assay. It is concluded that lanthanide fluorescence titrations provide a useful alternative to radiometal binding assays for the determination of chelator content in protein-chelator conjugates.

  1. Characterization of antibody-chelator conjugates: Determination of chelator content by terbium fluorescence titration

    International Nuclear Information System (INIS)

    Brandt, K.D.; Schnobrich, K.E.; Johnson, D.K.

    1991-01-01

    Fluorescence titrations were performed by adding varying mole ratios of terbium(III) to antibody conjugates formed by benzyl isothiocyanate derivatives of three different polyaminopolycarboxylate chelators (NTA, EDTA, and DTPA) and the results compared to values for average chelator content obtained by cobalt-57 binding assays. For two different murine monoclonal antibodies, the average chelator content obtained by terbium fluorescence titration correlated closely with that measured by the cobalt-57 binding assay. It is concluded that lanthanide fluorescence titrations provide a useful alternative to radiometal binding assays for the determination of chelator content in protein-chelator conjugates

  2. Systems of pyridine, piperidine, piperazine, morpholine hydrochlorides-terbium (dysprosium) chloride-water

    International Nuclear Information System (INIS)

    Gajfutdinova, R.K.; Sharafutdinova, A.A.; Murinov, Yu.I.

    1988-01-01

    The isothermal cross section method at 25 and 50 deg C is applied to study pyridine hydrochloride-terbium chloride-water (1) piperidine hydrochloride-dysprosium chloride-water (2), piperazine dihydrochloride-dysprosium chloride-water (3) and morpholine hydrochloride-terbium chloride (4) systems. Solubility isotherma prove the formation of incongruently soluble compound of the TbCl 3 x6C 5 H 5 NxHCl composition systems (1). The individuality of the new solid phase is proved by the chemical and DTA methods. Systems (2-4) are of a simple eutonic type

  3. Thermoluminescence of cerium and terbium -doped calcium pyrophosphate

    Energy Technology Data Exchange (ETDEWEB)

    Roman L, J.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Lozano R, I. B.; Diaz G, J. A. I., E-mail: jesus.roman@nucleares.unam.mx [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, 11500 Mexico D. F. (Mexico)

    2015-10-15

    The aim of this work is to report the thermoluminescence (Tl) response of Calcium Pyrophosphate phosphor doped with Cerium and Terbium impurities (Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+}). The phosphors were synthesized using the co-precipitation method and annealed at 900 degrees C by two hours for obtain the β phase. The intentional doping with Ce and Tb ions was 1 at.% and 0.1 at.%, whereas in the EDS results the concentration of impurities was 0.39 at.% and 0.05 at.%, respectively. The superficial morphology of phosphor is mainly composed by thin wafers of different size. All samples were exposed to gamma rays from {sup 60}Co in the Gammacell-200 irradiator. The Tl response of the phosphor was measured from Rt up to 350 degrees C and under nitrogen atmosphere in a Harshaw TLD 3500 reader. The glow curves of the Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+} powders showed a broad intense Tl peak centered at 165 degrees C and a shoulder at approximate 260 degrees C was observed. A linear Tl response in the range of absorbed dose of 0.2 to 10 Gy was obtained. Tl glow curves were analyzed using the initial rise (IR)and computerized glow curve deconvolution methods to evaluate the kinetics parameters such as activation energy (E), frequency factor (s) and kinetic order (b). (Author)

  4. 37 CFR 1.167 - Examination.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Examination. 1.167 Section 1.167 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF... Examination. Applications may be submitted by the Patent and Trademark Office to the Department of Agriculture...

  5. Magneto-optical studies of valence instability in europium and terbium phosphors

    Czech Academy of Sciences Publication Activity Database

    Rodrigues, L.C.v.; Hölsä, J.; Brito, H.F.; Maryško, Miroslav; Matos, J.R.; Paturi, P.; Rodrigues, R.V.; Lastusaari, M.

    2016-01-01

    Roč. 170, Feb (2016), 701-706 ISSN 0022-2313 Institutional support: RVO:68378271 Keywords : valence * europium * terbium * oxysulfide and -sulfate * phosphors * paramagnetic susceptibility Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.686, year: 2016

  6. A terbium(III)-organic framework for highly selective sensing of cytidine triphosphate.

    Science.gov (United States)

    Zhao, Xi Juan; He, Rong Xing; Li, Yuan Fang

    2012-11-21

    Highly selective sensing of cytidine triphosphate (CTP) against other triphosphate nucleosides including ATP, GTP and UTP is successfully achieved with a luminescent terbium(III)-organic framework (TbOF) of [Tb(2)(2,3-pzdc)(2)(ox)(H(2)O)(2)](n) (2,3-pzdc(2-) = 2,3-pyrazinedicarboxylate, ox(2-) = oxalate).

  7. Direct determination of graphene quantum dots based on terbium-sensitized luminescence

    Science.gov (United States)

    Llorent-Martínez, Eulogio J.; Molina-García, Lucía; Durán, Gema M.; Ruiz-Medina, Antonio; Ríos, Ángel

    2018-06-01

    Graphene quantum dots (GQD) were determined in water samples using terbium-sensitized luminescence (TSL). Terbium ions complex with GQD due to the carboxylic groups that are usually present in these nanomaterials, increasing the luminescence signal of terbium. In Tb(III)-GQD complexes, GQD absorb energy at their characteristic excitation wavelength and transfer it to terbium ion, which emits at its particular emission wavelength. The analytical signal, measured at λexc = 257 nm and λem = 545 nm, increases proportionally to GQD concentration between 50 and 500 μg L-1. Under optimum conditions, the proposed method presents a detection limit of 15 μg L-1 and is selective to GQD in the presence of other nanomaterials of similar size. As GQD are highly water-soluble, they are potential contaminants in environmental or drinking waters water samples, and hence the method was applied to the analysis of different drinking waters which were the target samples for the application of the developed method.

  8. Synthesis and novel fluorescence phenomenon of terbium(III) complex with N, N',N' -tris (2-benzimidazolmethyl) amine

    International Nuclear Information System (INIS)

    Yang, Tianlin; Gao, Min; Yang, Jinhui; Qin, Wenwu

    2010-01-01

    A benzimidazole ligand with a tripodal structure, N, N', N' -tris (2-benzimidazolmethyl) amine, and its terbium (III) complex has been synthesized. The complex has been characterized by element analysis, IR spectra, mass spectra, thermal analysis and molar conductivity. The terbium ion is found to coordinate with the nitrogen atoms (= N-) of imidazole ring and the bridgehead nitrogen atom. The fluorescence properties of the complex in aqueous solutions have been studied. Under excitation of UV light, the complex exhibits characteristic fluorescence of terbium ion. The luminescence of terbium complex in aqueous solutions is strongly enhanced by H + concentration. This phenomenon makes the new complex favorable for use in fluorescence switches and sensors. The mechanism of the fluorescence enhancement by protonation of the nitrogen atoms (-NH-) of imidazole ring is due to the suppressed photoinduced electron transfer fluorescence quenching on addition of acid. (author)

  9. X-ray fluorescence analysis of terbium oxide for rare earth impurities

    International Nuclear Information System (INIS)

    Chandola, L.C.; Machado, I.J.; Mohile, A.N.

    1975-01-01

    A method for the determination of Sm 2 O 3 , Eu 2 O 3 , Gd 2 O 3 , Dy 2 O 3 , Ho 2 O 3 and Y 2 O 3 in terbium oxide is described. The sample is converted to terbium oxalate, mixed with boric acid binder in the ratio 2:1, pelleted at a pressure of 20 tons over a boric acid backing pellet and irradiated with x-rays from a tungsten tube operated by Philips PW 1140 generator. The secondary x-rays thus generated are analysed by a LiF (200) crystal in Philips PW 1220 x-ray fluorescence spectrometer using suitable detectors. The minimum determination limit (MDL) is 0.01% for all rare earth oxides determined except for Y 2 O 3 for which it is 0.005%. (author)

  10. Investigation of terbium scandate as an alternative gate dielectric in fully depleted transistors

    Science.gov (United States)

    Roeckerath, M.; Lopes, J. M. J.; Özben, E. Durǧun; Urban, C.; Schubert, J.; Mantl, S.; Jia, Y.; Schlom, D. G.

    2010-01-01

    Terbium scandate thin films were deposited by e-gun evaporation on (100) silicon substrates. Rutherford backscattering spectrometry and x-ray diffraction studies revealed homogeneous chemical compositions of the films. A dielectric constant of 26 and CV-curves with small hystereses were measured as well as low leakage current densities of <1 nA/cm2. Fully depleted n-type field-effect transistors on thin silicon-on-insulator substrates with terbium scandate gate dielectrics were fabricated with a gate-last process. The devices show inverse subthreshold slopes of 80 mV/dec and a carrier mobility for electrons of 225 cm2/V•s was extracted.

  11. Automated spectrofluorimetric determinations of terbium and dysprosium in rare earth mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Lyle, S.J.; Za' tar, N. (Kent Univ., Canterbury (UK))

    1983-12-01

    Several methods involving the use of water-soluble binary and ternary complexes have been proposed for the spectrofluorimetric determination based on terbium(III) emission at 545 nm. These are terbium(III) with (A) ethylenediamine-N,N'-bis(o-hydroxyphenylacetic acid), (B) o-hydroxyphenyliminodiacetic acid, (C) EDTA + 5-sulphosalicylic acid, (D) EDTA + 1,2-dihydroxybenzene-3,5-disulphonic acid disodium salt (Tiron), and (E) iminodiacetic acid (IDA) + Tiron. Two of the reagent mixtures (D and E) can also be used for the fluorimetric determination of dysprosium(III) at 582 nm. A comparison has been made of these methods in order to select the most satisfactory procedure with respect to selectivity, sensitivity and suitability for adaption to automatic operation. Results are given and discussed.

  12. Cross sections from 800 MeV proton irradiation of terbium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, J.W., E-mail: jwengle@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Mashnik, S.G.; Bach, H.; Couture, A.; Jackman, K.; Gritzo, R.; Ballard, B.D.; Fassbender, M.; Smith, D.M.; Bitteker, L.J.; Ullmann, J.L.; Gulley, M.S.; Pillai, C.; John, K.D.; Birnbaum, E.R. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Nortier, F.M., E-mail: meiring@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2012-11-02

    Terbium foils were irradiated with 800 MeV protons to ascertain the potential for production of lanthanide isotopes of interest in medical, astrophysical, and basic science research and to contribute to nuclear data repositories. Isotopes produced in the foil were quantified by gamma spectroscopy. Cross sections for 35 isotopes produced in the irradiation are reported and compared with predictions by the MCNP6 transport code using the CEM03.03, Bertini and INCL + ABLA event generators. Our results indicate the need to accurately consider fission and fragmentation of relatively light target nuclei like terbium in the modeling of nuclear reactions at 800 MeV. The predictive power of the code was found to be different for each event generator tested but was satisfactory for most of the product yields in the mass region where spallation reactions dominate. However, none of the event generators' results are in complete agreement with measured data.

  13. Raman spectra of terbium trichloride, phosphorus pentachloride and their molten mixtures

    International Nuclear Information System (INIS)

    Salyulev, A.B.; Zakir'yanova, I.D.

    2008-01-01

    Raman spectroscopy was used to study in situ the behavior of individual terbium trichloride and phosphorus pentachloride in different aggregative states as a function of temperature, and of solutions of PCl 5 vapors in molten TbCl 3 . A conclusion is drawn about their structure and the nature of phase transformations and chemical reactions in wide ranges of temperature and saturated vapor pressures [ru

  14. A thermoluminescence study of Z2-centres in terbium-doped NaCl crystals

    International Nuclear Information System (INIS)

    Reddy, K.N.; Ahmed, I.M.; Pandaraiah, N.; Rao, U.V.S.; Babu, V.H.

    1983-01-01

    Thermoluminescence (TL), optical absorption are used to correlate thermal annealing of Z 2 -centres with TL peak occurring around 110 0 C in terbium-doped NaCl crystals. The TL glow peak occurring around 190 0 C is attributed to the thermal annealing of F-centres. The thermal activation parameters are calculated for both Z 2 - and F-centre peaks. (author)

  15. Terbium(III) ions as sensitizers of oxidation of indole and its derivatives in Fenton system

    Energy Technology Data Exchange (ETDEWEB)

    Kaczmarek, Małgorzata, E-mail: mkaczmar@amu.edu.pl; Staninski, Krzysztof

    2017-03-15

    Oxidation of indole and its derivatives in the Fenton system as a source of oxidising agents, in the presence of terbium(III) ions was studied by chemiluminescence methods to get the kinetic curves of emission decay and spectral distributions of chemiluminescence. Terbium(III) ions acted as a sensitizer of the mixtures Tb(III)-Fe(II)/Fe(III)-H{sub 2}O{sub 2}-indole or its derivative (tryptophan, tryptamine, indole-3-acetic acid and indole-3-acetyl aspartic acid). For the above indolic compounds, linear dependencies of integrated intensity of chemiluminescence on concentration of indolic compound in water and in water-acetonitrile solution were obtained. The limits of detection (LOD) and quantification (LOQ) of the indolic compounds studied were found to be by one or two orders of magnitude lower in the system with terbium(III) ions than without them. - Highlights: • Chemiluminescence emitted on oxidation of indolic compounds in Fenton system. • Tb (III) ions as sensitizers of indolic compounds oxidation in solutions. • Linear relations between CL intensity and indolic compound concentration.

  16. 26 CFR 1.167(b)-4 - Other methods.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Other methods. 1.167(b)-4 Section 1.167(b)-4...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(b)-4 Other methods. (a) Under section 167(b)(4) a taxpayer may use any consistent method of computing depreciation, such...

  17. Complex compounds of terbium(III) with some nonsteroidal anti-inflammatory drugs and their analytical applications

    International Nuclear Information System (INIS)

    Teslyuk, O.I.; Egorova, A.V.; Yagodkin, B.N.; Bel'tyukova, S.V.

    2007-01-01

    Luminescence properties of the complexes of terbium(III) with nonsteroidal anti-inflammatory drugs (ibuprofen and orthofen) were studied. It was demonstrated that in the presence of organic bases (2,2'-dipyridyl and 1,10-phenanthroline) mixed-ligand complexes are formed and the luminescence intensity of terbium(III) increases by a factor of up to 250. The optimum complexation conditions were determined. It was proposed to use these complexes as analytical forms for the luminescence determination of nonsteroidal anti-inflammatory drugs (ibuprofen and orthofen) in pharmaceutical dosage forms. The detection limits are 2 and 0.05 μg/ml, respectively [ru

  18. Green light emission in aluminum oxide powders doped with different terbium concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Mariscal B, L; Falcony, C. [IPN, Centro de Investigacion y de Estudios Avanzados, 07360 Ciudad de Mexico (Mexico); Carmona T, S.; Murrieta, H.; Sanchez A, M. A. [UNAM, Instituto de Fisica, 04510 Ciudad de Mexico (Mexico); Vazquez A, R. [IPN, Escuela Superior de Computo, 07738 Ciudad de Mexico (Mexico); Garcia R, C. M., E-mail: mariscal2005@gmail.com [UNAM, Facultad de Ciencias, 04510 Ciudad de Mexico (Mexico)

    2016-11-01

    Different emission intensities presented in aluminum oxide phosphors corresponding to different concentrations of doping performed with terbium are analyzed. The phosphors were synthesized by the evaporation technique and were characterized by photo and cathodoluminescence, X-ray diffraction and EDS techniques for different incorporation percentages of terbium as dopant; they show characteristic transitions in 494, 543, 587 and 622 nm, corresponding to {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4} and {sup 5}D{sub 4} → {sup 7}F{sub 3}, respectively when they are excited with λ{sub exc} = 380 nm wavelength at room temperature. The results of X-ray diffraction show the presence of α-Al{sub 2}O{sub 3} phases with peaks located at 2θ = 25.78, 35.34, 37.96, 43.56, 45.8, 52.74, 57.7, 61.5, 66.74, 68.44, 77.12 and 80.94, and the δ-Al{sub 2}O-3 phase 2θ = 32.82, 45.8, 61.36 and 66.74. These compounds were heat treated for two hours at 1100 degrees Celsius. EDS analyzes indicate that these compounds have close to 60% oxygen around of 40% aluminum in the presence of terbium as dopant which indicates a stoichiometry close to the expected one for alumina. (Author)

  19. Synthesis and luminescence properties of europium and terbium complexes with pyridine- or bipyridine-linked oligothiophene ligand

    International Nuclear Information System (INIS)

    Liu Ping; Huang Mingsheng; Pan Wanzhang; Zhang Yamin; Hu Jianhua; Deng Wenji

    2006-01-01

    With an aim to develop novel luminescence materials, europium and terbium complexes of 2,5-(2-thiophene)-pyridine (TPY) and 5,5'-bis(5-(2,2'-bithiophene))-2,2'-bipyridine (B2TBPY) were synthesized, and their luminescence properties studied. The complexes exhibit ligand-sensitized emission, which is typical of Eu(III) and Tb(III) ions

  20. 46 CFR 167.45-80 - Fire axes.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire axes. 167.45-80 Section 167.45-80 Shipping COAST... Firefighting and Fire Prevention Requirements § 167.45-80 Fire axes. (a) All nautical school ships shall be provided with fire axes, as follows: Number of axes Gross tons of nautical school ships: All not over 50...

  1. 46 CFR 167.05-25 - Nautical school ship.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Nautical school ship. 167.05-25 Section 167.05-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-25 Nautical school ship. The term nautical school ship means a vessel operated by or in connection with a nautical school...

  2. 7 CFR 3015.167 - Replacement of equipment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Replacement of equipment. 3015.167 Section 3015.167..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.167 Replacement of equipment. (a) If needed, equipment may be exchanged for replacement equipment. Replacement of equipment may be...

  3. 46 CFR 167.65-35 - Use of auto pilot.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Use of auto pilot. 167.65-35 Section 167.65-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Operating Requirements § 167.65-35 Use of auto pilot. Except as provided in 33 CFR 164.15, when...

  4. 46 CFR 167.65-25 - Steering gear tests.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Steering gear tests. 167.65-25 Section 167.65-25... SHIPS Special Operating Requirements § 167.65-25 Steering gear tests. On all nautical school ships making voyages of more than 48 hours' duration, the entire steering gear, the whistle, the means of...

  5. 33 CFR 117.167 - Little Potato Slough.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw of...

  6. 46 CFR 167.05-35 - Public nautical school.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school. 167.05-35 Section 167.05-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-35 Public nautical school. The term public nautical school means any school...

  7. 21 CFR 516.167 - Removal from the index.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Removal from the index. 516.167 Section 516.167... DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.167 Removal from the index. (a) After due...

  8. RDM lifetime measurement in 167Lu

    International Nuclear Information System (INIS)

    Rohilla, Aman; Gupta, C.K.; Chamoli, S.K.; Singh, R.P.; Muralithar, S.; Ashok Kumar; Govil, I.M.

    2014-01-01

    In this paper we are presenting the experiment performed for measuring lifetime in 167 Lu, which provides the measurement of the structural behavior of the nuclei due to single particle excitation. The enhanced γ-ray detection GDA setup present at IUAC was used and the data was acquired in the singles mode with the condition when any two of the BGO's element fire in coincidence with a Ge detector. The online data acquisition program CANDLE was used for data acquire in conjunction with CAMAC based data acquisition hardware

  9. Electroanalytical performance of a terbium(III)-selective sensor based on a neutral ionophore in environmental and medicinal samples

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, V.K.; Singh, A.K.; Gupta, Barkha [Indian Institute of Technology-Roorkee, Department of Chemistry, Roorkee (India)

    2008-04-15

    A new highly selective terbium(III) electrode was prepared with a polymeric film doped using S-2-benzothiazolyl-2-amino-{alpha}-(methoxyimino)-4-thiazolethiol acetate as an electroactive material, benzyl acetate (BA) as a plasticizer, and potassium tetrakis(4-chlorophenyl) borate (KTpClPB) as an anionic site in the percentage ratio 3.17:1.58:63.4:31.7 (ionophore-KTpClPB-BA-PVC, w/w). The electrode exhibited a linear response with a near Nernstian slope of 19.5 mV/decade within the concentration range 1.5 x 10{sup -7}-1.0 x 10{sup -2} M terbium ions, with a working pH range from 2.0 to 8.0, and a fast response time of 10 s and presented satisfactory reproducibility. The limit of detection was 9.3 x 10{sup -8} M. The results show that this electrode can be used in ethanol media up to 30% (v/v) concentration without interference. It can be used for 3 months without any considerable divergence in the potentials. Selectivity coefficients for terbium(III) with respect to many cations were investigated. The electrode is highly selective for terbium(III) ions over a large number of monovalent, bivalent, and trivalent cations. This shows the valuable property of the proposed electrode. The stability constant of the ionophore towards Tb{sup 3+} ions was determined with the sandwich membrane method. It was successfully used as an indicator electrode in potentiometric determination of terbium(III) ions with EDTA and in direct determination in tap water and binary mixtures with quantitative results. The utility of the proposed electrode was also determined in the presence of ionic and nonionic surfactants and in the presence of fluoride ions in four pharmaceutical (mouthwash) preparations. (orig.)

  10. Electroanalytical performance of a terbium(III)-selective sensor based on a neutral ionophore in environmental and medicinal samples

    International Nuclear Information System (INIS)

    Gupta, V.K.; Singh, A.K.; Gupta, Barkha

    2008-01-01

    A new highly selective terbium(III) electrode was prepared with a polymeric film doped using S-2-benzothiazolyl-2-amino-α-(methoxyimino)-4-thiazolethiol acetate as an electroactive material, benzyl acetate (BA) as a plasticizer, and potassium tetrakis(4-chlorophenyl) borate (KTpClPB) as an anionic site in the percentage ratio 3.17:1.58:63.4:31.7 (ionophore-KTpClPB-BA-PVC, w/w). The electrode exhibited a linear response with a near Nernstian slope of 19.5 mV/decade within the concentration range 1.5 x 10 -7 -1.0 x 10 -2 M terbium ions, with a working pH range from 2.0 to 8.0, and a fast response time of 10 s and presented satisfactory reproducibility. The limit of detection was 9.3 x 10 -8 M. The results show that this electrode can be used in ethanol media up to 30% (v/v) concentration without interference. It can be used for 3 months without any considerable divergence in the potentials. Selectivity coefficients for terbium(III) with respect to many cations were investigated. The electrode is highly selective for terbium(III) ions over a large number of monovalent, bivalent, and trivalent cations. This shows the valuable property of the proposed electrode. The stability constant of the ionophore towards Tb 3+ ions was determined with the sandwich membrane method. It was successfully used as an indicator electrode in potentiometric determination of terbium(III) ions with EDTA and in direct determination in tap water and binary mixtures with quantitative results. The utility of the proposed electrode was also determined in the presence of ionic and nonionic surfactants and in the presence of fluoride ions in four pharmaceutical (mouthwash) preparations. (orig.)

  11. Dicty_cDB: VFH167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH167 (Link to dictyBase) - - - Contig-U16272-1 VFH167P (Link... to Original site) VFH167F 641 VFH167Z 348 VFH167P 989 - - Show VFH167 Library VF (Link to library) Clone ID VFH167 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyoste...) Homo sapiens cDNA FLJ35376 fis, cl... 320 5e-86 AF401554_1( AF401554 |pid:none) Ictalurus punctatus riboso

  12. Effects of time on the magnetic properties of terbium-doped LaMnO3

    International Nuclear Information System (INIS)

    Liu Weibin; Zhang Yingtang; Guan Wen; Kinsman, William; Yuan Xinqiang; Chen Ziyu

    2012-01-01

    The magnetic properties of the perovskite form of LaMnO 3 have been shown strong interest in recent years due to its high potential for use in magnetic devices. In this paper, the magnetic properties of a 30% terbium-doped LaMnO 3 (LMTO) perovskite manganite synthesized by a conventional solid-state reaction were investigated. Data on these properties was recorded periodically via SQUID and VSM to reveal it to be best described magnetically as a spin glass system. Thus, the time effect must be taken into consideration in instantaneously determining this material’s spin glass state as well as the overall magnetic properties in the absence of a magnetic field. The results of this paper point to a more in-depth understanding of the change in magnetic properties associated with doped LaMnO 3 .

  13. Electronic structure of surface-supported bis(phthalocyaninato) terbium(III) single molecular magnets.

    Science.gov (United States)

    Vitali, Lucia; Fabris, Stefano; Conte, Adriano Mosca; Brink, Susan; Ruben, Mario; Baroni, Stefano; Kern, Klaus

    2008-10-01

    The electronic structure of isolated bis(phthalocyaninato) terbium(III) molecules, a novel single-molecular-magnet (SMM), supported on the Cu(111) surface has been characterized by density functional theory and scanning tunneling spectroscopy. These studies reveal that the interaction with the metal surface preserves both the molecular structure and the large spin magnetic moment of the metal center. The 4f electron states are not perturbed by the adsorption while a strong molecular/metal interaction can induce the suppression of the minor spin contribution delocalized over the molecular ligands. The calculations show that the inherent spin magnetic moment of the molecule is only weakly affected by the interaction with the surface and suggest that the SMM character might be preserved.

  14. Luminescent hybrid films obtained by covalent grafting of terbium complex to silica network

    International Nuclear Information System (INIS)

    Liu Fengyi; Fu Lianshe; Wang Jun; Liu Ze; Li Huanrong; Zhang Hongjie

    2002-01-01

    Luminescent hybrid thin films consisting of terbium complex covalently bonded to a silica-based network have been obtained in situ via a sol-gel approach. A new monomer, N-(4-benzoic acid-yl), N'-(propyltriethoxysilyl)urea (PABI), has been synthesized by grafting isocyanatopropyltriethoxysilane (ICPTES) to p-aminobenzoic acid and characterized by 1 H NMR, IR and MS. The monomer acts as a ligand for Tb 3+ ion and as a sol-gel precursor. Band emission from Tb 3+ ion due to an efficient ligand-to-metal energy transfer was observed by UV excitation. The decay curves of Tb 3+ in the hybrid films were measured. The energy difference between the triplet state energy of PABI and the 5 D 4 level of Tb 3+ ion falls in the exciting range to sensitize Tb 3+ ion fluorescence

  15. Influence of crystallite size and temperature on the antiferromagnetic helices of terbium and holmium metal

    Energy Technology Data Exchange (ETDEWEB)

    Bick, Jens-Peter; Michels, Andreas [Universitaet des Saarlandes, D-66041 Saarbruecken (Germany); University of Luxembourg, L-1511 Luxembourg (Luxembourg); Ferdinand, Adrian; Birringer, Rainer [Universitaet des Saarlandes, D-66041 Saarbruecken (Germany); Baller, Joerg; Sanctuary, Roland [University of Luxembourg, L-1511 Luxembourg (Luxembourg); Philippi, Stefan [Leibniz Institute for Solid State and Materials Research, D-01069 Dresden (Germany); Lott, Dieter [GKSS Research Center, D-21502 Geesthacht (Germany); Balog, Sandor [Paul Scherrer Institute, CH-5232 Villigen (Switzerland); Rotenberg, Eli [Lawrence Berkeley National Laboratory, California 94720 (United States); Kaindl, Guenter [Freie Universitaet Berlin, D-14195 Berlin-Dahlem (Germany); Doebrich, Kristian M. [Freie Universitaet Berlin, D-14195 Berlin-Dahlem (Germany); Max-Born-Institut, D-12489 Berlin (Germany)

    2011-07-01

    We report on the results of grain-size and temperature-dependent magnetization, specific-heat, neutron-scattering, and angle-resolved photoelectron spectroscopy (ARPES) experiments on the heavy rare-earth metals terbium and holmium, with particular emphasis on the temperature regions where the helical antiferromagnetic phases exist. In contrast to Ho, we find that the helical structure in Tb is relative strongly affected by microstructural disorder, specifically, it can no longer be detected for the smallest studied grain size of D=18 nm. Moreover, in coarse-grained Tb a helical structure persists even in the ferromagnetic regime, down to about T=215 K, in agreement with the ARPES data, which reveal a nesting feature of the Fermi surface at the L point of the Brillouin zone at T=210 K.

  16. Origin of gigantic magnetostriction and crystal field effects in terbium dititanate

    International Nuclear Information System (INIS)

    Aleksandrov, I.V.; Lidskij, B.V.; Mamsurova, L.G.

    1985-01-01

    The temperature and magnetic field dependences of the magnetostriction and magnetization and the temperature dependences of the magnetic susceptibility, specific heat and lattice parameter are investigated experimentally in a broad range of temperature and field strength for polycrystalline and single crystal Tb 2 Ti 2 O 7 . A conclusion is drawn regarding the structure of the energy levels of Tb 3+ in Tb 2 Ti 2 O 7 . A qualitative and quantitative explanation of all observed magnetic effects, and in particular of gigantic magnetostriction in Tb 2 Ti 2 O 7 , is presented which is based on the crystal field theory. It is shown that the huge magnitude of the magnetostriction in terbium dititanate is due to the specificity of the energy spectrum of Tb 3+ in Tb 2 Ti 2 O 7

  17. Hyperfine structure of the odd parity level system in the terbium atom

    International Nuclear Information System (INIS)

    Stefanska, D; Furmann, B

    2017-01-01

    Within this work new experimental results concerning the hyperfine structure ( hfs ) in the terbium atom are presented, concerning the odd parity levels system, hitherto only scarcely investigated (apart from the ground term). hfs constants A and B for 113 levels were determined for the first time, and for another 16 levels, which already occurred in our earlier works, supplementary results were obtained; additionally, our earlier results for 93 levels were compiled. The hfs of the odd parity levels was investigated using the method of laser induced fluorescence in a hollow cathode discharge. The hfs of 165 spectral lines, where the levels in question were involved as the upper levels, was recorded. Literature values of hfs constants of the even-parity lower levels (including our own earlier results) greatly facilitated the present data evaluation. (paper)

  18. Terbium fluorescence as a sensitive, inexpensive probe for UV-induced damage in nucleic acids

    International Nuclear Information System (INIS)

    El-Yazbi, Amira F.; Loppnow, Glen R.

    2013-01-01

    Graphical abstract: -- Highlights: •Simple, inexpensive, mix-and-read assay for positive detection of DNA damage. •Recognition of undamaged DNA via hybridization to a hairpin probe. •Terbium(III) fluorescence reports the amount of damage by binding to ssDNA. •Tb/hairpin is a highly selective and sensitive fluorescent probe for DNA damage. -- Abstract: Much effort has been focused on developing methods for detecting damaged nucleic acids. However, almost all of the proposed methods consist of multi-step procedures, are limited, require expensive instruments, or suffer from a high level of interferences. In this paper, we present a novel simple, inexpensive, mix-and-read assay that is generally applicable to nucleic acid damage and uses the enhanced luminescence due to energy transfer from nucleic acids to terbium(III) (Tb 3+ ). Single-stranded oligonucleotides greatly enhance the Tb 3+ emission, but duplex DNA does not. With the use of a DNA hairpin probe complementary to the oligonucleotide of interest, the Tb 3+ /hairpin probe is applied to detect ultraviolet (UV)-induced DNA damage. The hairpin probe hybridizes only with the undamaged DNA. However, the damaged DNA remains single-stranded and enhances the intrinsic fluorescence of Tb 3+ , producing a detectable signal directly proportional to the amount of DNA damage. This allows the Tb 3+ /hairpin probe to be used for sensitive quantification of UV-induced DNA damage. The Tb 3+ /hairpin probe showed superior selectivity to DNA damage compared to conventional molecular beacons probes (MBs) and its sensitivity is more than 2.5 times higher than MBs with a limit of detection of 4.36 ± 1.2 nM. In addition, this probe is easier to synthesize and more than eight times cheaper than MBs, which makes its use recommended for high-throughput, quantitative analysis of DNA damage

  19. Determination of fluoxetine in pharmaceutical and biological samples based on the silver nanoparticle enhanced fluorescence of fluoxetine-terbium complex.

    Science.gov (United States)

    Lotfi, Ali; Manzoori, Jamshid L

    2016-11-01

    In this study, a simple and sensitive spectrofluorimetric method is presented for the determination of fluoxetine based on the enhancing effect of silver nanoparticles (AgNPs) on the terbium-fluoxetine fluorescence emission. The AgNPs were prepared by a simple reduction method and characterized by UV-Vis spectroscopy and transmission electron microscopy. It was indicated that these AgNPs have a remarkable amplifying effect on the terbium-sensitized fluorescence of fluoxetine. The effects of various parameters such as AgNP and Tb 3+ concentration and the pH of the media were investigated. Under obtained optimal conditions, the fluorescence intensity of the terbium-fluoxetine-AgNP system was enhanced linearly by increasing the concentration of fluoxetine in the range of 0.008 to 19 mg/L. The limit of detection (b + 3s) was 8.3 × 10 -4 mg/L. The interference effects of common species found in real samples were also studied. The method had good linearity, recovery, reproducibility and sensitivity, and was satisfactorily applied for the determination of fluoxetine in tablet formulations, human urine and plasma samples. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  20. 25 CFR 167.14 - Movement of livestock.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Movement of livestock. 167.14 Section 167.14 Indians... Movement of livestock. Annually, prior to the normal lamb buying season, the Central Grazing Committee... and the procedures and methods to be used in moving livestock to market. All movements of livestock...

  1. 46 CFR 167.45-50 - Foam smothering system requirements.

    Science.gov (United States)

    2010-10-01

    ... 167.45-50 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Firefighting and Fire Prevention Requirements § 167.45-50 Foam smothering... deep in not more than 3 minutes. The arrangement of piping shall be such as to give a uniform...

  2. 26 CFR 1.167(b)-1 - Straight line method.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining a...

  3. 26 CFR 1.167(a)-1 - Depreciation in general.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation in general. 1.167(a)-1 Section 1... Depreciation in general. (a) Reasonable allowance. Section 167(a) provides that a reasonable allowance for the... the taxpayer for the production of income shall be allowed as a depreciation deduction. The allowance...

  4. 26 CFR 1.167(g)-1 - Basis for depreciation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Basis for depreciation. 1.167(g)-1 Section 1.167... for depreciation. The basis upon which the allowance for depreciation is to be computed with respect... property at that time, is the basis for computing depreciation. [T.D. 6500, 25 FR 11402, Nov. 26, 1960...

  5. 14 CFR 135.167 - Emergency equipment: Extended overwater operations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Emergency equipment: Extended overwater operations. 135.167 Section 135.167 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF...) One CO2 bottle for emergency inflation; (x) One inflation pump; (xi) Two oars; (xii) One 75-foot...

  6. Evaluating United States and world consumption of neodymium, dysprosium, terbium, and praseodymium in final products

    Science.gov (United States)

    Hart, Matthew

    This paper develops scenarios of future rare-earth-magnet metal (neodymium, dysprosium, terbium, and praseodymium) consumption in the permanent magnets used in wind turbines and hybrid electric vehicles. The scenarios start with naive base-case scenarios for growth in wind-turbine and hybrid-electric-vehicle sales over the period 2011 to 2020, using historical data for each good. These naive scenarios assume that future growth follows time trends in historical data and does not depend on any exogenous variable. Specifically, growth of each technological market follows historical time trends, and the amount of rare earths used per unit of technology remains fixed. The chosen reference year is 2010. Implied consumptions of the rare earth magnet metals are calculated from these scenarios. Assumptions are made for the material composition of permanent magnets, the market share of permanent-magnet wind turbines and vehicles, and magnet weight per unit of technology. Different scenarios estimate how changes in factors like the material composition of magnets, growth of the economy, and the price of a substitute could affect future consumption. Each scenario presents a different method for reducing rare earth consumption and could be interpreted as potential policy choices. In 2010, the consumption (metric tons, rare-earth-oxide equivalent) of each rare-earth-magnet metal was as follows. Total neodymium consumption in the world for both technologies was 995 tons; dysprosium consumption was 133 tons; terbium consumption was 50 tons; praseodymium consumption was zero tons. The base scenario for wind turbines shows there could be strong, exponential growth in the global wind turbine market. New U.S. sales of hybrid vehicles would decline (in line with the current economic recession) while non-U.S. sales increase through 2020. There would be an overall increase in the total amount of magnetic rare earths consumed in the world. Total consumption of each rare earth in the short

  7. Nanostructured Layered Terbium Hydroxide Containing NASIDs: In Vitro Physicochemical and Biological Evaluations.

    Science.gov (United States)

    Gu, Qing-Yang; Qiu, Xiao; Liu, Jing-Jing; Fu, Min; Chao, Jian-Ping; Ju, Rui-Jun; Li, Xue-Tao

    2018-08-01

    Diclofenac sodium (abrr. DS) and indomethacin (abrr. IMC) have been intercalated into the layered terbium hydroxide (LTbH) by anion exchange method. Chemical compositions, thermostability, morphology, luminescence property, release behaviors and cytotoxic effects have been investigated. The DS molecules may embed between layers with a bilayered arrangement and the IMC may correspond to a monolayered arrangement. The Tb3+ luminescence in DS-LTbH and IMC-LTbH composites were enhanced compared with LTbH precusor and the luminescence intensity increases with the deprotonation degree. Drug release was measured with HPLC, and LTbH showed sustained release behavior on both drugs. Further In Vitro evaluation were carried out on cancer cells. Cytotoxic effect of LTbH was observed with a sulforhodamine B colorimetric assay on a variety of cancer cell lines, which revealed that the LTbH showed little cytotoxic effect. Results indicate LTbH may offer a potential vehicle as an effective drug delivery system along with diagnostic integration.

  8. Sonochemical synthesis of terbium tungstate for developing high power supercapacitors with enhanced energy densities.

    Science.gov (United States)

    Sobhani-Nasab, Ali; Rahimi-Nasrabadi, Mehdi; Naderi, Hamid Reza; Pourmohamadian, Vafa; Ahmadi, Farhad; Ganjali, Mohammad Reza; Ehrlich, Hermann

    2018-07-01

    Sonochemically prepared nanoparticles of terbium tungstate (TWNPs) were evaluated through scanning electron microscopy (SEM), thermogravimetric analysis (TGA), X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FT-IR), UV-Vis spectroscopy, and the optimal products were further characterized in terms of their electrochemical properties using conventional and continuous cyclic voltammetry (CV, and CCV), galvanostatic charge/discharge technique, and electrochemical impedance spectroscopy (EIS). The CV studies indicated the TWNPs to have specific capacitance (SC) values of 336 and 205 F g -1 at 1 and 200 mV s -1 , and galvanostatic charge-discharge tests revealed the SC of the TWNP-based electrodes to be 300 F g -1 at 1 Ag -1 . Also continuous cyclic voltammetry evaluations proved the sample as having a capacitance retention value of 95.3% after applying 4000 potential cycles. In the light of the results TWNPs were concluded as favorable electrode materials for use in hybrid vehicle systems. Copyright © 2018 Elsevier B.V. All rights reserved.

  9. A Terbium Sensitized Luminescence Method for the Assay of Flubiprofen in Pharmaceutical Formulations

    Directory of Open Access Journals (Sweden)

    Salma M.Z. Al-Kindy

    2014-12-01

    Full Text Available A sensitive time-resolved luminescence method for the determination of flubiprofen (FLP in methanol and in aqueous solution is described. The method is based on the luminescence sensitization of terbium (Tb3+ by the formation of a ternary complex with FLP in the presence of 4,7 diphenyl 1,10 phenanthroline (DPP as co-ligand, and Tween-20 as surfactant. The signal for Tb-FLP-DPP was monitored at λex  = 285 nm and λem  = 552 nm. Optimum conditions for the formation of the complex in an aqueous system were TRIS buffer, pH 8.0, DPP (2.5Å~10−7  M, Tween-20 (0.30% and 4Å~10-5  mol L-1  of Tb3+  which allowed the determination of 20–1000 ng mL-1  of FLP with a limit of detection (LOD of 10 ng mL-1 . The relative standard deviations of the method ranged between 0.6 and 1.4% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assays of FLP in pharmaceutical formulations and spiked tap water samples with average recoveries of 87% – 95%.

  10. Preparation and luminescence properties of terbium-doped lanthanum oxide nanofibers by electrospinning

    Energy Technology Data Exchange (ETDEWEB)

    Song Lixin; Du Pingfan [Key Laboratory of Advanced Textile Materials and Manufacturing Technology (Zhejiang Sci-Tech University), Ministry of Education, Hangzhou 310018 (China); Xiong Jie, E-mail: jxiong@zstu.edu.cn [Key Laboratory of Advanced Textile Materials and Manufacturing Technology (Zhejiang Sci-Tech University), Ministry of Education, Hangzhou 310018 (China); Fan Xiaona; Jiao Yuxue [Key Laboratory of Advanced Textile Materials and Manufacturing Technology (Zhejiang Sci-Tech University), Ministry of Education, Hangzhou 310018 (China)

    2012-01-15

    Terbium-doped lanthanum oxide (La{sub 2}O{sub 3}:Tb{sup 3+}) nanofibers were prepared by electrospinning followed by calcination at high temperature. Thermogravimetric analyzer (TGA), field emission scanning electron microscopy (FE-SEM), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), and photoluminescence (PL) were used to characterize the obtained fibers. The results reveal that the nanofibers have an average diameter of ca. 95{+-}25 nm and are composed of pure La{sub 2}O{sub 3} phase. Under the excitation of 274 nm light, the La{sub 2}O{sub 3}:Tb{sup 3+} nanofibers exhibit the characteristic emission resulting from the {sup 5}D{sub 4}{yields}{sup 7}F{sub J} (J=3, 4, 5, 6) transitions of Tb{sup 3+} ions. And the PL emission intensity is stronger than that of their nanoparticle counterparts. - Highlights: > Tb{sup 3+}-doped La{sub 2}O{sub 3} (La{sub 2}O{sub 3}:Tb{sup 3+}) fluorescent nanofibers were prepared via a simple electrospinning technique. > Luminescent properties and other characteristics of the nanofibers were investigated in details. > Potential applications of La{sub 2}O{sub 3}:Tb{sup 3+} nanofibers and electrospinning technique described in this paper are suggested.

  11. Sensitization effects of supramolecular assemblies on the luminescence of terbium-ion prulifloxacin complexes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Hong; Yi Chongyue; Li Xue; Fang Fang [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Yang Yajiang, E-mail: yjyang@mail.hust.edu.c [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2011-04-15

    Luminescence enhancement of terbium-ion prulifloxacin complexes (Tb(III)-PUFX) in supramolecular hydrogels formed by assembly of 1,3:2,4-di-O-benzylidene-D-sorbitol (DBS) was investigated by steady-state fluorescence, varying temperature fluorescence and time-resolved fluorescence. The luminescence images show that Tb(III)-PUFX were dispersed in the DBS gels. The luminescence intensity of Tb(III)-PUFX in the DBS gels was significantly increased in comparison with that in corresponding aqueous solutions. The varying temperature fluorescent spectra show that the luminescence intensity of Tb(III)-PUFX decreased with an increase in the temperature. This implies that the luminescence enhancement of Tb(III)-PUFX is related to the dissociation and the formation of the DBS assemblies. Time-resolved fluorescence measurements show slower rotational motion in DBS gels in comparison with that in the corresponding aqueous solutions. This may be ascribed to a unique microstructure of three-dimensional network formed by DBC aggregates, resulting in deactivation of the nonradiative relaxation. The images of field emission scanning electron microscopy and polarized optical microscopy indicate that the morphology of the DBS assemblies was not influenced upon addition of Tb(III)-PUFX to the DBS gels.

  12. Sensitive luminescent determination of DNA using the terbium(III)-difloxacin complex

    International Nuclear Information System (INIS)

    Yegorova, Alla V.; Scripinets, Yulia V.; Duerkop, Axel; Karasyov, Alexander A.; Antonovich, Valery P.; Wolfbeis, Otto S.

    2007-01-01

    The interaction of the terbium-difloxacin complex (Tb-DFX) with DNA has been examined by using UV-vis absorption and luminescence spectroscopy. The Tb-DFX complex shows an up to 85-fold enhancement of luminescence intensity upon titration with DNA. The long decay times allow additional detection schemes like time-resolved measurements in microplate readers to enhance sensitivity by off-gating short-lived background luminescence. Optimal conditions are found at equimolar concentrations of Tb 3+ and DFX (0.1 or 1 μM) at pH 7.4. Under these conditions, the luminescence intensity is linearly dependent on the concentration of ds-DNAs and ss-DNA between 1-1500 ng mL -1 and 4.5-270 ng mL -1 , respectively. The detection limit is 0.5 ng mL -1 for ds-DNAs and 2 ng mL -1 for ss-DNA. The mechanism for the luminescence enhancement was also studied

  13. Efficient green luminescence of terbium oxalate crystals: A case study with Judd-Ofelt theory and single crystal structure analysis and the effect of dehydration on luminescence

    Science.gov (United States)

    Alexander, Dinu; Joy, Monu; Thomas, Kukku; Sisira, S.; Biju, P. R.; Unnikrishnan, N. V.; Sudarsanakumar, C.; Ittyachen, M. A.; Joseph, Cyriac

    2018-06-01

    Design and synthesis of Lanthanide based metal organic framework is a frontier area of research owing to their structural diversity enabling specific applications. The luminescence properties of rare earths, tuned by the structural features of Ln-MOFs are investigated extensively. Rare earth oxalates which can be synthesized in a facile method, ensuring the structural features of MOFs with excellent photoluminescence characteristics deserves much attention. This work is the first time report on the single crystal structure and Judd-Ofelt (JO) theoretical analysis - their correlation with the intense and sharp green luminescence of Terbium oxalate crystals. The intense green luminescence observed for Terbium oxalate crystals for a wide range of excitation from DUV to visible region despite the luminescence limiting factors are discussed. The absence of concentration quenching and lifting up of forbidden nature of f-f transitions, allowing direct excitation of Terbium ions is analysed with the help of JO theory and single crystal structure analysis. The JO analysis predicted the asymmetry of Terbium sites, allowing the electric dipole transitions and from the JO intensity parameters, promising spectroscopic parameters - emission cross section, branching ratio, gain band width and gain coefficient of the material were calculated. The single crystal structure analysis revealed the asymmetry of Tb sites and structure of Terbium oxalate is formed by the hydrogen bonded stacking of overlapped six Terbium membered rings connected by the oxalate ligands. The molecularly thick layers thus formed on the crystal surface are imaged by the atomic force microscopy. The presence of water channels in the structure and the effect of lattice water molecules on the luminescence intensity are also investigated.

  14. Construction of the energy matrix for complex atoms. Part VIII: Hyperfine structure HPC calculations for terbium atom

    Science.gov (United States)

    Elantkowska, Magdalena; Ruczkowski, Jarosław; Sikorski, Andrzej; Dembczyński, Jerzy

    2017-11-01

    A parametric analysis of the hyperfine structure (hfs) for the even parity configurations of atomic terbium (Tb I) is presented in this work. We introduce the complete set of 4fN-core states in our high-performance computing (HPC) calculations. For calculations of the huge hyperfine structure matrix, requiring approximately 5000 hours when run on a single CPU, we propose the methods utilizing a personal computer cluster or, alternatively a cluster of Microsoft Azure virtual machines (VM). These methods give a factor 12 performance boost, enabling the calculations to complete in an acceptable time.

  15. Solid-phase synthesis of compounds of europium and terbium with nitrogen-containing heterocyclic compounds under mechanical activation

    International Nuclear Information System (INIS)

    Kalinovskaya, I.V.; Karasev, V.E.

    2000-01-01

    Effect of solvents and parameters of mechanical treatment on basic regularities of synthesis of rare earth compounds with nitrogen-containing heterocyclic compounds is studied. It is shown that interaction on europium (3) and terbium (3) nitrates with nitrogen-containing heterocyclic compounds leads to formation of compounds of Ln(NO 3 )·2D composition, where Ln=Eu, Tb; D=2,2-dipyridyl, 1,10-phenanthroline, diphenylguanidine. Effect of conditions of mechanical treatment and different additions on process and yield of products is studied. Compounds prepared are characterized by the methods of chemical element analysis, IR spectroscopy and luminescent spectroscopy [ru

  16. Structural, elastic, mechanical and thermodynamic properties of Terbium oxide: First-principles investigations

    Directory of Open Access Journals (Sweden)

    Samah Al-Qaisi

    Full Text Available First-principles investigations of the Terbium oxide TbO are performed on structural, elastic, mechanical and thermodynamic properties. The investigations are accomplished by employing full potential augmented plane wave FP-LAPW method framed within density functional theory DFT as implemented in the WIEN2k package. The exchange-correlation energy functional, a part of the total energy functional, is treated through Perdew Burke Ernzerhof scheme of the Generalized Gradient Approximation PBEGGA. The calculations of the ground state structural parameters, like lattice constants a0, bulk moduli B and their pressure derivative B′ values, are done for the rock-salt RS, zinc-blende ZB, cesium chloride CsCl, wurtzite WZ and nickel arsenide NiAs polymorphs of the TbO compound. The elastic constants (C11, C12, C13, C33, and C44 and mechanical properties (Young’s modulus Y, Shear modulus S, Poisson’s ratio σ, Anisotropic ratio A and compressibility β, were also calculated to comprehend its potential for valuable applications. From our calculations, the RS phase of TbO compound was found strongest one mechanically amongst the studied cubic structures whereas from hexagonal phases, the NiAs type structure was found stronger than WZ phase of the TbO. To analyze the ductility of the different structures of the TbO, Pugh’s rule (B/SH and Cauchy pressure (C12–C44 approaches are used. It was found that ZB, CsCl and WZ type structures of the TbO were of ductile nature with the obvious dominance of the ionic bonding while RS and NiAs structures exhibited brittle nature with the covalent bonding dominance. Moreover, Debye temperature was calculated for both cubic and hexagonal structures of TbO in question by averaging the computed sound velocities. Keywords: DFT, TbO, Elastic properties, Thermodynamic properties

  17. Resonance energy transfer from quinolinone modified polystyrene-block-poly(styrene-alt-maleic anhydride) copolymer to terbium(III) metal ions

    Czech Academy of Sciences Publication Activity Database

    Výprachtický, Drahomír; Mikeš, F.; Lokaj, Jan; Pokorná, Veronika; Cimrová, Věra

    2015-01-01

    Roč. 160, April (2015), s. 27-34 ISSN 0022-2313 R&D Projects: GA ČR GAP106/12/0827; GA ČR(CZ) GA13-26542S Institutional support: RVO:61389013 Keywords : energy transfer * terbium luminescence * quinolinone donor Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.693, year: 2015

  18. Determination of sertraline in pharmaceutical and biological samples using 1, 10-phenanthroline-terbium probe and silver nanoparticles enhanced fluorescence

    Energy Technology Data Exchange (ETDEWEB)

    Lotfi, Ali, E-mail: alilotfi67@gmail.com [Young Researchers and Elite Club, Tabriz Branch, Islamic Azad University, Tabriz (Iran, Islamic Republic of); Manzoori, Jamshid L. [Department of Chemistry, Tabriz Branch, Islamic Azad University, Tabriz (Iran, Islamic Republic of); Mohagheghi, Arash [Clinical Psychiatry Research Center, Tabriz University of Medical Sciences, Tabriz (Iran, Islamic Republic of)

    2017-05-15

    Sertraline is an antidepressant widely prescribed for major depressive disorders. In this contribution we report a novel, rapid and sensitive spectrofluorimetric technique, developed and validated for the determination of sertraline in pharmaceutical, human urine and human plasma samples, based on the fluorescence enhancement of the sertraline by 1, 10-phenanthroline-terbium probe with Ag nanoparticles (AgNPs). The effect of pH, buffer concentration, the order of addition of reagents, terbium and 1, 10-phenanthroline concentrations, and concentration of Ag nanoparticles (AgNPs) as well as reaction time on the fluorescence intensity were investigated and the optimum conditions were determined. The linear range for determination of sertraline was obtained as 0.001–3 mg L{sup −1}. The limit of detection (b+3s) and the limit of quantification was calculated as 2.9×10{sup −4} mg L{sup −1} and 9.8×10{sup −4} mg L{sup −1}, respectively. The interference effects of common excipients found in pharmaceutical preparations were studied. The presented technique was used to determine the sertraline in pharmaceutical samples, human urine and plasma as real samples. The presented method was indicated a comparable results with the standard analytical techniques for sertraline. Good linearity, reproducibility, recovery and limit of detection have made this method suitable for determination of sertraline in various types of samples.

  19. Determination of sertraline in pharmaceutical and biological samples using 1, 10-phenanthroline-terbium probe and silver nanoparticles enhanced fluorescence

    International Nuclear Information System (INIS)

    Lotfi, Ali; Manzoori, Jamshid L.; Mohagheghi, Arash

    2017-01-01

    Sertraline is an antidepressant widely prescribed for major depressive disorders. In this contribution we report a novel, rapid and sensitive spectrofluorimetric technique, developed and validated for the determination of sertraline in pharmaceutical, human urine and human plasma samples, based on the fluorescence enhancement of the sertraline by 1, 10-phenanthroline-terbium probe with Ag nanoparticles (AgNPs). The effect of pH, buffer concentration, the order of addition of reagents, terbium and 1, 10-phenanthroline concentrations, and concentration of Ag nanoparticles (AgNPs) as well as reaction time on the fluorescence intensity were investigated and the optimum conditions were determined. The linear range for determination of sertraline was obtained as 0.001–3 mg L −1 . The limit of detection (b+3s) and the limit of quantification was calculated as 2.9×10 −4 mg L −1 and 9.8×10 −4 mg L −1 , respectively. The interference effects of common excipients found in pharmaceutical preparations were studied. The presented technique was used to determine the sertraline in pharmaceutical samples, human urine and plasma as real samples. The presented method was indicated a comparable results with the standard analytical techniques for sertraline. Good linearity, reproducibility, recovery and limit of detection have made this method suitable for determination of sertraline in various types of samples.

  20. Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

    Directory of Open Access Journals (Sweden)

    Devender Singh

    2016-12-01

    Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

  1. An ICP AES method for determination of dysprosium and terbium in high purity yttrium oxide

    International Nuclear Information System (INIS)

    Rupawate, V.H.; Hareendran, K.N.; Roy, S.B.

    2011-01-01

    High purity yttrium finds interesting application in astronavigation, luminescence, nuclear energy and metallurgical industries. Most of these applications require yttrium oxide of highest purity. Consequently there is a need for production of high purity yttrium oxide. Separation and purification of yttrium from other rare earths is a challenging task due to their close chemical properties. Liquid-liquid extraction and ion exchange have been widely used in the production of yttrium oxide of highest purity. Determination of impurities, especially other rare earths, in ppm level is required for process development and chemical characterization of the high purity Y 2 O 3 . Many methods have been described in literature. However since the advent of ICP AES much work in this area has been carried out by this technique. This paper describes the work done for determination of dysprosium (Dy) and terbium (Tb) in yttrium oxide using a high resolution sequential ICP AES. Emission spectra of rare earth elements are very complex and due to this complexity it is important to select spectral interference free analyte lines for determination of rare earths in rare earth matrix. For the determination of Dy and Tb in Y 2 O 3 , sensitive lines of Dy and Tb are selected from the instrument wavelength table and spectral interference free emission lines for the determination is selected by scanning around the selected wavelengths using 5 g/L Y solution and 5 mg/L standard solutions of Dy and Tb prepared in 4% nitric acid. It is found 353.170 nm line of Dy and 350.917 nm line Tb is suitable for quantitative determination. The signal to background ratio increases with increase in matrix concentration, i.e. from 1 to 5 mg/L. The optimum forward power is determined and it is found to be 1100W for Dy and 1000W for Tb. The instrument is calibrated using matrix matched standards containing 5g/L of Y matrix. Samples are dissolved in nitric acid and Y concentration is maintained at 5g/L. Two

  2. 46 CFR 167.30-10 - Special operating requirements.

    Science.gov (United States)

    2010-10-01

    ..., (3) Within or on the boundaries of fuel tanks; or, (4) To pipe lines, heating coils, pumps, fittings, or other appurtenances connected to such cargo or fuel tanks. (c) Such inspections shall be made and... SCHOOL SHIPS Repairs or Alterations § 167.30-10 Special operating requirements. Inspection and testing...

  3. 46 CFR 167.15-10 - Application for annual inspection.

    Science.gov (United States)

    2010-10-01

    ... NAUTICAL SCHOOL SHIPS Inspections § 167.15-10 Application for annual inspection. Application in writing for the annual inspection of every nautical school ship required to be inspected by law and the... Inspection, at any local Marine Inspection Office, U.S. Coast Guard, where the nautical school ship may be...

  4. 33 CFR 167.1700 - In Prince William Sound: General.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false In Prince William Sound: General... Schemes and Precautionary Areas Pacific West Coast § 167.1700 In Prince William Sound: General. The Prince William Sound Traffic Separation Scheme consists of four parts: Prince William Sound Traffic Separation...

  5. 46 CFR 167.05-20 - Marine inspector or inspector.

    Science.gov (United States)

    2010-10-01

    ...-20 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-20 Marine inspector or inspector. These terms mean any person from the... Officer in Charge, Marine Inspection, or any other person as may be designated for the performance of...

  6. 7 CFR 1786.167 - Restrictions to additional RUS financing.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Restrictions to additional RUS financing. 1786.167... additional RUS financing. (a) No borrower that prepays an electric loan at a discount as provided under this... borrower is unable to obtain financing at reasonable terms to restore the system from non-RUS sources...

  7. 34 CFR 668.167 - FFEL Program funds.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.167 FFEL Program funds... limitations contained in paragraph (d) of this section. (f) An institution placed under the cash monitoring payment method. The Secretary may require an institution that is placed under the cash monitoring...

  8. 7 CFR 400.167 - Limitations on Corporation's obligations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Limitations on Corporation's obligations. 400.167... INSURANCE CORPORATION, DEPARTMENT OF AGRICULTURE GENERAL ADMINISTRATIVE REGULATIONS Reinsurance Agreement... Corporation's obligations. The Agreement will include the following among the limitations on the obligations...

  9. Complete Stokes polarimetry of magneto-optical Faraday effect in a terbium gallium garnet crystal at cryogenic temperatures.

    Science.gov (United States)

    Majeed, Hassaan; Shaheen, Amrozia; Anwar, Muhammad Sabieh

    2013-10-21

    We report the complete determination of the polarization changes caused in linearly polarized incident light due to propagation in a magneto-optically active terbium gallium garnet (TGG) single crystal, at temperatures ranging from 6.3 to 300 K. A 28-fold increase in the Verdet constant of the TGG crystal is seen as its temperature decreases to 6.3 K. In contrast with polarimetry of light emerging from a Faraday material at room temperature, polarimetry at cryogenic temperatures cannot be carried out using the conventional fixed polarizer-analyzer technique because the assumption that ellipticity is negligible becomes increasingly invalid as temperature is lowered. It is shown that complete determination of light polarization in such a case requires the determination of its Stokes parameters, otherwise inaccurate measurements will result with negative implications for practical devices.

  10. A search for long-lived radionuclides produced by fast-neutron irradiations of copper, silver, europium, terbium, and hafnium

    International Nuclear Information System (INIS)

    Meadows, J.W.; Smith, D.L.; Ikeda, Y.; Konno, C.

    1990-01-01

    Identical sample packets, each containing samples of elemental copper, silver, europium, terbium, and hafnium, as well as titanium, iron and nickel as dosimeters, have been irradiated in three distinct accelerator neutron fields (at Argonne National Laboratory and Los Alamos National Laboratory in the U.S.A., and Japan Atomic Energy Research Institute, Tokai, Japan) as part of an interlaboratory research collaboration to search for the production of long-lived radionuclides for fusion waste disposal applications. This paper is a progress report on this project. To date, we have detected the following activities, and have obtained preliminary experimental cross section values for several of these: Ag-106m,108m,110m; Eu-150m,152g,154; Tb-158,160; and Hf-175,178m2,179m2,181. (author). 11 refs, 1 fig., 4 tabs

  11. Effects of time on the magnetic properties of terbium-doped LaMnO{sub 3}

    Energy Technology Data Exchange (ETDEWEB)

    Liu Weibin [Department of Physics, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China); Zhang Yingtang, E-mail: zhangyingtang76@mail.xjtu.edu.cn [School of Material Science and Engineering, Institute of Functional Material, Shaanxi University of Technology, Hanzhong 723003 (China); State Key Laboratory of Electrical Insulation and Power Equipment and MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter, Xi' an Jiaotong University, Xi' an 710049 (China); Guan Wen [State Key Laboratory of Electrical Insulation and Power Equipment and MOE Key Laboratory for Nonequilibrium Synthesis and Modulation of Condensed Matter, Xi' an Jiaotong University, Xi' an 710049 (China); Kinsman, William [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Yuan Xinqiang [School of Material Science and Engineering, Institute of Functional Material, Shaanxi University of Technology, Hanzhong 723003 (China); Chen Ziyu [Department of Physics, Beijing University of Aeronautics and Astronautics, Beijing 100191 (China)

    2012-09-01

    The magnetic properties of the perovskite form of LaMnO{sub 3} have been shown strong interest in recent years due to its high potential for use in magnetic devices. In this paper, the magnetic properties of a 30% terbium-doped LaMnO{sub 3} (LMTO) perovskite manganite synthesized by a conventional solid-state reaction were investigated. Data on these properties was recorded periodically via SQUID and VSM to reveal it to be best described magnetically as a spin glass system. Thus, the time effect must be taken into consideration in instantaneously determining this material's spin glass state as well as the overall magnetic properties in the absence of a magnetic field. The results of this paper point to a more in-depth understanding of the change in magnetic properties associated with doped LaMnO{sub 3}.

  12. Self-assembly of Terbium(III)-based metal-organic complexes with two-photon absorbing active

    Science.gov (United States)

    Li, Dandan; Shao, Nanqi; Sun, Xianshun; Zhang, Guocui; Li, Shengli; Zhou, Hongping; Wu, Jieying; Tian, Yupeng

    2014-12-01

    Hybrid complexes based on D-π-A type dyes p-aminostyryl-pyridinum and Terbium(III) complex anion (1, 2) have been synthesized by ionic exchange reaction. Meanwhile two different alkyl-substituted amino groups were used as electron donors in organic dyes cations. The synthesized complexes were characterized by element analysis. In addition, the structural features of them were systematic studied by single crystal X-ray diffraction analysis. Their linear properties have been systematically investigated by absorption spectra and fluorescence, the results show that the energy transfer takes place from the trans-4-[4‧-(N,N-diethylamino)styryl]-N-methyl pyridinium (2‧) cation to Tb(III). In addition, complex 2 exhibit a large two-photon absorption coefficient β: 0.044 cm/GW at 710 nm.

  13. Commercializing potassium terbium fluoride, KTF (KTb3F10) faraday crystals for high laser power optical isolator applications

    Science.gov (United States)

    Schlichting, Wolfgang; Stevens, Kevin; Foundos, Greg; Payne, Alexis

    2017-10-01

    Many scientific lasers and increasingly industrial laser systems operate in manufacture. However, for high-power laser applications TGG is limited by its absorption at 1064nm and its thermo-optic coefficient, dn/dT. Specifically, thermal lensing and depolarization effects become a limiting factor at high laser powers. While TGG absorption has improved significantly over the past few years, there is an intrinsic limit. Now, SYNOPTICS is commercializing the enhanced new crystal Potassium Terbium Fluoride KTF (KTb3F10) that exhibits much smaller nonlinear refractive index and thermo-optic coefficients, and still exhibits a Verdet constant near that of TGG. This cubic crystal has relatively low absorption and thermo-optic coefficients. It is now fully characterized and available for select production orders. At OPTIFAB in October 2017 we present recent results comparing the performance of KTF to TGG in optical isolators and show SYNOPTICS advances in large volume crystal growth and the production ramp up.

  14. Sensitivity improvement of Cerenkov luminescence endoscope with terbium doped Gd{sub 2}O{sub 2}S nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Xin; Chen, Xueli, E-mail: xlchen@xidian.edu.cn, E-mail: jimleung@mail.xidian.edu.cn; Cao, Xu; Zhan, Yonghua; Liang, Jimin, E-mail: xlchen@xidian.edu.cn, E-mail: jimleung@mail.xidian.edu.cn [Engineering Research Center of Molecular and Neuro Imaging of the Ministry of Education and School of Life Science and Technology, Xidian University, Xi' an, Shaanxi 710071 (China); Kang, Fei; Wang, Jing [Department of Nuclear Medicine, Xijing Hospital, Fourth Military Medical University, Xi' an, Shaanxi 710032 (China); Wu, Kaichun [Department of Digestive Diseases, Xijing Hospital, Fourth Military Medical University, Xi' an, Shaanxi 710032 (China)

    2015-05-25

    Our previous study showed a great attenuation for the Cerenkov luminescence endoscope (CLE), resulting in relatively low detection sensitivity of radiotracers. Here, a kind of radioluminescence nanoparticles (RLNPs), terbium doped Gd{sub 2}O{sub 2}S was mixed with the radionuclide {sup 68}Ga to enhance the intensity of emitted luminescence, which finally improved the detection sensitivity of the CLE by using the radioluminescence imaging technique. With the in vitro and in vivo pseudotumor experiments, we showed that the use of RLNPs mixed with the radionuclide {sup 68}Ga enabled superior sensitivity compared with the radionuclide {sup 68}Ga only, with 50-fold improvement on detection sensitivity, which guaranteed meeting the demands of the clinical diagnosis of gastrointestinal tract tumors.

  15. Κ-electron capture probability in 167Tm

    International Nuclear Information System (INIS)

    Sree Krishna Murty, G.; Chandrasekhar Rao, M.V.S.; Radha Krishna, K.; Bhuloka Reddy, S.; Satyanarayana, G.; Ramana Rao, P.V.; Sastry, D.L.

    1990-01-01

    The Κ-electron capture probability in the decay of 167 Tm for the first-forbidden transition 1/2 + →3/2 - was measured using the sum-coincidence method and employing a hyper-pure Ge system. The P Κ value is found to be 0.835±0.029, in agreement with the theoretical value of 0.829. (author)

  16. Kappa. -electron capture probability in sup 167 Tm

    Energy Technology Data Exchange (ETDEWEB)

    Sree Krishna Murty, G.; Chandrasekhar Rao, M.V.S.; Radha Krishna, K.; Bhuloka Reddy, S.; Satyanarayana, G.; Ramana Rao, P.V.; Sastry, D.L. (Andhra Univ., Visakhapatnam (India). Labs. for Nuclear Research); Chintalapudi, S.N. (Variable Energy Cyclotron Centre, Calcutta (India))

    1990-07-01

    The {Kappa}-electron capture probability in the decay of {sup 167}Tm for the first-forbidden transition 1/2{sup +}{yields}3/2{sup -} was measured using the sum-coincidence method and employing a hyper-pure Ge system. The P{sub {Kappa}} value is found to be 0.835{plus minus}0.029, in agreement with the theoretical value of 0.829. (author).

  17. A hydrometallurgical process for the recovery of terbium from fluorescent lamps: Experimental design, optimization of acid leaching process and process analysis.

    Science.gov (United States)

    Innocenzi, Valentina; Ippolito, Nicolò Maria; De Michelis, Ida; Medici, Franco; Vegliò, Francesco

    2016-12-15

    Terbium and rare earths recovery from fluorescent powders of exhausted lamps by acid leaching with hydrochloric acid was the objective of this study. In order to investigate the factors affecting leaching a series of experiments was performed in according to a full factorial plan with four variables and two levels (4 2 ). The factors studied were temperature, concentration of acid, pulp density and leaching time. Experimental conditions of terbium dissolution were optimized by statistical analysis. The results showed that temperature and pulp density were significant with a positive and negative effect, respectively. The empirical mathematical model deducted by experimental data demonstrated that terbium content was completely dissolved under the following conditions: 90 °C, 2 M hydrochloric acid and 5% of pulp density; while when the pulp density was 15% an extraction of 83% could be obtained at 90 °C and 5 M hydrochloric acid. Finally a flow sheet for the recovery of rare earth elements was proposed. The process was tested and simulated by commercial software for the chemical processes. The mass balance of the process was calculated: from 1 ton of initial powder it was possible to obtain around 160 kg of a concentrate of rare earths having a purity of 99%. The main rare earths elements in the final product was yttrium oxide (86.43%) following by cerium oxide (4.11%), lanthanum oxide (3.18%), europium oxide (3.08%) and terbium oxide (2.20%). The estimated total recovery of the rare earths elements was around 70% for yttrium and europium and 80% for the other rare earths. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Raman spectra of terbium trichloride, phosphorus pentachloride and their molten mixtures; Spektry kombinatsionnogo rasseyaniya sveta trikhlorida terbiya, pentakhlorida fosfora i ikh rasplavlennykh smesej

    Energy Technology Data Exchange (ETDEWEB)

    Salyulev, A B; Zakir' yanova, I D [UrO RAN, Inst. Vysokotemperaturnoj Ehlektrokhimii, Ekaterinburg (Russian Federation)

    2008-03-15

    Raman spectroscopy was used to study in situ the behavior of individual terbium trichloride and phosphorus pentachloride in different aggregative states as a function of temperature, and of solutions of PCl{sub 5} vapors in molten TbCl{sub 3}. A conclusion is drawn about their structure and the nature of phase transformations and chemical reactions in wide ranges of temperature and saturated vapor pressures.

  19. Determination of fluoroquinolone antibiotics by microchip capillary electrophoresis along with time-resolved sensitized luminescence of their terbium(III) complexes

    International Nuclear Information System (INIS)

    Sierra-Rodero, Marina; Fernández -Romero, Juan Manuel; Gómez -Hens, Agustina

    2014-01-01

    We report on the time-resolved detection of the three fluoroquinolone (FQs) antibiotics ciprofloxacin (CIP), enrofloxacin (ENR) and flumequine (FLU). On addition of terbium(III) ions, the terbium(III)-FQs chelates are formed in-situ in an on-capillary derivatization reaction of a microfluidic system. The laser-induced terbium(III)-sensitized luminescence of the chelates is measured at excitation/emission wavelengths of 337/545 nm. The analytes can be separated and quantified within less than 4 min. A solid phase extraction step for analyte preconcentration can be included prior to chelation and microchip capillary electrophoresis. The analytical ranges of the calibration graphs for CIP, ENR and FLU are from 10.6 to 60.0, 10.3 to 51.0, and 11.5 to 58.8 ng mL −1 , respectively, and the detection limits are 3.2, 3.1 and 3.6 ng mL −1 , respectively. The precision was established at two concentration levels of each analyte and revealed relative standard deviations in the range from 3.0 to 10.2 %. The method was applied to the analysis of FQ-spiked water samples. (author)

  20. Determination of trace amounts of rare earth elements in samarium, terbium and disprosium oxides by graphite furnace atomic-absorption spectrometry

    International Nuclear Information System (INIS)

    Dantas, E.S.K.

    1990-01-01

    A graphite furnace atomic-absorption spectrometry method for the determination of neodymium, europium, terbium, dysprosium and yttrium at trace level in samarium oxide; of samarium, europium, dysprosium, holmium, erbium and yttrium in terbium oxide and of europium, terbium, holmium, erbium and yttrium in dysprosium oxide was established. The best pyrolysis and atomization temperatures were determined for each lanthanide considered. Calibration curves were obtained for the pure elements, for binary mixtures formed by the matrix and each of the lanthanides studied and, finally, for the complex mixtures constituted by the matrix and all the other lanthanide of the group under scrutiny. This study has been carried out to examine the interference of the presence of one lanthanide on the behaviour of the other, since a lack of linearity on the calibration curves has been observed in some cases. Detection and determination limits have been determined as well. The detection limits encountered were within the range 0.002 to 0.3% for different elements. The precision of the method expressed as the relative standard deviation was calculated for each element present in each of the matrices studied. The conclusion arrived at is that the method can be applied for determining the above mentioned lanthanides present in the matrices studied with purity up to 99.50%. (author)

  1. Investigation of the luminescent properties of terbium-anthranilate complexes and application to the determination of anthranilic acid derivatives in aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Arnaud, N.; Georges, J

    2003-01-10

    The luminescent properties of terbium complexes with furosemide (FR), flufenamic (FF) acid, tolfenamic (TF) acid and mefenamic (MF) acid have been investigated in aqueous solutions. For all four compounds, complexation occurs when the carboxylic acid of the aminobenzoic group is dissociated and is greatly favoured in the presence of trioctylphosphine oxide as co-ligand and Triton X-100 as surfactant. Under optimum conditions, luminescence of the lanthanide ion is efficiently sensitised and the lifetime of the {sup 5}D{sub 4} resonance level of terbium in the complex is ranging between 1 and 1.9 ms, against 0.4 ms for the aqua ion. The sensitivity of the method for the determination of anthranilic acid derivatives is improved by one to two orders of magnitude with respect to that achieved using native fluorescence or terbium-sensitised luminescence in methanol. The limits of detection are 2x10{sup -10}, 5x10{sup -10} and 2x10{sup -9} mol l{sup -1} for flufenamic acid, furosemide and tolfenamic acid, and mefenamic acid, respectively, with within-run RSD values of less than 1%. The method has been applied to the determination of flufenamic acid in spiked calf sera with and without sample pretreatment. Depending on the method and the analyte concentration, the recovery was ranging between 83 and 113% and the lowest concentration attainable in serum samples was close to 1x10{sup -7} mol l{sup -1}.

  2. 17 CFR 1.67 - Notification of final disciplinary action involving financial harm to a customer.

    Science.gov (United States)

    2010-04-01

    ... disciplinary action involving financial harm to a customer. 1.67 Section 1.67 Commodity and Securities... Miscellaneous § 1.67 Notification of final disciplinary action involving financial harm to a customer. (a) Definitions. For purposes of this section: (1) Final disciplinary action means any decision by or settlement...

  3. 25 CFR 167.15 - Control of livestock disease and introduction of livestock.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Control of livestock disease and introduction of livestock. 167.15 Section 167.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER NAVAJO GRAZING REGULATIONS § 167.15 Control of livestock disease and introduction of livestock. (a) The...

  4. 33 CFR 167.1703 - In Prince William Sound: Valdez Arm Traffic Separation Scheme.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false In Prince William Sound: Valdez Arm Traffic Separation Scheme. 167.1703 Section 167.1703 Navigation and Navigable Waters COAST GUARD... Description of Traffic Separation Schemes and Precautionary Areas Pacific West Coast § 167.1703 In Prince...

  5. 33 CFR 167.1701 - In Prince William Sound: Precautionary areas.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false In Prince William Sound: Precautionary areas. 167.1701 Section 167.1701 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Traffic Separation Schemes and Precautionary Areas Pacific West Coast § 167.1701 In Prince William Sound...

  6. 26 CFR 1.167(b)-0 - Methods of computing depreciation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Methods of computing depreciation. 1.167(b)-0....167(b)-0 Methods of computing depreciation. (a) In general. Any reasonable and consistently applied method of computing depreciation may be used or continued in use under section 167. Regardless of the...

  7. 26 CFR 1.167(d)-1 - Agreement as to useful life and rates of depreciation.

    Science.gov (United States)

    2010-04-01

    ... depreciation. 1.167(d)-1 Section 1.167(d)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE... and Corporations § 1.167(d)-1 Agreement as to useful life and rates of depreciation. After August 16... respect to the estimated useful life, method and rate of depreciation and treatment of salvage of any...

  8. Triaxiality and the wobbling mode In 167Lu

    International Nuclear Information System (INIS)

    Amro, H.; Ma, W.C.; Winger, J.A.; Li, Y.; Thompson, J.; Hagemann, G.; Herskind, B.; Sletten, G.; Wilson, J.N.; Jensen, D.R.; Fallon, P.; Ward, D.; Diamond, R.M.; Goergen, A.; Machiavelli, A.; Huebel, H.; Domscheit, J.; Wiedenhoewer, I.

    2002-01-01

    High spin states in 167Lu nucleus were populated through the 123Sb(48Ca,xn) reaction at 203 MeV. Five presumably triaxial superdeformed (TSD) bands have been found. The electromagnetic properties of several connecting transitions between the yrast (TSD1) and the excited (TSD2) bands have been established. Evidence for the assignment of TSD2 band as a wobbling mode built on the yrast TSD band is presented. These bands coexist with bands built on quasiparticle excitations in normal deformed (ND) minimum for which new data are also presented

  9. A new luminescent terbium 4-methylsalicylate complex as a novel sensor for detecting the purity of methanol.

    Science.gov (United States)

    Zeng, Cheng-Hui; Yang, Yang-Yi; Zhu, Yi-Min; Wang, Hong-Ming; Chu, Tian-Shu; Ng, Seik Weng

    2012-01-01

    A new dinuclear terbium complex [Tb(2)(4-msal)(6)(H(2)O)(4)]·6H(2)O (1) (4-msal = 4-methylsalcylate) was synthesized. Its structure was determined by single crystal X-ray diffraction, and the complex was characterized by PXRD, FT-IR, fluorescence, TGA and DTA. Complex 1 exists as discrete molecules that are linked by extensive O-H … O hydrogen bonds into a 3D network. The luminescence lifetimes of 3 μM methanol solution and solid sample of 1 are 1.321 and 1.009 ms, respectively. The quantum yield of solid sample is 6.0%. The luminescence quenched more than 50% when 3% (vol/vol) different impurities (acetone, acetonitrile, chloroform, dichloromethane, dioxane, DMF, DMSO, ethanol, ether, ethyl acetate, glycol, H(2)O, hexane, TEA, THF and toluene or their mixture) were added. The inverse linear relationship between the Lg value of fluorescence intensity and the volume ratio of the minor component (to a maximum of 20%) is interpreted in terms of LgI = a-bX (I: luminescence intensity; X: volume ratio of impurities in methanol; a, b are constants). So 1 is a potential luminescent sensor for analyzing the purity of methanol. © 2012 Wiley Periodicals, Inc. Photochemistry and Photobiology © 2012 The American Society of Photobiology.

  10. Study of the role of complete fusion in the reaction of 48Ca and 56Fe with cerium and terbium

    International Nuclear Information System (INIS)

    Morrissey, D.J.

    1978-05-01

    48 Ca and 56 Fe beams from the Super HILAC accelerator were used to irradiate thick metal foils of cerium and terbium. Product gamma ray activities were detected offline and individual products were identified by half-life, gamma ray energy and gamma ray abundances. The production cross sections were iteratively fit to charge and mass dispersions to allow correction for parent decay and calculation of mass yields. From the mass yield curves contributions from quasielastic transfer, deep inelastic transfer and complete fusion reaction mechanisms were interred. Complete fusion was made up on contributions from both evaporation residue and fusion-fission products for the 48 Ca induced reactions. However, only fusion-fission products were detected in the 56 Fe induced reactions. Critical angular momenta for fusion were found to be 82 +- 8 h for 48 Ca + 159 Tb and 34 +- 5 h for 56 Fe + 140 Ce, which can be compared with 53 +- 8 h for 12 C + 197 Au (Natowitz, 1970) and 86 +- 5 h for 40 Ar + 165 Ho (Hanappe, 1973). All of these reactions lead to essentially the same compound nucleus and seem to show the dramatic decline in complete fusion for heavy ions larger than 40 Ar. The prediction of this decline was found to be beyond the model calculations of Bass and the critical distance approach of Glas and Mosel

  11. Terbium to Quantum Dot FRET Bioconjugates for Clinical Diagnostics: Influence of Human Plasma on Optical and Assembly Properties

    Directory of Open Access Journals (Sweden)

    Niko Hildebrandt

    2011-10-01

    Full Text Available Förster resonance energy transfer (FRET from luminescent terbium complexes (LTC as donors to semiconductor quantum dots (QDs as acceptors allows extraordinary large FRET efficiencies due to the long Förster distances afforded. Moreover, time-gated detection permits an efficient suppression of autofluorescent background leading to sub-picomolar detection limits even within multiplexed detection formats. These characteristics make FRET-systems with LTC and QDs excellent candidates for clinical diagnostics. So far, such proofs of principle for highly sensitive multiplexed biosensing have only been performed under optimized buffer conditions and interactions between real-life clinical media such as human serum or plasma and LTC-QD-FRET-systems have not yet been taken into account. Here we present an extensive spectroscopic analysis of absorption, excitation and emission spectra along with the luminescence decay times of both the single components as well as the assembled FRET-systems in TRIS-buffer, TRIS-buffer with 2% bovine serum albumin, and fresh human plasma. Moreover, we evaluated homogeneous LTC-QD FRET assays in QD conjugates assembled with either the well-known, specific biotin-streptavidin biological interaction or, alternatively, the metal-affinity coordination of histidine to zinc. In the case of conjugates assembled with biotin-streptavidin no significant interference with the optical and binding properties occurs whereas the histidine-zinc system appears to be affected by human plasma.

  12. Fluorometric determination of proteins using the terbium (III)-2-thenoyltrifluoroacetone-sodium dodecyl benzene sulfonate-protein system

    Energy Technology Data Exchange (ETDEWEB)

    Jia Zhen [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Department of Chemistry, Dezhou University, Dezhou 253023 (China); Yang Jinghe [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)]. E-mail: yjh@sdu.edu.cn; Wu Xia [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Wang Fei [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Guo Changying [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Liu Shufang [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)

    2006-12-15

    It is found that in hexamethylene tetramine (HMTA)-HCl buffer of pH=8.00, proteins can enhance the fluorescence of terbium (III) (Tb{sup 3+})-2-thenoyltrifluoroacetone (TTA)-sodium dodecyl benzene sulfonate (SDBS) system. Based on this, a sensitive method for the determination of proteins is proposed. The experiments indicate that under the optimum conditions, the enhanced fluorescence intensity is in proportion to the concentration of proteins in the range of 4.0x10{sup -9}-7.5x10{sup -6}g/mL for bovine serum albumin (BSA), 5.0x10{sup -9}-1.5x10{sup -5}g/mL for human serum albumin (HSA), 1.0x10{sup -8}-7.5x10{sup -6}g/mL for egg albumin (EA). Their detection limits (S/N=3) are 0.5, 0.8 and 2.0ng/mL, respectively. The interaction mechanism is also studied.

  13. Sparkle/PM3 for the modeling of europium(III), gadolinium(III), and terbium(III) complexes

    International Nuclear Information System (INIS)

    Freire, Ricardo O.; Rocha, Gerd B.; Simas, Alfredo M.

    2009-01-01

    The Sparkle/PM3 model is extended to europium(III), gadolinium(III), and terbium(III) complexes. The validation procedure was carried out using only high quality crystallographic structures, for a total of ninety-six Eu(III) complexes, seventy Gd(III) complexes, and forty-two Tb(III) complexes. The Sparkle/PM3 unsigned mean error, for all interatomic distances between the trivalent lanthanide ion and the ligand atoms of the first sphere of coordination, is: 0.080 A for Eu(III); 0.063 A for Gd(III); and 0.070 A for Tb(III). These figures are similar to the Sparkle/AM1 ones of 0.082 A, 0.061 A, and 0.068 A respectively, indicating they are all comparable parameterizations. Moreover, their accuracy is similar to what can be obtained by present-day ab initio effective core potential full geometry optimization calculations on such lanthanide complexes. Finally, we report a preliminary attempt to show that Sparkle/PM3 geometry predictions are reliable. For one of the Eu(III) complexes, BAFZEO, we created hundreds of different input geometries by randomly varying the distances and angles of the ligands to the central Eu(III) ion, which were all subsequently fully optimized. A significant trend was unveiled, indicating that more accurate local minima geometries cluster at lower total energies, thus reinforcing the validity of sparkle model calculations. (author)

  14. Study of quantum dot based on tin/yttrium mixed oxide doped with terbium to be used as biomarker

    International Nuclear Information System (INIS)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A.; Brito, Hermi F.; Nunes, Luiz Antonio O.

    2009-01-01

    Quantum dots (semiconductors nanocrystals) have brought a promising field to develop a new generation of luminescent biomarkers. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. These luminescent dots are functionalized with biomolecules. For the luminophore particle to be connect with biologicals molecules (for example covalent antibody) is necessary a previous chemical treatment to modify luminophore particle surface and this process is called functionalization. A prior chemical treatment with changes on the surface luminophore particle is necessary to couple the luminophore to biological molecules. This process can be used as coating which can protect these particles from being dissolved by acid as well as provide functional groups for biological conjugation. This work presents a photoluminescence study of nanoparticles based on tin/yttrium mixed oxides doped with terbium (SnO 2 /Y 2 O 3 :Tb 3+ ), synthesized by coprecipitation method. The nanoparticles were submitted to thermal treatment and characterized by X-Ray Powder Diffraction (XRD) that showed cassiterite phase formation and the influence of thermal treatment on nanoparticles structures. These nanoparticles going to be functionalized with a natural polysaccharide (chitosan) in order to form microspheres. These microspheres going to be irradiated with gamma radiation to sterilization and it can be evaluated if the nanoparticles are resistant to irradiation and they do not lose functionality with this process. (author)

  15. Development and Validation of A Spectrofluorimetric Determination of Calf Thymus DNA Using a Terbium-Danofloxacin Probe

    Directory of Open Access Journals (Sweden)

    Naser Soltani

    2016-03-01

    Full Text Available Background: Analysis of biomolecules is required in many biomedical research areas. A spectrofluorimetric method is proposed for determination of calf thymus DNA (ctDNA based on the fluorescence enhancement of terbium-danofloxacin (Tb3+-Dano in the presence of ctDNA. Methods: A probe with maximum excitation and emission wavelengths of 347 nm and 545 nm, respectively, was developed. The enhanced fluorescence intensity of Tb3+-Dano system was proportional to the concentration of ctDNA. The effective factors and the optimum conditions for the determination of ctDNA were studied. Under the optimum conditions of [Tris buffer]= 0.01 mol L-1 (pH 7.8, [ Tb3+]= 1×10-5 mol L-1 and [Dano]= 5×10-5 mol L-1, the maximum response was achieved. The developed method was evaluated in terms of accuracy, precision and limit of detection. Results: The linear concentration range for quantification of ctDNA was 36-3289 ng mL-1 and the detection limit (S/N=3 was 8 ng mL-1. The concentration of DNA extracted from Escherichia coli as an extracted sample was also determined using the developed probe. The concentration of DNA in extracted sample was determined using UV assay and developed method, the results were satisfactory. Conclusion: The proposed method is a simple, practical and relatively interference free method to follow up the concentrations of ctDNA.

  16. Evidence of mass exchange between inside and outside of sonoluminescing bubble in aqueous solution of terbium chloride

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Jinfu, E-mail: liang.shi2007@163.com [School of Physics and Electronic Science, Guizhou Normal University, Guiyang 550001 (China); Chen, Weizhong, E-mail: wzchen@nju.edu.cn [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China); Wang, Xun; Yang, Jing; Chen, Zhan [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China)

    2016-12-16

    Highlights: • Time-resolved spectra of SBSL were obtained for Tb{sup 3+} ions emission lines. • Mass exchange between inside and outside of SL bubble was probed via Tb{sup 3+} ions lines. • The argon rectification hypothesis was tested by time-resolved spectra of SBSL. • The rate of mass exchange inside an SBSL bubble increases with increasing sound pressure. - Abstract: Spectra of single-bubble sonoluminescence (SBSL) were obtained for Tb{sup 3+} ions emission lines from bubbles in an aqueous solution of terbium chloride (TbCl{sub 3}). The spectra provide experimental evidence to prove that an air bubble driven by strong ultrasound will not eventually become a rectified pure argon bubble, which is not as predicted by the argon rectification hypothesis. The time-resolved spectra of SBSL show a mass exchange of material such as Tb{sup 3+} ions between the inside and outside of the bubble. With increasing sound pressure, the rate of mass exchange and the SBSL intensity increases.

  17. Spectrofluorimetric determination of trace amount of coenzyme II using ciprofloxacin-terbium complex as a fluorescent probe

    International Nuclear Information System (INIS)

    Bian Weiwei; Wang Yusheng; Zhu Xiaojing; Jiang Chongqiu

    2006-01-01

    A new spectrofluorimetric method was developed for the determination of trace amount of nicotinamide adenine dinucleotide phosphate (NADP). Using terbium ion (Tb 3+ )-ciprofloxacin (CIP) complex as a fluorescent probe, in the buffer solution of pH=9.00, NADP can remarkably enhance the fluorescence intensity of the Tb 3+ -CIP complex at λ=545nm and the enhanced fluorescence intensity of Tb 3+ ion is in proportion to the concentration of NADP. Optimum conditions for the determination of NADP were also investigated. The dynamic range for the determination of NADP is 4.9x10 -7 -3.7x10 -6 molL -1 with detection limit of 1.3x10 -7 molL -1 . This method is simple, practical and relatively free interference from coexisting substances and can be successfully applied to determination of NADP in synthetic water samples. Moreover, the enhancement mechanisms of the fluorescence intensity in the Tb 3+ -CIP system and the Tb 3+ -CIP-NADP system have been also discussed

  18. Studies of binary cerium(IV)-praseodymium(IV) and cerium(IV)-terbium(IV) oxides as pigments for ceramic applications

    International Nuclear Information System (INIS)

    Furtado, L.M.L.

    1991-01-01

    It was investigated a series of pigments of general composition Ce 1-x Pr x O 2 , and Ce x Tb y O 2 , exhibiting radish and brown colors, respectively, and high temperature stability. The pigments were obtained by dissolving appropriate amounts of the pure lanthanide oxides in acids and precipitating the rare earths as mixed oxalates, which were isolated and calcined under air, at 1000 0 C. X-Ray powder diffractograms were consistent with a cubic structure for the pigments. Magnetic susceptibility measurements, using Gouy method, indicated the presence of Pr(IV) ions in the Ce 1-x Pr x O 2 pigments and of Terbium predominantly as Tb(III) ions in the Ce-tb mixed oxides. A new method, based on suspension of solid samples in PVA-STB gels (STB = sodium tetradecaborate), was employed for the measurements of the electronic spectra of the pigments. The thermal behaviour the pigments was investigated by the calcination of the oxalates in the temperature range of 500 to 1200 O C, from 10 to 60 minutes. (author)

  19. Effect of solvents on relation of intensities of bands of luminescence spectra of terbium and dysprosium ions in solutions of their complexes with acetoacetic ester

    International Nuclear Information System (INIS)

    Kononenko, L.I.; Bel'tyukova, S.V.; Meshkova, S.B.; Kravchenko, T.B.; Poluehktov, N.S.

    1978-01-01

    An investigation is made of the effect of different solvents on the ratio of the intensity of luminescence spectrum bands of terbium and dysprosium ions, corresponding and not corresponding to ''supersensitive'' transitions in complex compounds with acetoacetic ether. A dependence is established between these values and the dielectric constant of the solvent, and also parallels in their changes, which indicate the similar manifestation of the effect of solvents in both elements. A correlation is observed between ratios of the intensity of luminescence spectrum bands and values of forces of neodymium complex absorption band oscillators in different solvents

  20. 26 CFR 1.167(l)-4 - Public utility property; election to use asset depreciation range system.

    Science.gov (United States)

    2010-04-01

    ... depreciation range system. 1.167(l)-4 Section 1.167(l)-4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... Individuals and Corporations § 1.167(l)-4 Public utility property; election to use asset depreciation range system. (a) Application of section 167(l) to certain property subject to asset depreciation range system...

  1. Affinity of /sup 167/Tm-citrate for tumor and liver tissue

    Energy Technology Data Exchange (ETDEWEB)

    Ando, A; Ando, I; Hiraki, T; Sakamoto, K; Hisada, K; Takeshita, M

    1983-10-07

    Strong affinity of /sup 167/Tm-citrate for tumor tissue was reconfirmed by using Ehrlich tumor. Excellent tumor imaging was obtained with /sup 167/Tm-citrate because of its strong tumor affinity and because of the suitable physical characteristics of /sup 167/Tm. A large amount of /sup 167/Tm had accumulated in the connective tissue which contained inflammatory tissue, quite large amounts were found in areas containing viable and necrotic tumor tissue, and small amounts were present in viable tumor tissue. /sup 167/Tm was not seen in necrotic tumor tissue. It was concluded that lysosomes did not play a major role in the tumor concentration of /sup 167/Tm, but played an important role in the liver concentration of this nuclide. In the case of hepatoma AH109A, it was presumed that lysosomes played a considerably important role in the tumor concentration of /sup 167/Tm, hepatoma AH109A possessing some residual features of the liver. /sup 167/Tm was bound to acid mucopolysaccharides and transposed by the acid mucopolysaccharides in the tumor tissues and liver. The acid mucopolysaccharides to which /sup 167/Tm were bound in tumor and liver, were heparan sulfate, chondroitin sulfate (or keratosulfate) and heparin (or keratosulfate).

  2. Affinity of 167Tm-citrate for tumor and liver tissue

    International Nuclear Information System (INIS)

    Ando, A.; Ando, I.; Hiraki, T.

    1983-01-01

    Strong affinity of 167 Tm-citrate for tumor tissue was reconfirmed by using Ehrlich tumor. Excellent tumor imaging was obtained with 167 Tm-citrate because of its strong tumor affinity and because of the suitable physical characteristics of 167 Tm. A large amount of 167 Tm had accumulated in the connective tissue which contained inflammatory tissue, quite large amounts were found in areas containing viable and necrotic tumor tissue, and small amounts were present in viable tumor tissue. 167 Tm was not seen in necrotic tumor tissue. It was concluded that lysosomes did not play a major role in the tumor concentration of 167 Tm, but played an important role in the liver concentration of this nuclide. In the case of hepatoma AH109A, it was presumed that lysosomes played a considerably important role in the tumor concentration of 167 Tm, hepatoma AH109A possessing some residual features of the liver. 167 Tm was bound to acid mucopolysaccharides and transposed by the acid mucopolysaccharides in the tumor tissues and liver. The acid mucopolysaccharides to which 167 Tm were bound in tumor and liver, were heparan sulfate, chondroitin sulfate (or keratosulfate) and heparin (or keratosulfate). (orig.)

  3. Health survey of 167 pet rabbits (Oryctolagus cuniculus) in Finland.

    Science.gov (United States)

    Mäkitaipale, J; Harcourt-Brown, F M; Laitinen-Vapaavuori, O

    2015-10-24

    Only a limited amount of information is available about health status of pet rabbits. The aim of this study was to obtain data about the health status of pet rabbits considered healthy by the owners in Finland. Physical examination and lateral abdominal and lateral skull radiography were performed on 167 pet rabbits of which 118 (70.7 per cent) had abnormal findings in at least one examination. The most common findings were acquired dental disease (n=67, 40.1 per cent), vertebral column deformities and degenerative lesions (n=52, 31.1 per cent), skin disorders (n=28, 16.8 per cent) and eye disorders (n=12, 7.2 per cent). Vertebral column angulating deformities were significantly more common in dwarf lop rabbits (P≤0.001). The prevalence of health disorders was significantly higher in rabbits over three years of age of which 51 (82.3 per cent) had findings in at least one examination (Phealth problems. Because of the high prevalence of clinical and radiological findings in apparently healthy pet rabbits, regular physical examinations are advised, especially for animals over three years old. British Veterinary Association.

  4. Gamma spectrum following neutron capture in {sup 167}Er

    Energy Technology Data Exchange (ETDEWEB)

    Visser, D.; Khoo, T.L.; Lister, C.J. [and others

    1995-08-01

    Statistical decay from a highly excited state samples all the lower-lying states and, hence, provides a sensitive measure of the level density. Pairing has a major impact on the level density, e.g. creating a pair gap between the 0- and 2-quasiparticle configurations. Hence the shape of the statistical spectrum contains information on pairing, and can be used to provide information on the reduction of pairing with thermal excitation energy. For this reason, we measured the complete spectrum of {gamma}rays following thermal neutron capture in {sup 167}Er. The experiment was performed at the Brookhaven reactor using Compton-suppressed Ge detectors from TESSA. The spectrum, which was corrected for detector response and efficiency, reveals primary (first-step, high-energy) transitions up to nearly 8 MeV, secondary (last-step, lower-energy) transitions, as we as a continuous statistical component. Effort was expanded to identify all lines from contaminant sources and an upper limit of 5% was tentatively set for their contributions. The spectral shape of the statistical spectrum will be compared with theoretical spectra obtained from a calculation of pairing which accounts for a stepwise reduction of the pair correlations as the number of quasiparticles increases. The primary lines which decay directly to the near-yrast states will also be used to deduce the level densities.

  5. Compact all-fiber optical Faraday components using 65-wt%-terbium-doped fiber with a record Verdet constant of -32 rad/(Tm).

    Science.gov (United States)

    Sun, L; Jiang, S; Marciante, J R

    2010-06-07

    A compact all-fiber Faraday isolator and a Faraday mirror are demonstrated. At the core of each of these components is an all-fiber Faraday rotator made of a 4-cm-long, 65-wt%-terbium-doped silicate fiber. The effective Verdet constant of the terbium-doped fiber is measured to be -32 rad/(Tm), which is 27 x larger than that of silica fiber. This effective Verdet constant is the largest value measured to date in any fiber and is 83% of the Verdet constant of commercially available crystal used in bulk optics-based isolators. Combining the all-fiber Faraday rotator with fiber polarizers results in a fully fusion spliced all-fiber isolator whose isolation is measured to be 19 dB. Combining the all-fiber Faraday rotator with a fiber Bragg grating results in an all-fiber Faraday mirror that rotates the polarization state of the reflected light by 88 +/- 4 degrees .

  6. 46 CFR 167.55-1 - Draft marks and draft indicating systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Draft marks and draft indicating systems. 167.55-1... NAUTICAL SCHOOL SHIPS Special Markings Required § 167.55-1 Draft marks and draft indicating systems. (a... aft to the location of the draft marks, due to a raked stem or cut away skeg, the draft must be...

  7. 46 CFR 167.25-1 - Boilers, pressure vessels, piping and appurtenances.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Boilers, pressure vessels, piping and appurtenances. 167... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Marine Engineering § 167.25-1 Boilers, pressure vessels, piping and... the following standards for boilers, pressure vessels, piping and appurtenances: (1) Marine...

  8. 46 CFR 167.15-27 - Definitions relating to hull examinations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Definitions relating to hull examinations. 167.15-27... PUBLIC NAUTICAL SCHOOL SHIPS Inspections § 167.15-27 Definitions relating to hull examinations. As used... slipway for an examination of all accessible parts of the vessel's underwater body and all through-hull...

  9. 33 CFR 167.405 - Off San Francisco: Main ship channel.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Off San Francisco: Main ship channel. 167.405 Section 167.405 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY OFFSHORE TRAFFIC SEPARATION SCHEMES Description of Traffic Separation Schemes and Precautionary Areas...

  10. 46 CFR 167.05-30 - Officer in Charge, Marine Inspection.

    Science.gov (United States)

    2010-10-01

    ... NAUTICAL SCHOOL SHIPS Definitions § 167.05-30 Officer in Charge, Marine Inspection. This term means any... 46 Shipping 7 2010-10-01 2010-10-01 false Officer in Charge, Marine Inspection. 167.05-30 Section... inspection zone for the performance of duties with respect to the inspections, enforcement, and...

  11. 46 CFR 167.15-20 - Inspections of nautical school ships.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Inspections of nautical school ships. 167.15-20 Section... NAUTICAL SCHOOL SHIPS Inspections § 167.15-20 Inspections of nautical school ships. (a) At each annual inspection, or oftener if deemed necessary, the inspector will inspect the hull, boilers, machinery...

  12. 46 CFR 167.60-10 - Exhibition of certificate of inspection.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC NAUTICAL SCHOOL SHIPS Certificates of Inspection § 167.60-10 Exhibition of certificate of inspection. On every nautical school ship, the original certificate of inspection shall be framed under glass... 46 Shipping 7 2010-10-01 2010-10-01 false Exhibition of certificate of inspection. 167.60-10...

  13. 46 CFR 167.65-60 - Examination of boilers and machinery by engineer.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Examination of boilers and machinery by engineer. 167.65-60 Section 167.65-60 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL... machinery by engineer. It shall be the duty of an engineer when he assumes charge of the boilers and...

  14. 33 CFR 167.1702 - In Prince William Sound: Prince William Sound Traffic Separation Scheme.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false In Prince William Sound: Prince William Sound Traffic Separation Scheme. 167.1702 Section 167.1702 Navigation and Navigable Waters COAST....1702 In Prince William Sound: Prince William Sound Traffic Separation Scheme. The Prince William Sound...

  15. 46 CFR 167.20-17 - Bilge pumps, bilge piping and sounding arrangements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Bilge pumps, bilge piping and sounding arrangements. 167... Ships § 167.20-17 Bilge pumps, bilge piping and sounding arrangements. The number, capacity, and arrangement of bilge pumps and bilge piping shall be in accordance with the requirements for cargo vessels...

  16. 26 CFR 1.167(a)-14 - Treatment of certain intangible property excluded from section 197.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Treatment of certain intangible property... for Individuals and Corporations § 1.167(a)-14 Treatment of certain intangible property excluded from...) for rules relating to changes in method of accounting for property to which § 1.167(a)-14 applies...

  17. 26 CFR 1.167(a)-10 - When depreciation deduction is allowable.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false When depreciation deduction is allowable. 1.167... Corporations § 1.167(a)-10 When depreciation deduction is allowable. (a) A taxpayer should deduct the proper depreciation allowance each year and may not increase his depreciation allowances in later years by reason of...

  18. 46 CFR 167.45-30 - Use of approved fire-fighting equipment.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC NAUTICAL SCHOOL SHIPS Special Firefighting and Fire Prevention Requirements § 167.45-30 Use of approved fire-fighting equipment. Portable fire extinguishers or fire-extinguishing systems which conform... 46 Shipping 7 2010-10-01 2010-10-01 false Use of approved fire-fighting equipment. 167.45-30...

  19. Measurement of 167Er(n,p)167Ho reaction at 13.5 and 14.8 MeV

    International Nuclear Information System (INIS)

    Luo, Junhua; Liu, Jun; Han, Jiuning; Jiang, Li; Liu, Rong; Ge, Suhong; Liu, Zhenlai

    2013-01-01

    We have measured the 167 Er(n,p) 167 Ho cross-sections at two different neutron energies 13.5 and 14.8 MeV. Measurements were performed at Pd-300 neutron generator of Chinese Academy of Engineering Physics (CAEP) with monoenergetic neutrons produced via the 3 H(d,n) 4 He reaction using a tritium–titanium (T–Ti) target. Induced gamma activities were measured by a high-resolution gamma-ray spectrometer with high-purity germanium (HPGe) detector. The data for 167 Er(n,p) 167 Ho reaction cross-sections are reported to be 2.2±0.6 and 2.8±1.4 mb at 13.5±0.2 and 14.8±0.2 MeV incident neutron energies, respectively. The cross sections were also estimated with the TALYS-1.4 nuclear model code and compared with experimental data found in the literature, and with the comprehensive evaluation data in ENDF/B-VII.1 and JEFF-3.1/A libraries. - Highlights: • D–T neutron source was used to measure cross sections using activation method. • 27 Al(n,α) 24 Na was used as the monitor for the measurement. • The cross sections for the 167 Er(n,p) 167 Ho reactions have been measured. • Contribution of the interfering reaction 170 Er(n,α) 167 Dy was subtracted. • The results were compared with previous data and with evaluation data

  20. Physico-chemical characterization of terbium-161-chloride (161TbCl3) radioisotope from irradiated natural gadolinium oxide target

    International Nuclear Information System (INIS)

    Azmairit Aziz; Nana Suherman

    2015-01-01

    Currently cancer patients are increasing every year in Indonesia and become the third leading cause of death after heart disease and high blood pressure. Terbium-161 ( 161 Tb) is a low β- emitter (E β - = 0.155 MeV, T 1/2 = 6.9 d) and very similar to 177 Lu in terms of half-life, E β - energy and chemical properties.However, 161 Tb also ejects internal conversion electrons and Auger electrons which can provide a greater therapeutic effect than 177 Lu. Radioisotope of 161 Tb can be produced as a carrier-free for use in labeling of biomolecules as a targeted radiopharmaceutical for cancer therapy. 161 Tb was obtained through 160 Gd(n,γ) 161 Tb nuclear reaction by thermal neutron bombardment on 100 mg of natural gadolinium oxide target in RSG-G.A. Siwabessy at a thermal neutron flux of ~10 14 n.cm -2 .s -1 and followed by radiochemical separation of 161 Tb from Gd isotopes using extraction chromatography method. The physico-chemical characterization of 161 TbCl 3 solution was studied by determination of its radionuclide purity by means of a γ-rays spectrometry with HP-Ge detector coupled to a multichannel analyzer (MCA). Radiochemical purity was determined using paper chromatography and paper electrophoresis methods. The results showed that 161 TbCl 3 radioisotope has a pH of 2, radiochemical purity of 99.64 ± 0.34%, radionuclide purity of 99.69 ± 0.20%, specific activity and radioactive concentration at the end of irradiation (EOI) of 2.26 – 5.31 Ci/mg and 3.84 – 9.03 mCi/mL, respectively. 161 TbCl 3 solution stable for 3 weeks at room temperature with a radiochemical purity of 98.41 ± 0.42%. 161 TbCl 3 solution from irradiated natural gadolinium oxide target has the physico-chemical characteristic that meets the requirements for use as a precursor in preparation of radiopharmaceuticals. (author)

  1. Crystal structures of two mononuclear complexes of terbium(III nitrate with the tripodal alcohol 1,1,1-tris(hydroxymethylpropane

    Directory of Open Access Journals (Sweden)

    Thaiane Gregório

    2017-02-01

    Full Text Available Two new mononuclear cationic complexes in which the TbIII ion is bis-chelated by the tripodal alcohol 1,1,1-tris(hydroxymethylpropane (H3LEt, C6H14O3 were prepared from Tb(NO33·5H2O and had their crystal and molecular structures solved by single-crystal X-ray diffraction analysis after data collection at 100 K. Both products were isolated in reasonable yields from the same reaction mixture by using different crystallization conditions. The higher-symmetry complex dinitratobis[1,1,1-tris(hydroxymethylpropane]terbium(III nitrate dimethoxyethane hemisolvate, [Tb(NO32(H3LEt2]NO3·0.5C4H10O2, 1, in which the lanthanide ion is 10-coordinate and adopts an s-bicapped square-antiprismatic coordination geometry, contains two bidentate nitrate ions bound to the metal atom; another nitrate ion functions as a counter-ion and a half-molecule of dimethoxyethane (completed by a crystallographic twofold rotation axis is also present. In product aquanitratobis[1,1,1-tris(hydroxymethylpropane]terbium(III dinitrate, [Tb(NO3(H3LEt2(H2O](NO32, 2, one bidentate nitrate ion and one water molecule are bound to the nine-coordinate terbium(III centre, while two free nitrate ions contribute to charge balance outside the tricapped trigonal-prismatic coordination polyhedron. No free water molecule was found in either of the crystal structures and, only in the case of 1, dimethoxyethane acts as a crystallizing solvent. In both molecular structures, the two tripodal ligands are bent to one side of the coordination sphere, leaving room for the anionic and water ligands. In complex 2, the methyl group of one of the H3LEt ligands is disordered over two alternative orientations. Strong hydrogen bonds, both intra- and intermolecular, are found in the crystal structures due to the number of different donor and acceptor groups present.

  2. Study for the determination of samarium, europium,terbium, dysprosium and yttrium in gadolinium oxide matrix by means of atomic absorption spectrophotometry using a graphite furnace

    International Nuclear Information System (INIS)

    Caires, A.C.F.

    1985-01-01

    A study for determination of samarium, europium, terbium, dysprosium and yttrium in a gadolinium oxide matrix by atomic absorption spectrophotometry using a graphite furnace is presented. The best charrring and atomization conditions were estabilished for each element, the most convenient ressonance lines being selected as well. The study was carried out for the mentioned lanthanides both when pure and when in binary mixtures with gadolinium, besides those where all for them were together with gadolinium. The determination limits for pure lanthanides were found to be between 1.3 and 9.6 ng assuming a 20% relative standard deviation as acceptable. The detection limits were in the range 0.51 and 7.5 ng, assuming as positive any answer higher than twofold the standard deviation. (author) [pt

  3. Synthesis and characterization of bright green terbium coordination complex derived from 1,4-bis(carbonylmethyl)terephthalate: Structure and luminescence properties

    Science.gov (United States)

    Ma, Mengjiao; Li, Congcong; Shu, Dengkun; Wang, Chaohua; Xi, Peng

    2018-02-01

    A photoluminescent terbium (Tb) complex involving a novel benzoic-acid compound with a unique coordinated structure, namely 1,4-bis(carbonylmethyl)terephthalate (BCMT), has been designed and synthesized. The new coordinate structure and energy-transfer mechanism between the ligand and Tb(III) ions were investigated in detail. The results demonstrated that the BCMT-Tb(III) complex shows strong fluorescence intensity (4 × 106 a.u.) and long fluorescence lifetime (1.302 ms), owing to the favorable degree of energy matching between the triplet excited level of the ligand and the resonant level of Tb(III) ions. Based on the analysis of three-dimensional luminescence spectra, the as-prepared Tb(III) complex can be effectively excited in the range of 250-310 nm, and it shows high color purity, with a bright green appearance.

  4. High power single-frequency and frequency-doubled laser with active compensation for the thermal lens effect of terbium gallium garnet crystal.

    Science.gov (United States)

    Yin, Qiwei; Lu, Huadong; Su, Jing; Peng, Kunchi

    2016-05-01

    The thermal lens effect of terbium gallium garnet (TGG) crystal in a high power single-frequency laser severely limits the output power and the beam quality of the laser. By inserting a potassium dideuterium phosphate (DKDP) slice with negative thermo-optical coefficient into the laser resonator, the harmful influence of the thermal lens effect of the TGG crystal can be effectively mitigated. Using this method, the stable range of the laser is broadened, the bistability phenomenon of the laser during the process of changing the pump power is completely eliminated, the highest output power of an all-solid-state continuous-wave intracavity-frequency-doubling single-frequency laser at 532 nm is enhanced to 30.2 W, and the beam quality of the laser is significantly improved.

  5. 46 CFR 167.60-15 - Manning and persons allowed to be carried.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC NAUTICAL SCHOOL SHIPS Certificates of Inspection § 167.60-15 Manning and persons allowed to be carried. The Officer in Charge, Marine Inspection, shall specify in the Certificate of Inspection the...

  6. Study of the nucleotide binding site of the yeast Schizosaccharomyces pombe plasma membrane H+-ATPase using formycin triphosphate-terbium complex

    International Nuclear Information System (INIS)

    Ronjat, M.; Lacapere, J.J.; Dufour, J.P.; Dupont, Y.

    1987-01-01

    The plasma membrane of yeasts contains an H+-ATPase similar to the other cation transport ATPases of eukaryotic organisms. This enzyme has been purified and shows H+ transport in reconstituted vesicles. In the presence of Mg2+, formycin triphosphate (FTP) is hydrolyzed by the H+-ATPase and supports H+ transport. When combined with terbium ion, FTP (Tb-FTP) and ATP (Tb-ATP) are no longer hydrolyzed. Competition between Mg-ATP and Tb-FTP for ATP hydrolysis indicates that terbium-associated nucleotides bind to the catalytic site of the H+-ATPase. The fluorescent properties of the Tb-FTP complex were used to study the active site of the H+-ATPase. Fluorescence of Tb-FTP is greatly enhanced upon binding into the nucleotide site of H+-ATPase with a dissociation constant of 1 microM. Tb-ATP, Tb-ADP, and Tb-ITP are competitive inhibitors of Tb-FTP binding with Ki = 4.5, 5.0, and 6.0 microM, respectively. Binding of Tb-FTP is observed only in the presence of an excess of Tb3+ with an activation constant Ka = 25 microM for Tb3+. Analysis of the data reveals that the sites for Tb-FTP and Tb3+ binding are independent entities. In standard conditions these sites would be occupied by Mg-ATP and Mg2+, respectively. These findings suggest an important regulatory role of divalent cations on the activity of H+-ATPase. Replacement of H 2 O by D 2 O in the medium suggests the existence of two types of nucleotide binding sites differing by the hydration state of the Tb3+ ion in the bound Tb-FTP complex

  7. Terbium(III)/gold nanocluster conjugates: the development of a novel ratiometric fluorescent probe for mercury(II) and a paper-based visual sensor.

    Science.gov (United States)

    Qi, Yan-Xia; Zhang, Min; Zhu, Anwei; Shi, Guoyue

    2015-08-21

    In this work, a novel ratiometric fluorescent probe was developed for rapid, highly accurate, sensitive and selective detection of mercury(II) (Hg(2+)) based on terbium(III)/gold nanocluster conjugates (Tb(3+)/BSA-AuNCs), in which bovine serum albumin capped gold nanoclusters (BSA-AuNCs) acted as the signal indicator and terbium(III) (Tb(3+)) was used as the build-in reference. Our proposed ratiometric fluorescent probe exhibited unique specificity toward Hg(2+) against other common environmentally and biologically important metal ions, and had high accuracy and sensitivity with a low detection limit of 1 nM. In addition, our proposed probe was effectively employed to detect Hg(2+) in the biological samples from the artificial Hg(2+)-infected rats. More significantly, an appealing paper-based visual sensor for Hg(2+) was designed by using filter paper embedded with Tb(3+)/BSA-AuNC conjugates, and we have further demonstrated its feasibility for facile fluorescent sensing of Hg(2+) in a visual format, in which only a handheld UV lamp is used. In the presence of Hg(2+), the paper-based visual sensor, illuminated by a handheld UV lamp, would undergo a distinct fluorescence color change from red to green, which can be readily observed with naked eyes even in trace Hg(2+) concentrations. The Tb(3+)/BSA-AuNC-derived paper-based visual sensor is cost-effective, portable, disposable and easy-to-use. This work unveiled a facile approach for accurate, sensitive and selective measuring of Hg(2+) with self-calibration.

  8. File list: InP.CeL.05.AllAg.Kc167 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available InP.CeL.05.AllAg.Kc167 dm3 Input control Cell line Kc167 SRX749056,SRX365698,SRX511...SRX1056719,SRX495296 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/assembled/InP.CeL.05.AllAg.Kc167.bed ...

  9. 26 CFR 1.167(f)-1 - Reduction of salvage value taken into account for certain personal property.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Reduction of salvage value taken into account for certain personal property. 1.167(f)-1 Section 1.167(f)-1 Internal Revenue INTERNAL REVENUE SERVICE... for Individuals and Corporations § 1.167(f)-1 Reduction of salvage value taken into account for...

  10. 26 CFR 1.167(c)-1 - Limitations on methods of computing depreciation under section 167(b) (2), (3), and (4).

    Science.gov (United States)

    2010-04-01

    ... use of the declining balance method described in section 167(b)(2), the sum of the years-digits method... applicable only to tangible property having a useful life of three years or more. If construction... as constructed, reconstructed, or erected by the taxpayer if the work is done for him in accordance...

  11. Whole-body retention studies of /sup 167/Tm--citrate. Estimation of radiation dose to humans from /sup 167/Tm--citrate

    Energy Technology Data Exchange (ETDEWEB)

    Hiraki, T; Ando, A [Kanazawa Univ. (Japan). School of Paramedicine; Mori, H; Ando, I; Sakamoto, K

    1978-02-01

    For the purpose of calculating absorbed dose to humans from /sup 167/Tm-citrate, the whole-body retention studies using 5 rats were carried out. Up to 40 days following intravenous injection of /sup 167/Tm-citrate, the whole-body counts were monitored with an animal counter. The whole-body retention curve was obtained with three exponential components. Namely, the 26% of the injected /sup 167/Tm-citrate had a biological half-time of 3.4 hours, 12.5% had a biological half-time of 99 hours and 61.5% had a biological half-time of 106 days. These results indicate, that three components consist of the rapid clearance from the kidneys, the retention in the liver and other soft tissues with relatively long half-time and the retention in the bones with long half-time. Based on these biological data and the MIRD Committee method, the average dose estimates to the bone and whole-body from intravenous administration of 1 mCi /sup 167/Tm-citrate were 7.08 rads and 1.28 rads, respectively.

  12. Magnon Interactions in Terbium

    DEFF Research Database (Denmark)

    Nielsen, Mourits; Bjerrum Møller, Hans; Mackintosh, Allan

    1970-01-01

    Magnon energies and lifetimes have been studied in Tb and Tb-10% Ho single crystals by inelastic neutron scattering. The lifetimes of magnons propagating in the c-direction have been measured in the ferromagnetic phase of Tb, and are found to decrease with increasing temperature and wave......-vector, probably principally due to magnon-magnon interactions. The interaction of magnons with phonons has also been observed and the effect of Ho impurities on this interaction studied. In addition, excitations which are ascribed to local modes associated with the Ho ions have been observed. The dependence...... of the indirect exchange interaction on temperature in the alloy gives information on the mechanisms responsible for the transition from the helical to ferromagnetic structures. The dependence of the magnon energies on magnetic field at low temperatures gives detailed information on the role of magnetoelastic...

  13. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden; Bjerrum Møller, Hans

    1975-01-01

    with the symmetry, we deduce the dispersion relation for the spin waves in a basal-plane ferromagnet. This phenomenological spin-wave theory accounts for the observed behavior of the magnon energies in Tb. The two q⃗-dependent Bogoliubov components of the magnon energies are derived from the experimental results......, which are corrected for the effect of the direct coupling between the magnons and the phonons, and for the field dependence of the relative magnetization at finite temperatures. A large q⃗-dependent difference between the two energy components is observed, showing that the anisotropy of the two...

  14. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden

    1975-01-01

    The selection rules for the linear couplings between magnons and phonons propagating in the c direction of a simple basal-plane hcp ferromagnet are determined by general symmetry considerations. The acoustic-optical magnon-phonon interactions observed in the heavy-rare-earth metals have been...... explained by Liu as originating from the mixing of the spin states of the conduction electrons due to the spin-orbit coupling. We find that this coupling mechanism introduces interactions which violate the selection rules for a simple ferromagnet. The interactions between the magnons and phonons propagating...... in the c direction of Tb have been studied experimentally by means of inelastic neutron scattering. The magnons are coupled to both the acoustic- and optical-transverse phonons. By studying the behavior of the acoustic-optical coupling, we conclude that it is a spin-mixed-induced coupling as proposed...

  15. Endothelin-1 stimulates catalase activity through the PKCδ mediated phosphorylation of Serine 167

    Science.gov (United States)

    Rafikov, Ruslan; Kumar, Sanjiv; Aggarwal, Saurabh; Hou, Yali; Kangath, Archana; Pardo, Daniel; Fineman, Jeffrey R.; Black, Stephen M.

    2013-01-01

    Our previous studies have shown that endothelin-1 (ET-1) stimulates catalase activity in endothelial cells and lambs with acute increases in pulmonary blood flow (PBF), without altering gene expression. The purpose of this study was to investigate the molecular mechanism by which this occurs. Exposing pulmonary arterial endothelial cells (PAEC) to ET-1 increased catalase activity and decreased cellular hydrogen peroxide (H2O2) levels. These changes correlated with an increase in serine phosphorylated catalase. Using the inhibitory peptide δV1.1, this phosphorylation was shown to be PKCδ dependent. Mass spectrometry identified serine167 as the phosphorylation site. Site-directed mutagenesis was used to generate a phospho-mimic (S167D) catalase. Activity assays using recombinant protein purified from E.coli or transiently transfected COS-7 cells, demonstrated that S167D-catalase had an increased ability to degrade H2O2 compared to the wildtype enzyme. Using a phospho-specific antibody, we were able to verify that pS167 catalase levels are modulated in lambs with acute increases in PBF in the presence and absence of the ET receptor antagonist, tezosentan. S167 is being located on the dimeric interface suggesting it could be involved in regulating the formation of catalase tetramers. To evaluate this possibility we utilized analytical gel-filtration to examine the multimeric structure of recombinant wildtype- and S167D-catalase. We found that recombinant wildtype catalase was present as a mixture of monomers and dimers while S167D catalase was primarily tetrameric. Further, the incubation of wildtype catalase with PKCδ was sufficient to convert wildtype catalase into a tetrameric structure. In conclusion, this is the first report indicating that the phosphorylation of catalase regulates its multimeric structure and activity. PMID:24211614

  16. Measurement of the 169Tm (n ,3 n ) 167Tm cross section and the associated branching ratios in the decay of 167Tm

    Science.gov (United States)

    Champine, B.; Gooden, M. E.; Krishichayan, Norman, E. B.; Scielzo, N. D.; Stoyer, M. A.; Thomas, K. J.; Tonchev, A. P.; Tornow, W.; Wang, B. S.

    2016-01-01

    The cross section for the 169Tm(n ,3 n ) 167Tm reaction was measured from 17 to 22 MeV using quasimonoenergetic neutrons produced by the 2H(d ,n ) 3He reaction. This energy range was studied to resolve the discrepancy between previous (n ,3 n ) cross-section measurements. In addition, the absolute γ -ray branching ratios following the electron-capture decay of 167Tm were measured. These results provide more reliable nuclear data for an important diagnostic that is used at the National Ignition Facility to estimate the yield of reaction-in-flight neutrons produced via the inertial-confinement-fusion plasma in deuterium-tritium capsules.

  17. Cross-Section Measurement of the 169Tm(n,3n)167Tm Reaction and Constraining the Branching Ratio of 167Tm

    Science.gov (United States)

    Champine, Brian; Gooden, Matthew; Thomas, Keenan; Krishichayan, F.; Norman, Eric; Scielzo, Nick; Tonchev, Anton; Tornow, Werner

    2015-10-01

    The cross section of the 169Tm(n,3n)167Tm reaction has been measured from 17.5 to 21.5 MeV using activation technique. This energy region was chosen to resolve the two different trends of the previous (n,3n) cross section measurements on 169Tm. In addition, the branching ratio of the 207.8 keV γ-ray line stemming from electron capture of 167Tm was measured to be 0.419(16). The result of these measurements provide more accurate diagnostic estimation of the so called reaction-in-flight neutrons produced via the internal confinement fusion plasma in deuterium-tritium capsules at the National Ignition Facility.

  18. Transit Recovery of Kepler-167e: Providing JWST with an Unprecedented Jupiter-analog Exoplanet Target

    Science.gov (United States)

    Dalba, Paul; Muirhead, Philip; Tamburo, Patrick

    2018-05-01

    The Kepler Mission has uncovered a handful of long-period transiting exoplanets that orbit in the cold outer reaches of their systems, despite their low transit probabilities. Recent work suggests that cold gas giant exoplanet atmospheres are amenable to transmission spectroscopy (the analysis of the transit depth versus wavelength) enabling novel tests of planetary formation and evolution theories. Of particular scientific interest is Kepler-167e, a low-eccentricity Jupiter-analog exoplanet with a 1,071-day orbital period residing well beyond the snow-line. Transmission spectroscopy of Kepler-167e from JWST can reveal the composition of this planet's atmosphere, constrain its heavy-element abundance, and identify atmospheric photochemical processes. JWST characterization also enables unprecedented direct comparison with Jupiter and Saturn, which show a striking diversity in physical properties that is best investigated through comparative exoplanetology. Since Kepler only observed two transits of Kepler-167e, it is not known if this exoplanet exhibits transit timing variations (TTVs). About half of Kepler's long-period exoplanets have TTVs of up to 40 hours. Such a large uncertainty jeopardizes attempts to characterize the atmosphere of this unique Jovian exoplanet with JWST. To mitigate this risk, the upcoming third transit of Kepler-167e must be observed to test for TTVs. We propose a simple 10-hour, single-channel observation to capture ingress or egress of the next transit of Kepler-167e in December 2018. In the absence of TTVs, our observation will reduce the ephemeris uncertainty from an unknown value to approximately 3 minutes, thereby removing the risk in future transit observations with JWST. The excellent photometric precision of Spitzer is sufficient to identify the transit of Kepler-167e. Given the timing and nature of this program, Spitzer is the only observatory--on the ground or in space--that can make this pivotal observation.

  19. Association of the FAM167A-BLK region with systemic sclerosis.

    Science.gov (United States)

    Ito, Ikue; Kawaguchi, Yasushi; Kawasaki, Aya; Hasegawa, Minoru; Ohashi, Jun; Kawamoto, Manabu; Fujimoto, Manabu; Takehara, Kazuhiko; Sato, Shinichi; Hara, Masako; Tsuchiya, Naoyuki

    2010-03-01

    An association of single-nucleotide polymorphisms (SNPs) in the FAM167A (previously referred to as C8orf13)-BLK region with systemic lupus erythematosus (SLE) has been demonstrated in Caucasians and in Asians. Recent studies have shown that many genes, including IRF5, STAT4, and PTPN22, are shared susceptibility genes in multiple autoimmune diseases. We undertook the current study to examine whether the FAM167A-BLK region is also associated with susceptibility to systemic sclerosis (SSc). Japanese patients with SSc (n = 309) and healthy controls (n = 769) were enrolled in a 2-tiered case-control association study. In tier 1, 124 patients and 412 controls were tested to determine association of 16 tag SNPs encompassing the FAM167A-BLK region with SSc. In tier 2, an additional 185 patients and 357 controls were analyzed for SNP rs13277113. Two haplotype blocks that correspond approximately to FAM167A and BLK were observed. In tier 1 of the study, the rs13277113A allele in the BLK block exhibited the most significant association with SSc after correction for multiple testing (permutated P = 0.024). Two SNP haplotypes formed by rs13277113 and the most significant SNP in the FAM167A block did not exhibit stronger association. When samples from tier 1 and tier 2 were combined, the rs13277113A allele was significantly associated with SSc (odds ratio 1.45 [95% confidence interval 1.17-1.79], P = 6.1 x 10(-4)). Association or a tendency toward association of rs13277113A with SSc was observed regardless of a patient's autoantibody profile or whether a patient had diffuse cutaneous or limited cutaneous SSc. Our findings indicate that the rs13277113A allele is associated not only with SLE but also with SSc and that the FAM167A-BLK region is a common genetic risk factor for both SLE and SSc.

  20. Synthesis and crystal structure of terbium(III) meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}); Synthese und Kristallstruktur von Terbium(III)-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6})

    Energy Technology Data Exchange (ETDEWEB)

    Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)

    2003-06-01

    The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus

  1. Oral zinc sulphate vs. topical application of salicylic (16.7%) and lactic acid (16.7%) combination in the treatment of plantar warts

    International Nuclear Information System (INIS)

    Salman, S.

    2014-01-01

    Warts are commonly acquired viral tumors, caused by Human apilloma Virus (HPV). This virus can infect and cause disease at any site in the stratified squamous epithelium either keratinizing or non-keratinizing. A plantar wart (also called verruca plantaris) is a lesion that appears on the plantar surface of foot as a small, shining, sago-grain papule which soon assumes the typical appearance of a sharply-defined rounded lesion with a rough keratotic surface, surrounded by a smooth collar of thickened horn. Objective: To compare the efficacy and safety of oral zinc sulphate versus topical application of salicylic (16.7%) and lactic acid (16.7%) combination, in the treatment of plantar warts. Study Design: Comparative interventional study. Setting and Duration of Study: Department of Dermatology Unit-I, King Edward Medical University, Mayo Hospital Lahore, from 15 February, 2009 till 14 February, 2010. Methodology: After informed consent, one hundred patients of plantar warts were selected from the outpatient Department of Dermatology, Mayo Hospital, Lahore. The patients were divided into two equal groups; in group A, 50 patients were given oral zinc sulphate (10 mg/kg/day) in two or three divided doses and in group B, 50 patients were advised to apply a combination of salicylic (16.7%) and lactic acid (16.7%) once at night daily. In group A, using oral zinc sulphate, the treatment was given for two months and follow up continued for next 4 months. In group B, the topical preparation was also continued for 2 months or till the complete removal of wart (if before two months) and follow up was extended up to 4 months after treatment. Results:The mean age of patients in group A was 26.2 +- 8.1 years and in group B 26.3 +- 7.3 years. The mean number of warts in group A was 7.9 +- 3.5 and in group B 5.7 +- 2.6. The mean duration of disease in group A was 6.9 +- 4.1 months and in group B 6.0 +- 3.9 months. On follow up at 2nd month, in group A, 41 (82%) patients showed an

  2. 46 CFR 167.45-45 - Carbon dioxide fire-extinguishing system requirements.

    Science.gov (United States)

    2010-10-01

    ... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Firefighting and Fire Prevention Requirements § 167.45-45... school ship propelled by internal combustion engines, the quantity of carbon dioxide required may be... arrangement of the piping shall be such as to give a general and fairly uniform distribution over the entire...

  3. 46 CFR 167.60-5 - Period of time for which valid.

    Science.gov (United States)

    2010-10-01

    ... SCHOOL SHIPS Certificates of Inspection § 167.60-5 Period of time for which valid. A certificate of inspection for any period less than one year shall not be issued, but nothing herein shall be construed as preventing the revocation or suspension of a certificate of inspection in case such process is authorized by...

  4. 46 CFR 167.25-5 - Inspection of boilers, pressure vessels, piping and appurtenances.

    Science.gov (United States)

    2010-10-01

    ...) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Marine Engineering § 167.25-5 Inspection of boilers, pressure vessels, piping and appurtenances. The inspection of boilers, pressure vessels, piping and appurtenances... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection of boilers, pressure vessels, piping and...

  5. 46 CFR 167.01-8 - Inspection of school ships using gross tonnage criterion.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection of school ships using gross tonnage criterion... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS General Provisions § 167.01-8 Inspection of school ships using gross... school ships by relative sizes in gross tonnages. When it is determined in accordance with § 70.05-20 of...

  6. 46 CFR 167.15-28 - Inspection of lifesaving appliances and arrangements.

    Science.gov (United States)

    2010-10-01

    ... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Inspections § 167.15-28 Inspection of lifesaving appliances and arrangements. The inspection of lifesaving appliances and arrangements must be in accordance with the... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection of lifesaving appliances and arrangements...

  7. 46 CFR 167.30-1 - Notice of repairs or alterations required.

    Science.gov (United States)

    2010-10-01

    ... Inspection, whenever repairs or alterations are required, or will be made on a nautical school ship. (b) Whenever a nautical school ship is placed upon the dock, it shall be the duty of the master, owner or agent... NAUTICAL SCHOOL SHIPS Repairs or Alterations § 167.30-1 Notice of repairs or alterations required. (a) It...

  8. 46 CFR 167.60-1 - Issuance by Officer in Charge, Marine Inspection.

    Science.gov (United States)

    2010-10-01

    ... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Certificates of Inspection § 167.60-1 Issuance by Officer in Charge, Marine Inspection. (a) Every nautical school ship shall be inspected annually and if in the opinion of the Officer in Charge, Marine Inspection, the nautical school ship can be operated safely, he shall...

  9. 46 CFR 167.15-25 - Inspection standards for hulls, boilers and machinery.

    Science.gov (United States)

    2010-10-01

    ... SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Inspections § 167.15-25 Inspection standards for hulls, boilers and... 46 Shipping 7 2010-10-01 2010-10-01 false Inspection standards for hulls, boilers and machinery... inspection. These rules may be purchased from the American Bureau of Shipping (ABS), ABS Plaza, 16855...

  10. 46 CFR 167.30-5 - Proceeding to another port for repairs.

    Science.gov (United States)

    2010-10-01

    ... ship obtains a permit from the Officer in Charge, Marine Inspection, to go to another port for repairs... NAUTICAL SCHOOL SHIPS Repairs or Alterations § 167.30-5 Proceeding to another port for repairs. (a) The Officer in Charge, Marine Inspection, may issue a permit to proceed to another port for repairs, if in his...

  11. 21 CFR 172.167 - Silver nitrate and hydrogen peroxide solution.

    Science.gov (United States)

    2010-04-01

    ... SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) FOOD ADDITIVES PERMITTED FOR DIRECT ADDITION TO FOOD FOR HUMAN CONSUMPTION Food Preservatives § 172.167 Silver nitrate and hydrogen peroxide solution... intended to be filtered through a silver-containing water filter. (g) Bottled water must meet the quality...

  12. 26 CFR 1.167(a)-6 - Depreciation in special cases.

    Science.gov (United States)

    2010-04-01

    ....167(a)-6 Depreciation in special cases. (a) Depreciation of patents or copyrights. The cost or other basis of a patent or copyright shall be depreciated over its remaining useful life. Its cost to the patentee includes the various Government fees, cost of drawings, models, attorneys' fees, and similar...

  13. 26 CFR 1.167(l)-3 - Multiple regulation, asset acquisitions, reorganizations, etc.

    Science.gov (United States)

    2010-04-01

    ... not using, such method of regulated accounting only with respect to property subject to the... treatment of certain property as “pre-1970 public utility property” and § 1.167(l)-1(e)(4)(ii) for...) Property not entirely subject to jurisdiction of one regulatory body—(1) In general. If a taxpayer which...

  14. 26 CFR 1.167(i)-1 - Depreciation of improvements in the case of mines, etc.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation of improvements in the case of... and Corporations § 1.167(i)-1 Depreciation of improvements in the case of mines, etc. Property used in... depreciation provided in section 611 shall be treated for all purposes of the Code as if it were property...

  15. Preparation of transparent sol-gel films containing europium, terbium, and ytterbium cations from 4-(3'-triethoxysilylpropylimino)pent-2-en-2-ol

    International Nuclear Information System (INIS)

    Semenov, V.V.; Cherepennikova, N.F.; Kuznetsova, O.V.; Melenskova, N.V.; Bushuk, B.A.; Bushuk, S.B.; Kal'vinkovskaya, Yu.A.; Duglas, V.E.

    2007-01-01

    A reaction of 3-aminopropyl(triethoxy)silane with acetylacetone gave a mixture of two isomeric carbon-functionalized organosilicon compounds capable of complexation and sol-gel polymerization. These were 4-(3'-triethoxysilylpropylimino)pent-2-en-2-ol (EtO) 3 Si-CH 2 CH 2 CH 2 -N=C(Me)CH=C(Me)OH (Ia, 83%) and 4-(3'-triethoxysilylpropylamino)pent-3-en-2-one (EtO) 3 Si-CH 2 CH 2 CH 2 -NH-C(Me)=CH-C(O)Me (Ib, 17%). With acetylacetone trimethylsilyl ether instead of acetylacetone itself, compound Ia and silylated derivatives (Me 3 SiO) n (EtO) 3-n Si-CH 2 CH 2 CH 2 -N=C(Me)CH=C(Me)OH were obtained as admixture in 84 and 16% yields, respectively. Reactions of ligands Ia and Ib with europium and terbium propan-2-olates afforded the corresponding complexes. Formulations of lanthanide complexes, oligodimethylsiloxanediols, and 3-aminopropyl(triethoxy)silane were used to prepare transparent sol-gel films. The photoluminescence spectra of the films show narrow bands due to Eu 3+ or Tb 3+ emission. Emission from the organosilicon matrix appears as a broad band at 430 to 435 nm [ru

  16. VUV and UV–vis optical study on KGd2F7 luminescent host doped with terbium and co-doped with europium

    International Nuclear Information System (INIS)

    Lisiecki, Radosław

    2013-01-01

    The KGd 2 F 7 :Tb and KGd 2 F 7 :Tb,Eu samples were obtained using a solid state reaction. Excitation spectra and emission spectra are reported and analyzed within the VUV–UV–vis spectral range. The intense green luminescence is observed in the KGd 2 F 7 :Tb while the combined emission of terbium and europium in the KGd 2 F 7 :Tb,Eu covers substantially the region of white light. The materials under study can be effectively excited making use of intense f–d transitions of Tb 3+ in the VUV–UV region. Experimental lifetimes of luminescent levels have been measured and discussed. It was found that the considerable energy transfer from Tb 3+ to Eu 3+ occurs. -- Highlights: • The prospective green and white emitting phosphors. • The effective VUV and UV–vis excitation process. • The considerable energy transfer among optically active ions. • The influence of (Tb, Eu) co-doping on relaxation dynamic of excited states

  17. Preparation of a novel fluorescence probe of terbium-europium co-luminescence composite nanoparticles and its application in the determination of proteins

    Energy Technology Data Exchange (ETDEWEB)

    Gao Feng [College of Chemistry and Materials Science, Anhui Key Laboratory of Chemo/Biosensing, Anhui Normal University, Wuhu 241000 (China)], E-mail: summit8848cn@hotmail.com; Luo Fabao; Tang Lijuan; Dai Lu [College of Chemistry and Materials Science, Anhui Key Laboratory of Chemo/Biosensing, Anhui Normal University, Wuhu 241000 (China); Wang Lun [College of Chemistry and Materials Science, Anhui Key Laboratory of Chemo/Biosensing, Anhui Normal University, Wuhu 241000 (China)], E-mail: wanglun@mail.ahnu.edu.cn

    2008-03-15

    Terbium-europium Tb-Eu/acetylacetone(acac)/poly(acrylamide) (PAM) co-luminescence composite nanoparticles were successfully prepared using the ultrasonic approach. The as-prepared composite nanoparticles show the characteristic emission spectra of Tb{sup 3+}, located at 496 and 549 nm. Furthermore, the nanoparticles are water soluble, stable and have extremely narrow emission bands and high internal fluorescence quantum yield due to the co-luminescence effect. Further studies indicate that proteins can interact with the nanoparticles and induce the fluorescence quenching of the nanoparticles. Based on the fluorescence quenching of nanopaticles in the presence of proteins, a novel method for the sensitive determination of trace amounts of proteins was proposed. Under the optimal experimental conditions, the linear ranges of calibration curves are 0-3.5 {mu}g mL{sup -1} for human serum albumin (HSA) and 0-4.0 {mu}g mL{sup -1} for {gamma}-globulin ({gamma}-IgG), respectively. The limits of detection are 7.1 for HSA and 6.7ng mL{sup -1} for {gamma}-IgG, respectively. The method was applied to the quantification of proteins in synthetic samples and actual human serum samples with satisfactory results. This proposed method is sensitive, simple and has potential application in the clinical assay of proteins.

  18. Determination of terbium in phosphate rock by Tb{sup 3+}-selective fluorimetric optode based on dansyl derivative as a neutral fluorogenic ionophore

    Energy Technology Data Exchange (ETDEWEB)

    Hosseini, Morteza, E-mail: smhosseini@khayam.ut.ac.ir [Department of Chemistry, Islamic Azad University, Savadkooh Branch, Savadkooh (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Veismohammadi, Bahareh [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Faridbod, Farnoush [Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Abkenar, Shiva Dehghan [Department of Chemistry, Islamic Azad University, Savadkooh Branch, Savadkooh (Iran, Islamic Republic of); Norouzi, Parviz [Endocrinology and Metabolism Research Center, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)

    2010-04-07

    For the first time a highly sensitive and selective fluorimetric optode membrane was prepared for determination of trace amounts of Tb(III) ions in phosphate rock samples. The Tb(III) sensing system was constructed by incorporating 5-(dimethylamino)-N'-(2-hydroxy-1-naphthoyl) naphthalene-1-sulfonohydrazine (L) as a neutral Tb(III)-selective fluoroionophore, in the plasticized PVC membrane containing sodium tetraphenyl borate as a liphophilic anionic additive. The response of the optode is based on the strong fluorescence quenching of L by Tb{sup 3+} ions. At a pH value of 5.0, the optode displays a wide concentration range of 1.0 x 10{sup -7} to 1.0 x 10{sup -2} M, with a relatively fast response time of less than 45 s. In addition, to high stability and reproducibility, the sensor shows a unique selectivity towards Tb{sup 3+} ion with respect to common cations. The optode was applied successfully to the trace determination of terbium ion in binary mixture and water samples and the determination of Tb{sup 3+} in phosphate rock samples.

  19. Determination of terbium in phosphate rock by Tb3+-selective fluorimetric optode based on dansyl derivative as a neutral fluorogenic ionophore.

    Science.gov (United States)

    Hosseini, Morteza; Ganjali, Mohammad Reza; Veismohammadi, Bahareh; Faridbod, Farnoush; Abkenar, Shiva Dehghan; Norouzi, Parviz

    2010-04-07

    For the first time a highly sensitive and selective fluorimetric optode membrane was prepared for determination of trace amounts of Tb(III) ions in phosphate rock samples. The Tb(III) sensing system was constructed by incorporating 5-(dimethylamino)-N'-(2-hydroxy-1-naphthoyl) naphthalene-1-sulfonohydrazine (L) as a neutral Tb(III)-selective fluoroionophore, in the plasticized PVC membrane containing sodium tetraphenyl borate as a liphophilic anionic additive. The response of the optode is based on the strong fluorescence quenching of L by Tb(3+) ions. At a pH value of 5.0, the optode displays a wide concentration range of 1.0 x 10(-7) to 1.0 x 10(-2)M, with a relatively fast response time of less than 45 s. In addition, to high stability and reproducibility, the sensor shows a unique selectivity towards Tb(3+) ion with respect to common cations. The optode was applied successfully to the trace determination of terbium ion in binary mixture and water samples and the determination of Tb(3+) in phosphate rock samples. Crown Copyright 2010. Published by Elsevier B.V. All rights reserved.

  20. Molecular Orientation of a Terbium(III)-Phthalocyaninato Double-Decker Complex for Effective Suppression of Quantum Tunneling of the Magnetization.

    Science.gov (United States)

    Yamabayashi, Tsutomu; Katoh, Keiichi; Breedlove, Brian K; Yamashita, Masahiro

    2017-06-15

    Single-molecule magnet (SMM) properties of crystals of a terbium(III)-phthalocyaninato double-decker complex with different molecular packings ( 1 : TbPc₂, 2 : TbPc₂·CH₂Cl₂) were studied to elucidate the relationship between the molecular packing and SMM properties. From single crystal X-ray analyses, the high symmetry of the coordination environment of 2 suggested that the SMM properties were improved. Furthermore, the shorter intermolecular Tb-Tb distance and relative collinear alignment of the magnetic dipole in 2 indicated that the magnetic dipole-dipole interactions were stronger than those in 1 . This was confirmed by using direct current magnetic measurements. From alternating current magnetic measurements, the activation energy for spin reversal for 1 and 2 were similar. However, the relaxation time for 2 is three orders of magnitude slower than that for 1 in the low- T region due to effective suppression of the quantum tunneling of the magnetization. These results suggest that the SMM properties of TbPc₂ highly depend on the molecular packing.

  1. Study of the role of complete fusion in the reaction of /sup 48/Ca and /sup 56/Fe with cerium and terbium. [Cross sections, yield curves, tables

    Energy Technology Data Exchange (ETDEWEB)

    Morrissey, D.J.

    1978-05-01

    /sup 48/Ca and /sup 56/Fe beams from the Super HILAC accelerator were used to irradiate thick metal foils of cerium and terbium. Product gamma ray activities were detected offline and individual products were identified by half-life, gamma ray energy and gamma ray abundances. The production cross sections were iteratively fit to charge and mass dispersions to allow correction for parent decay and calculation of mass yields. From the mass yield curves contributions from quasielastic transfer, deep inelastic transfer and complete fusion reaction mechanisms were interred. Complete fusion was made up on contributions from both evaporation residue and fusion-fission products for the /sup 48/Ca induced reactions. However, only fusion-fission products were detected in the /sup 56/Fe induced reactions. Critical angular momenta for fusion were found to be 82 +- 8 h for /sup 48/Ca + /sup 159/Tb and 34 +- 5 h for /sup 56/Fe + /sup 140/Ce, which can be compared with 53 +- 8 h for /sup 12/C + /sup 197/Au (Natowitz, 1970) and 86 +- 5 h for /sup 40/Ar + /sup 165/Ho (Hanappe, 1973). All of these reactions lead to essentially the same compound nucleus and seem to show the dramatic decline in complete fusion for heavy ions larger than /sup 40/Ar. The prediction of this decline was found to be beyond the model calculations of Bass and the critical distance approach of Glas and Mosel.

  2. Investigation of concentration-dependence of thermodynamic properties of lanthanum, yttrium, scandium and terbium in eutectic LiCl-KCl molten salt

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yafei; Zhou, Wentao; Zhang, Jinsuo, E-mail: zhang.3558@osu.edu

    2016-09-15

    Thermodynamic properties of rare earth metals in LiCl-KCl molten salt electrolyte are crucial to the development of electrochemical separation for the treatment of used nuclear fuels. In the present study, activity coefficient, apparent potential, and diffusion coefficient of lanthanum, yttrium, scandium, and terbium in the molten salt (58 at% LiCl and 42 at% KCl) were calculated by the method of molecular dynamics simulation up to a concentration around 3 at% at temperatures of 723 K and 773 K. It was found that the activity coefficient and the apparent potential increase with the species concentration while diffusion coefficient shows a trend of increase followed by decrease. The calculated results were validated by available measurement data of dilution cases. This research extends the range of data to a wide component and would provide further insight to the pyroprocessing design and safeguards. - Highlights: • Investigation of activity coefficient, apparent potential and diffusion coefficient at different concentrations. • MD simulation was studied for the calculation of thermodynamic properties of rare earth elements in molten salt. • The present study is a pioneering work focusing on the concentration dependence of thermodynamic properties.

  3. Coevolution Pattern and Functional Conservation or Divergence of miR167s and their targets across Diverse Plant Species.

    Science.gov (United States)

    Barik, Suvakanta; Kumar, Ashutosh; Sarkar Das, Shabari; Yadav, Sandeep; Gautam, Vibhav; Singh, Archita; Singh, Sharmila; Sarkar, Ananda K

    2015-10-13

    microRNAs (miRNAs), a class of endogenously produced small non-coding RNAs of 20-21 nt length, processed from precursor miRNAs, regulate many developmental processes by negatively regulating the target genes in both animals and plants. The coevolutionary pattern of a miRNA family and their targets underscores its functional conservation or diversification. The miR167 regulates various aspects of plant development in Arabidopsis by targeting ARF6 and ARF8. The evolutionary conservation or divergence of miR167s and their target genes are poorly understood till now. Here we show the evolutionary relationship among 153 MIR167 genes obtained from 33 diverse plant species. We found that out of the 153 of miR167 sequences retrieved from the "miRBase", 27 have been annotated to be processed from the 3' end, and have diverged distinctively from the other miR167s produced from 5' end. Our analysis reveals that gma-miR167h/i and mdm-miR167a are processed from 3' end and have evolved separately, diverged most resulting in novel targets other than their known ones, and thus led to functional diversification, especially in apple and soybean. We also show that mostly conserved miR167 sequences and their target AUXIN RESPONSE FACTORS (ARFs) have gone through parallel evolution leading to functional diversification among diverse plant species.

  4. 78 FR 49318 - Availability of Draft Advisory Circular (AC) 90-106A and AC 20-167A

    Science.gov (United States)

    2013-08-13

    ...] Availability of Draft Advisory Circular (AC) 90-106A and AC 20- 167A AGENCY: Federal Aviation Administration... of draft Advisory Circular (AC) 90-106A, Enhanced Flight Vision Systems and draft AC 20- 167A... Federal holidays. FOR FURTHER INFORMATION CONTACT: For technical questions concerning draft AC 90-106A...

  5. 20 CFR 411.167 - What is an educational institution or a technical, trade or vocational school?

    Science.gov (United States)

    2010-04-01

    ... Education. (e) Approval by a State agency or subdivision of the State includes approval of a school, college... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false What is an educational institution or a technical, trade or vocational school? 411.167 Section 411.167 Employees' Benefits SOCIAL SECURITY...

  6. 78 FR 44600 - 167th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of...

    Science.gov (United States)

    2013-07-24

    ... DEPARTMENT OF LABOR Employee Benefits Security Administration 167th Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 167th open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...

  7. Identification of excited states in 167Os and 168Os: shape coexistence at extreme neutron deficiency

    International Nuclear Information System (INIS)

    Joss, D.T.; King, S.L.; Page, R.D.; Simpson, J.; Keenan, A.; Amzal, N.; Baeck, T.; Bentley, M.A.; Cederwall, B.; Cocks, J.F.C.; Cullen, D.M.; Greenlees, P.T.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Kuusiniemi, P.; Leino, M.; Muikku, M.; Savelius, A.; Uusitalo, J.; Williams, S.J.

    2001-01-01

    Excited states in the very neutron-deficient isotopes 167 Os and 168 Os have been observed using the reaction 112 Sn( 58 Ni, 2pxn). The JUROSPHERE γ-ray spectrometer array was used in conjunction with the RITU gas-filled recoil separator to collect prompt γ radiation in coincidence with recoils implanted in a silicon strip detector located at the focal plane of RITU. Using a selective recoil decay tagging technique it has been possible to unambiguously assign γ-ray transitions to 167 Os and 168 Os through the characteristic α radioactivity of these nuclides. The high-spin structure of the bands is discussed in terms of quasiparticle configurations within the framework of the cranked shell model. The role of shape coexistence in 168 Os is examined with phenomenological three-band mixing calculations

  8. Photoproduction of an isoscalar 3π resonance at 1.67 GeV

    International Nuclear Information System (INIS)

    Laberrigue, J.; Lassalle, J.C.; Patrick, G.N.; Storr, K.M.; Levy, J.M.; La Vaissiere, C. de; Yiou, T.P.; Atkinson, M.; Axon, T.J.; Barberis, D.; Brodbeck, T.J.; Brookes, G.R.; Bunn, J.J.; Bussey, P.J.; Clegg, A.B.; Dainton, J.B.; Davenport, M.; Dickinson, B.; Diekmann, B.; Donnachie, A.; Ellison, R.J.; Flower, P.; Flynn, P.J.; Galbraith, W.; Heinloth, K.; Henderson, R.C.W.; Hughes-Jones, R.E.; Hutton, J.S.; Ibbotson, M.; Jacob, H.P.; Jung, M.; Kemp, M.A.R.; Kumar, B.R.; Lafferty, G.D.; Lane, J.B.; Liebenau, V.; McClatchey, R.H.; Mercer, D.; Morris, J.A.G.; Morris, J.V.; Newton, D.; Paterson, C.; Paul, E.; Raine, C.; Reidenbach, M.; Rotscheidt, H.; Schloesser, A.; Sharp, P.H.; Skillicorn, I.O.; Smith, K.M.; Thompson, R.J.; Waite, A.P.

    1983-01-01

    A rhoπ enhancement with mass 1.67 +- 0.02 GeV and width 0.16 +- 0.02 GeV is observed in the channel #betta#p -> pπ + π - 0 . Assuming an incoherent background, the cross section x branching ratio is 100 +- 20 nb. A spin-parity analysis favours Jsup(P) = 1 - . The enhancement is most simply interpreted as a radial recurrence of the #betta# meson. (orig.)

  9. Feasibility of Uranium Concentration Measurements for H Canyon Tank 16.7

    International Nuclear Information System (INIS)

    Lascola, R.J.

    2003-01-01

    Savannah River Technology Center (SRTC) evaluated the feasibility of using the H Canyon on-line diode array spectrophotometer to measure uranium concentrations in Tank 16.7. On-line measurements will allow an increase in highly enriched uranium (HEU) production by removing delays associated with off-line measurements. The instrument must be able to measure uranium at concentrations below 1.0 g/L with an uncertainty no greater than 0.3 g/L. SRTC determined that the system has a limit of quantitation of 0.15 g/L. At concentrations of 0.5 and 1.0 g/L, the spectrometer uncertainty is 0.10 g/L. No design changes, such as an increase in flow cell path length, are required to obtain this performance. Expected levels of iron in Tank 16.7 solutions will not interfere with the measurement. The CHEMCHEK method should not be used for confirmatory analysis, as it contributes excessively to the overall uncertainty of the measurement. SRTC expects that the spectrophotometer will meet the measurement requirements for Tank 16.7

  10. A Broad G Protein-Coupled Receptor Internalization Assay that Combines SNAP-Tag Labeling, Diffusion-Enhanced Resonance Energy Transfer, and a Highly Emissive Terbium Cryptate.

    Science.gov (United States)

    Levoye, Angélique; Zwier, Jurriaan M; Jaracz-Ros, Agnieszka; Klipfel, Laurence; Cottet, Martin; Maurel, Damien; Bdioui, Sara; Balabanian, Karl; Prézeau, Laurent; Trinquet, Eric; Durroux, Thierry; Bachelerie, Françoise

    2015-01-01

    Although G protein-coupled receptor (GPCR) internalization has long been considered as a major aspect of the desensitization process that tunes ligand responsiveness, internalization is also involved in receptor resensitization and signaling, as well as the ligand scavenging function of some atypical receptors. Internalization thus contributes to the diversity of GPCR-dependent signaling, and its dynamics and quantification in living cells has generated considerable interest. We developed a robust and sensitive assay to follow and quantify ligand-induced and constitutive-induced GPCR internalization but also receptor recycling in living cells. This assay is based on diffusion-enhanced resonance energy transfer (DERET) between cell surface GPCRs labeled with a luminescent terbium cryptate donor and a fluorescein acceptor present in the culture medium. GPCR internalization results in a quantifiable reduction of energy transfer. This method yields a high signal-to-noise ratio due to time-resolved measurements. For various GPCRs belonging to different classes, we demonstrated that constitutive and ligand-induced internalization could be monitored as a function of time and ligand concentration, thus allowing accurate quantitative determination of kinetics of receptor internalization but also half-maximal effective or inhibitory concentrations of compounds. In addition to its selectivity and sensitivity, we provided evidence that DERET-based internalization assay is particularly suitable for characterizing biased ligands. Furthermore, the determination of a Z'-factor value of 0.45 indicates the quality and suitability of DERET-based internalization assay for high-throughput screening (HTS) of compounds that may modulate GPCRs internalization.

  11. A broad G protein-coupled receptor internalization assay that combines SNAP-tag labeling, diffusion-enhanced resonance energy transfer, and a highly emissive terbium cryptate acceptor

    Directory of Open Access Journals (Sweden)

    Angélique eLEVOYE

    2015-11-01

    Full Text Available Although G protein-coupled receptor (GPCR internalization has long been considered a major aspect of the desensitization process that tunes ligand responsiveness, internalization is also involved in receptor resensitization and signaling, as well as the ligand scavenging function of some atypical receptors. Internalization thus contributes to the diversity of GPCR-dependent signaling, and its dynamics and quantification in living cells has generated considerable interest. We developed a robust and sensitive assay to follow and quantify ligand-induced and constitutive GPCR internalization but also receptor recycling in living cells. This assay is based on diffusion-enhanced resonance energy transfer (DERET between cell surface GPCRs labeled with a luminescent terbium cryptate donor and a fluorescein acceptor present in the culture medium. GPCR internalization results in a quantifiable reduction of energy transfer. This method yields a high signal-to-noise ratio due to time-resolved measurements. For various GPCRs belonging to different classes, we demonstrated that constitutive and ligand-induced internalization could be monitored as a function of time and ligand concentration, thus allowing accurate quantitative determination of kinetics of receptor internalization but also half-maximal effective or inhibitory concentrations of compounds. In addition to its selectivity and sensitivity, we provided evidence that DERET-based internalization assay is particularly suitable for characterizing biased ligands. Furthermore, the determination of a Z’-factor value of 0.45 indicates the quality and suitability of DERET-based internalization assay for high-throughput screening (HTS of compounds that may modulate GPCRs internalization.

  12. 42 CFR 137.167 - What cost principles must a Self-Governance Tribe follow when participating in self-governance...

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What cost principles must a Self-Governance Tribe follow when participating in self-governance under Title V? 137.167 Section 137.167 Public Health PUBLIC... HUMAN SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Audits and Cost Principles § 137.167 What...

  13. 46 CFR 167.15-15 - Application for inspection of a new nautical school ship or a conversion of a vessel to a...

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Application for inspection of a new nautical school ship or a conversion of a vessel to a nautical school ship. 167.15-15 Section 167.15-15 Shipping COAST... Inspections § 167.15-15 Application for inspection of a new nautical school ship or a conversion of a vessel...

  14. 26 CFR 1.167(a)-11 - Depreciation based on class lives and asset depreciation ranges for property placed in service...

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation based on class lives and asset depreciation ranges for property placed in service after December 31, 1970. 1.167(a)-11 Section 1.167(a)-11...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(a)-11 Depreciation...

  15. Flywheel for a 167 MVA surge power motor-generator set

    International Nuclear Information System (INIS)

    Mertens, H.

    1975-01-01

    Flywheels to be subjected to major speed fluctuations are designed on the basis of both the usual strength analysis and fracture mechanics considerations, and the testing and operating instructions have to allow for this. Appropriate test units are used to determine the fracture toughness of the material. Residual stresses are measured and extensive ultrasonic and magnetic particle tests performed to enable the permissible number of stress cycles to be predicted. The article deals with these problems by reference to the flywheel of a 167 MVA surge power motor-generator set for the Max Planck Insitute for Plasma Physics in Garching. (orig.) [de

  16. A scanning tunneling microscopy study of the electronic and spin states of bis(phthalocyaninato)terbium(iii) (TbPc2) molecules on Ag(111).

    Science.gov (United States)

    Ara, Ferdous; Qi, Zhi Kun; Hou, Jie; Komeda, Tadahiro; Katoh, Keiichi; Yamashita, Masahiro

    2016-10-25

    In this article, we investigate a single molecule magnet bis(phthalocyaninato)terbium(iii) (TbPc 2 ) molecule film by using low temperature STM. In order to investigate the effect of molecule-substrate interaction on the electronic and spin properties of the adsorbed molecule, we tune the molecule-substrate coupling by switching the substrate between Au(111) and Ag(111), the latter of which provides stronger interaction with the molecule than the former. Despite the enhanced chemical reactivity of the Ag(111) surface compared with Au(111), a well-organized pseudo-square film is formed. In addition, a checker-board type contrast variation is identified, which is well explained by the existence of two types of molecules whose rotational angle between the top and bottom Pc is θ = 45° (bright molecule) and θ = 30° (dark molecule). The expected stronger molecule-substrate interaction, however, appears as an intriguing dI/dV mapping image which reveals the spatial distribution of the density of states (DOS). We identify the contrast reversal in the dI/dV mapping for the molecules of θ = 45° and θ = 30° at the sample voltages of V = 0.7 eV and 1.1 eV. Combined with the density functional theory (DFT) calculation, we attribute this change to the shift of an electronic state due to the rotation of the mutual angle between the top and bottom Pc. For the spin behavior, we previously observed a Kondo resonance for the TbPc 2 molecule adsorbed on the Au(111) surface. On the Ag(111) surface, the Kondo resonance is hardly observed, which is due to the annihilation of the π radical spin by the charge transfer from the substrate to the molecule. Instead we observe a Kondo peak for the molecule on the second layer, for which the spin recovers due to the reduction of the coupling with the substrate. In addition, when a magnetic field of 2 T normal to the surface is applied, the second layer molecule shows a sharp dip at the Fermi level. We attribute this to the inelastic

  17. Influence of intramolecular f-f interactions on nuclear spin driven quantum tunneling of magnetizations in quadruple-decker phthalocyanine complexes containing two terbium or dysprosium magnetic centers.

    Science.gov (United States)

    Fukuda, Takamitsu; Matsumura, Kazuya; Ishikawa, Naoto

    2013-10-10

    Nuclear spin driven quantum tunneling of magnetization (QTM) phenomena, which arise from admixture of more than two orthogonal electronic spin wave functions through the couplings with those of the nuclear spins, are one of the important magnetic relaxation processes in lanthanide single molecule magnets (SMMs) in the low temperature range. Although recent experimental studies have indicated that the presence of the intramolecular f-f interactions affects their magnetic relaxation processes, little attention has been given to their mechanisms and, to the best of our knowledge, no rational theoretical models have been proposed for the interpretations of how the nuclear spin driven QTMs are influenced by the f-f interactions. Since quadruple-decker phthalocyanine complexes with two terbium or dysprosium ions as the magnetic centers show moderate f-f interactions, these are appropriate to investigate the influence of the f-f interactions on the dynamic magnetic relaxation processes. In the present paper, a theoretical model including ligand field (LF) potentials, hyperfine, nuclear quadrupole, magnetic dipolar, and the Zeeman interactions has been constructed to understand the roles of the nuclear spins for the QTM processes, and the resultant Zeeman plots are obtained. The ac susceptibility measurements of the magnetically diluted quadruple-decker monoterbium and diterbium phthalocyanine complexes, [Tb-Y] and [Tb-Tb], have indicated that the presence of the f-f interactions suppresses the QTMs in the absence of the external magnetic field (H(dc)) being consistent with previous reports. On the contrary, the faster magnetic relaxation processes are observed for [Tb-Tb] than [Tb-Y] at H(dc) = 1000 Oe, clearly demonstrating that the QTMs are rather enhanced in the presence of the external magnetic field. Based on the calculated Zeeman diagrams, these observations can be attributed to the enhanced nuclear spin driven QTMs for [Tb-Tb]. At the H(dc) higher than 2000 Oe, the

  18. Radio-frequency ablation of colorectal liver metastases in 167 patients

    International Nuclear Information System (INIS)

    Gillams, A.R.; Lees, W.R.

    2004-01-01

    The objective of this paper is to report our results from a prospective study of 167 patients with colorectal liver metastases treated with radio-frequency ablation (RFA). Three hundred fifty-four treatments were performed in 167 patients, 99 males, mean age 57 years (34-87). The mean number of metastases was 4.1 (1-27). The mean maximum diameter was 3.9 cm (1-12). Fifty-one (31%) had stable/treated extra-hepatic disease. Treatments were performed under general anaesthesia using US and CT guidance and single or cluster water-cooled electrodes (Valleylab, Boulder, CO). All patients had been rejected for or had refused surgical resection. Eighty percent received chemotherapy. Survival data were stratified by tumour burden at the time of first RFA. The mean number of RFA treatments was 2.1 (1-7). During a mean follow-up of 17 months (0-89), 72 developed new liver metastases and 71 developed progressive extra-hepatic disease. There were 14/354 (4%) major local complications and 22/354 (6%) minor local complications. For patients with ≤5 metastases, maximum diameter ≤5 cm and no extra-hepatic disease, the 5-year survival from the time of diagnosis was 30% and from the time of first thermal ablation was 26%. Given that the 5-year survival for operable patients is a median of 32%, our 5-year survival of 30% is promising. (orig.)

  19. Pharmacological evidences for DFK167-sensitive presenilin-independent gamma-secretase-like activity.

    Science.gov (United States)

    Sevalle, Jean; Ayral, Erwan; Hernandez, Jean-François; Martinez, Jean; Checler, Frédéric

    2009-07-01

    Amyloid-beta (Abeta) peptides production is thought to be a key event in the neurodegenerative process ultimately leading to Alzheimer's disease (AD) pathology. A bulk of studies concur to propose that the C-terminal moiety of Abeta is released from its precursor beta-amyloid precursor protein by a high molecular weight enzymatic complex referred to as gamma-secretase, that is composed of at least, nicastrin (NCT), Aph-1, Pen-2, and presenilins (PS) 1 or 2. They are thought to harbor the gamma-secretase catalytic activity. However, several lines of evidence suggest that additional gamma-secretase-like activities could potentially contribute to Abeta production. By means of a quenched fluorimetric substrate (JMV2660) mimicking the beta-amyloid precursor protein sequence targeted by gamma-secretase, we first show that as expected, this probe allows monitoring of an activity detectable in several cell systems including the neuronal cell line telencephalon specific murine neurons (TSM1). This activity is reduced by DFK167, N-[N-(3,5-difluorophenacetyl)-L-alanyl]-S-phenylglycine t-butyl ester (DAPT), and LY68458, three inhibitors known to functionally interact with PS. Interestingly, JMV2660 but not the unrelated peptide JMV2692, inhibits Abeta production in an in vitrogamma-secretase assay as expected from a putative substrate competitor. This activity is enhanced by PS1 and PS2 mutations known to be responsible for familial forms of AD and reduced by aspartyl mutations inactivating PS or in cells devoid of PS or NCT. However, we clearly establish that residual JMV2660-hydrolysing activity could be recovered in PS- and NCT-deficient fibroblasts and that this activity remained inhibited by DFK167. Overall, our study describes the presence of a proteolytic activity displaying gamma-secretase-like properties but independent of PS and still blocked by DFK167, suggesting that the PS-dependent complex could not be the unique gamma-secretase activity responsible for Abeta

  20. Studies on the rare earth complexes with pyridine derivatives and their N-oxide(II) - Synthesis and properties of fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with 2,2'-bipyridine-N,N'-dioxide

    International Nuclear Information System (INIS)

    Minyu, T.; Ning, T.; Yingli, Z.; Jiyuan, B.

    1985-01-01

    The solid complexes of rare earth nitrates perchlorates and thiocyanates with 2,2'-bipyridine-N,N'-dioxide (bipyO/sub 2/) have been reported. However, the corresponding complexes of other rear earth chlorides have not been investigated except lanthanum, cerium and yttrium. As an extension of our previous work on the synthesis of complexes of praseodymium and neodymium chlorides wiht bipoyO/sub 2/, the authors have now prepared fluorescent solid complexes of samarium, europium, gadolium and terbium chlorides with biphyO/sub 2/, using methanol as a reaction medium. The new synthesized compounds have been identified by means of elemental analysis, infrared spectrometry, conductometry, differential thermal analysis (DTA), thermogravimetry (TG) and X-ray powder diffraction

  1. Paleointensity Behavior and Intervals Between Geomagnetic Reversals in the Last 167 Ma

    Science.gov (United States)

    Kurazhkovskii, A. Yu.; Kurazhkovskaya, N. A.; Klain, B. I.

    2018-01-01

    The results of comparative analysis of the behavior of paleointensity and polarity (intervals between reversals) of the geomagnetic field for the last 167 Ma are presented. Similarities and differences in the behavior of these characteristics of the geomagnetic field are discussed. It is shown that bursts of paleointensity and long intervals between reversals occurred at high mean values of paleointensity in the Cretaceous and Paleogene. However, there are differences between the paleointensity behavior and the reversal regime: (1) the characteristic times of paleointensity variations are less than the characteristic times of the frequency of geomagnetic reversals, (2) the achievement of maximum values of paleointensity at the Cretaceous-Paleogene boundary and the termination of paleointensity bursts after the boundary of 45-40 Ma are not marked by explicit features in the geomagnetic polarity behavior.

  2. Picomolar traces of americium(III) introduce drastic changes in the structural chemistry of terbium(III). A break in the ''gadolinium break''

    Energy Technology Data Exchange (ETDEWEB)

    Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)

    2017-10-16

    The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. 28 CFR 0.167 - Submission to Associate Attorney General by Director of Office of Alien Property of certain...

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Submission to Associate Attorney General... Forfeitures § 0.167 Submission to Associate Attorney General by Director of Office of Alien Property of... to the Associate Attorney General under preceding sections of this subpart Y, the Director of the...

  4. Functional analysis and molecular dynamics simulation of LOX-1 K167N polymorphism reveal alteration of receptor activity.

    Directory of Open Access Journals (Sweden)

    Silvia Biocca

    Full Text Available The human lectin-like oxidized low density lipoprotein receptor 1 LOX-1, encoded by the ORL1 gene, is the major scavenger receptor for oxidized low density lipoprotein in endothelial cells. Here we report on the functional effects of a coding SNP, c.501G>C, which produces a single amino acid change (K>N at codon 167. Our study was aimed at elucidating whether the c.501G>C polymorphism changes the binding affinity of LOX-1 receptor altering its function. The presence of p.K167N mutation reduces ox-LDL binding and uptake. Ox-LDL activated extracellular signal-regulated kinases 1 and 2 (ERK 1/2 is inhibited. Furthermore, ox-LDL induced biosynthesis of LOX-1 receptors is dependent on the p.K167N variation. In human macrophages, derived from c.501G>C heterozygous individuals, the ox-LDL induced LOX-1 46 kDa band is markedly lower than in induced macrophages derived from c.501G>C controls. Investigation of p.K167N mutation through molecular dynamics simulation and electrostatic analysis suggests that the ox-LDL binding may be attributed to the coupling between the electrostatic potential distribution and the asymmetric flexibility of the basic spine residues. The N/N-LOX-1 mutant has either interrupted electrostatic potential and asymmetric fluctuations of the basic spine arginines.

  5. 26 CFR 1.167(l)-1 - Limitations on reasonable allowance in case of property of certain public utilities.

    Science.gov (United States)

    2010-04-01

    ... depreciation. Further, the use of an unrecovered cost or other basis or salvage value for Federal income tax... an arm's-length cash sale at fair market value or in a tax-free exchange. Thus, for example, if... depreciation, provided that the use of such other method is allowable under section 167 without regard to...

  6. Study on the characteristics of sup(163,165,167)Tm excited states

    International Nuclear Information System (INIS)

    Adam, I.; Alikov, B.A.; Badalov, Kh.N.

    1985-01-01

    On the basis of analysis of transition intensities, de-excitation nature and systematics of sup(163,1965, 167)Tm nucleus level energy the interpretation of some excited states of studied isotopes is suggested. Results of calculations within the framework of an independent quasiparticle model and quasiparticle-phonon model confirm the suggested interpretation and show that taking account of quasiparticle-phonon interaction improves agreement of theoretical energy values with experimental as compared with the independent quasiparticle model. The calculation of energy of rotational states within the framework of a non adi batic rotational model shows that it is possible to obtain rather good agreement with experiment. It is noted that taking account of correctly the difference in deformations of one-particle states can result in the improvement of agreement of theory and experiment. When calculating rotational spectra for the description of high-lying states it is desirable to consider dependence of collective parameters, for example, inertia momentum, on spin

  7. Stationary and coherent spectroscopy of 167Er3+ in waveguides in 7LiYF4 crystal

    Directory of Open Access Journals (Sweden)

    Minnegaliev Mansur

    2017-01-01

    Full Text Available We have conducted a spectroscopic investigation of 167Er3+ ions in optical waveguides on an optical transition between the hyperfine sublevels of 4I15/2 and 4I9/2 multiplets. Waveguides with diameters ranging from 20 to 100 µm were produced in the crystal by a femtosecond laser using the depressed-cladding approach. The spectroscopy results of 167Er3+ ions inside the waveguides show additional broadening and an overall shifts of the spectra compared to the bulk spectrum of ions. The sign of the observed frequency shift depends on the diameter of the specific waveguide. We have also observed a two-pulse photon echo in several waveguides. The acquired results show the possibility for integrated quantum schemes in rare-earth ions doped crystals.

  8. Association between cotinine-verified smoking status and hypertension in 167,868 Korean adults.

    Science.gov (United States)

    Kim, Byung Jin; Han, Ji Min; Kang, Jung Gyu; Kim, Bum Soo; Kang, Jin Ho

    2017-10-01

    Previous studies showed inconsistent results concerning the relationship between chronic smoking and blood pressure. Most of the studies involved self-reported smoking status. This study was performed to evaluate the association of urinary cotinine or self-reported smoking status with hypertension and blood pressure in Korean adults. Among individuals enrolled in the Kangbuk Samsung Health Study and Kangbuk Samsung Cohort Study, 167,868 participants (men, 55.7%; age, 37.5 ± 6.9 years) between 2011 and 2013 who had urinary cotinine measurements were included. Individuals with urinary cotinine levels ≥50 ng/mL were defined as cotinine-verified current smokers. The prevalence of hypertension and cotinine-verified current smokers in the overall population was 6.8% and 22.7%, respectively (10.0% in men and 2.8% in women for hypertension: 37.7% in men and 3.9% in women for cotinine-verified current smokers). In a multivariate regression analysis adjusted for age, sex, body mass index, waist circumference, alcohol drinking, vigorous exercise, and diabetes, cotinine-verified current smoking was associated with lower prevalence of hypertension compared with cotinine-verified never smoking (OR[95% CI], 0.79 [0.75, 0.84]). Log-transformed cotinine levels and unobserved smoking were negatively associated with hypertension, respectively (0.96 [0.96, 0.97] and 0.55 [0.39, 0.79]). In a multivariate linear regression analysis, the cotinine-verified current smoking was inversely associated with systolic and diastolic blood pressure (BP) (regression coefficient[95% CI], -1.23[-1.39, -1.07] for systolic BP and -0.71 [-0.84, -0.58] for diastolic BP). In subgroup analyses according to sex, the inverse associations between cotinine-verified current smoking and hypertension were observed only in men. This large observational study showed that cotinine-verified current smoking and unobserved smoking were inversely associated with hypertension in Korean adults, especially only in

  9. Inner-sphere and outer-sphere complexes of yttrium(III), lanthanum (III), neodymium(III), terbium(III) and thulium(III) with halide ions in N,N-dimethylformamide

    International Nuclear Information System (INIS)

    Takahashi, Ryouta; Ishiguro, Shin-ichi

    1991-01-01

    The formation of chloro, bromo and iodo complexes of yttrium(III), and bromo and iodo complexes of lanthanum(III), neodymium(III), terbium(III) and thulium(III) has been studied by precise titration calorimetry in N,N-dimethylformamide (DMF) at 25 o C. The formation of [YCl] 2+ , [YCl 2 ] + , [YCl 3 ] and [YCl 4 ] - , and [MBr] 2+ and [MBr 2 ] + (M = Y, La, Nd, Tb, Tm) was revealed, and their formation constants, enthalpies and entropies were determined. It is found that the formation enthalpies change in the sequence ΔH o (Cl) > ΔH o (l), which is unusual for hard metal (III) ions. This implies that, unlike the chloride ion, the bromide ion forms outer-sphere complexes with the lanthanide(III) and yttrium(III) ions in DMF. Evidence for either an inner- or outer-sphere complex was obtained from 89 Y NMR spectra for Y(ClO 4 ) 3 , YCl 3 and YBr 3 DMF solutions at room temperature. (author)

  10. Enhancing Sm{sup 3+} red emission via energy transfer from Bi{sup 3+}→Sm{sup 3+} based on terbium bridge mechanism in Ca{sub 2}Al{sub 2}SiO{sub 7} phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Li, Minhong; Wang, LiLi; Ran, Weiguang; Ren, Chunyan; Song, Zeling; Shi, Jinsheng, E-mail: jsshiqn@aliyun.com

    2017-04-15

    Currently, the key change for white-LED is to improve the luminescence efficiency of red phosphor. Sm{sup 3+} activated phosphor was considered due to suitable emission position of red light. However, the luminescence intensity in the red region is weak. For enhancing red-emitting of Sm{sup 3+}, Bi{sup 3+} and Tb{sup 3+} ions were introduced into Ca{sub 2}Al{sub 2}SiO{sub 7}:Sm{sup 3+} phosphors based on the concept of energy transfer. For Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Sm{sup 3+} samples, it can be observed that the energy transfer process was blocked. Hence, Tb{sup 3+} was introduced into Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Sm{sup 3+} samples to increase Sm{sup 3+} luminescence intensity based on Bi{sup 3+}→Tb{sup 3+}→Sm{sup 3+} energy transfer process. Compared with Sm{sup 3+} single-doped Ca{sub 2}Al{sub 2}SiO{sub 7} phosphor, the luminescence intensity of Sm{sup 3+} was enhanced by 2.6 times. It can be found that Tb{sup 3+} ions play a role of storing the energy or transfer bridge from Bi{sup 3+}→ Sm{sup 3+} by investigating the Ca{sub 2}Al{sub 2}SiO{sub 7}:Bi{sup 3+}, Tb{sup 3+} and Ca{sub 2}Al{sub 2}SiO{sub 7}:Tb{sup 3+}, Sm{sup 3+} energy transfer mechanism. All these results suggest that terbium branch mechanism plays an important role on enhancing activators luminescence intensity.

  11. Benzimidazole -Resistance in Haemonchus Contortus: New PCR-RFLP Method for the Detection of Point Mutation at Codon 167 of Isotype 1 Β-Tubulin Gene

    Directory of Open Access Journals (Sweden)

    A Eslami

    2012-12-01

    Full Text Available Background: Due to the lack of a suitable and economic test for the analysis of the polymorphism at codon 167, we developed a new PCR-RFLP technique, based on a modified forward primer (UT-HC167 MF-primer, to identify simultaneously the SNPs at codons 167 and 200 of isotype 1 β-tubu­lin gene of Haemonchus contortus.Methods: There already are several safe and easy methods for identification of point mutations at codons 198 and 200. Due to the lack of a reliable and easy method for the detection of the single nucleo­tide polymorphism (SNP at codon 167, we developed an innovative PCR-RFLP technique based on a modified forward primer (UT-HC167 MF-primer, in which the nucleotide T at the posi­tion 443 was substituted through a nucleotide A creating a restriction site for restriction endonuc­lease SnaB I in the nucleotide sequences including codon 167. A total of 138 adult male H. contortus were collected from three different geo-climatic areas of Iran. The isolated genomic DNA of each single worm was amplified by PCR using primers flanking codon 167. The PCR product (527 bp was then amplified by semi-nested PCR using the UT-HC167 MF-primer and the reverse primer achiev­ing a PCR product of 451 bp in length. This PCR product was subsequently digested with the restriction endonucleases SnaB I and TaaI for analysis of the mutations at codons 167 and 200, respec­tively.Results: All worms had two alleles encoding for phenylalanine (BZss homozygote for both codons.Conclusion: Using the UT-HC167 MF-primer and a suitable reverse primer designed upstream from codon 200, it is possible to amplify a PCR product which can be used for analysis of the SNPs at all three mentioned codons using RFLP.

  12. Crystal structure of a sodium, zinc and iron(III-based non-stoichiometric phosphate with an alluaudite-like structure: Na1.67Zn1.67Fe1.33(PO43

    Directory of Open Access Journals (Sweden)

    Jamal Khmiyas

    2015-06-01

    Full Text Available The new title compound, disodium dizinc iron(III tris(phosphate, Na1.67Zn1.67Fe1.33(PO43, which belongs to the alluaudite family, has been synthesized by solid-state reactions. In this structure, all atoms are in general positions except for four, which are located on special positions of the C2/c space group. This structure is characterized by cation substitutional disorder at two sites, one situated on the special position 4e (2 and the other on the general position 8f. The 4e site is partially occupied by Na+ [0.332 (3], whereas the 8f site is entirely filled by a mixture of Fe and Zn. The full-occupancy sodium and zinc atoms are located at the Wyckoff positions on the inversion center 4a (-1 and on the twofold rotation axis 4e, respectively. Refinement of the occupancy ratios, bond-valence analysis and the electrical neutrality requirement of the structure lead to the given composition for the title compound. The three-dimensional framework of this structure consists of kinked chains of edge-sharing octahedra stacked parallel to [10-1]. The chains are formed by a succession of trimers based on [ZnO6] octahedra and the mixed-cation FeIII/ZnII [(Fe/ZnO6] octahedra [FeIII:ZnIII ratio 0.668 (3/0.332 (3]. Continuous chains are held together by PO4 phosphate groups, forming polyhedral sheets perpendicular to [010]. The stacked sheets delimit two types of tunnels parallel to the c axis in which the sodium cations are located. Each Na+ cation is coordinated by eight O atoms. The disorder of Na in the tunnel might presage ionic mobility for this material.

  13. Intracoronary Cytoprotective Gene Therapy: A Study of VEGF-B167 in a Pre-Clinical Animal Model of Dilated Cardiomyopathy.

    Science.gov (United States)

    Woitek, Felix; Zentilin, Lorena; Hoffman, Nicholas E; Powers, Jeffery C; Ottiger, Isabel; Parikh, Suraj; Kulczycki, Anna M; Hurst, Marykathryn; Ring, Nadja; Wang, Tao; Shaikh, Farah; Gross, Polina; Singh, Harinder; Kolpakov, Mikhail A; Linke, Axel; Houser, Steven R; Rizzo, Victor; Sabri, Abdelkarim; Madesh, Muniswamy; Giacca, Mauro; Recchia, Fabio A

    2015-07-14

    Vascular endothelial growth factor (VEGF)-B activates cytoprotective/antiapoptotic and minimally angiogenic mechanisms via VEGF receptors. Therefore, VEGF-B might be an ideal candidate for the treatment of dilated cardiomyopathy, which displays modest microvascular rarefaction and increased rate of apoptosis. This study evaluated VEGF-B gene therapy in a canine model of tachypacing-induced dilated cardiomyopathy. Chronically instrumented dogs underwent cardiac tachypacing for 28 days. Adeno-associated virus serotype 9 viral vectors carrying VEGF-B167 genes were infused intracoronarily at the beginning of the pacing protocol or during compensated heart failure. Moreover, we tested a novel VEGF-B167 transgene controlled by the atrial natriuretic factor promoter. Compared with control subjects, VEGF-B167 markedly preserved diastolic and contractile function and attenuated ventricular chamber remodeling, halting the progression from compensated to decompensated heart failure. Atrial natriuretic factor-VEGF-B167 expression was low in normally functioning hearts and stimulated by cardiac pacing; it thus functioned as an ideal therapeutic transgene, active only under pathological conditions. Our results, obtained with a standard technique of interventional cardiology in a clinically relevant animal model, support VEGF-B167 gene transfer as an affordable and effective new therapy for nonischemic heart failure. Copyright © 2015 American College of Cardiology Foundation. Published by Elsevier Inc. All rights reserved.

  14. The SERTS-97 Rocket Experiment on Study Activity on the Sun: Flight 36.167-GS on 1997 November 18

    Science.gov (United States)

    Swartz, Marvin; Condor, Charles E.; Davila, Joseph M.; Haas, J. Patrick; Jordan, Stuart D.; Linard, David L.; Miko, Joseph J.; Nash, I. Carol; Novello, Joseph; Payne, Leslie J.; hide

    1999-01-01

    This paper describes mainly the 1997 version of the Solar EUV Rocket Telescope and Spectrograph (SERTS-97), a scientific experiment that operated on NASA's suborbital rocket flight 36.167-GS. Its function was to study activity on the Sun and to provide a cross calibration for the CDS instrument on the SOHO satellite. The experiment was designed, built, and tested by the Solar Physics Branch of the Laboratory for Astronomy and Solar Physics at the Goddard Space Flight Center (GSFC). Other essential sections of the rocket were built under the management of the Sounding Rockets Program Office. These sections include the electronics, timers, IGN despin, the SPARCS pointing controls, the S-19 flight course correction section, the rocket motors, the telemetry, ORSA, and OGIVE.

  15. Lithium adsorptive properties of a new selective adsorbent derived from Li1.33Mn1.67O4

    International Nuclear Information System (INIS)

    Miyai, Yoshitaka; Ooi, Kenta; Nishimura, Tomonobu; Kumamoto, Jyunji.

    1994-01-01

    A new selective adsorbent was prepared by the acid treatment of Li 1.33 Mn 1.67 O 4 with spinel structure, followed by granulation with PVC as a binder. The adsorbent showed the highest capacities for lithium from seawater ; the equilibrium lithium uptakes reached 25.5 mg·g -1 by the powdered adsorbent and 18 mg·g -1 by the granulated one at 25degC. The column adsorption study with the granulated adsorbent (diameter 0.7-1.4mm) showed that the lithium uptake reached about 14 mg·g -1 by passing seawater for 30 days. This lithium content is nearly equal to that of lithium ore. Although the lithium adsorption capacity of the granulated adsorbent decreased slightly by repeating the adsorption-desorption cycle, it kept a high capacity as well as a high strength abrasion during the repetition of 10 cycles. (author)

  16. Magnetic and transport properties of Nd1.67Sr0.33NiO4

    International Nuclear Information System (INIS)

    Zaghrioui, M.; Giovannelli, F.; Pruvost, S.; Poirot, N.; Monot-Laffez, I.

    2006-01-01

    Nd 1.67 Sr 0.33 NiO 4 polycrystals have been prepared by modified sol-gel method and subsequent annealing. X-ray diffraction analysis, electrical resistivity, magnetic susceptibility and thermal magnetisation have been measured. Rietveld analyses show a tetragonal or pseudo-tetragonal K 2 NiF 4 -type structure. The resistivity measurements present a change in conduction mode close to 230 K, which corresponds to the charge ordering temperature. Below this temperature, the material adopts a variable range hopping conduction mode; and above, the conduction follows adiabatic thermal activated mode. The magnetic measurements show paramagnetic behaviour in the range of 80-300 K. Moreover, the magnetic susceptibility data show a sign of the charge ordering transition about 230 K

  17. Search for a new X(16.7) boson and dark photons in the NA64 experiment at CERN

    CERN Document Server

    Banerjee, D.; Chumakov, A.G.; Cooke, D.; Crivelli, P.; Depero, E.; Dermenev, A.V.; Donskov, S.V.; Dusaev, R.R.; Enik, T.; Charitonidis, N.; Feshchenko, A.; Frolov, V.N.; Gardikiotis, A.; Gerassimov, S.G.; Gninenko, SN; Hösgen, M.; Jeckel, M.; Karneyeu, A.E.; Kekelidze, G.; Ketzer, B.; Kirpichnikov, D.V.; Kirsanov, M.M.; Konorov, I.V.; Kovalenko, S.G.; Kramarenko, V.A.; Kravchuk, L.V.; Krasnikov, N.V.; Kuleshov, S.V.; Lyubovitskij, V.E.; Lysan, V.; Matveev, V.A.; Mikhailov, Yu.V.; Peshekhonov, D.V.; Polyakov, V.A.; Radics, B.; Rojas, R.; Rubbia, A.; Samoylenko, V.D.; Tikhomirov, V.O.; Tlisov, D.A.; Toropin, A.N.; Trifonov, A.Yu.; Vasilishin, B.I.; Vasquez Arenas, G.; Volkov, P.V.; Volkov, V.; Ulloa, P.

    2018-06-09

    We report the first results on a direct search for a new 16.7 MeV boson (X) which could explain the anomalous excess of e+e- pairs observed in the excited 8Be* nucleus decays. Due to its coupling to electrons, the X could be produced in the bremsstrahlung reaction e-Z -> e-ZX by a 100 GeV e- beam incident on an active target in the NA64 experiment at the CERN SPS and observed through the subsequent decay into a e+e- pair. With 5.4x10^10 electrons on target no evidence for such decays was found, allowing to set first limits on the X-e- coupling in the range 1.3x10^-4 e+e- of the bremsstrahlung A' with a mass < 23 MeV.

  18. Observation and investigation of narrow optical transitions of 167Er3+ ions in femtosecond laser printed waveguides in 7LiYF4 crystal

    Science.gov (United States)

    Minnegaliev, M. M.; Dyakonov, I. V.; Gerasimov, K. I.; Kalinkin, A. A.; Kulik, S. P.; Moiseev, S. A.; Saygin, M. Yu; Urmancheev, R. V.

    2018-04-01

    We produced optical waveguides in the 167Er3+:7 LiYF4 crystal with diameters ranging from 30 to 100 μm by using the depressed-cladding approach with femtosecond laser. Stationary and coherent spectroscopy was performed on the 809 nm optical transitions between the hyperfine sublevels of 4I15/2 and 4I9/2 multiplets of 167Er3+ ions both inside and outside of waveguides. It was found that the spectra of 167Er3+ were slightly broadened and shifted inside the waveguides compared to the bulk crystal spectra. We managed to observe a two-pulse photon echo on this transition and determined phase relaxation times for each waveguide. The experimental results show that the created crystal waveguides doped by rare-earth ions can be used in optical quantum memory and integrated quantum schemes.

  19. 42 CFR 137.168 - May the Secretary require audit or accounting standards other than those specified in § 137.167?

    Science.gov (United States)

    2010-10-01

    ... SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Audits and Cost Principles § 137.168 May the Secretary require audit or accounting standards other than those specified in § 137.167? No, no other audit... 42 Public Health 1 2010-10-01 2010-10-01 false May the Secretary require audit or accounting...

  20. 26 CFR 1.167(a)-12 - Depreciation based on class lives for property first placed in service before January 1, 1971.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation based on class lives for property... (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(a)-12 Depreciation based on class... section provides an elective class life system for determining the reasonable allowance for depreciation...

  1. Gender differences of suicides in children and adolescents: Analysis of 167 suicides in a Mexican population from 2003 to 2013.

    Science.gov (United States)

    Aguilar-Velázquez, Daniela Georgina; González-Castro, Thelma Beatriz; Tovilla-Zárate, Carlos Alfonso; Juárez-Rojop, Isela E; López-Narváez, Maria Lilia; Frésan, Ana; Hernández-Díaz, Yazmin; Guzmán-Priego, Crystell Guadalupe

    2017-12-01

    Suicide is the second cause of death in youth population. The aim of the present study was to analyze demographic characteristics and suicide methods used, as well as to identify gender differences among Mexican children and adolescents (aged 10-17 years) that committed suicide. Between January 2003 and December 2013, 167 suicides of children and adolescents between 10 and 17 years of age were documented by the Secretary of Health of the state of Tabasco, Mexico. All sociodemographic characteristics were compared according to gender. Our sample included 67.7% males and 32.3% females (male to female 2.1:1). The predominant marital status was single (89.6%) and hanging (93.7%) was the principal method of suicide used. Both female and male adolescents were predominantly students (50%); however, female adolescents were more frequently married (17%) and were housewives (26.4%). Our results identified that hanging is the principal suicide method used by children and adolescents in Mexican population; we also detected main gender differences in terms of poisoning/drug toxicity as the method used, occupation and marital status. These results should be taken into consideration when designing suicide prevention programs due to the differences found by gender. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Different collectivity in the two signatures of the i13/2 stemming band in 167Yb

    International Nuclear Information System (INIS)

    Petkov, P; Gladnishki, K A; Dewald, A; Fransen, C; Hackstein, M; Jolie, J; Pissulla, Th; Rother, W; Zell, K O; Möller, O; Reese, M; Deloncle, I

    2014-01-01

    Six lifetimes have been determined in the 5/2 + [642] band from vi 13/2 parentage in 167 Yb by means of Recoil distance Doppler-shift (RDDS) measurements carried out at the Cologne FN tandem. The deduced transition strengths and the level scheme are reasonably described by Particle plus triaxial rotor model (PTRM) calculations except for the behavior of the quadrupole collectivity in the two signatures of the 5/2 + [642] band. In that band, the quadrupole collectivity of the favored signature is appreciably larger than this of the unfavored signature. The effect increases with increasing the spin. Naturally, the rigid PTRM cannot explain these features, but the structure of its wave functions suggests a possible solution. It is associated with the enhanced contribution of low-Ω orbitals from vi 13/2 parentage in the favored signature compared to the unfavored one. This could selectively increase the deformation of the favored signature band members and give rise to a dynamic shape coexistence taking place between the two signatures which needs quantitative explanation by future theoretical work.

  3. Effect of Cavitation on Surface Damage of 16.7Cr-10Ni-2Mo Stainless Steel in Marine Environment

    Energy Technology Data Exchange (ETDEWEB)

    Chong, Sang-Ok; Han, Min-Su; Kim, Seong-Jong [Mokpo National Maritime University, Mokpo (Korea, Republic of)

    2015-10-15

    Stainless steel is generally known to have characteristics of excellent corrosion resistance and durability, but in a marine environment it can suffer from localized corrosion due to the breakdown of passivity film due to chloride ion in seawater. Furthermore, the damage behaviors are sped up under a cavitation environment because of complex damage from electrochemical corrosion and cavitation-erosion. In this study the characteristics of electrochemical corrosion and cavitation erosion behavior were evaluated on 16.7Cr-10Ni-2Mo stainless steel under a cavitation environment in natural seawater. The electrochemical experiments have been conducted at both static conditions and dynamic conditions inducing cavitation with different current density parameters. The surface morphology and damage behaviors were compared after the experiment. After the cavitation test with time variables morphological examinations on damaged specimens were analyzed by using a scanning electron microscope and a 3D microscope. the galvanostatic experiment gave a cleaner surface morphology presented with less damage depth at high current density regions. It is due to the effect of water cavitation peening under the cavitation condition. In the cavitation experiment, with amplitude of 30 μm and seawater temperature of 25 ℃, weight loss and cavitation-erosion damage depth were dramatically increased after 5 hours inducing cavitation.

  4. Atomistic modeling of crystal structure of Ca{sub 1.67}SiH{sub x}

    Energy Technology Data Exchange (ETDEWEB)

    Kovačević, Goran; Persson, Björn [Theoretical Chemistry, P.O.B. 124, Lund University, Lund 22100 (Sweden); Nicoleau, Luc [BASF Construction Solutions GmbH, Advanced Materials and Systems Research, Albert Frank Straße 32, 83304 Trostberg (Germany); Nonat, André [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 6303 CNRS-Université de Bourgogne, BP 47870, F-21078 Dijon Cedex (France); Veryazov, Valera, E-mail: valera.veryazov@teokem.lu.se [Theoretical Chemistry, P.O.B. 124, Lund University, Lund 22100 (Sweden)

    2015-01-15

    The atomic structure of calcium-silicate-hydrate (C{sub 1.67}-S-H{sub x}) has been investigated by theoretical methods in order to establish a better insight into its structure. Three models for C-S-H all derived from tobermorite are proposed and a large number of structures were created within each model by making a random distribution of silica oligomers of different size within each structure. These structures were subjected to structural relaxation by geometry optimization and molecular dynamics steps. That resulted in a set of energies within each model. Despite an energy distribution between individual structures within each model, significant energy differences are observed between the three models. The C-S-H model related to the lowest energy is considered as the most probable. It turns out to be characterized by the distribution of dimeric and pentameric silicates and the absence of monomers. This model has mass density which is closest to the experimental one.

  5. IAA-Ala Resistant3, an evolutionarily conserved target of miR167, mediates Arabidopsis root architecture changes during high osmotic stress

    KAUST Repository

    Kinoshita, Natsuko

    2012-09-01

    The functions of microRNAs and their target mRNAs in Arabidopsis thaliana development have been widely documented; however, roles of stress-responsive microRNAs and their targets are not as well understood. Using small RNA deep sequencing and ATH1 microarrays to profile mRNAs, we identified IAA-Ala Resistant3 (IAR3) as a new target of miR167a. As expected, IAR3 mRNA was cleaved at the miR167a complementary site and under high osmotic stress miR167a levels decreased, whereas IAR3 mRNA levels increased. IAR3 hydrolyzes an inactive form of auxin (indole-3-acetic acid [IAA]-alanine) and releases bioactive auxin (IAA), a central phytohormone for root development. In contrast with the wild type, iar3 mutants accumulated reduced IAA levels and did not display high osmotic stress-induced root architecture changes. Transgenic plants expressing a cleavage-resistant form of IAR3 mRNA accumulated high levels of IAR3 mRNAs and showed increased lateral root development compared with transgenic plants expressing wild-type IAR3. Expression of an inducible noncoding RNA to sequester miR167a by target mimicry led to an increase in IAR3 mRNA levels, further confirming the inverse relationship between the two partners. Sequence comparison revealed the miR167 target site on IAR3 mRNA is conserved in evolutionarily distant plant species. Finally, we showed that IAR3 is required for drought tolerance. © 2012 American Society of Plant Biologists. All rights reserved.

  6. IAA-Ala Resistant3, an evolutionarily conserved target of miR167, mediates Arabidopsis root architecture changes during high osmotic stress

    KAUST Repository

    Kinoshita, Natsuko; Wang, Huan; Kasahara, Hiroyuki; Liu, Jun; MacPherson, Cameron R.; Machida, Yasunori; Kamiya, Yuji; Hannah, Matthew A.; Chuaa, Nam Hai

    2012-01-01

    The functions of microRNAs and their target mRNAs in Arabidopsis thaliana development have been widely documented; however, roles of stress-responsive microRNAs and their targets are not as well understood. Using small RNA deep sequencing and ATH1 microarrays to profile mRNAs, we identified IAA-Ala Resistant3 (IAR3) as a new target of miR167a. As expected, IAR3 mRNA was cleaved at the miR167a complementary site and under high osmotic stress miR167a levels decreased, whereas IAR3 mRNA levels increased. IAR3 hydrolyzes an inactive form of auxin (indole-3-acetic acid [IAA]-alanine) and releases bioactive auxin (IAA), a central phytohormone for root development. In contrast with the wild type, iar3 mutants accumulated reduced IAA levels and did not display high osmotic stress-induced root architecture changes. Transgenic plants expressing a cleavage-resistant form of IAR3 mRNA accumulated high levels of IAR3 mRNAs and showed increased lateral root development compared with transgenic plants expressing wild-type IAR3. Expression of an inducible noncoding RNA to sequester miR167a by target mimicry led to an increase in IAR3 mRNA levels, further confirming the inverse relationship between the two partners. Sequence comparison revealed the miR167 target site on IAR3 mRNA is conserved in evolutionarily distant plant species. Finally, we showed that IAR3 is required for drought tolerance. © 2012 American Society of Plant Biologists. All rights reserved.

  7. Tb3O2Cl[SeO3]2 and Tb5O4Cl3[SeO3]2: Oxide Chloride Oxoselenates(IV) of Trivalent Terbium with ''Lone-Pair'' Channel or Layer Structures

    International Nuclear Information System (INIS)

    Wontcheu, Joseph; Schleid, Thomas

    2005-01-01

    Orthorhombic Tb 3 O 2 Cl[SeO 3 ] 2 (Pnma; a = 535.16(4), b = 1530.51(9), c = 1081.72(7) pm; Z = 4) is formed by reacting a stoichiometric mixture of Tb 4 O 7 , Tb, TbCl 3 , and SeO 2 in a suitable molar ratio (12: 8: 7: 42) within seven days in an evacuated sealed silica tube at 850 C. The needle-shaped, colourless single crystals (light, water and air stable) exhibit one-dimensional strands [(Tb1) 3/3 (Tb2) 2/1 O 4/2 ] 5+ [O 2 Tb 3 ] 5+ along [100] formed by two parallel chains [OTb 4/2 ] 4+ of trans-edge connected [OTb 4 ] 10+ tetrahedra (d(O-Tb) = 220 - 231 pm) which share an extra edge per chain link. The crystal structure contains two crystallographically different Tb 3+ cations: Tb1 is coordinated as bicapped trigonal prism, while Tb2 resides in square antiprismatic coordination. The Se 4+ coordination is best described as Ψ 1 tetrahedral ([SeO 3 E] 2- ; E: non-binding electron pair). The non-binding ''lone-pair'' electrons of four [SeO 3 ] 2- groups and two Cl - anions form pseudo-hexagonal empty channels along [100] between four cationic double chains. Tb 5 O 4 Cl 3 [SeO 3 ] 2 was prepared likewise as plate-like, colourless single crystals by solid-state reaction of an admixture of Tb 4 O 7 , Tb, TbOCl, TbCl 3 , and SeO 2 (molar ratio: 9: 6: 21: 7: 28) in an evacuated sealed silica tube during seven days at 850 C. This compound crystallizes in the monoclinic system (C2/m; a = 1229.13(9), b = 546.17(4), c = 978.79(7) pm, β = 90.485(6) ; Z = 2) and contains three crystallographically different Tb 3+ cations in seven- and eightfold coordination of O 2- and Cl - anions, respectively. The crystal structure of Tb 5 O 4 Cl 3 [SeO 3 ] 2 is layered and built up of corrugated terbium-oxygen sheets [O 4 Tb 5 ] 7+ formed by edge- and vertex-shared [OTb 4 ] 10+ tetrahedra (d(O-Tb) = 226-232 pm) spreading parallel (001). The structure is strongly related to the ''lone-pair'' channel structures of Tb 2 O[SeO 3 ] 2 and Tb 3 O 2 Cl[SeO 3 ] 2 , where single ([OTb 2 ] 4

  8. High-pressure synthesis of the first ternary melilite-type compound Sc{sub 1.67}B{sub 3}O{sub 7}

    Energy Technology Data Exchange (ETDEWEB)

    Schmitt, Martin K.; Huppertz, Hubert [Institut fuer Allgemeine, Anorganische und Theoretische Chemie, Universitaet Innsbruck (Austria); Ploner, Kevin [Institut fuer Physikalische Chemie, Universitaet Innsbruck (Austria); Hejny, Clivia [Institut fuer Mineralogie und Petrographie, Universitaet Innsbruck (Austria)

    2017-12-13

    Sc{sub 1.67}B{sub 3}O{sub 7} was synthesized in a high-pressure/high-temperature experiment at 3.5 GPa/1200 C employing a Walker-type multianvil module. The compound was characterized with X-ray diffraction and vibrational spectroscopy. It crystallizes in the tetragonal, acentric space group P42{sub 1}m (no. 113) with the lattice parameters a = 6.6597(4) and c = 4.4364(3) Aa. Sc{sub 1.67}B{sub 3}O{sub 7} is the first ternary compound adopting the melilite-type structure and therefore the simplest representative of this manifold structure family. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Magnon energies and exchange interactions in terbium

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden

    1968-01-01

    The magnon density of states, and hence the magnetic contribution to the specific heat, and also the exchange interaction between ions in the same sublattice have been calculated for Tb at 90°K, using experimental results obtained by inelastic neutron scattering.......The magnon density of states, and hence the magnetic contribution to the specific heat, and also the exchange interaction between ions in the same sublattice have been calculated for Tb at 90°K, using experimental results obtained by inelastic neutron scattering....

  10. Magnon lifetimes in terbium at low temperatures

    International Nuclear Information System (INIS)

    Bjerrum Moeller, H.; Mackintosh, A.R.

    1979-01-01

    The lifetimes of magnons propagating in the c-direction of Tb at 4.2 K have been measured by inelastic neutron scattering. In contrast to the behaviour at higher temperatures, where magnon-magnon scattering predominates, the broadening of the magnons increases towards the boundary of the single Brillouin zone, both in the acoustic and optical branches. This suggests that the scattering of the magnons by conduction electrons is important, and the observed lifetimes are consistent with a recent estimate of the magnitude of this effect. The acoustic magnons of very long wavelength behave anomalously, presumably due to dipolar interactions

  11. Spin-glass transition in disordered terbium

    International Nuclear Information System (INIS)

    Hauser, J.J.

    1985-01-01

    While crystalline Tb is a helix antiferromagnet with a Neel temperature of 229 K which becomes ferromagnetic at 222 K, disordered Tb exhibits a spin-glass transition. The spin-glass freezing temperature ranges from 183 to 53 K, the lowest temperatures corresponding to the greatest degree of atomic disorder. These experiments constitute the first evidence for an elemental spin-glass. (author)

  12. Spectroscopic analysis of lithium terbium tetrafluoride

    DEFF Research Database (Denmark)

    Christensen, H.P.

    1978-01-01

    The absorption spectra of Tb3+ in LiTbF4 have been recorded in the spectral interval from 4000 to 25000 cm-1 and for temperatures between 2.3 and 150 K. This covers the transitions from the ground multiplet 7F6 to the multiplets 7F3, 7F2, 7F1, 7F0, and 5D4. The transitions were predominantly of e...

  13. The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

    International Nuclear Information System (INIS)

    Butabaev, Yu.S.

    1994-01-01

    The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

  14. Preparation, optical, and photocatalytic studies of defect pyrochlores: KCr{sub 0.33}W{sub 1.67}O{sub 6} and A{sub x}Cr{sub 0.33}W{sub 1.67}O{sub 6}{center_dot}nH{sub 2}O

    Energy Technology Data Exchange (ETDEWEB)

    Ravi, G.; Veldurthi, Naveen Kumar [Osmania University, Department of Chemistry (India); Prasad, Muvva D. [University of Hyderabad, School of Chemistry (India); Muniratnam, N. R. [Centre for Materials Electronics Technology (C-MET) (India); Prasad, G. [Osmania University, Department of Physics (India); Vithal, M., E-mail: mugavithal@gmail.com [Osmania University, Department of Chemistry (India)

    2013-09-15

    Nano sized defect pyrochlores of compositions KCr{sub 0.33}W{sub 1.67}O{sub 6} and A{sub x}Cr{sub 0.33}W{sub 1.67}O{sub 6}{center_dot}nH{sub 2}O (A = Sn, Ag, Bi, Sm, Eu, and Gd) have been synthesized by sol-gel and ion exchange methods, respectively. These oxides were characterized by thermogravimetric analysis, powder X-ray diffraction, energy dispersive spectra, transmission electron microscopy, UV-Vis diffuse reflectance spectra, Raman spectra, and Fourier transform infrared spectra. Spontaneous exchange of K{sup +} with A ion is accompanied by insertion of water also into the lattice. KCr{sub 0.33}W{sub 1.67}O{sub 6} and A{sub x}Cr{sub 0.33}W{sub 1.67}O{sub 6}{center_dot}nH{sub 2}O crystallize in cubic lattice and isomorphous with KSbWO{sub 6}. The optical properties of Cr{sup 3+} were investigated. Substitution of K{sup +} by A ion leads to a shift of absorption onset to longer wavelengths marginally. The Raman spectra of all the samples are characteristic of defect pyrochlore system. The photocatalytic degradation of methylene blue aqueous solution was investigated using these oxides. The results obtained were fitted with the Langmuir-Hinshelwood model to study the degradation kinetics. Both Sn{sup 2+} and Bi{sup 3+}-doped KCr{sub 0.33}W{sub 1.67}O{sub 6} exhibit higher photoactivity in the degradation of methylene blue. The structure/composition of the photocatalyst remains the same even after fourth cycle of photodegradation.

  15. C-Terminal Substitution of HBV Core Proteins with Those from DHBV Reveals That Arginine-Rich 167RRRSQSPRR175 Domain Is Critical for HBV Replication

    Science.gov (United States)

    Kim, Taeyeung; Shin, Bo-Hye; Park, Gil-Soon; Park, Sun; Chwae, Yong-Joon; Shin, Ho-Joon; Kim, Kyongmin

    2012-01-01

    To investigate the contributions of carboxyl-terminal nucleic acid binding domain of HBV core (C) protein for hepatitis B virus (HBV) replication, chimeric HBV C proteins were generated by substituting varying lengths of the carboxyl-terminus of duck hepatitis B virus (DHBV) C protein for the corresponding regions of HBV C protein. All chimeric C proteins formed core particles. A chimeric C protein with 221–262 amino acids of DHBV C protein, in place of 146–185 amino acids of the HBV C protein, supported HBV pregenomic RNA (pgRNA) encapsidation and DNA synthesis: 40% amino acid sequence identity or 45% homology in the nucleic-acid binding domain of HBV C protein was sufficient for pgRNA encapsidation and DNA synthesis, although we predominantly detected spliced DNA. A chimeric C protein with 221–241 and 251–262 amino acids of DHBV C, in place of HBV C 146–166 and 176–185 amino acids, respectively, could rescue full-length DNA synthesis. However, a reciprocal C chimera with 242–250 of DHBV C (242RAGSPLPRS 250) introduced in place of 167–175 of HBV C (167RRRSQSPRR 175) significantly decreased pgRNA encapsidation and DNA synthesis, and full-length DNA was not detected, demonstrating that the arginine-rich 167RRRSQSPRR175 domain may be critical for efficient viral replication. Five amino acids differing between viral species (underlined above) were tested for replication rescue; R169 and R175 were found to be important. PMID:22911745

  16. Hb Matera (HBB: c.167 T > A): A Second Case Detected in a Pregnant Chinese Woman by the Capillary Electrophoresis Method.

    Science.gov (United States)

    Li, You-qiong; Ye, Li-Hua; Mo, Yun

    2016-01-01

    Hb Matera (HBB: c.167 T > A) is an unstable β-globin gene variant with an ATG > AAG substitution at codon 55. Its coelution with Hb A2 on high performance liquid chromatography (HPLC) makes it difficult to discriminate between Hb Matera and Hb E (HBB: c.79 G > A) that also coelutes with Hb A2 in this method. However, we found that capillary electrophoresis (CE) was able to detect Hb Matera and discriminate it from Hb E, based on the quantification of the peaks and on hematological parameters.

  17. Comparison Between Several Integrase-defective Lentiviral Vectors Reveals Increased Integration of an HIV Vector Bearing a D167H Mutant

    Directory of Open Access Journals (Sweden)

    Muhammad Qamar Saeed

    2014-01-01

    Full Text Available HIV-1 derived vectors are among the most efficient for gene transduction in mammalian tissues. As the parent virus, they carry out vector genome insertion into the host cell chromatin. Consequently, their preferential integration in transcribed genes raises several conceptual and safety issues. To address part of these questions, HIV-derived vectors have been engineered to be nonintegrating. This was mainly achieved by mutating HIV-1 integrase at functional hotspots of the enzyme enabling the development of streamlined nuclear DNA circles functional for transgene expression. Few integrase mutant vectors have been successfully tested so far for gene transfer. They are cleared with time in mitotic cells, but stable within nondividing retina cells or neurons. Here, we compared six HIV vectors carrying different integrases, either wild type or with different mutations (D64V, D167H, Q168A, K186Q+Q214L+Q216L, and RRK262-264AAH shown to modify integrase enzymatic activity, oligomerization, or interaction with key cellular cofactor of HIV DNA integration as LEDGF/p75 or TNPO3. We show that these mutations differently affect the transduction efficiency as well as rates and patterns of integration of HIV-derived vectors suggesting their different processing in the nucleus. Surprisingly and most interestingly, we report that an integrase carrying the D167H substitution improves vector transduction efficiency and integration in both HEK-293T and primary CD34+ cells.

  18. 16.7 W 885 nm diode-side-pumped actively Q -switched Nd:YAG/YVO4 intracavity Raman laser at 1176 nm

    International Nuclear Information System (INIS)

    Jiang, Pengbo; Zhang, Guizhong; Liu, Jian; Ding, Xin; Sheng, Quan; Sun, Bing; Shi, Rui; Wu, Liang; Yao, Jianquan; Yu, Xuanyi; Wang, Rui

    2017-01-01

    We proposed and experimentally demonstrated the generation of high-power 1176 nm Stokes wave by frequency shifting of a 885 nm diode-side-pumped Nd:YAG laser using a YVO 4 crystal in a Z -shaped cavity configuration. Employing the 885 nm diode-side-pumped scheme and the Z -shaped cavity, for the first time to our knowledge, we realized the thermal management effectively, achieving excellent 1176 nm Stokes wave consequently. With an incident pump power of ∼190.0 W, a maximum average output power of 16.7 W was obtained at the pulse repetition frequency of 10 kHz. The pulse duration and spectrum linewidth of the Stokes wave at the maximum output power were 20.3 ns and ∼0.08 nm, respectively. (paper)

  19. Synthesize and Analysis of Li1.33Mn1.67O4 as Adsorbent for Lithium Extraction of Lumpur Sidoarjo

    Science.gov (United States)

    Noerochim, L.; Kistiyanto, W. P.; Susanti, D.; Purwaningsih, H.; Widodo, A.

    2017-07-01

    Li1.33Mn1.67O4 (LMO) was successfully synthesized by solid state reaction method at temperature variation of 500, 600, and 700 °C. As-prepared samples are immersed in 1 lt 0.5M HCL for 24 hours to create vacant site for lithium ion. Lithium extraction process is employed by soaking the adsorbent LMO in 1 lt of Lumpur Sidoarjo for 24 hrs. SEM images of adsorbent with variation of calcination temperature show irregular shape with particles size in the range of 15-52 μm. The calcination temperature effects on the size of the grain and crystallinity of adsorbent. LMO 700 sample has the highest capacity of lithium adsorption with capacity of 29.8 mg/g. It is attributed to the high crystalline of LMO 700 sample compared with other samples.

  20. Powder neutron diffraction study on Pb2Sr2YCu3O8+δ(δ = 0.0 and 1.67)

    International Nuclear Information System (INIS)

    Fujishita, Hideshi; Sato, Masatoshi; Morii, Yukio; Funahashi, Satoru.

    1993-01-01

    Powder neutron diffraction patterns of Pb 2 Sr 2 YCu 3 O 8+δ (δ = 0.0 and 1.67) were analyzed by Rietveld method. For δ = 0, it had been indicated, by powder X-ray diffraction, that the structure was a monoclinic one. The R factors of the present analysis for the monoclinic structure were about 3/4 of those for the previous orthorhombic ones. The structure was almost the same as the previous X-ray result except z (02). For the annealed phase, the tetragonal and the orthorhombic structures had been presented by X-ray diffraction and by neutron diffraction, respectively. The R factors of the present analysis for the orthorhombic structure were about 5/6 of those for the tetragonal structure. The distance between the Pb plane and the oxygen deficient Cu plane was found to become larger in proportion to δ, though there occurs a phase separation in low δ region. (author)

  1. Magnetic and transport properties of Nd{sub 1.67}Sr{sub 0.33}NiO{sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Zaghrioui, M. [Laboratoire d' Electrodynamique des Materiaux Avances, UMR 6157 CNRS-CEA, Universite Francois Rabelais, IUT de Blois, C.S. 2903, 3 place Jean Jaures 41029 Blois cedex (France)]. E-mail: zaghrioui@univ-tours.fr; Giovannelli, F. [Laboratoire d' Electrodynamique des Materiaux Avances, UMR 6157 CNRS-CEA, Universite Francois Rabelais, IUT de Blois, C.S. 2903, 3 place Jean Jaures 41029 Blois cedex (France); Pruvost, S. [Laboratoire d' Electrodynamique des Materiaux Avances, UMR 6157 CNRS-CEA, Universite Francois Rabelais, IUT de Blois, C.S. 2903, 3 place Jean Jaures 41029 Blois cedex (France); Poirot, N. [Laboratoire d' Electrodynamique des Materiaux Avances, UMR 6157 CNRS-CEA, Universite Francois Rabelais, IUT de Blois, C.S. 2903, 3 place Jean Jaures 41029 Blois cedex (France); Monot-Laffez, I. [Laboratoire d' Electrodynamique des Materiaux Avances, UMR 6157 CNRS-CEA, Universite Francois Rabelais, IUT de Blois, C.S. 2903, 3 place Jean Jaures 41029 Blois cedex (France)

    2006-10-15

    Nd{sub 1.67}Sr{sub 0.33}NiO{sub 4} polycrystals have been prepared by modified sol-gel method and subsequent annealing. X-ray diffraction analysis, electrical resistivity, magnetic susceptibility and thermal magnetisation have been measured. Rietveld analyses show a tetragonal or pseudo-tetragonal K{sub 2}NiF{sub 4}-type structure. The resistivity measurements present a change in conduction mode close to 230 K, which corresponds to the charge ordering temperature. Below this temperature, the material adopts a variable range hopping conduction mode; and above, the conduction follows adiabatic thermal activated mode. The magnetic measurements show paramagnetic behaviour in the range of 80-300 K. Moreover, the magnetic susceptibility data show a sign of the charge ordering transition about 230 K.

  2. Effect of Xe ion (167 MeV) irradiation on polycrystalline SiC implanted with Kr and Xe at room temperature

    International Nuclear Information System (INIS)

    Hlatshwayo, T T; Kuhudzai, R J; Njoroge, E G; Malherbe, J B; O’Connell, J H; Skuratov, V A; Msimanga, M

    2015-01-01

    The effect of swift heavy ion (Xe 167 MeV) irradiation on polycrystalline SiC individually implanted with 360 keV Kr and Xe ions at room temperature to fluences of 2  ×  10 16 cm −2 and 1  ×  10 16 cm −2 respectively, was investigated using transmission electron microscopy (TEM), Raman spectroscopy and Rutherford backscattering spectrometry (RBS). Implanted specimens were each irradiated with 167 MeV Xe +26 ions to a fluence of 8.3  ×  10 14 cm −2 at room temperature. It was observed that implantation of 360 keV Kr and Xe ions individually at room temperature amorphized the SiC from the surface up to a depth of 186 and 219 nm respectively. Swift heavy ion (SHI) irradiation reduced the amorphous layer by about 27 nm and 30 nm for the Kr and Xe samples respectively. Interestingly, the reduction in the amorphous layer was accompanied by the appearance of randomly oriented nanocrystals in the former amorphous layers after SHI irradiation in both samples. Previously, no similar nanocrystals were observed after SHI irradiations at electron stopping powers of 33 keV nm −1 and 20 keV nm −1 to fluences below 10 14 cm −2 . Therefore, our results suggest a fluence threshold for the formation of nanocrystals in the initial amorphous SiC after SHI irradiation. Raman results also indicated some annealing of radiation damage after swift heavy ion irradiation and the subsequent formation of small SiC crystals in the amorphous layers. No diffusion of implanted Kr and Xe was observed after swift heavy ion irradiation. (paper)

  3. [Comparative analysis of TACE alone or plus RFA in the treatment of 167 cases of intermediate and advanced staged primary hepatocellular carcinoma].

    Science.gov (United States)

    Zhao, Ming; Wang, Jian-peng; Wu, Pei-hong; Zhang, Fu-jun; Huang, Zi-lin; Li, Wang; Zhang, Liang; Pan, Chang-chuan; Li, Chuan-xing; Jiang, Yong

    2010-11-09

    To evaluate the clinical efficacy and survival rate of transarterial chemoembolization (TACE) alone or plus radiofrequency ablation (RFA) in patients with intermediate or advanced stage primary hepatocellular carcinoma (HCC). In this retrospective study, 467 cases received RFA or TACE plus RFA. Among them, 167 cases with strict clinical procedure (TACE alone or plus RFA) and complete follow-up data were included. Eighty-seven cases received TACE and 80 cases had TACE plus RFA between January 2000 and December 2006. Hierarchical analyses were performed using log-rank tests and survival curve was estimated by Kaplan-Meier method. A total of 167 patients received TACE alone or plus RFA for a follow-up period of 1 to 89 months. In the TACE alone group, the time-to-progression (TTP) was an average of 3.6 months. The median survival was 13 months, one-year survival rate 52.9%, three-year survival rate 11.5% and five-year survival rate 4.6%. In the TACE plus RFA group, the TTP time was an average of 10.8 months. The median survival time was 30 months, one-year survival rate 85.0%, three-year survival rate 45.0% and five-year survival rate 11.3%. In the TACE alone group, the median survival of intermediate stage HCC was 14 months, one-year survival rate 62.2%, three-year survival rate 13.3% and five-year survival rate 4.4%; In the TACE plus RFA group, the median survival of intermediate stage HCC was 14 months, one-year survival rate 90.1%, three-year survival rate 52.9% and five-year survival rate 13.7%. All differences of two groups has statistical significance (P advanced stage HCC, the median survival time was 12 months, one-year survival rate 35%, three-year survival rate 7.1% and five-year survival rate 0 in the TACE alone group versus 28 months, 62.1%, 24.1% and 6.9% in the TACE plus RFA group (P = 0.00). There was significantly statistic difference between both groups in intermediate and advanced staging HCC. Among them, 60/485 (12.4%) patients required a therapy

  4. Genetic variation in codons 167, 198 and 200 of the beta-tubulin gene in whipworms (Trichuris spp.) from a range of domestic animals and wildlife

    DEFF Research Database (Denmark)

    Hansen, Tina Vicky Alstrup; Nejsum, Peter; Olsen, Annette

    2013-01-01

    A recurrent problem in the control of whipworm (Trichuris spp.) infections in many animal species and man is the relatively low efficacy of treatment with a single application of benzimidazoles (BZs). The presence of single nucleotide polymorphisms (SNPs) in codons 167, 198 and 200 in the beta...

  5. Blue light alters miR167 expression and microRNA-targeted auxin response factor genes in Arabidopsis thaliana plants.

    Science.gov (United States)

    Pashkovskiy, Pavel P; Kartashov, Alexander V; Zlobin, Ilya E; Pogosyan, Sergei I; Kuznetsov, Vladimir V

    2016-07-01

    The effect of blue LED (450 nm) on the photomorphogenesis of Arabidopsis thaliana Col-0 plants and the transcript levels of several genes, including miRNAs, photoreceptors and auxin response factors (ARF) was investigated. It was observed that blue light accelerated the generative development, reduced the rosette leaf number, significantly reduced the leaf area, dry biomass and led to the disruption of conductive tissue formation. The blue LED differentially influenced the transcript levels of several phytochromes (PHY a, b, c, d, and e), cryptochromes (CRY 1 and 2) and phototropins (PHOT 1 and 2). At the same time, the blue LED significantly increased miR167 expression compared to a fluorescent lamp or white LEDs. This increase likely resulted in the enhanced transcription of the auxin response factor genes ARF4 and ARF8, which are regulated by this miRNA. These findings support the hypothesis that the effects of blue light on A. thaliana are mediated by auxin signalling pathway involving miRNA-dependent regulation of ARF gene expression. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  6. Gas Cerenkov detector for measuring 16.7-MeV gamma rays from the D(T,γ)5He reaction

    International Nuclear Information System (INIS)

    Brolley, J.E.; Ladish, J.S.; Lyons, P.B.

    1983-01-01

    A gas Cerenkov detector has been developed for measuring radiation from the 16.7-MeV gamma branch of the D-T reaction. This has useful applications as a diagnostic tool for weapons tests at the Nevada Test Site (NTS), as well as for evaluation of ICF targets and Tokomak plasmas. The Cerenkov process was chosen because of excellent time response. A gas radiator allows threshold control to eliminate low-energy background, such as gamma radiation produced by a neutron capture or scattering. The detector consists of a thin aluminum converter to provide energetic pair and Compton electrons, a deflecting magnet, a Cerenkov radiator, and an optical system for collection and detection of Cerenkov light. The radiator is a gas chamber filled with approximately one atmosphere of carbon dioxide. A photodiode is used for light detection. The electron beam from the DOE/EG and G electron linear accelerator at EG and G's Santa Barbara Operations has been used to measure the detector response as functions of electron energy and gas pressure. A Monte Carlo production-transport code is used to calculate geometrical properties of the pair and Compton electron distributions as they enter the Cerenkov radiator. Fluorescence, transition radiation, and other optical backgrounds produced by subthreshold electrons are being evaluated in order to optimize the detector design

  7. Sequential fission process observed in the reaction (16.7 MeV/u) 238U + nat.Au using mica as dielectric track detector

    International Nuclear Information System (INIS)

    Shahzad, Muhammad Ikram; Qureshi, Imtinan Elahi; Manzoor, Shahid; Khan, Hameed Ahmed

    1999-01-01

    The evidence of sequential fission has been found in the heavy-ion reaction (16.7 MeV/u) 238 U + nat. Au, using muscovite mica as Dielectric Track Detector (DTD) placed in a 2π-geometry configuration. The reaction products originating from the interactions of 238 U ions with the atoms of gold were registered in the detector in the form of tracks and identified for performing a detailed kinematical analysis. For this purpose the spherical polar coordinates of the correlated tracks of the multipronged events have been analyzed on an event-by-event basis. Automatic, semi-automatic and manual measuring methods have been employed to collect and manipulate the track data. The known characteristics of binary and ternary events observed in the reaction have been used for the calibration of the detectors. The computed masses, Q-values and relative velocities of the reaction products determined in this analysis are compared with theoretical predictions based on sequential fission process. Agreement within one standard deviation with respect to the experimental values has been found for the majority of analyzed events. Therefore, it is concluded that three particles in the exit channel of the reaction are produced in two successive steps. In the first step of the reaction, two intermediate nuclei are formed as a result of an inelastic collision between projectile and target atoms while in the second step the fission of one of the intermediate nuclei of the previous step takes place. Furthermore no proximity effects have been observed

  8. Carrier frequency of GJB2 gene mutations c.35delG, c.235delC and c.167delT among the populations of Eurasia.

    Science.gov (United States)

    Dzhemileva, Lilya U; Barashkov, Nikolay A; Posukh, Olga L; Khusainova, Rita I; Akhmetova, Vita L; Kutuev, Ildus A; Gilyazova, Irina R; Tadinova, Vera N; Fedorova, Sardana A; Khidiyatova, Irina M; Lobov, Simeon L; Khusnutdinova, Elza K

    2010-11-01

    Hearing impairment is one of the most common disorders of sensorineural function and the incidence of profound prelingual deafness is about 1 per 1000 at birth. GJB2 gene mutations make the largest contribution to hereditary hearing impairment. The spectrum and prevalence of some GJB2 mutations are known to be dependent on the ethnic origin of the population. This study presents data on the carrier frequencies of major GJB2 mutations, c.35delG, c.167delT and c.235delC, among 2308 healthy persons from 18 various populations of Eurasia: Russians, Bashkirs, Tatars, Chuvashes, Udmurts, Komi-Permyaks and Mordvins (Volga-Ural region of Russia); Belarusians and Ukrainians (East Europe); Abkhazians, Avars, Cherkessians and Ingushes (Caucasus); Kazakhs, Uighurs and Uzbeks (Central Asia); and Yakuts and Altaians (Siberia). The data on c.35delG and c.235delC mutation prevalence in the studied ethnic groups can be used to investigate the prospective founder effect in the origin and prevalence of these mutations in Eurasia and consequently in populations around the world.

  9. MiR-218-targeting-Bmi-1 mediates the suppressive effect of 1,6,7-trihydroxyxanthone on liver cancer cells.

    Science.gov (United States)

    Fu, Wei-Ming; Tang, Li-Peng; Zhu, Xiao; Lu, Ying-Fei; Zhang, Yan-Ling; Lee, Wayne Yuk-Wai; Wang, Hua; Yu, Yang; Liang, Wei-Cheng; Ko, Chun-Hay; Xu, Hong-Xi; Kung, Hsiang-Fu; Zhang, Jin-Fang

    2015-01-01

    Traditional Chinese medicine is recently emerged as anti-cancer therapy or adjuvant with reduced side-effects and improved quality of life. In the present study, an active ingredient, 1,6,7-trihydroxyxanthone (THA), derived from Goodyera oblongifolia was found to strongly suppress cell growth and induce apoptosis in liver cancer cells. MicroRNAs are a group of small non-coding RNAs that regulate gene expression at post-transcriptional levels. Our results demonstrated that miR-218 was up-regulated and oncogene Bmi-1 was down-regulated by THA treatment. Further investigation showed that THA-induced-miR-218 up-regulation could lead to activation of tumor suppressor P16(Ink4a) and P14(ARF), the main down-stream targets of Bmi-1. In conclusion, THA might be a potential anti-cancer drug candidate, at least in part, through the activation of miR-218 and suppression of Bmi-1 expression.

  10. Sequential fission process observed in the reaction (16.7 MeV/u) {sup 238}U + {sup nat.}Au using mica as dielectric track detector

    Energy Technology Data Exchange (ETDEWEB)

    Shahzad, Muhammad Ikram; Qureshi, Imtinan Elahi; Manzoor, Shahid; Khan, Hameed Ahmed

    1999-01-04

    The evidence of sequential fission has been found in the heavy-ion reaction (16.7 MeV/u) {sup 238}U + {sup nat.}Au, using muscovite mica as Dielectric Track Detector (DTD) placed in a 2{pi}-geometry configuration. The reaction products originating from the interactions of {sup 238}U ions with the atoms of gold were registered in the detector in the form of tracks and identified for performing a detailed kinematical analysis. For this purpose the spherical polar coordinates of the correlated tracks of the multipronged events have been analyzed on an event-by-event basis. Automatic, semi-automatic and manual measuring methods have been employed to collect and manipulate the track data. The known characteristics of binary and ternary events observed in the reaction have been used for the calibration of the detectors. The computed masses, Q-values and relative velocities of the reaction products determined in this analysis are compared with theoretical predictions based on sequential fission process. Agreement within one standard deviation with respect to the experimental values has been found for the majority of analyzed events. Therefore, it is concluded that three particles in the exit channel of the reaction are produced in two successive steps. In the first step of the reaction, two intermediate nuclei are formed as a result of an inelastic collision between projectile and target atoms while in the second step the fission of one of the intermediate nuclei of the previous step takes place. Furthermore no proximity effects have been observed.

  11. Frequency distributions of 174 fractures of the distal condyles of the third metacarpal and metatarsal bones in 167 Thoroughbred racehorses (1999-2009).

    Science.gov (United States)

    Jacklin, B D; Wright, I M

    2012-11-01

    Although fractures of the metacarpal and metatarsal condyles are the most common long-bone fractures of Thoroughbred horses in training, limited data on variations in morphology and incidence have been published. Additionally, grouped analyses of previous studies from the UK and USA would permit comparison between study groups and the creation of a substantial pool of international data. Retrospective analysis of case records of horses with fractures of the distal condyles of third metacarpal/metatarsal bones seen over the last 10 years at Newmarket Equine Hospital. The current series was compared with a prior series from the UK; pooled analyses of these, and series from the USA were also compared. One hundred and seventy-four fractures were identified in 167 racehorses. The current series contained a significantly lower proportion of medial condylar fractures than in a similar population 17 years earlier. Fractures that originated more abaxially tended to be shorter, and a significant proportion of lateral condylar fractures arose outside of the condylar groove. There was also some apparent seasonality of fractures of the lateral condyles in 2-year-old horses, but not so in older horses or those with medial condylar fractures. A substantial portion (approximately 50%) of fractures in the present series cannot be explained by unifying theories of aetiopathogenesis, which suggest that fractures usually arise within the condylar groove, as a focus of cumulative fatigue and failure of adaptation of bone. A separate aetiopathogenesis may be responsible for a proportion of condylar fractures encountered in racehorses, and further work is required to elucidate this. Changes in the number of medial condylar fractures encountered may reflect the introduction of artificial racing and training surfaces, and also may reflect changes in the age demographic of horses racing in the UK since the introduction of year-round 'all-weather' racing. © 2012 EVJ Ltd.

  12. Spin dynamics in the low-temperature tetragonal phase of congruent with ( 1/ 8 ) doped single crystal La1.67Eu0.2Sr0.13CuO4

    International Nuclear Information System (INIS)

    Suh, B. J.; Hammel, P. C.; Huecker, M.; Buechner, B.; Ammerahl, U.; Revcolevschi, A.

    2000-01-01

    We present 139 La and 63 Cu NMR relaxation measurements in single crystal La 1.67 Eu 0.2 Sr 0.13 CuO 4 . A strong peak in the 139 La spin-lattice relaxation rate observed in the spin ordered state is well described by the BPP mechanism [Bloembergen, Purcell, and Pound, Phys. Rev. 73, 679 (1948)] and arises from continuous slowing of electronic spin fluctuations with decreasing temperature; these spin fluctuations exhibit XY-like anisotropy in the ordered state. The spin pseudogap is significantly enhanced by the static charge-stripe order in the LTT phase. (c) 2000 The American Physical Society

  13. The systems terbium (holmium) nitrate-piperidine nitrate-water

    International Nuclear Information System (INIS)

    Khisaeva, D.A.; Zhuravlev, E.F.; Semenova, Eh.B.

    1982-01-01

    Using the method of cross sections at 25 and 50 deg C solubility in the systems Tb(NO 3 ) 2 -C 5 H 10 NHxHNO 3 -H 2 O and Ho(NO 3 ) 3 -C 5 H 10 NHxHNO 3 -H 2 O has been studied. The systems are characterized by chemical interaction of components. Solubility isotherms have crystallization fields of solid phases of the composition Tb(NO 3 ) 3 x3[C 5 H 10 NHxHNO 3 ]x3H 2 O and Ho(NO 3 ) 3 x2[C 5 H 10 NHxHNO 3 ]. The compounds detected are singled out preparatively, their IR spectra are studied, their thermogravimetric analysis is carried out. Investigation results are compared with similar systems formed by nitrates of other representatives of rare earth group

  14. Analysis of the fourth spectrum of terbium (Tb IV)

    International Nuclear Information System (INIS)

    Spector, N.; Sugar, J.

    1976-01-01

    The low-energy level structure of Tb 3+ has been derived from spectra obtained with a sliding spark light source. The 7 F ground term of the 4f 8 configuration was found as well as all levels of the configurations 4f 7 5d, 6s, and 6p built on the 8 S 7 / 2 core state of 4f 7 . Of the possible 51 lines connecting these levels, 48 were observed. Optimized radial parameters are given for the observed configurations. A value for the ionization energy of 39.37(0.10) eV is derived for Tb 3+

  15. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    tion and solid-state lasers attracted remarkable attention in the last few decades. .... Figure 1. Vis absorption spectrum of 1.0 mol% Tb3+-doped. LBZLFB glass. Figure 2. .... both ions quickly decay non-radiatively to the ground level. The energy ...

  16. Preparation of extractive resins for producing terbium-161

    International Nuclear Information System (INIS)

    De la Cruz B, C. C.; Monroy G, F.

    2009-10-01

    This paper presents the development of a methodology for extractive resins preparation to base of HDEHP, which allows to separation of Tb from Gd generating an own technology of preparation of these resins. The study included the extractive resins preparation from 6 different supports: kieselguhr Dg, alumina, red volcanic rock, chiluca, quarry and fluorite; two treatment types of of supports and varied concentrations of HDEHP extractant (di(2-etil hexyl) orthophosphoric acid), in order to determine which resin has improved efficiency of Gd and Tb separation, and radionuclide purity of 161 Tb. Resins were prepared to base of kieselguhr to determine the most appropriate silicon deposition process. Two silicon deposition treatments were realized: treatment I , by contact with silicon deposition solution (dimethyldichlorosilane / heptane 1:30) and treatment II by contact with vapors of dimethyldichlorosilane in vacuum. The extractant retention was carried out to different concentrations of HDEHP / acetone: 1:4, 1:8, 1:15, 1:20, 1:30 and 1:40. According to the results, there is not direct relation of HDEHP concentration used in extractive resins preparation to base of kieselguhr over the efficiency of Gd and Tb separation and of radionuclide purity of 161 Tb. The effect of support in the efficiency of Gd and Tb separation was studied to prepare resins with the supports kieselguhr, alumina, quarry, chiluca, volcanic rock and fluorite, using the silicon deposition treatment II for the supports and a concentration of HDEHP / acetone 1:20, for extractant retention. Only resins based on kieselguhr could separate to Gd from Tb quantitatively, the resin at a concentration of HDEHP / Acetone 1:20 was the best results obtained in Gd and Tb separation, achieving a separation efficiency greater than 90% and a radionuclide purity higher than 99%. (Author)

  17. Coherent magnetic structures in terbium/holmium superlattices

    DEFF Research Database (Denmark)

    Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

    1997-01-01

    to 230 K, two samples retain this magnetic structure while the third undergoes a transition first to a mixed phase of helically and ferromagnetically ordered Tb moments, then to a phase with only helically ordered To moments. Ln all cases, the magnetic ordering is found to be long ranged, with coherence...

  18. Inelastic scattering of neutrons by spin waves in terbium

    DEFF Research Database (Denmark)

    Bjerrum Møller, Hans; Houmann, Jens Christian Gylden

    1966-01-01

    Measurements of spin-wave dispersion relations for magnons propagating in symmetry directions in ferromagnetic Tb; it is first experiment to give detailed information on magnetic excitations in heavy rare earths; Tb was chosen for these measurements because it is one of few rare-earth metals which...... does not have very high thermal-neutron capture cross section, so that inelastic neutron scattering experiments can give satisfactory information on magnon dispersion relations....

  19. Spin waves in terbium. II. Magnon-phonon interaction

    International Nuclear Information System (INIS)

    Jensen, J.; Houmann, J.G.

    1975-01-01

    The selection rules for the linear couplings between magnons and phonons propagating in the c direction of a simple basal-plane hcp ferromagnet are determined by general symmetry considerations. The acoustic-optical magnon-phonon interactions observed in the heavy-rare-earth metals have been explained by Liu as originating from the mixing of the spin states of the conduction electrons due to the spin-orbit coupling. We find that this coupling mechanism introduces interactions which violate the selection rules for a simple ferromagnet. The interactions between the magnons and phonons propagating in the c direction of Tb have been studied experimentally by means of inelastic neutron scatttering. The magnons are coupled to both the acoustic- and optical-transverse phonons. By studying the behavior of the acoustic-optical coupling, we conclude that it is a spin-mixed-induced coupling as proposed by Liu. The coupled magnon--transverse-phonon system for the c direction of Tb is analyzed in detail, and the strengths of the couplings are deduced as a function of wave vector by combining the experimental studies with the theory

  20. High pressure phases of terbium: Possibility of a thcp phase

    International Nuclear Information System (INIS)

    Staun Olsen, J.; Steenstrup, S.; Gerward, L.

    1985-01-01

    High pressure phases of trivalent Tb studied by energy dispersive X-ray diffraction with synchrotron radiation exhibits the closed packed sequence (hcp -> Sm -> dhcp -> fcc) typical of the trivalent rare earth metals. Furthermore, a phase consistent with a triple hexagonal closed packed (thcp) structure was observed in a narrow pressure range around 30 GPa. (orig.)

  1. Optical spectra and band structure of Ag(x)Ga(x)Ge(1-x)Se2 (x = 0.333, 0.250, 0.200, 0.167) single crystals: experiment and theory.

    Science.gov (United States)

    Reshak, A H; Parasyuk, O V; Fedorchuk, A O; Kamarudin, H; Auluck, S; Chyský, J

    2013-12-05

    Theoretical and experimental studies of the Ag(x)Ga(x)Ge(1-x)Se2 (x = 0.333, 0.250, 0.200, 0.167) single crystals are performed. These crystals possess a lot of intrinsic defects which are responsible for their optoelectronic features. The theoretical investigations were performed by means of DFT calculations using different exchange-correlation potentials. The experimental studies were carried out using the modulated VUV ellipsometry for dielectric constants and birefringence studies. The comparison of the structure obtained from X-ray with the theoretically optimized structure is presented. The crucial role of the intrinsic defect states is manifested in the choice of the exchange correlation potential used. The data may be applicable for a large number of the ternary chalcogenides which are sensitive to the presence of the local disordered states near the band edges.

  2. Publications | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Stakeholder-focused cost-benefit analysis in the water sector : synthesis report ... of a potential "demographic dividend" - surplus generated by the economy that, if. ... Use of inorganic fertilizers could be fundamental in addressing low and ...

  3. Publications | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Background: The Ministry of Health made a breakthrough through delivery care ... women and new mothers in Indonesia who are not covered by any insurance yet. ... Background:The policy of Maternity Benefit for the Uninsured (Jampersal) is ...

  4. Reference: 167 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 3% plastoquinone. Photooxidation of P700 of PSI in the abc4 mutant was not observed, and reduced-versus-oxidized difference spectros...copy indicated that the abc4 mutant had no P700. The maximum quantum yield of photo

  5. Search Results | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    A communication system that can provide health managers with timely surveillance ... and marketing - to boost agricultural productivity and enhance rural livelihoods ... the reach of education to remote locations and non-traditional students.

  6. 25 CFR 167.3 - Objectives.

    Science.gov (United States)

    2010-04-01

    ..., and the building up of those resources where they have deteriorated. (b) The protection of the... grazing lands, and to foster a better relationship and a clearer understanding between the Navajo people... may be established and maintained either on or off the reservation through District Grazing Committee...

  7. Page | 167 RESTORATIVE JUSTICE INTERVENTION IN THE ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Executive arm of government, law makers, leaders of the society, law ..... effect of oil pollution in these areas is so enormous to attract government and .... D. Matza, ; 'Technics of Neutralization: A Theory of Delinquency',: American Sociological.

  8. 167 CURBING PROMISCUOUS HABITS AMONG NIGERIANS ...

    African Journals Online (AJOL)

    . ... belief, usually in a bad way. ... The act may be carried out by physical force, coercion, abuse of authority or ... congenital disorders, death and disability at least, in part due to genetic .... Even if they stick together, the feeling of guilt remains;.

  9. 27 CFR 19.167 - Organizational documents.

    Science.gov (United States)

    2010-04-01

    ... rights of the respective owners or holders. (b) Articles of partnership. Copy of the articles of partnership or association, if any, or certificate of partnership or association where required to be filed by..., or other legal entity, and the nature and amount of the stockholding or other interest of each...

  10. 40 CFR 167.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Federal Insecticide, Fungicide, and Rodenticide Act. In addition, when used in this part, the following terms shall have the meanings stated below: Act means the Federal Insecticide, Fungicide, and... other pesticide production activity is performed at the establishment. Device means any device or class...

  11. A inconstitucionalidade da (DRU sob a luz do inciso XI do artigo 167 da Constituição Social e a falsa idéia do déficit previdenciário

    Directory of Open Access Journals (Sweden)

    Karen Costa Braga

    2015-07-01

    Full Text Available O presente estudo científico tem o nítido propósito de realizar um estudo científico sobre a desvinculação das receitas públicas, no ordenamento jurídico brasileiro, que extirpa do orçamento da Seguridade Social uma parcela de toda a sua arrecadação. Longe de querer esgotar o tema, esta pesquisa faz uma abordagem do constitucionalismo moderno e a figura dos princípios como fonte de interpretação das normas jurídicas além de realizar uma análise dos critérios jurídicos e temporais da instituição da DRU e a sua inconstitucionalidade sob o enfoque do artigo 167 inciso XI do texto constitucional que veda a utilização dos recursos provenientes das contribuições sociais previstas no artigo 195 para pagamento de outras despesas que não os benefícios previdenciários. A tendência seguida no presente artigo científico é a de que, apesar de já decidido pelo Supremo Tribunal Federal a constitucionalidade da DRU, esta questão foi analisada sob o enfoque tributário e não sob o enfoque constitucional-social. É vezo da cultura legislativa-tributária brasileira ignorar a supremacia da Constituição Federal e há, atualmente, recordes de receitas desvinculadas dos cofres do Regime Geral da Previdência Social. Por derradeiro, faz-se uma análise integrativa dos mecanismos utilizados, indevidamente para operacionalizar a atividade estatal e ainda o debate entre o possível engessamento da prática orçamentária rígida e a defasagem dos direitos prestacionais que garantiriam, sob o enfoque dos direitos sociais, o mínimo existencial e a completude da dignidade da pessoa humana.

  12. Saúde autorreferida e qualidade de vida em praticantes de caminhada do programa academia das cidades, Petrolina – PE, Brasil - doi: 10.5020/18061230.2012.p167

    Directory of Open Access Journals (Sweden)

    Jéssica Thayani Santos Brandão

    2012-11-01

    Full Text Available Avaliar a saúde autorreferida (SAR e qualidade de vida (QV em praticantes de caminhada no Programa Academia das Cidades (PAC. Métodos: Estudo transversal descritivo, conduzido com 300 praticantes de caminhada no PAC, em Petrolina-PE, Brasil. Realizou-se entrevista com questões distribuídas em quatro partes: sociodemográficas/ hábitos de vida (idade, sexo, situação conjugal, renda, ocupação e hábitos de vida; saúde autorreferida (escala de 5 pontos sobre a percepção de saúde; qualidade de vida (WHOQOLOMS e informações sobre o PAC e benefícios da caminhada. Resultados: Observou-se idade média de 40,75 (±14,72 e 99 (33,0% sujeitos tinham idade entre 41-60 anos, 208 (69,3% eram mulheres, 166 (55,3% eram casados, 167 (55,7% tinham mais de 12 anos de escolaridade, 106 (35,3% recebiam entre 2-3 salários mínimos, 234 (78,0% trabalhavam e 153 (51,0% praticavam caminhada 3 vezes por semana. A televisão (37,3% foi a principal fonte de informação sobre os benefícios da caminhada e as redes sociais (55,0% forneceram as principais informações sobre a existência do programa que influenciou a maioria (63,7% a iniciar a atividade. Não houve diferença estatisticamente significante nos escores de QV e na SAR, de acordo com a idade, entretanto observou-se que, à medida que aumenta a frequência da caminhada semanal, aumentam os escores de QV e SAR. Conclusão: A caminhada foi importante determinante da promoção da saúde e qualidade de vida, à medida que aumentava a frequência semanal da atividade, cujos benefícios e existência de locais para sua prática foram disseminados pela televisão e pelas redes sociais, respectivamente.

  13. Decision No. 2008-DC-0114 of 26 September 2008 by the French Nuclear Safety Authority Setting Forth Specific Requirements to Be Met by Electricite de France - Societe anonyme (EDF-SA) at the Flamanville Nuclear site Regarding the Design and Construction of the Flamanville-3 (INB No. 167) NPP and the Operation of Flamanville-1 (INB No. 108) and Flamanville-2 (INB No. 109) NPPs

    International Nuclear Information System (INIS)

    2009-01-01

    This decision sets forth the requirements to be met by Electricite de France (EDF-SA), the operator, regarding the design and construction of Basic Nuclear Installation ('installation nucleaire de base' - INB) No. 167 and the operation of INBs Nos. 108 and 109 on the Flamanville Site, Manche Department. The specific requirements applicable to INB No. 167 (Flamanville-3) are described in Annex 1. Common requirements applicable to INBs Nos. 167 (Flamanville 3), 108 (Flamanville 1) and 109 (Flamanville 2) are described in Annex 2. Content of the annex 1 (Requirements applicable to INB No. 167 - Flamanville-3): Organisation and management: Organisation and management, Operations to be declared to or approved by ASN; Accident-risk management: Process control (Nuclear safety demonstration, Compliance of operations, Analysis of internal and external hazards leading to hostile conditions or damages to structures, systems and components, Analysis of hazards caused by the environment of the installation that may induced hostile conditions or damages to structures, systems and components, Probabilistic studies, Specific studies, Environmental qualification of systems, equipment, material and components, Controls or tests performed to comply with the hypotheses used in safety demonstration); Prevention of accident conditions that may lead to large early releases (Core-meltdown situations occurring while the primary circuit is at high pressure, Fuel-meltdown situations in the spent-fuel cooling pool, Reactivity accidents resulting from the rapid introduction in the primary circuit of cold water or of water with an insufficient concentration of soluble neutron absorber, Core-meltdown situations with containment bypass, Global hydrogen detonations and steam explosions likely to compromise the integrity of the reactor containment), Basic nuclear safety functions of the installation (Common provisions, Reactivity control, Cooling of nuclear fuel, Containment of radioactive

  14. Photoluminescence studies of a Terbium(III) complex as a fluorescent probe for DNA detection

    Energy Technology Data Exchange (ETDEWEB)

    Khorasani-Motlagh, Mozhgan, E-mail: mkhorasani@chem.usb.ac.ir; Noroozifar, Meissam; Niroomand, Sona; Moodi, Asieh

    2013-11-15

    The photoluminescence properties of a Tb(III) complex of the form [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] (phen=1,10-phenanthroline) in different solvents are presented. It shows the characteristic luminescence of the corresponding Ln{sup 3+} ion in the visible region. The emission intensity of this complex in coordinating solvent is higher than non-coordinating one. The suggested mechanism for the energy transfer between the ligand and Tb{sup 3+} ion is the intramolecular energy transfer mechanism. The interactions of the Tb(III) complex with fish salmon DNA are studied by fluorescence spectroscopy, circular dichroism study and viscosity measurements. The results of fluorescence titration reveal that DNA strongly quenches the intrinsic fluorescence of the complex through a static quenching procedure. The binding constant (K{sub b}) of the above metal complex at 25 °C is determined by the fluorescence titration method and it is found to be (8.06±0.01)×10{sup 3} M{sup −1}. The thermodynamic parameters (ΔH{sup 0}>0, ΔS{sup 0}>0 and ΔG{sup 0}<0) indicate that the hydrophobic interactions play a major role in DNA–Tb complex association. The results support the claim that the title complex bonds to FS-DNA by a groove mode. -- Highlights: • Photoluminescence of [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] in different solvents are studied. • Tb(III) complex shows good binding affinity to FS DNA with K{sub b}=(8.06±0.01)×10{sup 3} M{sup −1}. • Viscosity of DNA almost unchanged by increasing amount of Tb complex. • CD spectrum of DNA has a little change with increasing amount of Tb complex. • Thermodynamic parameters indicate that the binding reaction is entropically driven.

  15. Selective Sensing of Tyrosine Phosphorylation in Peptides Using Terbium(III Complexes

    Directory of Open Access Journals (Sweden)

    Jun Sumaoka

    2016-01-01

    Full Text Available Phosphorylation of tyrosine residues in proteins, as well as their dephosphorylation, is closely related to various diseases. However, this phosphorylation is usually accompanied by more abundant phosphorylation of serine and threonine residues in the proteins and covers only 0.05% of the total phosphorylation. Accordingly, highly selective detection of phosphorylated tyrosine in proteins is an urgent subject. In this review, recent developments in this field are described. Monomeric and binuclear TbIII complexes, which emit notable luminescence only in the presence of phosphotyrosine (pTyr, have been developed. There, the benzene ring of pTyr functions as an antenna and transfers its photoexcitation energy to the TbIII ion as the emission center. Even in the coexistence of phosphoserine (pSer and phosphothreonine (pThr, pTyr can be efficintly detected with high selectivity. Simply by adding these TbIII complexes to the solutions, phosphorylation of tyrosine in peptides by protein tyrosine kinases and dephosphorylation by protein tyrosine phosphatases can be successfully visualized in a real-time fashion. Furthermore, the activities of various inhibitors on these enzymes are quantitatively evaluated, indicating a strong potential of the method for efficient screening of eminent inhibitors from a number of candidates.

  16. Thermally induced depolarization in terbium gallium garnet ceramics rod with natural convection cooling

    Czech Academy of Sciences Publication Activity Database

    Slezák, Ondřej; Yasuhara, R.; Lucianetti, Antonio; Vojna, David; Mocek, Tomáš

    2015-01-01

    Roč. 17, č. 6 (2015), s. 1-8, č. článku 065610. ISSN 2040-8978 R&D Projects: GA MŠk ED2.1.00/01.0027; GA MŠk EE2.3.20.0143; GA MŠk EE2.3.30.0057 Grant - others:HILASE(XE) CZ.1.05/2.1.00/01.0027; OP VK 6(XE) CZ.1.07/2.3.00/20.0143; OP VK 4 POSTDOK(XE) CZ.1.07/2.3.00/30.0057 Institutional support: RVO:68378271 Keywords : stress-induced birefringence * thermal depolarization * high-power lasers Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.847, year: 2015

  17. Charge-transfer-based terbium MOF nanoparticles as fluorescent pH sensor for extreme acidity.

    Science.gov (United States)

    Qi, Zewan; Chen, Yang

    2017-01-15

    Newly emerged metal organic frameworks (MOFs) have aroused the great interest in designing functional materials by means of its flexible structure and component. In this study, we used lanthanide Tb 3+ ions and small molecular ligands to design and assemble a kind of pH-sensitive MOF nanoparticle based on intramolecular-charge-transfer effect. This kind of made-to-order MOF nanoparticle for H + is highly specific and sensitive and could be used to fluorescently indicate pH value of strong acidic solution via preset mechanism through luminescence of Tb 3+ . The long luminescence lifetime of Tb 3+ allows eliminating concomitant non-specific fluorescence by time-revised fluorescence techniques, processing an advantage in sensing H + in biological media with strong autofluorescence. Our method showed a great potential of MOF structures in designing and constructing sensitive sensing materials for specific analytes directly via the assembly of functional ions/ligands. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Understanding charge carrier relaxation processes in terbium arsenide nanoparticles using transient absorption spectroscopy

    Science.gov (United States)

    Vanderhoef, Laura R.

    Erbium arsenide nanoparticles epitaxially grown within III-V semiconductors have been shown to improve the performance of devices for applications ranging from thermoelectrics to THz pulse generation. The small size of rare-earth nanoparticles suggests that interesting electronic properties might emerge as a result of both spatial confinement and surface states. However, ErAs nanoparticles do not exhibit any signs of quantum confinement or an emergent bandgap, and these experimental observations are understood from theory. The incorporation of other rare-earth monopnictide nanoparticles into III-V hosts is a likely path to engineering carrier excitation, relaxation and transport dynamics for optoelectronic device applications. However, the electronic structure of these other rare-earth monopnictide nanoparticles remains poorly understood. The objective of this research is to explore the electronic structure and optical properties of III-V materials containing novel rare-earth monopnictides. We use ultrafast pump-probe spectroscopy to investigate the electronic structure of TbAs nanoparticles in III-V hosts. We start with TbAs:GaAs, which was expected to be similar to ErAs:GaAs. We study the dynamics of carrier relaxation into the TbAs states using optical pump terahertz probe transient absorption spectroscopy. By analyzing how the carrier relaxation rates depend on pump fluence and sample temperature, we conclude that the TbAs states are saturable. Saturable traps suggest the existence of a bandgap for TbAs nanoparticles, in sharp contrast with previous results for ErAs. We then apply the same experimental technique to two samples of TbAs nanoparticles in InGaAs with different concentrations of TbAs. We observe similar relaxation dynamics associated with trap saturation, though the ability to resolve these processes is contingent upon a high enough TbAs concentration in the sample. We have also constructed an optical pump optical probe transient absorption spectroscopy system to allow complimentary measurements to be taken on these materials in the near future.

  19. Luminescence properties of terbium-doped Li 3 PO 4 phosphor for ...

    Indian Academy of Sciences (India)

    A polycrystalline sample of Li 3 PO 4 :Tb 3 + phosphor was successfully synthesized using solid-state diffusion method. This synthesis method is of low cost, low temperature and does not require any other atmospheres for the synthesis. The powder X-ray diffraction (PXRD), photoluminescence (PL) emission and excitation ...

  20. Novel Luminescent Probe Based on a Terbium(III) Complex for Hemoglobin Determination

    Science.gov (United States)

    Yegorova, A. V.; Leonenko, I. I.; Aleksandrova, D. I.; Scrypynets, Yu. V.; Antonovich, V. P.; Ukrainets, I. V.

    2014-09-01

    We have studied the spectral luminescent properties of Tb(III) and Eu(III) complexes with a number of novel derivatives of oxoquinoline-3-carboxylic acid amides (L1-L5 ). We have observed quenching of the luminescence of 1:1 Tb(III)-L1-5 complexes by hemoglobin (Hb), which is explained by resonance energy transfer of electronic excitation from the donor (Tb(III)-L1-5 ) to the acceptor (Hb). Using the novel luminescent probe Tb(III)-L1, we have developed a method for determining Hb in human blood. The calibration Stern-Volmer plot is linear in the Hb concentration range 0.6-36.0 μg/mL, detection limit 0.2 μg/mL (3·10-9 mol/L).

  1. Spin waves in terbium. III. Magnetic anisotropy at zero wave vector

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden; Jensen, J.; Touborg, P.

    1975-01-01

    The energy gap at zero wave vector in the spin-wave dispersion relation of ferromagnetic. Tb has been studied by inelastic neutron scattering. The energy was measured as a function of temperature and applied magnetic field, and the dynamic anisotropy parameters were deduced from the results...... the effects of zero-point deviations from the fully aligned ground state, and we tentatively propose polarization-dependent two-ion couplings as their origin........ The axial anisotropy is found to depend sensitively on the orientation of the magnetic moments in the basal plane. This behavior is shown to be a convincing indication of considerable two-ion contributions to the magnetic anisotropy at zero wave vector. With the exception of the sixfold basal...

  2. Field-impressed anisotropy of susceptibility in iron-terbium thin films

    International Nuclear Information System (INIS)

    Stephenson, A.; Booth, N.A.

    1995-01-01

    Two thin films of Fe 1-x Tb x where x=0.17 and 0.23 are shown to exhibit the effect of field-impressed anisotropy. After application of a direct field of 80 mT, which gives them an isothermal remanent magnetization (IRM) in their plane, the anisotropy of initial susceptibility differs from that measured after the films have been tumble-demagnetized. By subtracting the susceptibility results of the tumble-demagnetized state from those obtained after the application of the 80 mT direct field, it is shown that the effect of this field is to decrease the susceptibility measured along the former applied field direction and to increase the susceptibility at right angles to this. The effect is almost certainly due to changes in domain alignment. Even though these films contain many domains, the above results are similar to those previously obtained for single-domain γFe 2 O 3 and magnetite particles. The sense of the effect is opposite to that for multi-domain magnetite particles where the susceptibility has been found to increase along the previously applied field direction. ((orig.))

  3. Spallation of terbium by 170 MeV protons. First part: qualitative study

    International Nuclear Information System (INIS)

    Olkowsky, J.; Le Pape, M.; Gratot, I.; Cohen, L.

    1959-01-01

    The products of the reaction Tb+p (170 MeV) have been studied by radiochemical methods. For each element, α, β, γ and X rays have been studied and results compared to literature data. The cross sections will be given in a further work. We observe a new alpha emitter of gadolinium, half-life 7 h, with the following γ-rays: X (43 keV), 220 keV, 340 keV, 550 keV, 720 keV. New γ-rays are given: 155 Tb: 480 keV; 880 keV 146 Eu (38 h): 125 keV; 570 keV 147 Eu: 570 keV 145 Eu: 180 keV. Reprint of a paper published in 'Le journal de physique et le radium', tome 20, N. 5, may 1959, p. 549-556 [fr

  4. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    ... of faster and multiple readout, very high sensitivity, absence of thermal quenching and possible use of phosphor in plastic binders [3–15]. ... synthesis technique was developed to reduce the time required for the synthesis, which was about.

  5. Effect of terbium substitution on the magnetocaloric properties of Gd3Ga5O12

    International Nuclear Information System (INIS)

    Reshmi, C.P.; Savitha Pillai, S.; Varma, Manoj Raama; Suresh, K.G.

    2011-01-01

    The magnetic refrigeration is an environment friendly cooling technology based on magnetocaloric effect. The most crucial ingredient behind a magnetic refrigerator is a magnetic material which possesses large magnetocaloric effect. Certain materials when placed in a magnetic field suddenly get heats up and suddenly cooled down by the application and the removal of magnetic field due to their change in entropy. This is measured either in terms of isothermal entropy change and adiabatic temperature change observed when the applied magnetic field is varied. The refrigerators which operate below 15K have applications in liquefying helium and for the development of space based cooling system for the space crafts. The material of choice in this temperature range is rare earth gallium garnets. Rare earth garnets are complex ceramic oxides having the chemical formula A 3 B 2 C 3 O 12 have attracted attention due to their interesting magnetic properties. The magnetism in R 3 Ga 5 O 12 is due to the exchange interaction between the rare earth spins. In the proposed work we have chosen Gd 3 Ga 5 O 12 as parent material, substituted Tb systematically in the place of Gd. The structural studies were done by using Rietveld analysis of X-Ray diffraction. There is a systematic variation of volume and lattice parameter upon substitution of Tb. The magnetic characterizations were done by a vibrating sample magnetometer. The experimental magnetic moments of the materials were calculated from the M-T curve by using Curie-Weiss fit and are good agreement with the theoretical values. There is a systematic increase of magnetic moments by Tb substitution. The magnetocaloric effect is calculated by using the integrated Maxwell's relation from the magnetization data. At low magnetic fields the Tb substituted compounds show good MCE values than GGG. Tb substitution enhances the magnetocaloric effect at low magnetic fields and the ΔS M values are higher for x = 1 and 3 at 1T. Hence these materials can be used as refrigerants for future cryogenic applications. (author)

  6. Determination of adenosine disodium triphosphate using prulifloxacin-terbium(III) as a fluorescence probe by spectrofluorimetry

    International Nuclear Information System (INIS)

    Yu Fengshan; Li Lin; Chen Fang

    2008-01-01

    A new spectrofluorimetric method is developed for determination of adenosine disodium triphosphate (ATP). The interactions between prulifloxacin (PUFX)-Tb 3+ complex and adenosine disodium triphosphate has been studied by using UV-vis absorption and fluorescence spectra. Using prulifloxacin-Tb 3+ as a fluorescence probe, under the optimum conditions, ATP can remarkably enhance the fluorescence intensity of the prulifloxacin-Tb 3+ complex at λ = 545 nm and the enhanced fluorescence intensity is in proportion to the concentration of ATP. Optimum conditions for the determination of ATP were also investigated. The dynamic range for the determination of ATP is 4.0 x 10 -7 to 2.0 x 10 -5 mol L -1 , and the detection limit (3 σ/k) is 1.7 x 10 -8 mol L -1 . This method is simple, practical and relatively free interference from coexisting substances and can be successfully applied to determination of ATP in real pharmaceutical samples. The mechanism of fluorescence enhancement of prulifloxacin-Tb 3+ complex by ATP was also discussed

  7. Assessment of terbium (III) as a luminescent probe for the detection of tuberculosis biomarkers

    International Nuclear Information System (INIS)

    Bamogo, W.; Mugherli, L.; Banyasz, A.; Novelli-Rousseau, A.; Mallard, F.; Tran-Thi, T.-H.

    2015-01-01

    A detection method for nicotinic acid, a specific metabolite marker of Mycobacterium tuberculosis present in cultures and patients' breath, is studied in complex solutions containing other metabolites and in biological media such as urine, saliva and breath condensate. The method is based on the analysis of the luminescence increase of Tb 3+ complexes in the presence of nicotinic acid due to the energy transfer from the excited ligand to the lanthanide ion. It is shown that other potential markers found in M. tuberculosis culture supernatant, such as methyl phenylacetate, p-methyl anisate, methyl nicotinate and 2-methoxy biphenyl, can interfere with nicotinic acid via a competitive absorption of the excitation photons. A new strategy to circumvent these interferences is proposed with an upstream trapping of volatile markers preceding the detection of nicotinic acid in the liquid phase via the luminescence of Tb 3+ complexes. The cost of the method is evaluated and compared with the Xpert MTB/RIF test endorsed by the World Health Organization. - Highlights: • Nicotinic acid, a specific marker of M. tuberculosis, can be detected via luminescence. • The detection limit with a commercial phosphorimeter is 0.4 µmol·L -1 . • Other metabolites of M. tuberculosis can interfere via absorbed excitation light. • The interference can be removed via trapping of the most volatile metabolites. • A breath analysis procedure's cost is compared with the Xpert TBM/RIF test.

  8. Assessment of terbium (III) as a luminescent probe for the detection of tuberculosis biomarkers

    Energy Technology Data Exchange (ETDEWEB)

    Bamogo, W. [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Mugherli, L. [CEA, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Banyasz, A. [CNRS, IRAMIS, LIDyL/Laboratoire Francis Perrin, URA 2453, F-91191 Gif-sur-Yvette (France); Novelli-Rousseau, A.; Mallard, F. [BioMérieux SA, F-38000 Grenoble (France); Tran-Thi, T.-H., E-mail: thu-hoa.tran-thi@cea.fr [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France)

    2015-10-08

    A detection method for nicotinic acid, a specific metabolite marker of Mycobacterium tuberculosis present in cultures and patients' breath, is studied in complex solutions containing other metabolites and in biological media such as urine, saliva and breath condensate. The method is based on the analysis of the luminescence increase of Tb{sup 3+} complexes in the presence of nicotinic acid due to the energy transfer from the excited ligand to the lanthanide ion. It is shown that other potential markers found in M. tuberculosis culture supernatant, such as methyl phenylacetate, p-methyl anisate, methyl nicotinate and 2-methoxy biphenyl, can interfere with nicotinic acid via a competitive absorption of the excitation photons. A new strategy to circumvent these interferences is proposed with an upstream trapping of volatile markers preceding the detection of nicotinic acid in the liquid phase via the luminescence of Tb{sup 3+} complexes. The cost of the method is evaluated and compared with the Xpert MTB/RIF test endorsed by the World Health Organization. - Highlights: • Nicotinic acid, a specific marker of M. tuberculosis, can be detected via luminescence. • The detection limit with a commercial phosphorimeter is 0.4 µmol·L{sup -1}. • Other metabolites of M. tuberculosis can interfere via absorbed excitation light. • The interference can be removed via trapping of the most volatile metabolites. • A breath analysis procedure's cost is compared with the Xpert TBM/RIF test.

  9. Influence of dysprosium and terbium additions on aluminium structure and properties

    International Nuclear Information System (INIS)

    Fridlyander, I.N.; Sokolovskaya, E.M.; Zimina, E.N.; Tkachenko, E.A.; Artemova, M.S.

    1992-01-01

    The influence of 0.3%Dy and 0.3%Tb additions were investigated on grain size in aluminium ingots and on recrystallization and mechanical properties in 1.5 mm thick sheets. Grain refinement in ingots was revealed along with an increase of sheet recrystallization temperature and grain growth retardation in the process of secondary recrystallization. Ultimate strength was found to rise at some decrease of specific elongation

  10. Optical lines in europium-terbium double activated calcium tungstate phosphor

    Energy Technology Data Exchange (ETDEWEB)

    Nazarov, M.V. [Department of Material Science and Engineering, Korea Advanced Institute of Science and Technology, 373-1 Guseong-dong, Yuseong-gu, Daejeon 305-701 (Korea, Republic of); Tsukerblat, B.S. [Department of Chemistry, Ben-Gurion University of the Negev, 84105 Beer-Sheva (Israel)]. E-mail: tsuker@bgumail.bgu.ac.il; Popovici, E.-J. [' Raluca Ripan' Institute for Research in Chemistry, Cluj-Napoca (Romania); Jeon, D.Y. [Department of Material Science and Engineering, Korea Advanced Institute of Science and Technology, 373-1 Guseong-dong, Yuseong-gu, Daejeon 305-701 (Korea, Republic of)

    2004-09-20

    The Letter is devoted to the problem of the optical anisotropy of the rare-earth ions occupying low-symmetry positions in crystals. The crystal field multiplets arising from LSJ terms of Eu{sup 3+} and Tb{sup 3+} ions in the crystal field of calcium tungstate scheelite (CaWO{sub 4}) are analyzed with regard to the experimental data on the low temperature photoluminescence and cathodoluminescence spectra. The selection rules as well as an angular (polarization) dependence of the two-photon absorption are discussed.

  11. Magneto-optical studies of valence instability in europium and terbium phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Rodrigues, Lucas C.V. [Department of Chemistry, University of Turku, FI-20014 Turku (Finland); Instituto de Química, Universidade de São Paulo, São Paulo, -SP (Brazil); Hölsä, Jorma [Department of Chemistry, University of Turku, FI-20014 Turku (Finland); Instituto de Química, Universidade de São Paulo, São Paulo, -SP (Brazil); Turku University Centre for Materials and Surfaces (MatSurf) (Finland); University of the Free State, Department of Physics, Bloemfontein (South Africa); Brito, Hermi F. [Instituto de Química, Universidade de São Paulo, São Paulo, -SP (Brazil); Maryško, Miroslav [Institute of Physics, The Academy of Sciences of the Czech Republic, Cukrovarnická 10, CZ-162 53 Praha 6 (Czech Republic); Matos, Jivaldo R. [Instituto de Química, Universidade de São Paulo, São Paulo, -SP (Brazil); Paturi, Petriina [Wihuri Physical Laboratory, Department of Physics and Astronomy, University of Turku, FI-20014 Turku (Finland); Rodrigues, Rodrigo V. [Instituto de Química, Universidade de São Paulo, São Paulo, -SP (Brazil); Lastusaari, Mika, E-mail: miklas@utu.fi [Department of Chemistry, University of Turku, FI-20014 Turku (Finland); Turku University Centre for Materials and Surfaces (MatSurf) (Finland)

    2016-02-15

    The impurities and dopants' inappropriate valences may deteriorate the performance of luminescent materials, cause waste of the precious rare earth (R) material and thus incur financial losses. The usual methods to detect the valence of rare earths; XPS, Mössbauer and XANES spectroscopies, are not sensitive enough for low concentrations and the EPR methods are not very suitable for powders. In this work, the comparison between the theoretical and experimental temperature-dependent paramagnetic susceptibilities was used to obtain quantitatively the concentrations of the impurity valence in Eu{sub 2}O{sub 2}S and Tb{sub 2}O{sub 2}SO{sub 4}, both containing nominally only R{sup 3+}. Minute (ppm level) Eu{sup 2+} impurities could be analyzed because of the huge difference in the paramagnetic susceptibility between Eu{sup 2+} and Eu{sup 3+} at low temperatures. However, temperatures below 50 K are then needed whilst the Tb{sup IV} impurity in a Tb{sup 3+} matrix can be observed already at higher temperatures. The latter method based on comparing the slopes of the Tb{sup 3+}/Tb{sup IV} paramagnetic susceptibility vs temperature curves for the Tb{sup 3+}/Tb{sup IV} couple is less sensitive than for the Eu{sup 2+}/Eu{sup 3+} one. Finally, the host independent temperature evolution of the paramagnetic susceptibility was calculated for Gd{sup 3+} (or Eu{sup 2+} or Tb{sup IV}) to yield a simple analytical expression to be used universally. - Highlights: • Wave functions for Eu{sup 3+}/Tb{sup 3+} with crystal field effect calculated for oxysulfide/sulfate. • Paramagnetic susceptibility between 4 and 300 K simulated for 4f{sup 6/7/8} configurations. • Amount of valence impurities (Eu{sup 2+} and Tb{sup IV}) evaluated from susceptibility data. • Waste of raw materials and loss of luminescence intensity of phosphors can be avoided.

  12. Luminescent properties of terbium complexes with catecholamines and their application in analysis

    International Nuclear Information System (INIS)

    Kravchenko, T.B.; Bel'tyukova, S.V.; Kononenko, L.I.; Poluehktov, N.S.

    1982-01-01

    Tb complexing with a representative of catecholamines - adrenaline - is studied using the luminescence method. It is found, that the complexing takes place in alkaline medium (pH 12.0). To prevent from compound oxidation with air oxygen and to create the necessary pH in solution sodium borohydride is used. The highest luminescence intensity is achieved when the reaction occurs in aqueous-isopropanol solutions. It is established that in the complexes formed the ratio of components is the following: Tb:adrenaline=1:3. Luminescent properties of Tb complex with adrenaline are used to determine the latter. The least detectable amount of adrenaline constitutes 0.02 μg, the determination error does not exceed 5.5% [ru

  13. Effective photosensitized energy transfer of nonanuclear terbium clusters using methyl salicylate derivatives.

    Science.gov (United States)

    Omagari, Shun; Nakanishi, Takayuki; Seki, Tomohiro; Kitagawa, Yuichi; Takahata, Yumie; Fushimi, Koji; Ito, Hajime; Hasegawa, Yasuchika

    2015-03-12

    The photophysical properties of the novel nonanuclear Tb(III) clusters Tb-L1 and Tb-L2 involving the ligands methyl 4-methylsalicylate (L1) and methyl 5-methylsalicylate (L2) are reported. The position of the methyl group has an effect on their photophysical properties. The prepared nonanuclear Tb(III) clusters were identified by fast atom bombardment mass spectrometry and powder X-ray diffraction. Characteristic photophysical properties, including photoluminescence spectra, emission lifetimes, and emission quantum yields, were determined. The emission quantum yield of Tb-L1 (Φ(ππ*) = 31%) was found to be 13 times larger than that of Tb-L2 (Φ(ππ*) = 2.4%). The photophysical characterization and DFT calculations reveal the effect of the methyl group on the electronic structure of methylsalicylate ligand. In this study, the photophysical properties of the nonanuclear Tb(III) clusters are discussed in relation to the methyl group on the aromatic ring of the methylsalicylate ligand.

  14. Synthetic shibkovite K(K{sub 1.67}H{sub 2}O{sub 0.33})(Ca{sub 1.3}Na{sub 0.7})[Zn{sub 3}Si{sub 12}O{sub 30}]: the crystal structure and comparative crystal chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Kiriukhina, G. V., E-mail: g-biralo@yandex.ru; Yakubovich, O. V.; Dimitrova, O. V. [Moscow State University, Faculty of Geology (Russian Federation)

    2015-01-15

    The structure of a single crystal of a synthetic analog of mineral shibkovite K(K{sub 1.67}H{sub 2}O{sub 0.33})(Ca{sub 1.3}Na{sub 0.7})[Zn{sub 3}Si{sub 12}O{sub 30}] (milarite structure type) obtained by hydrothermal synthesis in the AlPO{sub 4}-K{sub 3}PO{sub 4}-CaCO{sub 3}-Na{sub 2}CO{sub 3}-ZnCO{sub 3}-SiO{sub 2}-H{sub 2}O system has been solved (R = 0.0406) by X-ray diffraction analysis: a = 10.5327(2) Å, c = 14.2019(3) Å, sp. gr. P6/mcc, Z = 2, and ρ{sub calcd} = 2.90 g/cm{sup 3}. The crystal-chemical features of the new phase are studied in comparison with the other terms of the milarite group. It is shown that the crystallization conditions for minerals and synthetic analogs of this group determine the presence or absence of crystallization water in the structures of compounds.

  15. Measurement of the 209Bi(n ,4 n )206Bi and 169Tm(n ,3 n )167Tm cross sections between 23.5 and 30.5 MeV relevant to reaction-in-flight neutron studies at the National Ignition Facility

    Science.gov (United States)

    Gooden, M. E.; Bredeweg, T. A.; Champine, B.; Combs, D. C.; Finch, S.; Hayes-Sterbenz, A.; Henry, E.; Krishichayan, Rundberg, R.; Tornow, W.; Wilhelmy, J.; Yeamans, C.

    2017-08-01

    At the National Ignition Facility, experiments are being performed to measure charged-particle stopping powers in the previously unexplored warm dense plasma regime. These measurements are done using reaction-in-flight (RIF) neutrons from an inertial confinement fusion system. RIF neutrons are produced with a continuum of energies up to 30 MeV. By making activation measurements utilizing threshold reactions for neutrons in the energy range of 15 167Tm reaction has been used. However, in an effort to provide a secondary complimentary measurement, efforts are underway to make use of the 209Bi(n ,4 n )206Bi reaction, with a threshold of 22.5 MeV. The cross sections were measured at the 10 MV tandem Van De Graaff accelerator at the Triangle Universities Nuclear Laboratory with quasimonoenergetic neutrons between 23.5 and 30.5 MeV, where few previous measurements have been made. Cross-section data are compared to calculations and other available measurements.

  16. What we do | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This knowledge can be used as a tool for addressing pressing global challenges. We share it with ... There has been dramatic growth in telecentres and other local information and communication technology (ICT) projects in Sri Lanka. Sri Lanka ... Multinational Tobacco Companies and Tobacco Consumption (China).

  17. 167-- 8 Dec 2009.indd [FINAL VESION].indd

    African Journals Online (AJOL)

    2009-12-08

    Dec 8, 2009 ... canonical scriptures – in the reformed tradition – and were therefore deemed unworthy of dogma and proclamation (Kaiser 2004:6). They could be used for teaching – as the Belgic Confession states – but this rarely, if at all, happened in a reformed congregation. However, a few factors have contributed to a ...

  18. 40 CFR 161.167 - Discussion of formation of impurities.

    Science.gov (United States)

    2010-07-01

    ... present in his product at any time before use at a level equal to or greater than 0.1 percent (1000 ppm... at any time before use at a level equal to or greater than 0.1 percent (1000 ppm) by weight of the...) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES Product Chemistry Data...

  19. 167 APPLICABILITY OF THE DOCTRINE OF RES IPSA LOQUITUR ...

    African Journals Online (AJOL)

    Fr. Ikenga

    for treatment, and there is an implied term of contract that a doctor will exercise reasonable care and skill in the treatment of his patient. According to Halsbury's Law of England,14. A person who holds himself out as ready to give medical advice or treatment impliedly undertakes that he is possessed of skill and knowledge ...

  20. MO-A-BRC-01: TG167 Report - Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Nath, R. [Yale University School of Medicine (United States)

    2016-06-15

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used to evaluate innovative radiotherapy devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining equivalence of the innovative device to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of an innovative brachytherapy device or application is a critical part in which physicists are actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative products or applications and includes evaluation of 1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, 2) risks and benefits from regulatory and safety perspectives, and 3) resource assessment and preparedness. Further, calibration methods should be traceable to a primary standards dosimetry laboratory such as NIST in the U.S. or to other primary standards dosimetry laboratory located elsewhere. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the ADCLs is encouraged before a source is introduced into widespread routine clinical use. The AAPM and GEC-ESTRO have developed guidelines for the safe and consistent application of brachytherapy using innovative brachytherapy devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. NRC, FDA, Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, European Commission for CE Marking, and institutional review boards and radiation safety committees. Learning Objectives: Understand the necessary dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use. Evaluate risks and benefits from regulatory and safety perspectives. Identify necessary resources and create a plan for clinical introduction of innovative brachytherapy device or applications. Consultant for Theragenics Corp.; R. Nath, Consultant to Theragenics Corp.

  1. MO-A-BRC-02: TG167 Report - Detailed Description

    Energy Technology Data Exchange (ETDEWEB)

    Rivard, M.

    2016-06-15

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used to evaluate innovative radiotherapy devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining equivalence of the innovative device to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of an innovative brachytherapy device or application is a critical part in which physicists are actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative products or applications and includes evaluation of 1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, 2) risks and benefits from regulatory and safety perspectives, and 3) resource assessment and preparedness. Further, calibration methods should be traceable to a primary standards dosimetry laboratory such as NIST in the U.S. or to other primary standards dosimetry laboratory located elsewhere. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the ADCLs is encouraged before a source is introduced into widespread routine clinical use. The AAPM and GEC-ESTRO have developed guidelines for the safe and consistent application of brachytherapy using innovative brachytherapy devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. NRC, FDA, Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, European Commission for CE Marking, and institutional review boards and radiation safety committees. Learning Objectives: Understand the necessary dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use. Evaluate risks and benefits from regulatory and safety perspectives. Identify necessary resources and create a plan for clinical introduction of innovative brachytherapy device or applications. Consultant for Theragenics Corp.; R. Nath, Consultant to Theragenics Corp.

  2. What we do | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Understanding Trauma and Reconciliation following Mass Violence of a Political Nature (India). Topic(s): Religion, Conflicts, Conflict Resolution. Region(s): Asia, India, South And Central Asia. There have been few studies addressing the issues of reconciliation and justice on the Indian subcontinent after the Partition riot of ...

  3. 167 APPLICABILITY OF THE DOCTRINE OF RES IPSA LOQUITUR ...

    African Journals Online (AJOL)

    Fr. Ikenga

    Hence, a reasonable man is a person of normal/ordinary intelligence,8 or a ... providing treatment which falls below the accepted standard of practice in the .... and Dental Practitioners in Nigeria, also known as Code of Medical Ethics in ...

  4. People’s Republic of China Scientific Abstracts, Number 167.

    Science.gov (United States)

    1977-04-28

    Station, Kwang-si Huan-chiang County TITLE: "Treatment of Uterine Prolapse with Urena Lobata and Eucommia Ulmoides Decoction and Acupuncture" SOURCE... uterine prolapse were treated with Urena lobata and eucommia ulmoides decoction and acupuncture. The decoction was taken twice daily. Acupuncture...rabbits and dogs it was shown that both atropine and scopo- lamine were able to counteract the arrhythmia caused by catecholamines, but could not

  5. 26 CFR 1.167(a)-3 - Intangibles.

    Science.gov (United States)

    2010-04-01

    .... (a) In general. If an intangible asset is known from experience or other factors to be of use in the... with reasonable accuracy, such an intangible asset may be the subject of a depreciation allowance. Examples are patents and copyrights. An intangible asset, the useful life of which is not limited, is not...

  6. MO-A-BRC-01: TG167 Report - Introduction

    International Nuclear Information System (INIS)

    Nath, R.

    2016-01-01

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used to evaluate innovative radiotherapy devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining equivalence of the innovative device to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of an innovative brachytherapy device or application is a critical part in which physicists are actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative products or applications and includes evaluation of 1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, 2) risks and benefits from regulatory and safety perspectives, and 3) resource assessment and preparedness. Further, calibration methods should be traceable to a primary standards dosimetry laboratory such as NIST in the U.S. or to other primary standards dosimetry laboratory located elsewhere. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the ADCLs is encouraged before a source is introduced into widespread routine clinical use. The AAPM and GEC-ESTRO have developed guidelines for the safe and consistent application of brachytherapy using innovative brachytherapy devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. NRC, FDA, Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, European Commission for CE Marking, and institutional review boards and radiation safety committees. Learning Objectives: Understand the necessary dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use. Evaluate risks and benefits from regulatory and safety perspectives. Identify necessary resources and create a plan for clinical introduction of innovative brachytherapy device or applications. Consultant for Theragenics Corp.; R. Nath, Consultant to Theragenics Corp.

  7. MO-A-BRC-02: TG167 Report - Detailed Description

    International Nuclear Information System (INIS)

    Rivard, M.

    2016-01-01

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used to evaluate innovative radiotherapy devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining equivalence of the innovative device to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of an innovative brachytherapy device or application is a critical part in which physicists are actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative products or applications and includes evaluation of 1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, 2) risks and benefits from regulatory and safety perspectives, and 3) resource assessment and preparedness. Further, calibration methods should be traceable to a primary standards dosimetry laboratory such as NIST in the U.S. or to other primary standards dosimetry laboratory located elsewhere. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the ADCLs is encouraged before a source is introduced into widespread routine clinical use. The AAPM and GEC-ESTRO have developed guidelines for the safe and consistent application of brachytherapy using innovative brachytherapy devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. NRC, FDA, Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, European Commission for CE Marking, and institutional review boards and radiation safety committees. Learning Objectives: Understand the necessary dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use. Evaluate risks and benefits from regulatory and safety perspectives. Identify necessary resources and create a plan for clinical introduction of innovative brachytherapy device or applications. Consultant for Theragenics Corp.; R. Nath, Consultant to Theragenics Corp.

  8. 167 ORIGINAL ARTICLE Auteur correspondant : adesola.ajayi ...

    African Journals Online (AJOL)

    boaz

    of commercial enzymes for the food and pharmaceutical industries and this increases the cost of production and the finished goods. This study was carried out to isolate .... of enzymes for industrial uses in the developing economy of Nigeria.

  9. 167 Biologie de reproduction du cerf de Barbarie (Cervus elaphus ...

    African Journals Online (AJOL)

    oumani

    Résumé. La biologie de reproduction des cerfs de Barbarie (Cervus elaphus barabrus) a été étudiée dans le parc d'El Feidja et la réserve de Mhebès sur des populations qui vivent respectivement en état de captivité et semi captivité. Il ressort de cette étude que la période de rut débute en fin août-début septembre.

  10. 167 History, Land and Conflict in Nigeria: The Aguleri- Umuleri ...

    African Journals Online (AJOL)

    Tracie1

    human lives, and material resources and as well, created acrimonious relationships ... conflicts, the Economic, as well as the Human Needs Theory of conflict is ..... April, 2011. Petition to the police on the issue of the site where Chief Basil of.

  11. What we do | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Middle East, Palestine, Central Asia, Far East Asia, South Asia, Israel. PROJECT ... Tobacco is the mainstay of the economy of Malawi, accounting for over 70% of export earnings. Malawi ... Health Costs Attributable to Smoking in Viet Nam.

  12. What we do | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cigarette Taxation in Tanzania. Topic(s): Taxation, Tobacco, Smoking, Preventive Medicine. Region(s): Africa, South Of Sahara, Tanzania. Tobacco consumption in Tanzania rose by 20% between 2002 and 2007, and is predicted to increase by a further 46% by 2016.

  13. Dicty_cDB: CHN167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available q*sr*ti*nqylcsrysft*ere* k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknwlqiw*rylfc*ly**i iqllfhik*lsnctyvim*sft...*csl*nlgrlccq*sr*ti*nqylcsrysft*ere* k*tfhslgkr*e*itlmaw**vn*fridclagikncsticsknw

  14. 49 CFR 37.167 - Other service requirements.

    Science.gov (United States)

    2010-10-01

    ... person seeking a ride on a particular route. (d) The entity shall permit service animals to accompany... available, through accessible formats and technology, to enable users to obtain information and schedule...

  15. 10 CFR 26.167 - Quality assurance and quality control.

    Science.gov (United States)

    2010-01-01

    ... at the appropriate cutoff concentration for the compound of interest as specified in § 26.161(c) and (f), a control without the compound of interest (i.e., a certified negative control), and at least one control with one of the compounds of interest at a measurable concentration; and (ii) A...

  16. What we do | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Multinational Tobacco Companies and Tobacco Consumption (China). Topic(s): Transnational Corporations, Tobacco Industry, Marketing, Smoking, Women, Youth, Surveys. Region(s): Asia, China, Far East Asia. Until recently, the Chinese tobacco industry has been run as a state-owned monopoly.

  17. 29 CFR 1952.167 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 1910.142) in agriculture (except for agricultural temporary labor camps associated with egg, poultry or red meat production, or the post-harvest processing of agricultural or horticultural commodities). The... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...

  18. 15 CFR 16.7 - Participation in program.

    Science.gov (United States)

    2010-01-01

    ... participant in the event that he does not appeal such notification by the end of the thirty (30) day period...) Participants may reproduce the Department of Commerce Label and Mark in advertising: Provided, That the entire...

  19. 26 CFR 1.167(a)-8 - Retirements.

    Science.gov (United States)

    2010-04-01

    ... value or over the fair market value at the time of such retirement if greater, but only if— (i) The... such productive use without disposition as, for example, by being placed in a supplies or scrap account... timing of the retirement, the estimated useful life used in computing depreciation, and whether the asset...

  20. All projects related to | Page 167 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: Sri Lanka, Central Asia, Far East Asia, South Asia, Bangladesh, ... success has primarily taken place in the garment and textiles industry. ... SOCIAL STRUCTURE, POLICY MAKING, Economic and social development, CHILDREN.

  1. 7 CFR 457.167 - Pecan revenue crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... include selling through an on-farm or roadside stand, or a farmer's market, or permitting the general... of in-shell pecans grown during a crop year. Harvest—Collecting mature pecans from the orchard. Hedge...—Pecans as they are removed from the orchard with the nut-meats in the shell. Interplanted—Acreage on...

  2. Metal ion displacements in noncentrosymmetric chalcogenides La{sub 3}Ga{sub 1.67}S{sub 7}, La{sub 3}Ag{sub 0.6}GaCh{sub 7} (Ch=S, Se), and La{sub 3}MGaSe{sub 7} (M=Zn, Cd)

    Energy Technology Data Exchange (ETDEWEB)

    Iyer, Abishek K. [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Yin, Wenlong [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Institute of Chemical Materials, China Academy of Engineering Physics, Mianyang 621900 (China); Rudyk, Brent W. [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Lin, Xinsong [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada); Centre for Oil Sands Sustainability, Northern Alberta Institute of Technology, Edmonton, Alberta, Canada T6N1E5 (Canada); Nilges, Tom [Department of Chemistry, Technical University of Munich, 85748 Garching b. München (Germany); Mar, Arthur, E-mail: arthur.mar@ualberta.ca [Department of Chemistry, University of Alberta, Edmonton, Alberta, Canada T6G2G2 (Canada)

    2016-11-15

    The quaternary Ga-containing chalcogenides La{sub 3}Ag{sub 0.6}GaS{sub 7}, La{sub 3}Ag{sub 0.6}GaSe{sub 7}, La{sub 3}ZnGaSe{sub 7}, and La{sub 3}CdGaSe{sub 7}, as well as the related ternary chalcogenide La{sub 3}Ga{sub 1.67}S{sub 7}, were prepared by reactions of the elements at 950 °C. They adopt noncentrosymmetric hexagonal structures (space group P6{sub 3}, Z=2) with cell parameters (a=10.2 Å, c=6.1 Å for the sulfides; a=10.6 Å, c=6.4 Å for the selenides) that are largely controlled by the geometrical requirements of one-dimensional stacks of Ga-centered tetrahedra separated by the La atoms. Among these compounds, which share the common formulation La{sub 3}M{sub 1–x}GaCh{sub 7} (M=Ga, Ag, Zn, Cd; Ch=S, Se), the M atoms occupy sites within a stacking of trigonal antiprisms formed by Ch atoms. The location of the M site varies between extremes with trigonal antiprismatic (CN6) and trigonal planar (CN3) geometry. Partial occupation of these sites and intermediate ones accounts for the considerable versatility of these structures and the occurrence of large metal displacement parameters. The site occupations can be understood in a simple way as being driven by the need to satisfy appropriate bond valence sums for both the M and Ch atoms. Band structure calculations rationalize the substoichiometry observed in the Ag-containing compounds (La{sub 3}Ag{sub 0.6}GaS{sub 7}, La{sub 3}Ag{sub 0.6}GaSe{sub 7}) as a response to overbonding. X-ray photoelectron spectroscopy supports the presence of monovalent Ag atoms in these compounds, which are not charge-balanced. - Graphical abstract: Partial occupation of metal atoms in multiple sites accounts for versatility in Ga-containing chalcogenides La{sub 3}M{sub 1–x}GaCh{sub 7} with noncentrosymmetric hexagonal structures. - Highlights: • La{sub 3}M{sub 1–x}GaCh{sub 7} (M =Ga, Ag, Zn, Cd; Ch =S, Se) adopt related hexagonal structures. • Large displacements of M atoms originate from partial occupation of multiple

  3. Potassium terbium fluoride crystal growth development for faraday rotator discs fabrication, 6 July 1978--6 February 1979

    Energy Technology Data Exchange (ETDEWEB)

    1979-05-17

    Crystal growth experiments were performed and growth of KTb/sub 3/F/sub 10/ crystals were accomplished. The crystal growth experiments consisted of hot zone modification and development of growth parameters. Several boules of KTb/sub 3/F/sub 10/ 30 to 40mm in diameter and one boule 50mm in diameter were grown at rates varying from .5mm/hr to 3.0mm/hr. The crystals evaluated display excellent optical quality. The optical path distortion was less than 0.5 fringe/cm at 633nm as viewed in Twyman--Green interferometry. Growth of large crystals has been limited by mechanical cleavage.

  4. Fluorescence enhancement of samarium complex co-doped with terbium complex in a poly(methyl methacrylate) matrix

    International Nuclear Information System (INIS)

    Jiu Hongfang; Zhang Lixin; Liu Guode; Fan Tao

    2009-01-01

    The fluorescence property of Sm(DBM) 3 phen- (DBM-dibenzoylmethide, phen-1,10-phenanthroline) and Tb(DBM) 3 phen-co-doped poly(methyl methacrylate) (PMMA) was investigated. The excitation, emission spectra and fluorescence lifetime of the co-doped samples were examined. In the co-doped samples, the luminescence intensities of Sm 3+ enhance with an increase of the Tb(DBM) 3 phen content and with a decrease of the Sm(DBM) 3 phen content. The reason for the fluorescence enhancement effect in the co-doped polymer is the intermolecular energy transfer. To give a vivid picture for this co-doped system, a model for the fluorescence enhancement of Sm(DBM) 3 phen- and Tb(DBM) 3 phen-co-doped PMMA is presented

  5. The microstructure and coefficient transmission of think films Bi2Te3-xSex, alloyed by terbium

    International Nuclear Information System (INIS)

    Abdullaev, N.M.; Mekhtieva, S.I.; Jalilov, N.Z.; Memmedov, N.R.; Zeynalov, V.Z.

    2007-01-01

    The defects of films microstructures of the thermoelectric materials n- and p-type Bi 2 Te 3 -xSe x , alloyed by Tb and Cl, with think, obtained by thermic evaporation in vacuum have been investigated by microscopic methods

  6. pH dependent photophysical studies of new europium and terbium complexes of tripodal ligand: Experimental and semiempirical approach

    International Nuclear Information System (INIS)

    Akbar, Rifat; Baral, Minati; Kanungo, B K

    2015-01-01

    The photophysical properties of adduct of a novel nonadentate tripodal ligand, 5,5′-(2-(((8-hydroxyquinolin-5-yl)methylamino)methyl)-2-methylpropane-1, 3-diyl)bis(azanediyl)bis(methylene diquinolin-8-ol, (TAME5OX), with Eu 3+ and Tb 3+ metal ions have been probed for photonics applications. The absorption spectroscopy of these complexes show remarkable spectral changes due to characteristic lanthanide transitions, which support the use of TAME5OX as a sensitive optical pH based sensor to detect Ln 3+ metal ions in biological systems. In addition, these complexes have also been shown to exhibit strong green fluorescence allowing simultaneous sensing within the visible region under physiological pH in competitive medium for both Eu 3+ and Tb 3+ ions. The intense fluorescence from these compounds were revealed to intermittently get quenched under acidic as well as basic conditions due to the photoinduced intramolecular electron transfer from excited 8-hydroxyquinoline (8-HQ) moiety to metal ion, just an opposite process. This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensor. The thermodynamic stability and aqueous coordination chemistry of the chelator with the said lanthanide ions have also been probed by potentiometric, UV–visible and fluorescence spectrophotometric method. TAME5OX has been found to form two protonated complexes [Ln(H 5 L)] 5+ and [Ln(H 4 L)] 4+ below pH 2.5 with both metal ions, which consecutively deprotonates through one proton process with rise of pH. The formation constants (log β 11n ) of neutral complexes have been determined to be 33.51 and 32.16 with pLn (pLn=−log[Ln 3+ ]) values of 16.14 and 19.48 for Eu 3+ and Tb 3+ ions, respectively, calculated at pH 7.4, indicating TAME5OX is a good lanthanide synthetic chelator. The emission lifetimes of the Eu 3+ and Tb 3+ complexes recorded in D 2 O and H 2 O suggest the presence of water molecules in the first coordination sphere of the metal ions. NMR titrations were carried out to determine the stoichiometry of chelates. The complexe's coordination geometries were optimized by using PM7 as sparkle/PM7 model. The theoretical electronic behavior was evaluated to support the experimental findings, based on ZINDO/S methodology at configuration interaction with single excitations (CIS) level. These results emphasize the capability of the use of the theoretical models in prediction of geometries and all other calculations of compounds containing lanthanide ions and create new interesting possibilities for the design in-silico of novel and highly efficient lanthanide–organic edifice. - Highlights: • Photophysical behavior of Eu 3+ and Tb 3+ complexes of TAME5OX has been investigated. • This tripodal ligand forms thermodynamically stable Ln 3+ complexes. • These compounds exhibit strong green fluorescence under physiological pH. • Green fluorescence gets quenched under acidic and basic conditions, due to PET process. • This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensors

  7. Circularly photostimulated electrogyration in europium- and terbium-doped GaN nanocrystals embedded in a silica xerogel matrix

    International Nuclear Information System (INIS)

    Kityk, I V; Nyk, M; Strek, W; Jablonski, J M; Misiewicz, J

    2005-01-01

    Circularly polarized optical poling was proposed and discovered for GaN nanocrystallites embedded in a silica xerogel matrix. The method consists of the creation of screw-like polarization of the medium during the interaction of two circularly polarized coherent bicolour beams. It was shown that doping of the GaN nanocrystallites by Tb 3+ and Eu 3+ ions leads to substantial enhancement of the electrogyration. The effect observed is a consequence of the superposition of nanoconfined effects and the contribution of the localized rare-earth 4f levels. The role of the anharmonic electron-phonon interaction is discussed. The photoluminescence and cathodoluminescence spectra of the GaN composites were investigated. It was demonstrated that the Eu-doped nanocrystallites give a substantially higher effect of the electrogyration compared to the Tb-doped and non-doped ones

  8. pH dependent photophysical studies of new europium and terbium complexes of tripodal ligand: Experimental and semiempirical approach

    Energy Technology Data Exchange (ETDEWEB)

    Akbar, Rifat [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India); Baral, Minati [Department of Chemistry, National Institute of Technology Kurukshetra, Haryana 136119 (India); Kanungo, B K, E-mail: b.kanungo@gmail.com [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India)

    2015-11-15

    The photophysical properties of adduct of a novel nonadentate tripodal ligand, 5,5′-(2-(((8-hydroxyquinolin-5-yl)methylamino)methyl)-2-methylpropane-1, 3-diyl)bis(azanediyl)bis(methylene diquinolin-8-ol, (TAME5OX), with Eu{sup 3+} and Tb{sup 3+} metal ions have been probed for photonics applications. The absorption spectroscopy of these complexes show remarkable spectral changes due to characteristic lanthanide transitions, which support the use of TAME5OX as a sensitive optical pH based sensor to detect Ln{sup 3+} metal ions in biological systems. In addition, these complexes have also been shown to exhibit strong green fluorescence allowing simultaneous sensing within the visible region under physiological pH in competitive medium for both Eu{sup 3+} and Tb{sup 3+} ions. The intense fluorescence from these compounds were revealed to intermittently get quenched under acidic as well as basic conditions due to the photoinduced intramolecular electron transfer from excited 8-hydroxyquinoline (8-HQ) moiety to metal ion, just an opposite process. This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensor. The thermodynamic stability and aqueous coordination chemistry of the chelator with the said lanthanide ions have also been probed by potentiometric, UV–visible and fluorescence spectrophotometric method. TAME5OX has been found to form two protonated complexes [Ln(H{sub 5}L)]{sup 5+} and [Ln(H{sub 4}L)]{sup 4+} below pH 2.5 with both metal ions, which consecutively deprotonates through one proton process with rise of pH. The formation constants (log β{sub 11n}) of neutral complexes have been determined to be 33.51 and 32.16 with pLn (pLn=−log[Ln{sup 3+}]) values of 16.14 and 19.48 for Eu{sup 3+} and Tb{sup 3+} ions, respectively, calculated at pH 7.4, indicating TAME5OX is a good lanthanide synthetic chelator. The emission lifetimes of the Eu{sup 3+} and Tb{sup 3+} complexes recorded in D{sub 2}O and H{sub 2}O suggest the presence of water molecules in the first coordination sphere of the metal ions. NMR titrations were carried out to determine the stoichiometry of chelates. The complexe's coordination geometries were optimized by using PM7 as sparkle/PM7 model. The theoretical electronic behavior was evaluated to support the experimental findings, based on ZINDO/S methodology at configuration interaction with single excitations (CIS) level. These results emphasize the capability of the use of the theoretical models in prediction of geometries and all other calculations of compounds containing lanthanide ions and create new interesting possibilities for the design in-silico of novel and highly efficient lanthanide–organic edifice. - Highlights: • Photophysical behavior of Eu{sup 3+} and Tb{sup 3+} complexes of TAME5OX has been investigated. • This tripodal ligand forms thermodynamically stable Ln{sup 3+} complexes. • These compounds exhibit strong green fluorescence under physiological pH. • Green fluorescence gets quenched under acidic and basic conditions, due to PET process. • This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensors.

  9. The variation in europium(III) and terbium(III) luminescence lifetimes with concentration in rare earth oxysulphide matrices

    International Nuclear Information System (INIS)

    Charreire, Y.; Dexpert-Ghys, J.; Leskelae, M.; Niinistoe, L.

    1983-01-01

    The transient properties of the Eu 3+ 5 D 2 , 5 D 1 , 5 D 0 emitting levels in oxysulphide matrices at various doping concentrations were analysed under either charge transfer state or direct 5 Dsub(J) selective excitation using pulsed laser light. At low Eu 3+ concentrations the data can be described in terms of the step process 5 D 2 → 5 D 1 → 5 D 0 . The decrease in the 5 D 2 and 5 D 1 lifetimes with concentration can be interpreted by cross-relaxation (Eu-Eu) processes, whereas the presence of an (unidentified) impurity in the phosphors is proposed to explain the concentration quenching of 5 D 0 . This conclusion is supported by the observation of similar behaviour for Tb 3+ 5 D 4 emission in the same matrices which is attributed to Eu 3+ ions acting as traps. (Auth.)

  10. White- and blue-light-emitting dysprosium(III) and terbium(III)-doped gadolinium titanate phosphors.

    Science.gov (United States)

    Antić, Ž; Kuzman, S; Đorđević, V; Dramićanin, M D; Thundat, T

    2017-06-01

    Here we report the synthesis and structural, morphological, and photoluminescence analysis of white- and blue-light-emitting Dy 3 + - and Tm 3 + -doped Gd 2 Ti 2 O 7 nanophosphors. Single-phase cubic Gd 2 Ti 2 O 7 nanopowders consist of compact, dense aggregates of nanoparticles with an average size of ~25 nm for Dy 3 + -doped and ~50 nm for Tm 3 + -doped samples. The photoluminescence results indicated that ultraviolet (UV) light excitation of the Dy 3 + -doped sample resulted in direct generation of white light, while a dominant yellow emission was obtained under blue-light excitation. Intense blue light was obtained for Tm 3 + -doped Gd 2 Ti 2 O 7 under UV excitation suggesting that this material could be used as a blue phosphor. Copyright © 2016 John Wiley & Sons, Ltd.

  11. Clinical evaluation of the radiolanthanide terbium-152: first-in-human PET/CT with 152Tb-DOTATOC.

    Science.gov (United States)

    Baum, Richard P; Singh, Aviral; Benešová, Martina; Vermeulen, Christiaan; Gnesin, Silvano; Köster, Ulli; Johnston, Karl; Müller, Dirk; Senftleben, Stefan; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Prior, John O; van der Meulen, Nicholas P; Müller, Cristina

    2017-10-31

    The existence of theragnostic pairs of radionuclides allows the preparation of radiopharmaceuticals for diagnostic and therapeutic purposes. Radiolanthanides, such as 177 Lu, are successfully used for therapeutic purposes; however, a perfect diagnostic match is currently not available for clinical use. A unique, multi-disciplinary study was performed using 152 Tb (T 1/2 = 17.5 h, Eβ + average = 1140 keV, Iβ + = 20.3%), which resulted in the first-in-human PET/CT images with this promising radionuclide. For this purpose, 152 Tb was produced via a spallation process followed by mass separation at ISOLDE, CERN. The chemical separation and quality control, performed at PSI, resulted in a pure product in sufficient yields. Clinical PET phantom studies revealed an increased image noise level, because of the smaller β + branching ratio of 152 Tb as compared to standard PET nuclides at matched activity concentrations; however, the expected recovery would be comparable at matched signal-to-noise ratios in clinical PET. 152 Tb was used for labeling DOTATOC, at Zentralklinik Bad Berka, and administered to a patient for a first-in-human clinical study. PET scans were performed over a period of 24 h, allowing the visualization of even small metastases with increased tumor-to-background contrast over time. Based on the results obtained in this work, it can be deduced that PET/CT imaging with 152 Tb-labeled targeting agents has promise for clinical application and may be particularly interesting for pre-therapeutic dosimetry.

  12. Obtainment and characterization of pure and doped gadolinium oxy ortho silicates with terbium III, precursor of luminescent silicates with sulphur

    International Nuclear Information System (INIS)

    Simoneti, J.A.

    1992-01-01

    Silicate and sulfide lattices are uniquely efficient luminescent materials to excitation by cathodic rays and furthermore the cathodoluminescence study of these compounds have been few investigated. In this work it has been prepared, characterized and investigated some spectroscopic properties of pure and Tb a+ - activated Gd 2 Si O 3 system and it has been tried to substitute oxygen by sulphur in order to obtain this or sulfide-silicate lattices. Products were characterized by vibrational infrared spectroscopy, powder X-ray diffraction patterns and electronic emission in UV-VIS region. (author)

  13. Preparation of three terbium complexes with p-aminobenzoic acid and investigation of crystal structure influence on luminescence property

    International Nuclear Information System (INIS)

    Ye Chaohong; Sun Haoling; Wang Xinyi; Li Junran; Nie Daobo; Fu Wenfu; Gao Song

    2004-01-01

    Three new rare earth p-aminobenzoic acid complexes, [Tb 2 L 6 (H 2 O) 2 ] n (1), [Tb 2 L 6 (H 2 O) 4 ].2H 2 O (2) and [Tb(phen) 2 L 2 (H 2 O) 2 ](phen)L·4H 2 O (3) (HL: p-aminobenzoic acid; phen: 1, 10-phenanthroline), with different structural forms are reported in this paper. Complex 1 is a polymolecule with a two-dimensional plane structure. Compound 2 is a binuclear molecule, and 3 appears to be a mononuclear complex. The fluorescence intensity, the fluorescence life-time and emission quantum yield of 2, which has two coordination water molecules, is better than those of 1, which has only one coordination water molecule. This is an unusual phenomenon for general fluorescent rare earth complexes. The fluorescence performance of 3 is the most unsatisfactory among the three complexes. Their crystal structures show that the coordination mode of the ligand is an important factor influencing the luminescence properties of a fluorescent rare earth complex

  14. Optical and magnetooptical properties of terbium–scandium–aluminum and terbium-containing (gallates and aluminates) garnets

    Energy Technology Data Exchange (ETDEWEB)

    Valiev, Uygun V. [Faculty of Physics, National University of Uzbekistan, Vuzgorodok, Tashkent 100174 (Uzbekistan); Gruber, John B. [Department of Physics, San Jose State University, retired, San Jose, CA 95192 (United States); Burdick, Gary W. [Department of Physics, Andrews University, Berrien Springs, MI 49104 (United States); Ivanov, Igor’ A. [Shubnikov Institute of Crystallography, Russian Academy of Sciences, Moscow 119333 (Russian Federation); Fu, Dejun, E-mail: djfu@whu.edu.cn [School of Physics and Technology, Wuhan University, 430072 Wuhan (China); Pelenovich, Vasiliy O. [School of Physics and Technology, Wuhan University, 430072 Wuhan (China); Juraeva, Nafisa I. [Faculty of Physics, National University of Uzbekistan, Vuzgorodok, Tashkent 100174 (Uzbekistan)

    2016-08-15

    Comparative measurements of the Faraday rotation in Tb{sub 3}Ga{sub 5}O{sub 12} (TGG) and Tb{sub 3}Sc{sub 2–x}Al{sub 3+x}O{sub 12} (TSAG) garnets shows the values of the Verdet constant for TSAG are about 25% higher than that of TGG in the wavelength range 400–700 nm at the temperatures T=95 and 300 K. The increase of the Verdet constant is explained by increase of the “paramagnetic” frequency factor caused by the shift of the resonance frequency of the first allowed 4f→5d transition to the area of the lower frequencies in UV. The shift and observed strong broadening of the UV absorption bands in TSAG are explained by significant modification of the crystalline environment of the Tb{sup 3+} ion in this garnet. A comparison of the data of the C/D ratio in TSAG with the value of the magnetic moment of the Tb{sup 3+} ground state in Tb{sub 3}Al{sub 5}O{sub 12} (TAG) determined from magnetic measurements, showed an acceptable agreement for these parameters measured by fundamentally different methods. Measurements of the visible emission spectra reveal a strong influence of some disordering of the crystal field (CF) in TSAG in comparison with the terbium–aluminum garnet spectra. Magnetooptical effects of the intensity change of the luminescence lines in TSAG is caused by modification of the electronic structure of the {sup 5}D{sub 4} and {sup 7}F{sub 5} multiplets by Sc{sup 3+} ions in the lattice, leading to a local symmetry reduction of the Tb{sup 3+} ion in TSAG.

  15. Photophysical studies of highly luminescent europium(III) and terbium(III) complexes functionalized with amino and mercapto groups

    Energy Technology Data Exchange (ETDEWEB)

    Souza, E.R.; Monteiro, J.H.S.K.; Mazali, I.O.; Sigoli, F.A., E-mail: fsigoli@iqm.unicam.br

    2016-02-15

    This work proposes the replacement of coordinated-water molecules from the precursor complexes [Ln(aba){sub 3}(H{sub 2}O)] and [Ln(tta){sub 3}(H{sub 2}O){sub 2}], (Ln=Eu{sup 3+}, Gd{sup 3+} or Tb{sup 3+}, aba{sup −}=aminobenzoate, tta{sup −}=thenoyltrifluoroacetonate) by the ligands mercaptobenzoate (mba{sup −}), mercaptopropionate (mpa{sup −}), phenanthroline (phen), dimethylformamide (dmf) and acetoacetanilide (aaa{sup −}), leading to anionic or neutral amino (–NH{sub 2}) or mercapto (–SH) functionalized-lantanides (III) complexes with reasonable emission quantum yields for potential application on fluorescence microscopy of biological moieties. The complexes photophysical properties were studied using luminescence spectroscopy and theoretical models to determine the transfer and back energy transfer rates and quantum yields, that were compared with experimental ones. The anionic complexes [Eu(tta){sub 3}(L)]{sup −} showed high quantum yield values and their sensitization efficiency are in the range of 39–81%. The overlay of the ground state geometries, obtained from the Sparkle/PM3 model, of the complexes [Eu(tta){sub 3}(aba)]{sup −}, [Eu(tta){sub 3}(mba)]{sup −} and [Eu(tta){sub 3}(mpa)]{sup −}, suggest similar coordination polyhedrons occupied by the europium(III). The highest transfer rates T→{sup 5}D{sub 1,0} were obtained for the anionic complexes [Eu(tta){sub 3}(L)]{sup −} which might be a result of the low triplet level energies and R{sub L} values. - Highlights: • Lanthanides functionalized-complexes. • Free mercapto and amino groups. • Covalence degree of Eu-ligands. • Energy transfer rates. • Intrinsic and absolute quantum yields and sensitization.

  16. Isothermal sections of phase equilibria diagrams for systems (terbium, dysprosium, holmium)-molybdenum-boron at 1273 K

    International Nuclear Information System (INIS)

    Kuz'ma, Yu.B.; Zakharchuk, N.P.; Maksimova, L.T.

    1988-01-01

    The methods of X-ray analysis are used to study the R-Mo-B (R-Tb, Dy, Ho) systems and isothermal sections of phase equilibria diagrams at 1273 K are plotted. A formation of RMoB 4 (structure of the YCrB 4 type) is confirmed and borides R 3 MoB 7 (structure of the Er 3 CrB 7 type) and ∼ RMo 4 B 8 (of the unknown structure) are obtained for the first time. Borides DyMoB 3 and HoMoB 3 are of the ErMoB 3 structure. Lattice periods of new compounds are indicated. Diffractogrammes of borides Dy 3 MoB 7 and DyMoB 3 are calculated. A peculiarity of components interaction in the systems rare-earth metal-molybdenum-boron is considered

  17. submitter Clinical evaluation of the radiolanthanide terbium-152: first-in-human PET/CT with $^152$Tb-DOTATOC

    CERN Document Server

    Baum, Richard P; Benešová, Martina; Vermeulen, Christiaan; Gnesin, Silvano; Köster, Ulli; Johnston, Karl; Müller, Dirk; Senftleben, Stefan; Kulkarni, Harshad R; Türler, Andreas; Schibli, Roger; Prior, John O; van der Meulen, Nicholas P; Müller, Cristina

    2017-01-01

    The existence of theragnostic pairs of radionuclides allows the preparation of radiopharmaceuticals for diagnostic and therapeutic purposes. Radiolanthanides, such as $^{177}$Lu, are successfully used for therapeutic purposes; however, a perfect diagnostic match is currently not available for clinical use. A unique, multi-disciplinary study was performed using $^{152}$Tb ($T_{1/2}$ = 17.5 h, E$\\beta ^+_{average}$ = 1140 keV, I$β^+$ = 20.3%), which resulted in the first-in-human PET/CT images with this promising radionuclide. For this purpose, $^{152}$Tb was produced via a spallation process followed by mass separation at ISOLDE, CERN. The chemical separation and quality control, performed at PSI, resulted in a pure product in sufficient yields. Clinical PET phantom studies revealed an increased image noise level, because of the smaller $\\beta^+$ branching ratio of $^{152}$Tb as compared to standard PET nuclides at matched activity concentrations; however, the expected recovery would be comparable at matched ...

  18. An SH2 domain-based tyrosine kinase assay using biotin ligase modified with a terbium(III) complex.

    Science.gov (United States)

    Sueda, Shinji; Shinboku, Yuki; Kusaba, Takeshi

    2013-01-01

    Src homology 2 (SH2) domains are modules of approximately 100 amino acids and are known to bind phosphotyrosine-containing sequences with high affinity and specificity. In the present work, we developed an SH2 domain-based assay for Src tyrosine kinase using a unique biotinylation reaction from archaeon Sulfolobus tokodaii. S. tokodaii biotinylation has a unique property that biotin protein ligase (BPL) forms a stable complex with its biotinylated substrate protein (BCCP). Here, an SH2 domain from lymphocyte-specific tyrosine kinase was genetically fused to a truncated BCCP, and the resulting fusion protein was labeled through biotinylation with BPL carrying multiple copies of a luminescent Tb(3+) complex. The labeled SH2 fusion proteins were employed to detect a phosphorylated peptide immobilized on the surface of the microtiter plate, where the phosphorylated peptide was produced by phosphorylation to the substrate peptide by Src tyrosine kinase. Our assay allows for a reliable determination of the activity of Src kinase lower than 10 pg/μL by a simple procedure.

  19. Photoinduced proton transfer coupled with energy transfer: Mechanism of sensitized luminescence of terbium ion by salicylic acid doped in polymer.

    Science.gov (United States)

    Misra, Vinita; Mishra, Hirdyesh

    2008-06-28

    In the present work, excited state intramolecular proton transfer (ESIPT) in salicylic acid (SA) monoanion and subsequent sensitization of Tb(3+) ion in polyvinyl alcohol (PVA) have been studied. The study has been carried out both by steady state and time domain fluorescence measurement techniques at room temperature. It is found that the SA completely ionizes and exists as monoanion in PVA. It exhibits a large Stokes shifted blue emission (10 000 cm(-1)) due to ESIPT and shows a decay time of 6.85 ns. On the other hand, Tb(3+) ion shows a very weak green emission and a decay time of approximately 641 mus in PVA film. Upon incorporating Tb(3+) ion in SA doped PVA film, both intensity and decay time of SA decrease and sensitized emission from Tb(+3) ion along with 3.8 mus rise time is observed. Energy transfer is found to take place both from excited singlet as well as triplet states. A brief description of the properties of the present system from the viewpoint of luminescent solar collector material is addressed.

  20. Evaluation of Some (n,n'), (n,γ), (n,p), (n,2n) and (n,3n) Reaction Excitation Functions for Fission and Fusion Reactor Dosimetry Applications; Evaluation of the Excitation Functions for the 54Fe(n,p)54Mn, 58Ni(n,2n)57Ni, 67Zn(n,p)67Cu, 92Mo(n,p)92mNb, 93Nb(n,γ)94Nb, 113In(n,n')113mIn, 115In(n,γ) 116mIn, and 169Tm(n,3n)167Tm Reactions. Progress Report on Research Contract No 16242

    International Nuclear Information System (INIS)

    Zolotarev, K.I.; Zolotarev, P.K.

    2013-12-01

    Cross section data for the 54 Fe(n,p) 54 Mn, 58 Ni(n,2n) 57 Ni, 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 93 Nb(n,γ) 94 Nb, 113 In(n,n') 113m In, 115 In(n,γ) 116m In, 169 Tm(n,3n) 167 Tm reactions are needed to solve a wide spectrum of scientific and technical tasks. Activation detectors based on these reactions may be used in the field of reactor dosimetry. Furthermore, the 54 Fe(n,p) 54 Mn reaction is often used in experimental nuclear physics as a monitor reaction for measurements of unknown cross sections by means of the activation method over the neutron energy range from 5 to 15 MeV. The 93 Nb(n,γ) 94 Nb reaction is also very promising for using in retrospective neutron dosimetry for determination of total neutron fluence during a campaign of a reactor. In the existing version of the International Reactor Dosimetry File and the new extended version named as IRDFF data for excitation functions of 67 Zn(n,p) 67 Cu, 92 Mo(n,p) 92m Nb, 113 In(n,n') 113m In, and 169 Tm(n,3n) 167 Tm reactions are absent. Data for these reactions are also absent in the JENDL/D-99 dosimetry file. Excitation functions of 67 Zn(n,p) 67 Cu and 169 Tm(n,3n) 167 Tm are presented in the TENDL-2012, EAF-2010, JENDL-4.0, JEFF-3.1/A, MENDL-2 libraries. Cross section data for the 67 Zn(n,p) 67 Cu reaction up to 20 MeV are given also in the JENDL/HE-2007 library. Excitation functions of the 92 Mo(n,p) 92m Nb and 113 In(n,n') 113m In reactions are evaluated in the EAF-2010 and JEFF-3.1/A libraries. Cross section data for the 113 In(n,n') 113m In reaction are given also in the TENDL-2010 library. It is necessary to note that neutron data in the JEFF-3.1/A and JENDL-4.0 libraries were evaluated up to 20 MeV. Neutron data in the TENDL-2012, EAF-2010, MENDL-2 and TENDL-2010 libraries had been evaluated up to 30 MeV, 60 MeV, 100 MeV and 200 MeV, respectively. Neutron cross sections in the MENDL-2, TENDL-2010 and TENDL-2012 libraries had been obtained on the basis of pure theoretical model calculations

  1. 9 CFR 381.167 - Other poultry dishes and specialty items.

    Science.gov (United States)

    2010-01-01

    ...) with Vegetables 15 Gravy with sliced (Kind) 15 (Kind) Tetrazzini 15 (Kind) chili with beans 17 Creamed... (Kind) with Gravy and Dressing 25 (Kind) Salad 3 25 (Kind) chili 28 (Kind) Hash 30 Sliced (Kind) with Gravy 35 Minced (Kind) Barbecue 40 1 The product name may contain other appropriate descriptive terms...

  2. SYNTHESIS OF 8-METHYLNONANE-1,6,7-TRIEN-4-ONE AND ...

    African Journals Online (AJOL)

    Preferred Customer

    of the first synthesized allene is penta-2,3-dienedioic acid (1) (Figure 1). ..... Absorptions are indicated as (s) = strong, (m) = medium, and (w) = weak. ..... For reviews on allene chemistry, see (a) Schuster, H.F.; Coppola, G.M. Allenes in Organic.

  3. December, 2013 ISSN 1119-944X 167 Rice Production under

    African Journals Online (AJOL)

    ONIKOYI

    Nigeria is the most populous country in Africa with a population of over 130 ... consumed in South East Asia, which is a major centre of the world population. ... Studies have shown that aggregate rice production in Nigeria has been growing at.

  4. Ce que nous faisons | Page 167 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Modèles commerciaux libres (Amérique latine). Le Centro de Tecnologia e Sociedade (CTS - centre pour la technologie et la société) fait partie de la Faculté de droit de la Fundação Getulio Vargas à Rio de Janeiro. Brésil, Amérique Du Sud, Nigéria, Nord Du Sahara, Sud Du Sahara, Amérique Nord Et Centrale. PROJECT ...

  5. SU-F-J-167: Use of MR for Permanent Prostate Implant Preplanning

    Energy Technology Data Exchange (ETDEWEB)

    Narayana, V; McLaughlin, P [Assarian Cancer Center, Novi, MI (United States); University of Michigan, Ann Arbor, MI (United States); Yao, B [Assarian Cancer Center, Novi, MI (United States)

    2016-06-15

    Purpose: To study the feasibility using MR imaging to improve target definition on ultrasound during permanent prostate implants and aid in source strength determination for treatment planning in the OR. Methods: Patients who receive permanent prostate implants undergo MR and CT imaging prior to the implant procedure to determine the volume of the prostate, bony restriction to the procedure, bladder extension, external sphincter length and neurovascular bundle. The volume of the prostate is generally used to order seeds for the procedure. In 10 patients, the MR was used as the preplanning study with the PTV defined as a 2 mm expansion of the MR prostate in all directions except the posterior. Various dose volume parameters for the MR prostate and the PTV were compared to the actual preplan developed and executed in the OR. In addition, there parameters were compared to the post implant dosimetry performed 3 weeks after the implant procedure. Results: The results show that the number of seeds used using MR and US (ultrasound) planning was generally with 2 seeds and the maximum difference was 7 seeds. There is no significant difference between any of the dose index parameters of V100, V150, V200, D99 and D90 parameters between MR planning, US planning and postimplant evaluation There was a significant difference between planned D99 (avg of 105%) and achieved D99 (avg 91%). Conclusion: MR imaging is an invaluable tool to improve target definition for permanent prostate implants. Use of MR images for preplanning improves the confidence with which source can be ordered for the procedure that is OR planned. Ordering a maximum of 10 seeds more than planned would be sufficient to deliver a plan in the OR using US. Moving ahead to non-rigid registration between MR ad US images could further increase the confidence level of MR planning.

  6. IAEA Newsbriefs. V. 10, no. 1(67). Mar-Apr 1995

    International Nuclear Information System (INIS)

    1995-01-01

    This issue gives brief information on the following topics: IAEA Board to Consider Proposal on Safeguards, IAEA Director General to Address NPT Conference in mid-April, IAEA Hosts UN System-Wide Meeting, Joint IAEA/EC/WHO Conference on Chernobyl Announced, IAEA Concludes Post-Chernobyl Research Project, Uranium Data in Environmental Monitoring, Director General Address in Chile, South Africa, the Philippines Host Nuclear Information Seminars, Upcoming IAEA Conferences, Symposia and Seminars, Isotopes in Water Resources Management, Environmental Impacts of Radioactive Releases, Joint FAO/IAEA Symposium on Crop Improvement, Other Conferences, Symposia and Seminars in 1995, Safeguards and Non-Proliferation Developments (IAEA Safeguards Agreements, New NPT Members), Handbook on Nuclear Communications, SIT Campaign in Zanzibar, and other short information

  7. 46 CFR 167.01-1 - Basis and purpose of part.

    Science.gov (United States)

    2010-10-01

    ... uniform application. This part is not applicable to civilian nautical school ships. [CGD 95-028, 62 FR... Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL... are prescribed and apply to public nautical school ships, except vessels of the Navy or Coast Guard...

  8. MO-A-BRC-00: TG167: Clinical Recommendations for Innovative Brachytherapy Devices and Applicators

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2016-06-15

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used to evaluate innovative radiotherapy devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining equivalence of the innovative device to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of an innovative brachytherapy device or application is a critical part in which physicists are actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative products or applications and includes evaluation of 1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, 2) risks and benefits from regulatory and safety perspectives, and 3) resource assessment and preparedness. Further, calibration methods should be traceable to a primary standards dosimetry laboratory such as NIST in the U.S. or to other primary standards dosimetry laboratory located elsewhere. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the ADCLs is encouraged before a source is introduced into widespread routine clinical use. The AAPM and GEC-ESTRO have developed guidelines for the safe and consistent application of brachytherapy using innovative brachytherapy devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. NRC, FDA, Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, European Commission for CE Marking, and institutional review boards and radiation safety committees. Learning Objectives: Understand the necessary dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use. Evaluate risks and benefits from regulatory and safety perspectives. Identify necessary resources and create a plan for clinical introduction of innovative brachytherapy device or applications. Consultant for Theragenics Corp.; R. Nath, Consultant to Theragenics Corp.

  9. Recombinant Helicobacter bilis Protein P167 for Mouse Serodiagnosis in a Multiplex Microbead Assay

    OpenAIRE

    Feng, Sunlian; Kendall, Lon V.; Hodzic, Emir; Wong, Scott; Lorenzana, Edward; Freet, Kimberly; Ku, Karin S.; Luciw, Paul A.; Barthold, Stephen W.; Khan, Imran H.

    2004-01-01

    Infection of mice with Helicobacter bilis is widespread in research and commercial mouse colonies. Therefore, sensitive, specific, and high-throughput assays are needed for rapid and accurate testing of mice in large numbers. This report describes a novel multiplex assay, based on fluorescent microbeads, for serodetection of H. bilis infection. The assay requires only a few microliters of serum to perform and is amenable to a high-throughput format. Individual microbead sets were conjugated t...

  10. 46 CFR 167.45-1 - Steam, carbon dioxide, and halon fire extinguishing systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Steam, carbon dioxide, and halon fire extinguishing....45-1 Steam, carbon dioxide, and halon fire extinguishing systems. (a) General requirements. (1...-extinguishing system. On such vessels contracted for prior to January 1, 1962, a steam smothering system may be...

  11. 26 CFR 1.167(h)-1 - Life tenants and beneficiaries of trusts and estates.

    Science.gov (United States)

    2010-04-01

    ... reserve) allocable to each. For example: (1) If under the trust instrument or local law the income of a... local law the income of a trust is to be distributed to a named beneficiary, but the trustee is directed... otherwise provided in this paragraph when the trust instrument or local law requires or permits the trustee...

  12. 26 CFR 1.167(a)-7 - Accounting for depreciable property.

    Science.gov (United States)

    2010-04-01

    ... treating each individual item as an account, or by combining two or more assets in a single account. Assets..., unadjusted for depreciation or salvage, shall be removed from the asset account and shall be charged to the... asset shall be removed from the asset account, and the depreciation reserve shall be charged with the...

  13. 46 CFR 67.167 - Requirement for exchange of Certificate of Documentation.

    Science.gov (United States)

    2010-10-01

    ... State of incorporation of any corporate owner of the vessel changes; (4) The name of the vessel changes... restrictions imposed on the vessel change by addition or substitution; (6) The legal name of any owner of the... immediately, except as provided in § 67.161, when: (1) The ownership of the vessel changes in whole or in part...

  14. 33 CFR 167.452 - In the Santa Barbara Channel: Between Point Conception and Point Arguello.

    Science.gov (United States)

    2010-07-01

    ....452 In the Santa Barbara Channel: Between Point Conception and Point Arguello. (a) A separation zone... 120°30.16′ W. 34°18.90′ N 120°30.96′ W. 34°25.70′ N 120°51.81′ W. 34°23.75′ N 120°52.51′ W. (b) A traffic lane for westbound traffic is established between the separation zone and a line connecting the...

  15. MO-A-BRC-00: TG167: Clinical Recommendations for Innovative Brachytherapy Devices and Applicators

    International Nuclear Information System (INIS)

    2016-01-01

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used to evaluate innovative radiotherapy devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining equivalence of the innovative device to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of an innovative brachytherapy device or application is a critical part in which physicists are actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative products or applications and includes evaluation of 1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, 2) risks and benefits from regulatory and safety perspectives, and 3) resource assessment and preparedness. Further, calibration methods should be traceable to a primary standards dosimetry laboratory such as NIST in the U.S. or to other primary standards dosimetry laboratory located elsewhere. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the ADCLs is encouraged before a source is introduced into widespread routine clinical use. The AAPM and GEC-ESTRO have developed guidelines for the safe and consistent application of brachytherapy using innovative brachytherapy devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. NRC, FDA, Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, European Commission for CE Marking, and institutional review boards and radiation safety committees. Learning Objectives: Understand the necessary dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use. Evaluate risks and benefits from regulatory and safety perspectives. Identify necessary resources and create a plan for clinical introduction of innovative brachytherapy device or applications. Consultant for Theragenics Corp.; R. Nath, Consultant to Theragenics Corp.

  16. SU-E-J-167: Dosimetric Consequences From Minimal Displacements in APBI with SAVI Applicators

    Energy Technology Data Exchange (ETDEWEB)

    Chandrasekara, S; Dumitru, N [Bucharest (Romania); Hyvarinen, M [Florida Atlantic University, Boca Raton, FL (United States); Pella, S [South Florida Radiation Oncology, Boca Raton, FL (United States)

    2015-06-15

    Purpose: To determine the importance of providing proper solid immobilization in every fraction of treatment in APBI with brachytherapy. Methods: 125 patients treated with APBI brachytherapy with SAVI applicators at SFRO Boca Raton, from 2013–2015 were considered for this retrospective study. The CT scans of each patient, which were taken before each treatment, were imported in to the Oncentra treatment planning system. Then they were compared with the initial CT scan which was used for the initial plan. Deviation in displacements in reference to ribs and skin surface was measured and dosimetric evaluations respective to the initial image were performed. Results: Small deviations in displacements were observed from the SAVI applicator to the ribs and the skin surface. Dosimetric evaluations revealed, very small changes in the inter-fractionation position make significant differences in the maximum dose to critical organs. Additionally, the volume of the cavity also changed between fractions. As a Result, the maximum dose manifested variance between 10% and 32% in ribs and skin surface respectively. Conclusion: It appears that taking a CT scan before each treatment is necessary to minimize the risk of delivering undesired high doses to the critical organs. This study indicates, in 30% of the cases re-planning was necessary between treatments. We conclude that, treatment planning teams should evaluate the placement of the device by analyzing the CT images before each treatment and they must be prepared for re-planning if needed. This study also reveals the urgent need of improving the immobilization methods with APBI when treating with the SAVI applicator.

  17. 40 CFR 167.90 - Where to obtain and submit forms.

    Science.gov (United States)

    2010-07-01

    ... establishments not found at the same location as their company headquarters, must submit applications and reports... establishments not found at the same location as their company headquarters to be submitted by the company headquarters to the Regional Office having jurisdiction over the State in which the company headquarters is...

  18. 167th International School of Physics "Enrico Fermi" : Strangeness and Spin in Fundamental Physics

    CERN Document Server

    Bressani, T; Feliciello, A; Ratcliffe, Ph G

    2008-01-01

    Strangeness and Spin in Fundamental Physics is dedicated to the discussion of the role played by two subtle and somehow puzzling quantum numbers, the strangeness and the spin, in fundamental physics. They both relate to basic properties of the fundamental quantum field theories describing strong and electro-weak interactions and to their phenomenological applications. In some instances, like the partonic spin structure of the proton, they are deeply correlated. The many puzzling results recently obtained by measuring several spin asymmetries have stimulated gigantic progresses in the study of the spin structure of protons and neutrons. Intense theoretical activity has discovered new features of non-perturbative QCD, like strong correlations between the spin and the intrinsic motions of quarks inside the nucleons. The purpose of this publication is that of providing a complete, updated and critical account of the most recent and relevant discoveries in the above fields, both from the experimental and theoretic...

  19. Elementos doi: 10.5007/1807-9288.2011v7n1p167

    Directory of Open Access Journals (Sweden)

    Francisco Carlos de Carvalho Marinho

    2011-01-01

    Full Text Available Encerrando a presente edição da revista Texto Digital, apresentamos a belíssima criação "Elementos" do prof. Dr. Chico Marinho, da Universidade Federal de Minas Gerais (UFMG. Para ter acesso ao arquivo, clique aqui.

  20. A Record Year at the Federal Trough: Colleges Feast on $1.67-Billion in Earmarks.

    Science.gov (United States)

    Brainard, Jeffrey; Southwick, Ron

    2001-01-01

    Discusses how for fiscal year 2001, Congress earmarked more money for federal projects for specific colleges than ever before. It provided a 60 percent increase over the previous year, although such earmarks have drawn criticism as wasteful and harmful to merit-based competition for funds. Includes a list of top recipients of "pork." (EV)

  1. Study of the joining particle rotation in nuclei of 161-167 Er and 235 U

    International Nuclear Information System (INIS)

    Fernandez L, M.

    1996-01-01

    The residual quadrupole pairing and spin-spin interactions among the nucleons, in presence of the rotational motion, lead to additional terms in the particle-rotation coupling which attenuate the effects of the Coriolis interaction. These couplings are determined by using the density matrix formalism, under the consideration of the exact conservation of the nuclear angular moment. Finally the energy levels of the rotational bands and the mixing amplitudes of the BE2 transition probabilities are calculated for some odd deformed nuclei. A very good agreement between the theoretical and experimental energies is obtained. The Coriolis attenuation produced by these interactions shows itself as relevant for explaining the experimental results. (Author)

  2. 46 CFR 167.65-45 - Notice to mariners; aids to navigation.

    Science.gov (United States)

    2010-10-01

    .... These notices may be obtained free of charge, by making application to Commander, 9th Coast Guard...), published by the Commander, 9th Coast Guard District, contain announcements and information on changes in... major seaports in the United States and are also on file in the U.S. Consulates where they may be...

  3. CCDC 954775: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(2-fluoro-4-(1H-tetrazol-5-yl)benzoate) tetrahydroxide tetradecahydrate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  4. CCDC 959634: Experimental Crystal Structure Determination : octakis(mu~3~-Hydroxo)-undecakis(mu~2~-2-fluorobenzoato)-(N,N-dimethylformamide)-nitrato-hexa-aqua-hexa-terbium

    KAUST Repository

    Guillerm, Vincent; Weseliński, Łukasz J.; Belmabkhout, Youssef; Cairns, Amy J.; D'Elia, Valerio; Wojtas, Łukasz; Adil, Karim; Eddaoudi, Mohamed

    2014-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  5. On the controlled isotropic shrinkage induced fine-tuning of photo-luminescence in terbium ions embedded silica inverse opal films

    Science.gov (United States)

    Shrivastava, Vishnu Prasad; Kumar, Jitendra; Sivakumar, Sri

    2017-12-01

    Tb3+ embedded silica inverse opal structures with different photonic stop bands have been fabricated by annealing the SiO2-polystyrene spheres (diameter 390 nm) opal template at 320-650 oC. The PSB tuning realized in the wavelength range 498 - 600 nm is shown to depend on annealing temperature and impending isotropic shrinkage of silica matrix. The impact of wide PSB shift on four Tb3+ ion emission bands (blue, green, yellow, and red at 486, 545, 580, and 620 nm, respectively) corresponding to 5D4→7Fj (j = 6,5,4,3) transitions have been investigated. The effect amounts to significant suppression of emission bands at 586, 545 and 486 nm in inverse opals, obtained by annealing opal template at 350, 400, and 650 oC, respectively. Further, luminescence lifetime of Tb3+ ion 5D4 state increases with shrinkage induced in inverse opal progressively and get enhanced up to 2.3 times vis-à-vis reference silica. The changes in refractive index caused by thermal annealing of opal template is found to be responsible for the observed improvement in 5D4 state lifetime.

  6. Effect of adding aluminum ion on the structural, optical, electrical and magnetic properties of terbium doped yttrium iron garnet nanoparticles films prepared by sol–gel method

    Energy Technology Data Exchange (ETDEWEB)

    Aldbea, Ftema W.; Ibrahim, N.B., E-mail: baayah@ukm.edu.my; Yahya, M.

    2014-12-01

    Highlights: • The conductivity of YIG films increased with increasing of Al content. • The saturation magnetization at room temperature decreased with increasing Al{sup 3+} content. • Al{sup 3+} substituted Tb-YIG films has been prepared by a sol-gel method. - Abstract: Tb{sub 0.8}Y{sub 2.2}Al{sub y}Fe{sub 5−y}O{sub 12} nanoparticle films with y = 0.0, 0.2, 0.4, 0.6, 0.8 and 1.0 were prepared by a sol–gel method for potential use as a magnetic sensor and in magneto-optical applications. The films were deposited onto quartz substrate, followed by annealing at 900 °C in air for 2 h. X-ray diffractometry results confirmed the formation of a pure garnet structure. The lattice parameter decreased with increasing Al{sup 3+} content due to the substitution of Al{sup 3+} ions with the larger Fe{sup 3+} ions. The grain size of the films decreased up to y = 0.6. This variation is discussed based on the stress on the grain surface. The films observed to be transparent between 76 and 92% in the visible and infrared regions. The films demonstrated a strong absorption of 10{sup 4} cm{sup −1} caused by the charge transfer transition in the UV region. The absorption edge shifts to lower wavelengths at higher Al contents of 0.8 and 1 due to electronic transitions. The conductivity of films increased with increasing of Al content due to the increasing in free carrier concentration. The saturation magnetization at room temperature decreased with increasing Al{sup 3+} content, whereas the coercivity increased markedly at y = 0.6.

  7. CCDC 1411423: Experimental Crystal Structure Determination : catena-[dimethylammonium hexakis(mu-fumarato)-octakis(mu-hydroxo)-hexa-terbium N,N-dimethylformamide solvate hexahydrate

    KAUST Repository

    Assen, Ayalew H.

    2016-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  8. CCDC 954773: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4-(tetrazol-2-id-5-yl)benzoate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  9. CCDC 954774: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4'-(tetrazol-2-id-5-yl)biphenyl-4-carboxylate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  10. CCDC 1410946: Experimental Crystal Structure Determination : catena-[dimethylammonium tris(mu-naphthalene-1,4-dicarboxylato)-tetrakis(mu-hydroxo)-triaqua-tri-terbium(iii) unknown solvate

    KAUST Repository

    Xue, Dongxu

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  11. Time-Resolved Analysis of a Highly Sensitive Förster Resonance Energy Transfer Immunoassay Using Terbium Complexes as Donors and Quantum Dots as Acceptors

    Directory of Open Access Journals (Sweden)

    Niko Hildebrandt

    2007-01-01

    Full Text Available CdSe/ZnS core/shell quantum dots (QDs are used as efficient Förster Resonance Energy Transfer (FRET acceptors in a time-resolved immunoassays with Tb complexes as donors providing a long-lived luminescence decay. A detailed decay time analysis of the FRET process is presented. QD FRET sensitization is evidenced by a more than 1000-fold increase of the QD luminescence decay time reaching ca. 0.5 milliseconds, the same value to which the Tb donor decay time is quenched due to FRET to the QD acceptors. The FRET system has an extremely large Förster radius of approx. 100 Å and more than 70% FRET efficiency with a mean donor-acceptor distance of ca. 84 Å, confirming the applied biotin-streptavidin binding system. Time-resolved measurement allows for suppression of short-lived emission due to background fluorescence and directly excited QDs. By this means a detection limit of 18 attomol QDs within the immunoassay is accomplished, an improvement of more than two orders of magnitude compared to commercial systems.

  12. Comparison of the Magnetic Anisotropy and Spin Relaxation Phenomenon of Dinuclear Terbium(III) Phthalocyaninato Single-Molecule Magnets Using the Geometric Spin Arrangement.

    Science.gov (United States)

    Morita, Takaumi; Damjanović, Marko; Katoh, Keiichi; Kitagawa, Yasutaka; Yasuda, Nobuhiro; Lan, Yanhua; Wernsdorfer, Wolfgang; Breedlove, Brian K; Enders, Markus; Yamashita, Masahiro

    2018-02-28

    Herein we report the synthesis and characterization of a dinuclear Tb III single-molecule magnet (SMM) with two [TbPc 2 ] 0 units connected via a fused-phthalocyaninato ligand. The stable and robust complex [(obPc)Tb(Fused-Pc)Tb(obPc)] (1) was characterized by using synchrotron radiation measurements and other spectroscopic techniques (ESI-MS, FT-IR, UV). The magnetic couplings between the Tb III ions and the two π radicals present in 1 were explored by means of density functional theory (DFT). Direct and alternating current magnetic susceptibility measurements were conducted on magnetically diluted and nondiluted samples of 1, indicating this compound to be an SMM with improved properties compared to those of the well-known [TbPc 2 ] -/0/+ and the axially symmetric dinuclear Tb III phthalocyaninato triple-decker complex (Tb 2 (obPc) 3 ). Assuming that the probability of quantum tunneling of the magnetization (QTM) occurring in one TbPc 2 unit is P QTM , the probability of QTM simultaneously occurring in 1 is P QTM 2 , meaning that QTM is effectively suppressed. Furthermore, nondiluted samples of 1 underwent slow magnetic relaxation times (τ ≈ 1000 s at 0.1 K), and the blocking temperature (T B ) was determined to be ca. 16 K with an energy barrier for spin reversal (U eff ) of 588 cm -1 (847 K) due to D 4d geometry and weak inter- and intramolecular magnetic interactions as an exchange bias (H bias ), reducing QTM. Four hyperfine steps were observed by micro-SQUID measurement. Furthermore, solution NMR measurements (one-dimensional, two-dimensional, and dynamic) were done on 1, which led to the determination of the high rotation barrier (83 ± 10 kJ/mol) of the obPc ligand. A comparison with previously reported Tb III triple-decker compounds shows that ambient temperature NMR measurements can indicate improvements in the design of coordination environments for SMMs. A large U eff causes strong uniaxial magnetic anisotropy in 1, leading to a χ ax value (1.39 × 10 -30 m 3 ) that is larger than that for Tb 2 (obPc) 3 (0.86 × 10 -30 m 3 ). Controlling the coordination environment and spin arrangement is an effective technique for suppressing QTM in TbPc 2 -based SMMs.

  13. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    International Nuclear Information System (INIS)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger

    2014-01-01

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  14. Electroluminescence color tuning between green and red from metal-oxide-semiconductor devices fabricated by spin-coating of rare-earth (terbium + europium) organic compounds on silicon

    Science.gov (United States)

    Matsuda, Toshihiro; Hattori, Fumihiro; Iwata, Hideyuki; Ohzone, Takashi

    2018-04-01

    Color tunable electroluminescence (EL) from metal-oxide-semiconductor devices with the rare-earth elements Tb and Eu is reported. Organic compound liquid sources of (Tb + Ba) and Eu with various Eu/Tb ratios from 0.001 to 0.4 were spin-coated on an n+-Si substrate and annealed to form an oxide insulator layer. The EL spectra had only peaks corresponding to the intrashell Tb3+/Eu3+ transitions in the spectral range from green to red, and the intensity ratio of the peaks was appropriately tuned using the appropriate Eu/Tb ratios in liquid sources. Consequently, the EL emission colors linearly changed from yellowish green to yellowish orange and eventually to reddish orange on the CIE chromaticity diagram. The gate current +I G current also affected the EL colors for the medium-Eu/Tb-ratio device. The structure of the surface insulator films analyzed by cross-sectional transmission electron microscopy (TEM), X-ray diffraction (XRD) analysis, and X-ray photoelectron spectroscopy (XPS) has four layers, namely, (Tb4O7 + Eu2O3), [Tb4O7 + Eu2O3 + (Tb/Eu/Ba)SiO x ], (Tb/Eu/Ba)SiO x , and SiO x -rich oxide. The EL mechanism proposed is that electrons injected from the Si substrate into the SiO x -rich oxide and Tb/Eu/Ba-silicate layers become hot electrons accelerated in a high electric field, and then these hot electrons excite Tb3+ and Eu3+ ions in the Tb4O7/Eu2O3 layers resulting in EL emission from Tb3+ and Eu3+ intrashell transitions.

  15. Tunable white light emission from hafnium oxide films co-doped with trivalent terbium and europium ions deposited by Pyrosol technique

    Energy Technology Data Exchange (ETDEWEB)

    Guzman-Olguin, J.C.; Montes, E.; Guzman-Mendoza, J. [Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada del Instituto Politecnico Nacional, Unidad Legaria (Mexico); Baez-Rodriguez, A.; Zamora-Peredo, L. [Centro de Investigacion en Micro y Nanotecnologia, Universidad Veracruzana, Boca del Rio, Ver (Mexico); Garcia-Hipolito, M.; Alvarez-Fregoso, O. [Instituto de Investigaciones en Materiales, Universidad Nacional Autonoma de Mexico, Circuito Exterior, Ciudad Universitaria, Coyoacan (Mexico); Martinez-Merlin, I.; Falcony, C. [Centro de Investigacion y de Estudios Avanzados del Instituto Politecnico Nacional (Mexico)

    2017-10-15

    In this paper, the photo and cathodoluminescent properties of HfO{sub 2} films optically activated with different atomic concentrations of Tb{sup 3+} and Eu{sup 3+} ions, deposited by the Pyrosol technique, are reported. These films were deposited at temperatures from 400 to 600 C, using chlorides as raw materials. The surface morphologies of all deposited films were rough and dense. X-ray diffraction analysis showed that the films deposited at 600 C were polycrystalline exhibiting the HfO{sub 2} monoclinic phase. The tuning by the means of the excitation wavelength generates photoluminescence spectra, for co-doped films, in several emissions from blue to yellow (including white light) due to the characteristic electronic transitions of Tb{sup 3+} (green), Eu{sup 3+}(red) ions and the violet-blue emission associated to the host lattice (HfO{sub 2}). According to the chromaticity diagram, the best white light is reached for the sample S2 excited with 382 nm (x = 0.3343, y = 0.3406). The cathodoluminescence emission spectra for co-doped films showed emissions from green to red (including yellow, orange and other intermediate emissions). The averaged quantum efficiency values of the sample labeled as S2 resulted between 47 and 78% depending on the excitation wavelength. In addition, XPS, TEM, SEM and decay times were performed to characterize these films. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. Luminescence of yttrium niobium-tantalate doubly activated by europium and/or terbium under X-ray and electron beam excitation

    Energy Technology Data Exchange (ETDEWEB)

    Arellano, I.D., E-mail: arellano@utp.edu.co [Department of Physics, Technological University of Pereira, Vereda La Julita, Pereira (Colombia); Nazarov, M.V. [Institute of Applied Physics, Academy of Sciences of Moldova, Republic of Moldova (Moldova, Republic of); School of Materials and Mineral Resources Engineering Universiti Sains Malaysia, 14300 Nibong Tebal, Penang (Malaysia); Cortes, J.A. [Department of Physics, Technological University of Pereira, Vereda La Julita, Pereira (Colombia); Ahmad Fauzi, M.N [School of Materials and Mineral Resources Engineering Universiti Sains Malaysia, 14300 Nibong Tebal, Penang (Malaysia)

    2012-09-15

    This paper reports the luminescence emission spectra of Y(Ta,Nb)O{sub 4} activated by rare earth ions such as Eu{sup 3+} and Tb{sup 3+}. The influence of these rare earth ions on the luminescence of yttrium niobium-tantalate phosphors was investigated. The luminescent properties were studied under X-ray and electron beam excitations. Under these excitations, the emission centers of the rare earth activators (Eu{sup 3+},Tb{sup 3+}) were found to contribute efficiently to the overall luminescence. Changing the mol concentration of the incorporated activators resulted in a broad variation of visible photoluminescence. Color cathodoluminescence images showed clearly the dependence of chromaticity on the different activators. With their various luminescence chromaticities, these rare earth activated phosphors are promising materials for solid-state lighting applications as well as for X-ray intensifying screens in medical diagnosis, providing a broad variation of visible photoluminescence from blue to red. - Highlights: Black-Right-Pointing-Pointer The Y(Ta,Nb)O{sub 4} phosphors were activated by rare earth ions such as Eu{sup 3+} and Tb{sup 3+}. Black-Right-Pointing-Pointer The phosphors were studied under X-ray and electron beam excitations. Black-Right-Pointing-Pointer The emission centers contribute efficiently to the overall luminescence. Black-Right-Pointing-Pointer Changing the concentration of the activators resulted in a broad luminescence.

  17. Crystal structure of a mixed-ligand terbium(III coordination polymer containing oxalate and formate ligands, having a three-dimensional fcu topology

    Directory of Open Access Journals (Sweden)

    Chainok Kittipong

    2016-01-01

    Full Text Available The title compound, poly[(μ3-formato(μ4-oxalatoterbium(III], [Tb(CHO2(C2O4]n, is a three-dimensional coordination polymer, and is isotypic with the LaIII, CeIII and SmIII analogues. The asymmetric unit contains one TbIII ion, one formate anion (CHO2− and half of an oxalate anion (C2O42−, the latter being completed by application of inversion symmetry. The TbIII ion is nine-coordinated in a distorted tricapped trigonal–prismatic manner by two chelating carboxylate groups from two C2O42− ligands, two carboxylate oxygen atoms from another two C2O42− ligands and three oxygen atoms from three CHO2− ligands, with the Tb—O bond lengths and the O—Tb—O bond angles ranging from 2.4165 (19 to 2.478 (3 Å and 64.53 (6 to 144.49 (4°, respectively. The CHO2− and C2O42− anions adopt μ3-bridging and μ4-chelating-bridging coordination modes, respectively, linking adjacent TbIII ions into a three-dimensional 12-connected fcu topology with point symbol (324.436.56. The title compound exhibits thermal stability up to 623 K, and also displays strong green photoluminescence in the solid state at room temperature.

  18. Resonance energy transfer from quinolinone modified polystyrene-block-poly(styrene-alt-maleic anhydride) copolymer to terbium(III) metal ions

    Energy Technology Data Exchange (ETDEWEB)

    Výprachtický, Drahomír, E-mail: vyprachticky@imc.cas.cz [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovský Sq. 2, 162 06 Prague 6 (Czech Republic); Mikeš, František [New York University Polytechnic School of Engineering, Polymer Research Institute, 6 MetroTech Center, Brooklyn, NY 11201 (United States); Lokaj, Jan; Pokorná, Veronika; Cimrová, Věra [Institute of Macromolecular Chemistry, Academy of Sciences of the Czech Republic, Heyrovský Sq. 2, 162 06 Prague 6 (Czech Republic)

    2015-04-15

    Polystyrene-block-poly(styrene-alt-maleic anhydride) was synthesized by nitroxide mediated radical polymerization and modified with 7-amino-4-methylquinolin-2(1H)-one (I) and methanol. The formed block polymer ligand contained a quinolinone fluorophore (Ω) and carboxyl (III) or sodium carboxylate (IV) binding sites. The ligand-to-metal resonance energy transfer (RET) and ligand binding properties of [III–Tb{sup 3+}] and [IV–Tb{sup 3+}] complexes were investigated by steady-state and time-resolved luminescence spectroscopy in tetrahydrofuran/methanol and/or tetrahydrofuran/deuterated methanol mixtures and compared with those of a low-molecular-weight model ligand, i.e. the sodium salt of N-(4-methyl-2-oxo-1,2-dihydroquinolin-7-yl)succinamic acid (II). The long-lived emission intensities of Tb{sup 3+} at 490, 545, 585, and 620 nm corresponding to the {sup 5}D{sub 4}→{sup 7}F{sub 6}, {sup 5}D{sub 4}→{sup 7}F{sub 5}, {sup 5}D{sub 4}→{sup 7}F{sub 4}, and {sup 5}D{sub 4}→{sup 7}F{sub 3} transitions, respectively, were strongly increased by the addition of ligands in the order [II-Tb{sup 3+}]⪡[III-Tb{sup 3+}]<[IV-Tb{sup 3+}]. The efficiency of energy transfer (E) was evaluated from the emission intensity of the donor (Ω) in the presence or absence of the acceptor (Tb{sup 3+}) depending on the acceptor concentration and ligand neutralization. It was concluded that the macromolecular ligand structural properties (polymer coil and supramolecular structures, e.g. micelles) were responsible for the increase in RET. The time-resolved luminescence measurements revealed that the binding affinity of the ligands II, III, and IV increased in the order II

  19. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  20. CCDC 1410822: Experimental Crystal Structure Determination : heptakis(dimethylammonium) dodecakis(mu-hydroxo)-bis(mu-oxo)-nonaaqua-nona-terbium tris(octakis(mu-hydroxo)-triaqua-bis(2-fluorobenzoato)-bis(formato)-hexa-terbium) dodecakis(5-[(4-carboxylatophenyl)methoxy]benzene-1,3-dicarboxylate) unknown solvate

    KAUST Repository

    Alezi, Dalal

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  1. Jewish Literature and History Between the War of the Maccabees (167 BC and the Bar Kochba Rebellion (135 AC

    Directory of Open Access Journals (Sweden)

    Ricardo Martínez Lacy

    2016-06-01

    Full Text Available Droysen postuló la existencia de una época helenística en la que se dio la fusión de la cultura europea clásica y la asiática oriental. Le dio ese nombre, que se encuentra atestado por primera vez en el segundo libro de los Macabeos (4.13, donde designa la adopción de la cultura, la manera de pensar y el idioma griegos (Bichler: 5-22. El resultado de esa síntesis, según el mismo autor, fue el cristianismo. En este proceso, es importante la literatura porque desde su origen el judaísmo se ha regido e, incluso, se define por medio de una ley escrita a la cual se le fueron agregando libros, algunos aceptados como canónicos, que fueron formando la Biblia, y otros no, los Apócrifos del Antiguo Testamento. En esta época se empieza a escribir una literatura judía más profana, con Filón de Alejandría, que escribió libros de religión, historia y filosofía, y Flavio Josefo, historiador. Este corpus literario conforma el testimonio más directo de la helenización judía, de ahí su importancia histórica.

  2. Jewish Literature and History Between the War of the Maccabees (167 BC) and the Bar Kochba Rebellion (135 AC)

    OpenAIRE

    Ricardo Martínez Lacy

    2016-01-01

    Droysen postuló la existencia de una época helenística en la que se dio la fusión de la cultura europea clásica y la asiática oriental. Le dio ese nombre, que se encuentra atestado por primera vez en el segundo libro de los Macabeos (4.13), donde designa la adopción de la cultura, la manera de pensar y el idioma griegos (Bichler: 5-22). El resultado de esa síntesis, según el mismo autor, fue el cristianismo. En este proceso, es importante la literatura porque desde su origen el judaísmo se ha...

  3. SU-E-T-167: Evaluation of Mobius Dose Calculation Engine Using Out of the Box Preconfigured Beam Data

    Energy Technology Data Exchange (ETDEWEB)

    Cardan, R [UAB University of Alabama, Birmingham, Birmingham, AL (United States); Faught, A [MD Anderson Cancer Center, Houston, TX (United States); Huang, M; Benhabib, S [University of Alabama at Birmingham, Birmingham, AL (United States); Brezovich, I; Popple, R [University of Alabama Birmingham, Birmingham, AL (United States); Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)

    2014-06-01

    Purpose: Determine the dose calculation accuracy of a preconfigured Mobius server for use in secondary checks of a treatment planning system. Methods: 10 plans were created for irradiation on two of the IROC (formerly RPC) accreditation phantoms: 4 for the head and neck phantom and 6 for the lung phantom. The plans each were created using one of four different photon energies (6FFF, 10 FFF, 6X, and 15X) and were varied in treatment type including VMAT, step and shoot IMRT, dynamic MLC IMRT (DMLC), and conformal RT (CRT). The TLDs in the phantoms were contoured, and each plan was sent for calculation to Mobius software (Mobius Medical Systems, Houston, TX) with a default configuration. Each plan was then irradiated on the planned phantom 3 times to create an average reading across 56 TLDs. These readings were then compared against the corresponding Mobius calculation at each TLD location. Results: The mean difference (MD) normalized to the plan prescription dose between each TLD and Mobius calculation for all measurements was 0.5 ± 3.3%, with a maximum difference of 8.4%. The MD was 0.6 ± 3.8%, − 2.0 ± 1.9%, 1.7 ± 3.7%, and 1.9 ± 1.2% across the 6FFF, 10FFF, 6X and 15X energies respectively. The MD was −1.2 ± 2.3% for lung plans and 1.8 ± 3.5% for head/neck plans. Across treatment types, the MD ranged from − 1.8 ± 1.7% for CRT to 4.3 ± 2.4 % for DMLC. Conclusion: Out of the box and preconfigured, Mobius provides accurate dose calculations with respect to beam energy, treatment type, and treatment site.

  4. Academic Resilience: What Schools and Countries Do to Help Disadvantaged Students Succeed in PISA. OECD Education Working Papers, No. 167

    Science.gov (United States)

    Agasisti, Tommaso; Avvisati, Francesco; Borgonovi, Francesca; Longobardi, Sergio

    2018-01-01

    Resilience refers to the capacity of individuals to prosper despite encountering adverse circumstances. This paper defines academic resilience as the ability of 15-year-old students from disadvantaged backgrounds to perform at a certain level in the Programme for International Student Assessment (PISA) in reading, mathematics and science that…

  5. 46 CFR 167.65-70 - Reports of accidents, repairs, and unsafe boilers and machinery by engineers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Reports of accidents, repairs, and unsafe boilers and... of accidents, repairs, and unsafe boilers and machinery by engineers. (a) Before making repairs to a boiler of a nautical school ship the engineer in charge shall report, in writing, the nature of such...

  6. Vol. 4(1), S/No 13, January, 2015:148-167 ISSN: 2225-8590 (Print ...

    African Journals Online (AJOL)

    DR Nneka

    2015-01-13

    Jan 13, 2015 ... The basic assumption in Public interest discourse is that regulation is .... households on a self-targeting basis by relevant service authorities in their .... Pricing policy (EPP) documents into perspective, it is necessary to summarize the ... the attraction and retention of a competent work force (EPP 2008: 8).

  7. FCJ-167 Spraying, fishing, looking for trouble: The Chinese Internet and a critical perspective on the concept of trolling

    Directory of Open Access Journals (Sweden)

    Gabriele de Seta

    2013-12-01

    Full Text Available Internet research has dealt with trolls from many different perspectives, framing them as agents of disruption, nomadic hate breeders and lowbrow cynics spawned by the excessive freedoms of online interaction, or as legitimate and necessary actors in the ecology of online communities. Yet, the question remains: what is a troll, where it come from and where does it belong? Presenting the results of a brief troll-hunt on the Chinese Internet and discussing the features of troll-like figures in Chinese digital folklore, I argue in favour of a localised understanding of Internet cultures, presenting trolling as a culture-specific construct that has come to embody disparate kinds of online behaviour and to function as an umbrella term for different kinds of discourse about the Internet itself.

  8. Preliminary Measurements and Code Calculations of Flow through a Cascade of DCA Blading at a Solidity of 1.67.

    Science.gov (United States)

    1982-06-01

    turbines that are capable of developing large amounts of thrust or power has motivated a continuing drive to obtain more ac- curate predictions of the flow...O - ps4 .. 8. OLU .ju J I.- .oqct 0 i CCU (J O4 a0.12 0. O.-4q ry ~WCLn Cc 43- cc . 49 0- 1W - 0.a- 4tWO U .-. NQ ujc0W - a~U .1 0U 0 0 *M o-% Ow a%.N

  9. The purification of the rare earth metals. II

    International Nuclear Information System (INIS)

    Jordan, R.G.; Jones, D.W.; Hems, V.J.

    1975-01-01

    Solid-state electrotransport processing has been demonstrated as a technique for purifying terbium. The results show that both oxygen and nitrogen migrate rapidly in the same direction as the electron flow. Although hydrogen contamination occurs on contact with air, terbium of better than 99.9 at. % has been prepared from commercially available starting material. The preparation and characterisation of high-quality single-crystal terbium specimens is also described. (Auth.)

  10. Filmes delgados luminescentes obtidos a partir de hidroxicarbonatos de ítrio ativados por európio ou térbio Luminescent thin films obtained from ytrium hydroxycarbonates activated by terbium or europium

    Directory of Open Access Journals (Sweden)

    Emy Niyama

    2004-04-01

    Full Text Available These films were obtained by dip coating. Parameters like dislocation velocity; number of deposits, suspension concentration, and number of deposits followed or not by heat treatment between each deposit and calcination temperature were evaluated for establishing the best homogeneity. The obtained films were characterized in terms of their morphology, optical quality and photoluminescence by scanning electron microscopy (SEM, UV-vis absorption spectrophotometry and luminescence spectroscopy, respectively. The morphologic and luminescent characteristics showed dip coating as good laboratory technique for development of thin films for optical applications.

  11. Terbium doped SnO2 nanoparticles as white emitters and SnO2:5Tb/Fe3O4 magnetic luminescent nanohybrids for hyperthermia application and biocompatibility with HeLa cancer cells.

    Science.gov (United States)

    Singh, Laishram Priyobarta; Singh, Ningthoujam Premananda; Srivastava, Sri Krishna

    2015-04-14

    SnO2:5Tb (SnO2 doped with 5 at% Tb(3+)) nanoparticles were synthesised by a polyol method and their luminescence properties at different annealing temperatures were studied. Characterization of nanomaterials was done by X-ray diffraction (XRD), Fourier transformation infrared spectroscopy (FTIR), transmission electron microscopy (TEM) and vibrating sample magnetometry (VSM). XRD studies indicate that the prepared nanoparticles were of tetragonal structures. Upon Tb(3+) ion incorporation into SnO2, Sn(4+) changes to Sn(2+) and, on annealing again at higher temperature, Sn(2+) changes to Sn(4+). The prepared nanoparticles were spherical in shape. Sn-O vibrations were found from the FTIR studies. In photoluminescence studies, the intensity of the emission peaks of Tb(3+) ions increases with the increase of annealing temperature, and emission spectra lie in the region of white emission in the CIE diagram. CCT calculations show that the SnO2:5Tb emission lies in cold white emission. Quantum yields up to 38% can be obtained for 900 °C annealed samples. SnO2:5Tb nanoparticles were well incorporated into the PVA polymer and such a material incorporated into the polymer can be used for display devices. The SnO2:5Tb/Fe3O4 nanohybrid was prepared and investigated for hyperthermia applications at different concentrations of the nanohybrid. This achieves a hyperthermia temperature (42 °C) under an AC magnetic field. The hybrid nanomaterial SnO2:5Tb/Fe3O4 was found to exhibit biocompatibility with HeLa cells (human cervical cancer cells) at concentrations up to 74% for 100 μg L(-1). Also, this nanohybrid shows green emission and thus it will be helpful in tracing magnetic nanoparticles through optical imaging in vivo and in vitro application.

  12. Stability constants and thermodynamic parameters of trivalent gadolinium, yttrium, terbium, dysprosium and holmium complexes with 2-(p-sulphophenylazo) 1,8-dihydroxynaphthalene 3,6 disulphonic acid (trisodium salt)[SPADNS

    International Nuclear Information System (INIS)

    Dubey, S.N.; Nagpal, S.; Kalra, H.L.; Puri, D.M.

    1980-01-01

    The stepwise stability constants of Gd(III), Y(III), Tb(III), Dy(III) and Ho(III) complexes with SPADNS have been determined potentiometrically in aqueous solution using Bjerrum-Calvin technique as modified by Irving and Rossotti at different temperatures (20deg and 40deg) and 0.1 M ionic strength (NaClO 4 ). The trend in the stability of these metal complexes has been found to be: Ho(III) > Dy(III) > Tb(III) > Y(III) > Gd(III). The overall changes in ΔGdeg, ΔHdeg and ΔSdeg accompanying the complex formation have also been determined. (author)

  13. Stability constants and thermodynamic parameters of trivalent gadolinium, yttrium, terbium, dysprosium and holmium complexes with 2-(p-sulphophenylazo) 1,8-dihydroxynaphthalene 3,6 disulphonic acid (trisodium salt)(SPADNS)

    Energy Technology Data Exchange (ETDEWEB)

    Dubey, S.N.; Nagpal, S.; Kalra, H.L.; Puri, D.M. (Kurukshetra Univ. (India). Dept. of Chemistry)

    1980-10-01

    The stepwise stability constants of Gd(III), Y(III), Tb(III), Dy(III) and Ho(III) complexes with SPADNS have been determined potentiometrically in aqueous solution using Bjerrum-Calvin technique as modified by Irving and Rossotti at different temperatures (20deg and 40deg) and 0.1 M ionic strength (NaClO/sub 4/). The trend in the stability of these metal complexes has been found to be: Ho(III) > Dy(III) > Tb(III) > Y(III) > Gd(III). The overall changes in ..delta..Gdeg, ..delta..Hdeg and ..delta..Sdeg accompanying the complex formation have also been determined.

  14. CCDC 1410820: Experimental Crystal Structure Determination : heptakis(dimethylammonium) heptacosa-terbium dodecakis((1,1'-biphenyl)-3,4',5-tricarboxylate) hexakis(2-fluorobenzoate) hexakis(formate) hexatriacontakis(hydroxide) bis(oxide) unknown solvate hydrate

    KAUST Repository

    Alezi, Dalal; Peedikakkal, Abdul Malik P.; Weseliński, Łukasz J.; Guillerm, Vincent; Belmabkhout, Youssef; Cairns, Amy J.; Chen, Zhijie; Wojtas, Łukasz; Eddaoudi, Mohamed

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  15. CCDC 954772: Experimental Crystal Structure Determination : catena-(Dimethylammonium tris(mu~4~-3-fluorobiphenyl-4,4'-dicarboxylato)-tetrakis(mu~3~-hydroxo)-triaqua-tri-terbium unknown solvate)

    KAUST Repository

    Xue, Dongxu; Cairns, Amy J.; Belmabkhout, Youssef; Wojtas, Lukasz; Liu, Yunling; Al Kordi, Mohamed; Eddaoudi, Mohamed

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  16. CCDC 954770: Experimental Crystal Structure Determination : catena-(Dimethylammonium tris(mu~4~-3,3'-difluorobiphenyl-4,4'-dicarboxylato)-tetrakis(mu~3~-hydroxo)-triaqua-tri-terbium unknown solvate)

    KAUST Repository

    Xue, Dongxu; Cairns, Amy J.; Belmabkhout, Youssef; Wojtas, Lukasz; Liu, Yunling; Al Kordi, Mohamed; Eddaoudi, Mohamed

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  17. Reconstruction of geomagnetic activity and near-Earth interplanetary conditions over the past 167 yr - Part 1: A new geomagnetic data composite

    Science.gov (United States)

    Lockwood, M.; Barnard, L.; Nevanlinna, H.; Owens, M. J.; Harrison, R. G.; Rouillard, A. P.; Davis, C. J.

    2013-11-01

    We present a new composite of geomagnetic activity which is designed to be as homogeneous in its construction as possible. This is done by only combining data that, by virtue of the locations of the source observatories used, have similar responses to solar wind and IMF (interplanetary magnetic field) variations. This will enable us (in Part 2, Lockwood et al., 2013a) to use the new index to reconstruct the interplanetary magnetic field, B, back to 1846 with a full analysis of errors. Allowance is made for the effects of secular change in the geomagnetic field. The composite uses interdiurnal variation data from Helsinki for 1845-1890 (inclusive) and 1893-1896 and from Eskdalemuir from 1911 to the present. The gaps are filled using data from the Potsdam (1891-1892 and 1897-1907) and the nearby Seddin observatories (1908-1910) and intercalibration achieved using the Potsdam-Seddin sequence. The new index is termed IDV(1d) because it employs many of the principles of the IDV index derived by Svalgaard and Cliver (2010), inspired by the u index of Bartels (1932); however, we revert to using one-day (1d) means, as employed by Bartels, because the use of near-midnight values in IDV introduces contamination by the substorm current wedge auroral electrojet, giving noise and a dependence on solar wind speed that varies with latitude. The composite is compared with independent, early data from European-sector stations, Greenwich, St Petersburg, Parc St Maur, and Ekaterinburg, as well as the composite u index, compiled from 2-6 stations by Bartels, and the IDV index of Svalgaard and Cliver. Agreement is found to be extremely good in all cases, except two. Firstly, the Greenwich data are shown to have gradually degraded in quality until new instrumentation was installed in 1915. Secondly, we infer that the Bartels u index is increasingly unreliable before about 1886 and overestimates the solar cycle amplitude between 1872 and 1883 and this is amplified in the proxy data used before 1872. This is therefore also true of the IDV index which makes direct use of the u index values.

  18. Reconstruction of geomagnetic activity and near-Earth interplanetary conditions over the past 167 yr – Part 1: A new geomagnetic data composite

    Directory of Open Access Journals (Sweden)

    M. Lockwood

    2013-11-01

    Full Text Available We present a new composite of geomagnetic activity which is designed to be as homogeneous in its construction as possible. This is done by only combining data that, by virtue of the locations of the source observatories used, have similar responses to solar wind and IMF (interplanetary magnetic field variations. This will enable us (in Part 2, Lockwood et al., 2013a to use the new index to reconstruct the interplanetary magnetic field, B, back to 1846 with a full analysis of errors. Allowance is made for the effects of secular change in the geomagnetic field. The composite uses interdiurnal variation data from Helsinki for 1845–1890 (inclusive and 1893–1896 and from Eskdalemuir from 1911 to the present. The gaps are filled using data from the Potsdam (1891–1892 and 1897–1907 and the nearby Seddin observatories (1908–1910 and intercalibration achieved using the Potsdam–Seddin sequence. The new index is termed IDV(1d because it employs many of the principles of the IDV index derived by Svalgaard and Cliver (2010, inspired by the u index of Bartels (1932; however, we revert to using one-day (1d means, as employed by Bartels, because the use of near-midnight values in IDV introduces contamination by the substorm current wedge auroral electrojet, giving noise and a dependence on solar wind speed that varies with latitude. The composite is compared with independent, early data from European-sector stations, Greenwich, St Petersburg, Parc St Maur, and Ekaterinburg, as well as the composite u index, compiled from 2–6 stations by Bartels, and the IDV index of Svalgaard and Cliver. Agreement is found to be extremely good in all cases, except two. Firstly, the Greenwich data are shown to have gradually degraded in quality until new instrumentation was installed in 1915. Secondly, we infer that the Bartels u index is increasingly unreliable before about 1886 and overestimates the solar cycle amplitude between 1872 and 1883 and this is amplified in the proxy data used before 1872. This is therefore also true of the IDV index which makes direct use of the u index values.

  19. CRED Subsurface Temperature Recorder (STR); NWHI, GAR; Long: -167.99952, Lat: 24.99883 (WGS84); Sensor Depth: 10.40m; Data Range: 20030719-20040919.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  20. CRED Subsurface Temperature Recorder (STR); NWHI, GAR; Long: -167.99958, Lat: 24.99883 (WGS84); Sensor Depth: 10.36m; Data Range: 20040920-20060705.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Data from Coral Reef Ecosystem Division (CRED), NOAA Pacific Islands Fisheries Science Center (PIFSC) Subsurface Temperature Recorders (STR) provide a time series of...

  1. Corrigendum to ;Dynamics of epidemic spreading with vaccination: Impact of social pressure and engagement; [Physica A 467 (2017) 167-179

    Science.gov (United States)

    Pires, Marcelo A.; Crokidakis, Nuno

    2017-09-01

    The authors regret to inform that there are two misprints in the axis of Fig. 3 of the paper. In Fig. 3(c), the correct identification of the x-axis is γ (gamma) instead of λ (lambda), and in Fig. 3(d), the correct identification of the y-axis is γ (gamma) instead of λ (lambda). These modifications do not affect the results of the paper, as well as the discussion made in the text.

  2. Guidelines by the AAPM and GEC-ESTRO on the use of innovative brachytherapy devices and applications: Report of Task Group 167

    Energy Technology Data Exchange (ETDEWEB)

    Nath, Ravinder [Department of Therapeutic Radiology, School of Medicine, Yale University, New Haven, Connecticut 06510 (United States); Rivard, Mark J., E-mail: mark.j.rivard@gmail.com [Department of Radiation Oncology, School of Medicine, Tufts University, Boston, Massachusetts 02111 (United States); DeWerd, Larry A. [Accredited Dosimetry and Calibration Laboratory, University of Wisconsin, Madison, Wisconsin 53706 (United States); Dezarn, William A. [Department of Radiation Oncology, School of Medicine, Wake Forest University, Winston-Salem, North Carolina 27157 (United States); Thompson Heaton, H. [Hagerstown, Maryland 21740 (United States); Ibbott, Geoffrey S. [Department of Radiation Physics, University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Meigooni, Ali S. [Comprehensive Cancer Centers of Nevada, Las Vegas, Nevada 89169 (United States); Ouhib, Zoubir [Radiation Oncology, Lynn Regional Cancer Center, Delray Beach, Florida 33484 (United States); Rusch, Thomas W. [Xoft, Inc., A Subsidiary of iCAD, Inc., San Jose, California 95134 (United States); Siebert, Frank-André [Clinic of Radiotherapy, Universitätsklinikum Schleswig-Holstein, Campus Kiel, Kiel 24105 (Germany); Venselaar, Jack L. M. [Department of Medical Physics and Engineering, Instituut Verbeeten, Tilburg LA 5000 (Netherlands)

    2016-06-15

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used in the evaluation of innovative devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining the equivalence of the innovative treatment modality to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of innovative radiotherapy devices or applications is a critical part in which physicists should be actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative brachytherapy devices and applications and includes evaluation of (1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, (2) risks and benefits from a regulatory and safety perspective, and (3) resource assessment and preparedness. Further, it is suggested that any developed calibration methods be traceable to a primary standards dosimetry laboratory (PSDL) such as the National Institute of Standards and Technology in the U.S. or to other PSDLs located elsewhere such as in Europe. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the Accredited Dosimetry Calibration Laboratories in the U.S. is encouraged before a source is introduced into widespread routine clinical use. The American Association of Physicists in Medicine and the Groupe Européen de Curiethérapie-European Society for Radiotherapy and Oncology (GEC-ESTRO) have developed guidelines for the safe and consistent application of brachytherapy using innovative devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. Nuclear Regulatory Commission, U.S. Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, U.S. Food and Drug Administration, European Commission for CE Marking (Conformité Européenne), and institutional review boards and radiation safety committees.

  3. PP167. A process evaluation of an innovative implementation strategy of the Dutch guidelines on hypertensive disorders in pregnancy using a computerized decision support system

    DEFF Research Database (Denmark)

    Luitjes, S.H.E.; Mesri, K; Wouters, M

    2012-01-01

    strategy of professional audit and feedback. In this study a process evaluation of BOS has been done, analyzing its efficiency, barriers and formulate improvement points.OBJECTIVES: Gynecologists, residents and clinical midwives from seven hospitals using BOS were asked to fill in the questionnaire...... by the respondents were mainly regarding the lay-out. Most respondents (85.3%) found it useful to make a computer based support system for other guidelines and 79.4% would also use this.CONCLUSION: BOS is regarded suitable as an instrument for implementing guidelines and respondents find it useful to develop...

  4. 17 CFR 230.426 - Filing of certain prospectuses under § 230.167 in connection with certain offerings of asset...

    Science.gov (United States)

    2010-04-01

    ... intention to purchase the asset-backed securities. (2) Any ABS informational and computational material if a... issuer or an underwriter that it will purchase all or a portion of the class of asset-backed securities...

  5. Guidelines by the AAPM and GEC-ESTRO on the use of innovative brachytherapy devices and applications: Report of Task Group 167

    International Nuclear Information System (INIS)

    Nath, Ravinder; Rivard, Mark J.; DeWerd, Larry A.; Dezarn, William A.; Thompson Heaton, H.; Ibbott, Geoffrey S.; Meigooni, Ali S.; Ouhib, Zoubir; Rusch, Thomas W.; Siebert, Frank-André; Venselaar, Jack L. M.

    2016-01-01

    Although a multicenter, Phase III, prospective, randomized trial is the gold standard for evidence-based medicine, it is rarely used in the evaluation of innovative devices because of many practical and ethical reasons. It is usually sufficient to compare the dose distributions and dose rates for determining the equivalence of the innovative treatment modality to an existing one. Thus, quantitative evaluation of the dosimetric characteristics of innovative radiotherapy devices or applications is a critical part in which physicists should be actively involved. The physicist’s role, along with physician colleagues, in this process is highlighted for innovative brachytherapy devices and applications and includes evaluation of (1) dosimetric considerations for clinical implementation (including calibrations, dose calculations, and radiobiological aspects) to comply with existing societal dosimetric prerequisites for sources in routine clinical use, (2) risks and benefits from a regulatory and safety perspective, and (3) resource assessment and preparedness. Further, it is suggested that any developed calibration methods be traceable to a primary standards dosimetry laboratory (PSDL) such as the National Institute of Standards and Technology in the U.S. or to other PSDLs located elsewhere such as in Europe. Clinical users should follow standards as approved by their country’s regulatory agencies that approved such a brachytherapy device. Integration of this system into the medical source calibration infrastructure of secondary standard dosimetry laboratories such as the Accredited Dosimetry Calibration Laboratories in the U.S. is encouraged before a source is introduced into widespread routine clinical use. The American Association of Physicists in Medicine and the Groupe Européen de Curiethérapie-European Society for Radiotherapy and Oncology (GEC-ESTRO) have developed guidelines for the safe and consistent application of brachytherapy using innovative devices and applications. The current report covers regulatory approvals, calibration, dose calculations, radiobiological issues, and overall safety concerns that should be addressed during the commissioning stage preceding clinical use. These guidelines are based on review of requirements of the U.S. Nuclear Regulatory Commission, U.S. Department of Transportation, International Electrotechnical Commission Medical Electrical Equipment Standard 60601, U.S. Food and Drug Administration, European Commission for CE Marking (Conformité Européenne), and institutional review boards and radiation safety committees.

  6. Synthesis of the first 11-vertex arachno-dicarbathiaborane anion, [1,6,7-C2SB8H11](-). Theoretical refinement of its structure

    Czech Academy of Sciences Publication Activity Database

    Janoušek, Zbyněk; Holub, Josef; Hnyk, Drahomír; Londesborough, Michael Geoffrey Stephen; Shoemaker, R. K.

    2003-01-01

    Roč. 22, č. 27 (2003), s. 3541-3545 ISSN 0277-5387 R&D Projects: GA MŠk LN00A028 Institutional research plan: CEZ:AV0Z4032918 Keywords : boranes * heteroboranes * NMR spectroscopy Subject RIV: CA - Inorganic Chemistry Impact factor: 1.584, year: 2003

  7. 18 CFR 16.7 - Information to be made available to the public at the time of notification of intent under...

    Science.gov (United States)

    2010-04-01

    ... whether the project is and has been operated in accordance with the requirements of each license article... and wildlife management plan related to the project area prepared by the existing licensee or any... access to, CEII, shall apply in the event of a challenge to a CEII designation or a request for access to...

  8. Reconstruction of geomagnetic activity and near-Earth interplanetary conditions over the past 167 yr – Part 2: A new reconstruction of the interplanetary magnetic field

    Directory of Open Access Journals (Sweden)

    M. Lockwood

    2013-11-01

    Full Text Available We present a new reconstruction of the interplanetary magnetic field (IMF, B for 1846–2012 with a full analysis of errors, based on the homogeneously constructed IDV(1d composite of geomagnetic activity presented in Part 1 (Lockwood et al., 2013a. Analysis of the dependence of the commonly used geomagnetic indices on solar wind parameters is presented which helps explain why annual means of interdiurnal range data, such as the new composite, depend only on the IMF with only a very weak influence of the solar wind flow speed. The best results are obtained using a polynomial (rather than a linear fit of the form B = χ · (IDV(1d − βα with best-fit coefficients χ = 3.469, β = 1.393 nT, and α = 0.420. The results are contrasted with the reconstruction of the IMF since 1835 by Svalgaard and Cliver (2010.

  9. ROMEIRO, Adriana. A construção de um mito: Antônio de Albuquerque e o levante emboaba, p.167-188.

    OpenAIRE

    Romeiro, Adriana

    2011-01-01

    Este artigo examina a construção da imagem de herói pacificador em torno de Antônio de Albuquerque, governador da capitania do Rio de Janeiro e depois da capitania de São Paulo e Minas do Ouro, considerado o responsável pela pacificação da Guerra dos Emboabas. Descrito por Cláudio Manuel da Costa como um herói dotado das virtudes da coragem e prudência, tal imagem se deslocaria depois para os estudos históricos, conformando as narrativas sobre a Guerra dos Emboabas, em particular, e a adminis...

  10. F167. ACCESS, UNDERSTAND, APPRAISE AND APPLY TO / OF HEALTH INFORMATION AND HEALTH LITERACY IN INDIVIDUALS AT-RISK FOR PSYCHOSIS: A SYSTEMATIC REVIEW

    Science.gov (United States)

    Seves, Mauro; Haidl, Theresa; Eggers, Susanne; Rostamzadeh, Ayda; Genske, Anna; Jünger, Saskia; Woopen, Christiane; Jessen, Frank; Ruhrmann, Stephan

    2018-01-01

    Abstract Background Numerous studies suggest that health literacy (HL) plays a crucial role in maintaining and improving individual health. Furthermore, empirical findings highlight the relation between levels of a person’s HL and clinical outcomes. So far, there are no reviews, which investigate HL in individuals at-risk for psychosis. The aim of the current review is to assess how individuals at risk of developing a first episode of psychosis gain access to, understand, evaluate and apply risk-related health information. Methods A mixed-methods approach was used to analyze and synthesize a variety of study types including qualitative and quantitative studies. Search strategy, screening and data selection have been carried out according to the PRISMA criteria. The systematic search was applied on peer-reviewed literature in PUBMED, Cochrane Library, PsycINFO and Web of Science. Studies were included if participants met clinical high risk criteria (CHR), including the basic symptom criterion (BS) and the ultra-high risk (UHR) criteria. The UHR criteria comprise the attenuated psychotic symptom criterion (APS), the brief limited psychotic symptom criterion (BLIPS) and the genetic risk and functional decline criterion (GRDP) Furthermore, studies must have used validated HL measures or any operationalization of the HL’s subdimensions (access, understanding, appraisal, decision-making or action) as a primary outcome. A third inclusion criterion comprised that the concept of HL or one of the four dimensions was mentioned in title or abstract. Data extraction and synthesis was implemented according to existing recommendations for appraising evidence from different study types. The quality of the included studies was evaluated and related to the study results. Results The search string returned 10587 papers. After data extraction 15 quantitative as well as 4 qualitative studies and 3 reviews were included. The Quality assessment evaluated 12 publications as “good”, 9 as “fair” and one paper as “poor”. Only one of the studies assessed HL with as primary outcome. In the other studies, the five different subdimensions of HL were investigated as a secondary outcome respectively mentioned in the paper. “Gaining Access” was examined in 18 of the 22 studies. “Understanding” has been assessed in 7 publications. “Appraise” was examined in 9 studies. “Apply decision making” and “Apply health behavior” were investigated in 1 of 8 studies. Since none of the included publications operationalized neither HL nor the subdimensions of HL with a validated measure, no explicit influencing factors could be found. Discussion Quantitative and qualitative evidence indicates that subjects at-risk for psychosis describe a lack of understanding about their state and fear stigmatization that might lead to dysfunctional coping strategies, such as ignoring and hiding symptoms. Affected subjects are eager to be informed about their condition and describe favoured channels for obtaining information. The internet, family members, school personnel and GP’s play a crucial role in gain access to, understand, evaluate and apply risk-related health information. The results clearly highlight that more research should be dedicated to HL in individuals at risk of developing a psychosis. Further studies should explore the relation between HL and clinical outcomes in this target population by assessing the underlining constructs with validated tools.

  11. Dakwah STAIN Purwokerto KOMUNIKA ISSN: 1978-1261 Vol.3 No.2 Juli-Desember 2009 pp.167-183 GENDER DALAM KONSTRUKSI MEDIA

    Directory of Open Access Journals (Sweden)

    Hariyanto Hariyanto

    2015-03-01

    Full Text Available Gender issues, the image of the relation of men and women in the media product, located at the position concurrence. While the media products that represent a certain meaning and reality to be submitted by his creator (media workers. Not infrequently, sense of product made through the media has put the position of media products as part of social reality itself.On the other hand, the position of the meaning of media products into the medium for the legitimacy of a change in governance norms and values in society. In other words, the image of the relation of men and women in the media products that contain sexual harassment can be carried still values the old conservative and applicable to the community that Indonesia is very patriarchy

  12. Multibeam collection for TN167: Multibeam data collected aboard Thomas G. Thompson from 2004-03-27 to 2004-04-17, Guam to Yokohama, Japan

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  13. The effect of population density on the elimination dynamics of a recessive lethal mutation l(2)M167(DTS) from experimental populations of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Kulikov, A. M.; Marec, František; Mitrofanov, V. G.

    2005-01-01

    Roč. 41, č. 3 (2005), s. 249-255 ISSN 1022-7954 Grant - others:Russian Foundation for Basic Research(RU) 02-04-50021; Program of the Presidium of the Russian Academy of Sciences "Dynamics of Gene Pools in Plants, Animals, and Humans"(RU) 10002-251/P-24/154-150/2004-04 -111 Institutional research plan: CEZ:AV0Z50070508 Keywords : Drosophila melanogaster Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.240, year: 2005

  14. Selection on viability of individuals heterozygous for the temperature-sensitive lethal mutation l(2)M167DTS in experimental populations of Drosophila melanogaster

    Czech Academy of Sciences Publication Activity Database

    Kulikov, A. M.; Marec, František; Mitrofanov, V. G.

    2005-01-01

    Roč. 41, č. 6 (2005), s. 613-619 ISSN 1022-7954 Grant - others:Russian Foundation for Basic Research(RU) 02-04-50021; Program of the Presidium of the Russian Academy of Sciences "Dynamics of Gene Pools in Plants, Animals, and Humans"(RU) 10002-251/P-24/154-150/2004-04-111 Institutional research plan: CEZ:AV0Z50070508 Keywords : heterozygous Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.240, year: 2005

  15. Determination of fitness components of flies bearing the recessive lethal l(2)M167DTS mutation with dominant heat sensitivity in artificial Drosophila melanogaster populations

    Czech Academy of Sciences Publication Activity Database

    Kulikov, A. M.; Kuznetsov, A.; Marec, František; Mitrofanov, V. G.

    2005-01-01

    Roč. 41, č. 6 (2005), s. 620-629 ISSN 1022-7954 Grant - others:Russian Foundation for Basic Research(RU) 02-04-50021; Program of the Presidium of the Russian Academy of Sciences "Dynamics of Gene Pools in Plants, Animals, and Humans"(RU) 10002-251/P-24/154-150/2004-04-111 Institutional research plan: CEZ:AV0Z50070508 Keywords : mutation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.240, year: 2005

  16. 167: CRITICALLY APPRAISE OF THE REPORTING QUALITY OF RANDOMIZED CONTROLLED TRIALS ARTICLES IN THE FIELD OF DIABETES IN MEDICAL GUIDELINES IN IRAN

    Science.gov (United States)

    Aletaha, Azadeh; Baradaran, Hamid Reza; Soltani, Akbar; Ramezani, Amir

    2017-01-01

    Background and aims To determine the quality of randomized controlled clinical trial reports in diabetes research in Iran and their presence in domestic and foreign credible guidelines which can imply whether randomized controlled trial articles in the field of diabetes are of good quality or not with respect to their high level of received citations, quality and credibility. Method We included RCTs conducted on Diabetes mellitus in Iran. Animal studies, educational, interventions, and non-randomized trials were excluded. This was a bibliographic study examining published journal articles involving RCTs in diabetes research from Iranian authors. A systematic search of ten databases(ISI Web of science, Scopus, PubMed, Science Direct, The Cochrane Library, Taylor & Francis Online, Biomed Central, EBSCO, ProQuest and OVID)were undertaken from July 2004–2014. We excluded duplicated publications reporting the same groups of participants and intervention two independent reviewers identify all eligible articles specifically designed data extraction form. Two reviewers assessed the quality of reporting by CONSORT 2010 (Consolidated Standards of Reporting Trials) checklist statement and also evaluate each article with Scientometry tools in 260 valid English diabetes guidelines. Result Overall, we included 185 RCTs on diabetes mellitus, One hundred and eight five (185) studies were included and appraised. Half of them (55.7%) were published in Iranian journals. Most (89.7%) were parallel RCTs, and being performed on type2 diabetic patients (77.8%). Less than half of the CONSORT items (43.2%) were reported in studies, totally. The reporting of randomization and blinding were poor. A few studies 15.1% mentioned the method of random sequence generation and strategy of allocation concealment. And only 34.8% of trials report how blinding was applied. From 185 articles, twelve articles (10%) are presented in 260 Guidelines. Conclusion The reporting quality of abstracts of RCTs on Diabetes mellitus still should be improved. After the publication of CONSORT for abstracts guideline, the RCT abstracts reporting quality were improvement to some extent. The presence of RCTs on diabetes mellitus in guidelines was poor. This indicates that RCTs on diabetes mellitus need substantial improvement. In order to present an adequate reporting of the randomized controlled trial results, it is necessary that comprehensive information be given about the study's design, implementation, included groups, and method of data analysis and interpretation of the results.

  17. Therapeutic use of radioactive isotopes

    CERN Document Server

    Caroline Duc

    2013-01-01

    In December, researchers from ISOLDE-CERN, the Paul Scherrer Institute (PSI) and the Institut Laue-Langevin (ILL) published the results of an in vivo study which successfully proved the effectiveness of four terbium isotopes for diagnosing and treating cancerous tumours.   Four terbium isotopes suitable for clinical purposes. “ISOLDE is the only installation capable of supplying terbium isotopes of such purity and intensity in the case of three out of the four types used in this study,” explains Karl Johnson, a physicist at ISOLDE.  “Producing over a thousand different isotopes, our equipment offers the widest choice of isotopes in the world!” Initially intended for fundamental physics research, ISOLDE has diversified its activities over time to invest in various projects in the materials science, biochemistry and nuclear medicine fields. The proof-of-concept study has confirmed that the four terbium isotopes 149Tb, 152Tb, 155Tb produ...

  18. O Não-Estado de Direito e de “Bem-Estar Social” que Reproduz a Exclusão Social na América do Sul - 10.5102/uri.v4i2.167

    Directory of Open Access Journals (Sweden)

    Alexandre Reis Nascimento

    2007-10-01

    Full Text Available O presente trabalho analisa O Não-Estado de Direito e de “Bem-Estar Social” que reproduz a exclusão social na América do Sul. O enfoque direciona-se para um discurso político e econômico na América do Sul voltado para o termo “globalização”, que foi a principal referência dos anos noventa nos mais diversos domínios de atividades e circunstâncias do mundo pós-Guerra Fria, aparentemente como a verdade absoluta para solucionar os problemas do mundo. Este termo é derivado de políticas neoliberais no início dos anos oitenta, através da difusão da abertura da economia de mercado dos Estados-Nações. Porém, esta proposta obscureceu os direitos dos povos, principalmente nos paises periféricos, onde houve um aumento da “injustiça social” e as “lutas de classes” e de “libertação” demonstram-se como fenômeno terminado, como conceitos obsoletos.

  19. A Response to Ages Past. Commentary on Harris, R. M., Michell, B.G. & Cooley. C. (1985) The Gender Gap in Library Education. (Journal of Education for Library and Information Science, 25(3), 167-176)

    Science.gov (United States)

    Wellstead, Peta

    2015-01-01

    Much has changed in the information environment since the years of Harris' review. It is important to mention the significance of the impact of technology that has rendered the work of librarians and information workers almost unknowable to those teaching in the period 1965-1983. As a result of these reviews and technological changes, many…

  20. Análise de estratégias de merchandising em telenovelas http://dx.doi.org/10.15601/1983-7631/rt.v7n13p157-167

    Directory of Open Access Journals (Sweden)

    Ana Clara Oliveira Santos Garner

    2015-02-01

    Full Text Available A televisão é um dos meios de comunicação e entretenimento mais utilizados pela sociedade. Dentre os programas de televisão mais assistidos no Brasil temos as telenovelas. Além de desenvolverem teledramaturgias de qualidade, também são utilizadas como o principal veículo de merchandising, no intuito de divulgar e estimular a compra de produtos e serviços. Este artigo faz uma análise do merchandising nas telenovelas da Rede Globo Sangue Bom e Amor à Vida. Seu objetivo foi identificar as principais ferramentas de merchandising usadas nas telenovelas, a fim de influenciar nos hábitos de consumo e comportamento dos telespectadores. A metodologia empregada foi a análise de conteúdo, por meio de categorias de análise.Palavras-chave: Telenovela; Rede Globo; Merchandising

  1. Police recording of road accident in-patients : investigation into the completeness, representativity, and reliability of police records of hospitalized traffic victims. Article published in Accident Analysis and Prevention, 1984/06. 16(3) pp167-184.

    NARCIS (Netherlands)

    Maas, M.W. & Harris, S.

    1984-01-01

    Many road safety research projects make use of the official police road accident data. Their use is often restricted to the data of fatal accidents and fatalities because it is the only complete registration, and the extent of underreporting of injury accidents is unknown. The need to extend the use

  2. Reeleição para a Câmara dos Deputados brasileira em 2006 e as incertezas do sistema eleitoral DOI:10.5007/2175-7984.2011v10n19p167

    Directory of Open Access Journals (Sweden)

    Alvaro Augusto de Borba Barreto

    2011-10-01

    Full Text Available A pesquisa relaciona o sucesso ou o fracasso na tentativa de reeleição dos deputados federais no pleito de 2006 com a votação individual e o posicionamento de cada um na lista, comparados a 2002, na tentativa de verificar se a performance em alguns desses indicadores pode ser a garantia para a manutenção do mandato parlamentar. São encontradas situações correspondentes a cada uma das oito combinações possíveis, as quais, ao serem analisadas, demonstram que não há fórmula de sucesso na atual configuração do sistema eleitoral: fazer mais votos e/ou melhorar o posicionamento na lista não são suficientes para a manutenção do mandato, bem como desempenho negativo em comparação ao pleito anterior não elimina esta possibilidade.

  3. Cermet electrode

    Science.gov (United States)

    Maskalick, Nicholas J.

    1988-08-30

    Disclosed is a cermet electrode consisting of metal particles of nickel, cobalt, iron, or alloys or mixtures thereof immobilized by zirconia stabilized in cubic form which contains discrete deposits of about 0.1 to about 5% by weight of praseodymium, dysprosium, terbium, or a mixture thereof. The solid oxide electrode can be made by covering a substrate with particles of nickel, cobalt, iron, or mixtures thereof, growing a stabilized zirconia solid oxide skeleton around the particles thereby immobilizing them, contacting the skeleton with a compound of praseodymium, dysprosium, terbium, or a mixture thereof, and heating the skeleton to a temperature of at least 500.degree. C. The electrode can also be made by preparing a slurry of nickel, cobalt, iron, or mixture and a compound of praseodymium, dysprosium, terbium, or a mixture thereof, depositing the slurry on a substrate, heating the slurry to dryness, and growing a stabilized zirconia skeleton around the metal particles.

  4. Investigation of the chemistry of the dielectric/FeCoTb interface by x-ray photoelectron spectroscopy and Auger electron spectroscopy

    International Nuclear Information System (INIS)

    Stickle, W.F.; Coulman, D.

    1987-01-01

    The interfacial chemistry of magneto-optic structures of sputter deposited SiO, SiO 2 , Si 3 N 4 /FeCoTb/SiO, SiO 2 , and Si 3 N 4 was studied in detail by x-ray photoelectron spectroscopy (XPS) and Auger electron spectroscopy (AES). XPS and AES depth profiles have revealed a substantial amount of redox chemistry at the dielectric/rare-earth transition metal interfaces. The chemical reactions occur preferentially with the terbium as revealed in the XPS portion of the study by the formation of terbium oxide and terbium silicide. In the case of Si 3 N 4 evidence of TbN/sub x/ has also been observed. ''As deposited'' and annealed samples of the magneto-optic structures are compared and contrasted. It is concluded that Si 3 N 4 is a superior dielectric for magneto-optic media

  5. Radiochemical separation of Tb-149 after tandem accelerator production

    International Nuclear Information System (INIS)

    Sarkar, S.R.

    1996-01-01

    Full text: Terbium-149 is produced by the heavy ion induced reaction of the type 142 Nd( 12 C,5n) 149 Dy→ 149 Tb. This work concerns the separation of terbium from neodymium target, and other lanthanides produced by secondary reactions on neodymium target. Firstly, anion-exchange separation is carried out at room temperature using acid-alcohol media (90% methanol-10% 5M nitric acid) as eluent. But the separation is not satisfactory. To achieve satisfactory separation, cation exchange separation is performed under pressure at room temperature using 0.1 6M α-hydroxyisobutyric acid of pH 5 as eluent. The pressure is exerted from a nitrogen gas cylinder. The simplicity and efficacy of this method for the separation of terbium are discussed in comparison with the commercially available high performance liquid chromatography system

  6. Reactive Chemical Vapor Deposition Method as New Approach for Obtaining Electroluminescent Thin Film Materials

    Directory of Open Access Journals (Sweden)

    Valentina V. Utochnikova

    2012-01-01

    Full Text Available The new reactive chemical vapor deposition (RCVD method has been proposed for thin film deposition of luminescent nonvolatile lanthanide aromatic carboxylates. This method is based on metathesis reaction between the vapors of volatile lanthanide dipivaloylmethanate (Ln(dpm3 and carboxylic acid (HCarb orH2Carb′ and was successfully used in case of HCarb. Advantages of the method were demonstrated on example of terbium benzoate (Tb(bz3 and o-phenoxybenzoate thin films, and Tb(bz3 thin films were successfully examined in the OLED with the following structure glass/ITO/PEDOT:PSS/TPD/Tb(bz3/Ca/Al. Electroluminescence spectra of Tb(bz3 showed only typical luminescent bands, originated from transitions of the terbium ion. Method peculiarities for deposition of compounds of dibasic acids H2Carb′ are established on example of terbium and europium terephtalates and europium 2,6-naphtalenedicarboxylate.

  7. Extraction of nitrates of lanthanoids (3) of the yttrium group and yttrium (3) by trialkylbenzylammonium nitrate in toluene

    International Nuclear Information System (INIS)

    Pyartman, A.K.; Kovalev, S.V.; Keskinov, V.A.; Kopyrin, A.A.

    1997-01-01

    A study was made on extraction of nitrates of lanthanoids (3) of the yttrium group (terbium-lutetium) and yttrium (3) by trialkylbensylammonium nitrate in toluene at T=298.15 K pH 2. Extraction isotherms are described with account of formation of compound of (R 4 N) 2 [Ln(NO 3 ) 5 ] composition in organic phase. Values of extraction constants decreasing in terbium (3)-lutetium (3) series, were calculated. Value of extraction constant for yttrium (3) is close to the value of extraction constant for ytterbium (3). 13 refs., 2 figs., 3 tabs

  8. Luminescent materials based on Tb, Eu-containing layered double hydroxides

    International Nuclear Information System (INIS)

    Zhuravleva, N.G.; Eliseev, A.A.; Lukashin, A.V.; Kinast, U.; Tret'yakov, Yu.D.

    2004-01-01

    Luminescent materials on the basis of magnesium-aluminium layered double hydroxides with intercalated anionic complexes of terbium and europium picolinates were synthesized. Relying on data of spectroscopy, elementary and X-ray phase analyses, the change in the rare earth complex structure and metal/ligand ratio, depending on the hydroxide layer charge, determined by Mg/Al ratio in the double hydroxide, were ascertained. The values of quantum yields of luminescence for terbium-containing samples amounted to 30-50% [ru

  9. Kinetic study of Tb/sup 3 +/(/sup 5/D/sub 3/) luminescence in phosphate glasses

    Energy Technology Data Exchange (ETDEWEB)

    Anisimov, V.A.; Dmitryuk, A.V.; Karapetyan, G.O.

    1986-01-01

    This paper presents precise determinations of the kinetics of terbium luminescence over a broad dynamic range, in order to refine the mechanism of concentration quenching of the Tb/sup 3 +/(/sup 5/D/sub 3/) luminescence in glasses. After establishing the mechanism of Tb/sup 3 +/(/sup 5/D/sub 3/) luminescence quenching by the iteration method, the authors determine the value of the parameter for an arbitrary concentration of the activator. Results of this study show that the mechanism of concentration quenching of luminescence is static dipole-dipole interaction of terbium ions.

  10. Rare earth oxyhalogenide base thermoluminescent material

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1976-01-01

    A process is described that consists to expose a thermoluminescent material to ionizing radiations, the material being a rare earth oxyhalogenide with terbium additions, to heat this material up to the emission of visible radiations and to measure the emitted radiations which are proportional to the ionizing radiation dose [fr

  11. Performance of 20 Ci 137Cs γ-ray Compton spectrometer for the ...

    Indian Academy of Sciences (India)

    of the machine is assessed using aluminum, terbium and mercury samples and the exper- imental data from ... keV) are used. This is particularly true in the case of heavy elements ... In this paper, a design with optimum choice of experimental.

  12. Untitled

    Indian Academy of Sciences (India)

    Recently there has been a spurt in studies on heavy rare earth metals because of the magnon-phonon interactions observed in them. The phonon dispersion relations in terbium have been investigated by Houmann and Nicklow (1970) and by Menon and. Rao (1972). The magnon dispersion relations have been measured ...

  13. Test plan for air monitoring during the Cryogenic Retrieval Demonstration

    International Nuclear Information System (INIS)

    Yokuda, E.

    1992-06-01

    This report presents a test plan for air monitoring during the Cryogenic Retrieval Demonstration (CRD). Air monitors will be used to sample for the tracer elements neodymium, terbium, and ytterbium, and dysprosium. The results from this air monitoring will be used to determine if the CRD is successful in controlling dust and minimizing contamination. Procedures and equipment specifications for the test are included

  14. Scanning Electron Microscope-Cathodoluminescence Analysis of Rare-Earth Elements in Magnets.

    Science.gov (United States)

    Imashuku, Susumu; Wagatsuma, Kazuaki; Kawai, Jun

    2016-02-01

    Scanning electron microscope-cathodoluminescence (SEM-CL) analysis was performed for neodymium-iron-boron (NdFeB) and samarium-cobalt (Sm-Co) magnets to analyze the rare-earth elements present in the magnets. We examined the advantages of SEM-CL analysis over conventional analytical methods such as SEM-energy-dispersive X-ray (EDX) spectroscopy and SEM-wavelength-dispersive X-ray (WDX) spectroscopy for elemental analysis of rare-earth elements in NdFeB magnets. Luminescence spectra of chloride compounds of elements in the magnets were measured by the SEM-CL method. Chloride compounds were obtained by the dropwise addition of hydrochloric acid on the magnets followed by drying in vacuum. Neodymium, praseodymium, terbium, and dysprosium were separately detected in the NdFeB magnets, and samarium was detected in the Sm-Co magnet by the SEM-CL method. In contrast, it was difficult to distinguish terbium and dysprosium in the NdFeB magnet with a dysprosium concentration of 1.05 wt% by conventional SEM-EDX analysis. Terbium with a concentration of 0.02 wt% in an NdFeB magnet was detected by SEM-CL analysis, but not by conventional SEM-WDX analysis. SEM-CL analysis is advantageous over conventional SEM-EDX and SEM-WDX analyses for detecting trace rare-earth elements in NdFeB magnets, particularly dysprosium and terbium.

  15. Tuning the activity of Pt alloy electrocatalysts by means of the lanthanide contraction

    DEFF Research Database (Denmark)

    Escribano, Maria Escudero; Malacrida, Paolo; Hansen, Martin Hangaard

    2016-01-01

    is lanthanum, cerium, samarium, gadolinium, terbium, dysprosium, thulium, or calcium. The materials are among the most active polycrystalline Pt-based catalysts reported, presenting activity enhancement by a factor of 3 to 6 over Pt. The active phase consists of a Pt overlayer formed by acid leaching. The ORR...

  16. Radio-luminescence efficiency and rare-earth dispersion in Tb-doped silica glasses

    Czech Academy of Sciences Publication Activity Database

    Fasoli, M.; Moretti, F.; Lauria, A.; Chiodini, N.; Vedda, A.; Nikl, Martin

    2007-01-01

    Roč. 42, - (2007), s. 784-787 ISSN 1350-4487 Institutional research plan: CEZ:AV0Z10100521 Keywords : sol-gel * scintillators * silica * rare earths * terbium Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.054, year: 2007

  17. Viscosity measurements of molten refractory metals using an electrostatic levitator

    International Nuclear Information System (INIS)

    Ishikawa, Takehiko; Paradis, Paul-François; Okada, Junpei T; Watanabe, Yuki

    2012-01-01

    Viscosities of several refractory metals (titanium, nickel, zirconium, niobium, ruthenium, rhodium, hafnium, iridium and platinum) and terbium have been measured by the oscillation drop method with an improved procedure. The measured data were less scattered than our previous measurements. Viscosities at their melting temperatures showed good agreement with literature values and some predicted values. (paper)

  18. Thermoluminescent coactivated rare earth oxyhalide phosphors and x-ray image converters utilizing said phosphors

    International Nuclear Information System (INIS)

    Rabatin, J.G.

    1984-01-01

    Oxyhalides of lanthanum, gadolinium and lutetium coactivated with a first activator selected from bismuth and samarium to provide the color of light emission and a second coactivator (e.g. terbium or praseodymium) which increases the amount of stored energy in a stored radiographic latent image are found to be superior in their conversion efficiency of x-rays to visible light. (author)

  19. Charge Carrier Trapping Processes in RE2O2S (RE = La, Gd, Y, and Lu)

    NARCIS (Netherlands)

    Luo, H.; Bos, A.J.J.; Dorenbos, P.

    2017-01-01

    Two different charge carrier trapping processes have been investigated in RE2O2S:Ln3+ (RE = La, Gd, Y, and Lu; Ln = Ce, Pr, and Tb) and RE2O2S:M (M = Ti4+ and Eu3+). Cerium, praseodymium and terbium act as recombination centers and hole trapping centers while host intrinsic defects provide the

  20. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Huray, P.G.; Nave, S.E.

    1984-01-01

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  1. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EL55E] ... Length = 167 ... Query: 7 ... LIVNQHLRLEQITEDDAEPVFRLICRQRDYLSRWLPGVGLTSNVSSTLKFIRSLKPLEQV 66 ... ... ... LIVNQHLRLEQITEDDAEPVFRLICRQRDYLSRWLPGVGLTSNVSSTLKFIRSLKPLEQV Sbjct: 1 ... LIVNQHLRLEQITEDDA

  2. Decision no 2010-DC-0188 by the Nuclear Safety Authority on the 7. of July 2010 specifying to Electricite de France-Societe Anonyme (EDF-SA) the limits of releases in the environment of liquid and gaseous effluents for the operation of Flamanville 1 (IBN n 108), Flamanville 2 (INB n 109) and Flamanville 3 (INB n 167) reactors

    International Nuclear Information System (INIS)

    2010-01-01

    This document contains references to the different legal and official documents (codes, orders, minister's opinion, public surveys, administrative authorizations, local community opinion) at the root of this specification of limits related to releases in the environment of liquid and gaseous effluents by the three Flamanville nuclear reactors operated by Electricite de France-Societe Anonyme (EDF-SA). Tables present the limits for different gaseous and liquid radioactive emissions (carbon 14, hydrogen 3, iodine, radioactive rare earths, and other beta and gamma emitters) from these different installations, but also the maximum admitted concentrations for gaseous chemical effluents (boric acid, hydrazine hydrate, morpholine, phosphates, nitrates, various metals, and so on). The limits for thermal releases are also specified

  3. The effect of male mating competitiveness, developmental rate, and viability of larvae and pupae in D. melanogaster heterozygous for the temperature-sensitive lethal mutation 1(2)M167(DTS) on the dynamics of the mutation elimination from the population

    Czech Academy of Sciences Publication Activity Database

    Kulikov, A. M.; Marec, František; Mitrofanov, V. G.

    2005-01-01

    Roč. 41, č. 5 (2005), s. 495-500 ISSN 1022-7954 Grant - others:Russian Foundation for Basic Research(RU) 02-04-50021; Program of the Presidium of the Russian Academy of Sciences "Dynamics of Gene Pools in Plants, Animals, and Humans"(RU) 10002-251/P-24/154-150/2004-04-111 Institutional research plan: CEZ:AV0Z50070508 Keywords : mutation elimination Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.240, year: 2005

  4. Luminescent properties of Al{sub 2}O{sub 3}: Tb powders; Propiedades luminiscentes de polvos de Al{sub 2}O{sub 3}: Tb

    Energy Technology Data Exchange (ETDEWEB)

    Esparza G, A.E.; Garcia, M.; Falcony, C.; Azorin N, J. [CICATA-IPN, Legaria 694, Col. Irrigacion, 11500 Mexico D.F. (Mexico)

    2000-07-01

    In this work the photo luminescent and cathode luminescent characteristics of aluminium oxide (Al{sub 2}O{sub 3}) powders impurified with terbium (Tb) were studied for their use in dosimetry. The optical, structural, morphological characteristics of the powders as function of variation in the impurity concentration and the annealing temperature will be presented. As regards the optical properties of powders (photoluminescence and cathode luminescence) it was observed a characteristic emission associated with radiative transitions between electron energy levels of terbium, the spectra associated with this emission consists of several peaks associated with such transitions. In the structural and morphological characterization (X-ray diffraction and scanning electron microscopy) it was appreciated that in accordance the annealing temperature of powders is augmented it is evident the apparition of certain crystalline phases. The results show that this is a promissory material for radiation dosimetry. (Author)

  5. Luminescent properties of Al2O3: Tb powders

    International Nuclear Information System (INIS)

    Esparza G, A.E.; Garcia, M.; Falcony, C.; Azorin N, J.

    2000-01-01

    In this work the photo luminescent and cathode luminescent characteristics of aluminium oxide (Al 2 O 3 ) powders impurified with terbium (Tb) were studied for their use in dosimetry. The optical, structural, morphological characteristics of the powders as function of variation in the impurity concentration and the annealing temperature will be presented. As regards the optical properties of powders (photoluminescence and cathode luminescence) it was observed a characteristic emission associated with radiative transitions between electron energy levels of terbium, the spectra associated with this emission consists of several peaks associated with such transitions. In the structural and morphological characterization (X-ray diffraction and scanning electron microscopy) it was appreciated that in accordance the annealing temperature of powders is augmented it is evident the apparition of certain crystalline phases. The results show that this is a promissory material for radiation dosimetry. (Author)

  6. The use of rare earth radiotracers in the study of solvent extraction kinetics

    International Nuclear Information System (INIS)

    Lim, T.M.; Tran, T.

    1993-01-01

    The suitability of rare earth radionuclides as tracers in research and industry are assessed. In general, the most desirable characteristics of radiotracers for process studies are a half-life in the range 5-200 days, a high yield, high energy γ-emission and low cost of production. The majority of rare earths have at least one radionuclide with acceptable characteristics. The application of radiotracers to the study of kinetics of rare earth solvent extraction have been studied using a modified Lewis cell. Terbium-160 was selected as the most suitable rare earth radionuclide for our experiments. Samples of both aqueous and organic phases were continuous withdrawn, monitored using an automated γ-counting system based on two sodium iodide detectors and then pumped back to the Lewis cell. Excellent results were obtained and the rate of extraction was shown to be first order with respect to the terbium concentration. 6 refs., 1 tab., 7 figs

  7. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    International Nuclear Information System (INIS)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100 deg. C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed

  8. Structure and luminescence spectra of lutetium and yttrium borates synthesized from ammonium nitrate melt

    Science.gov (United States)

    Klassen, Nikolay V.; Shmurak, Semion Z.; Shmyt'ko, Ivan M.; Strukova, Galina K.; Derenzo, Stephen E.; Weber, Marvin J.

    2005-01-01

    Lutetium and yttrium borates doped with europium, terbium, gadolinium, etc. have been synthesized by dissolving initial oxides and nitrates in ammonium nitrate melt and thermal decomposition of the solvent. Annealings in the range of 500-1100°C modified the dimensions of the grains from 2 to 3 nm to more than 100 nm. Significant dependence of the structure of lutetium borate on slight doping with rare earth ions has been found: terbium makes high-temperature vaterite phase preferential at room temperature, whereas europium stabilizes low-temperature calcite phase. Influence of the structure of the borates on the pattern of the luminescence spectra of europium dopant was observed. Possibilities for manufacturing of scintillating lutetium borate ceramics by means of this method of synthesis are discussed.

  9. Neutron and X-ray small angle scattering (S.A.S.) study of the amorphous alloy Tbsub(.25)Cusub(.75)

    International Nuclear Information System (INIS)

    Boucher, B.

    1980-07-01

    The magnetic properties of amorphous alloys REsub(x) Msub(x-1) (R.E.=heavy rare earths, M=Cu, Ag, Au) have been widely studied. They are of the speromagnetic type for x>=0.33 and are mictomagnetic for x -12 cm). Also the atomic volume of Terbium (approximately 33 A 3 ) is almost three times that of Copper (11.8 A 3 ) and Cu is less absorbant than Ag or Au. Tb alloys exhibit high magnetic ordering temperatures and important moments in contrast to the majority of other alloys of the same family. One inconvenience with Terbium, however, is the large (X-ray) fluorescence (lambda Cu). In order to confirm some interpretations of S.A.S., we were obliged to determine some physical parameters such as the density and porosity and to examine the sample with microscope. These results are also given here

  10. The temperature dependence of thermooptical properties of magnetooptical TAG ceramics doped with silicon and titanium

    Science.gov (United States)

    Starobor, Aleksey; Palashov, Oleg

    2018-04-01

    Thermal effects in terbium aluminum garnet (TAG) ceramics (thermal lens and thermally induced depolarization) doped with silicon and titanium were investigated in temperature range of 79-293K. Samples with low dopant concentrations shows decreasing of negative thermal effects with cooling to 79 K. However for most part of samples thermal depolarization starts increasing after initial decreasing with cooling. Apparently it is connected with defects in media. Best sample (0.4 at% of Si) as pure TAG shows monotonous decreasing of thermally induced depolarization and 3.5 times Verdet constant increasing with cooling to 79 K, that leads to 1.8-times advantage over common magnetooptical media - terbium gallium garnet. It allows to provide an isolation of 30 dB at a radiation power of more than 6 kW as estimated. However, the procedure for creating ceramics samples obviously needs improvement because of the large scatter in the quality of the samples.

  11. Lyoluminescence sensitisation

    International Nuclear Information System (INIS)

    Galand, E.; Niezette, J.; Vanderschueren, J.

    1993-01-01

    Lyoluminescence (LL) of several carbohydrates and amino acids has been measured in water for a γ dose of respectively, 20 Gy and 50 Gy. It has been demonstrated that the LL yield depends markedly not only on the nature of the LL material but also on its commercial origin. By using solutions of organic dyes such as eosin B, rhodamine B or fluorescein, a substantial enhancement of LL has been observed with carbohydrates. Concentration effect has been investigated and maximum LL yields have been observed in the range 10 -5 -10 -4 mol. On the other hand, LL of amino acids has been increased by the use of rare earth ion solutions. Dysprosium, europium and terbium solutions have been used, but it has been proved that terbium nitrate is the most appropriate solution. Concentration effect has been studied for several amino acids and dosimetric response of glutamine has been investigated with different rare earth ions solutions. (Author)

  12. Are LOD and LOQ Reliable Parameters for Sensitivity Evaluation of Spectroscopic Methods?

    Science.gov (United States)

    Ershadi, Saba; Shayanfar, Ali

    2018-03-22

    The limit of detection (LOD) and the limit of quantification (LOQ) are common parameters to assess the sensitivity of analytical methods. In this study, the LOD and LOQ of previously reported terbium sensitized analysis methods were calculated by different methods, and the results were compared with sensitivity parameters [lower limit of quantification (LLOQ)] of U.S. Food and Drug Administration guidelines. The details of the calibration curve and standard deviation of blank samples of three different terbium-sensitized luminescence methods for the quantification of mycophenolic acid, enrofloxacin, and silibinin were used for the calculation of LOD and LOQ. A comparison of LOD and LOQ values calculated by various methods and LLOQ shows a considerable difference. The significant difference of the calculated LOD and LOQ with various methods and LLOQ should be considered in the sensitivity evaluation of spectroscopic methods.

  13. Combination of photosensitive elements for use in radiography

    International Nuclear Information System (INIS)

    Bollen, R.H.; Vandenabeele, H.

    1976-01-01

    A new and improved combination of photosensitive elements is proposed that can be used in radiography. The combination according to the invention is composed of an X-ray fluorescence intensifying screen and a photographic halide of silver containing a color coupler. The color coupler causes a negative silver image and a color image to be formed in the material. The fluorescent layer of the fluorescence screen contains a mixture of lanthanum oxychloride or lanthanum oxybromide activated with terbium or terbium and ytterbium. Detailed information about variants in the composition of the fluorescent substance, the grain sizes of the silver halides, variations of the color couplers and about the coating of the single layers is given. (UWI) [de

  14. Hyperfine interactions measured by nuclear orientation technique

    International Nuclear Information System (INIS)

    Brenier, R.

    1982-01-01

    This report concerns the use of hyperfine interaction to magnetism measurements and to the determination of the nuclear structure of Terbium isotopes by the low temperature nuclear orientation technique. In the first part we show that the rhodium atom does not support any localized moment in the chromium matrix. The hyperfine magnetic field at the rhodium nuclear site follows the Overhauser distribution, and the external applied magnetic field supports a negative Knight shift of 16%. In the second part we consider the structure of neutron deficient Terbium isotopes. We introduce a coherent way of evaluation and elaborate a new nuclear thermometer. The magnetic moments allows to strike on the studied states configuration. The analysis of our results shows a decrease of the nuclear deformation for the lighter isotopes [fr

  15. Direct two-photon excitation of Sm3+, Eu3+, Tb3+, Tb.DOTA-, and Tb.propargylDO3A in solution

    Science.gov (United States)

    Sørensen, Thomas Just; Blackburn, Octavia A.; Tropiano, Manuel; Faulkner, Stephen

    2012-07-01

    We have observed direct two-photon excitation of samarium, europium and terbium ions in solution upon near IR excitation using a tuneable pulsed light source, and have also studied two-photon processes in a pair of related terbium complexes, namely [Tb.DOTA]- and Tb.propargylDO3A. Direct two-photon excitation of lanthanides is observed in simple systems in the absence of sensitizing chromophores. Where even simple chromophores such as a triple bond are present in the complex, then single and two-photon excitation of chromophore excited states competes with direct two-photon excitation of the ions and is the dominant pathway for sensitizing formation of the lanthanide excited state.

  16. On possibility of transuranium element by the method of transport reactions

    International Nuclear Information System (INIS)

    Sinitsyna, G.S.; Krashenitsyn, G.N.; Shestakov, B.I.

    1983-01-01

    A possibility to use chemical transport reaction for separation of uranium, plutonium and some transplutonium elements is shown. The method is based on the use of the known plutonium property to form tetrachloride existing only in the gaseous phase in chlorine atmosphere, which is transported ever the temperature gradiept. Two ways of transport reaction realization - the method of flow and the method of diffusion in closed volume are tested. The experiments are made using specially synthesized plutonium dioxide, containing uranium, americium, curium, lanthanum, terbium, barium. Chlorination is realized by the mixture of chlorine and carbon tetrachloride at temperatures 723-953 K. Plutonium trichloride is deposited in the range 613-653 K, uranium - in the range 473-523 K, curium, americium, lanthanum, terbium, barium remain in the start zone if its temperature does not exceed 873 K

  17. Factors Affecting the Efficiency of Excited-States Interactions of Complexes between Some Visible Light-Emitting Lanthanide Ions and Cyclophanes Containing Spirobiindanol Phosphonates

    Directory of Open Access Journals (Sweden)

    M. S. Attia

    2007-01-01

    Full Text Available The efficiency of excited-states interactions between lanthanide ions Tb3+ and Eu3+ and some new cyclophanes (I, II, and III has been studied in different media. High luminescence quantum yield values for terbium and europium complexes in DMSO and PMMA were obtained. The photophysical properties of the green and red emissive Tb3+ and Eu3+ complexes have been elucidated, respectively.

  18. Neutron resonance spins of 159Tb from experiments with polarized neutrons and polarized nuclei

    International Nuclear Information System (INIS)

    Alfimenkov, V.P.; Ivanenko, A.I.; Lason', L.; Mareev, Yu.D.; Ovchinnikov, O.N.; Pikel'ner, L.B.; Sharapov, Eh.I.

    1976-01-01

    Spins of 27 neutron resonances of 159 Tb with energies up to 114 eV have been measured using polarized neutrons and nuclei beams in the modernized time-of-flight spectrometer of the IBR-30 pulse reator. The direct measurements of the terbium resonances spins performed using polarized neutrons reaffirm the conclusion that there are no unstationary effects in the behaviour of 159 Tb neutron resonances in the energy range

  19. Luminescence and energy transfer processes in Ce.sup.3+./sup. activated (Gd,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Mareš, Jiří A.; Beitlerová, Alena; Zorenko, Yu.; Iskaliyeva, A.; Gorbenko, V.; Bryknar, Z.; Nikl, Martin

    2017-01-01

    Roč. 188, Aug (2017), s. 60-66 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA MŠk LO1409 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : gadolinium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline flms Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 2.686, year: 2016

  20. Luminescence and energy transfer processes in (Lu,Tb).sub.3./sub.Al.sub.5./sub.O.sub.12./sub. single crystalline films doped with Ce.sup.3+./sup.

    Czech Academy of Sciences Publication Activity Database

    Bartosiewicz, Karol; Babin, Vladimir; Nikl, Martin; Mareš, Jiří A.; Zorenko, Yu.; Gorbenko, V.

    2016-01-01

    Roč. 173, May (2016), s. 141-148 ISSN 0022-2313 R&D Projects: GA ČR GA16-15569S; GA ČR GAP204/12/0805 EU Projects: European Commission(XE) 316906 - LUMINET Institutional support: RVO:68378271 Keywords : lutetium terbium aluminum garnets * Ce 3+ * energy transfer * luminescence * single crystalline films Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.686, year: 2016

  1. Voltammetric determination of zirconium using azo compounds

    International Nuclear Information System (INIS)

    Orshulyak, O.O.; Levitskaya, G.D.

    2008-01-01

    The optimum conditions for zirconium complexation with azo compounds are found. The applicability of Eriochrome Red B, Calcon, and Calcion to the voltammetric determination of zirconium, total Zr(IV) and Hf(IV), and Zr(IV) in the presence of Zn(II), Cu(II), Cd(II), Ni(II), or Ti(IV) is demonstrated. The developed procedures are used to determine zirconium in a terbium alloy and in an alloy for airplane wheel drums [ru

  2. Modeled Neutron Induced Nuclear Reaction Cross Sections for Radiochemsitry in the region of Thulium, Lutetium, and Tantalum I. Results of Built in Spherical Symmetry in a Deformed Region

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2013-09-06

    We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.

  3. Preparation of thermoluminescent materials

    International Nuclear Information System (INIS)

    1976-01-01

    Thermoluminescent materials have been found to be suitable for measuring long term exposures to low level ionizing radiation. Oxyhalides of lanthanum, gadolinium and yttrium, including the oxychlorides and oxybromides are activated with terbium and have been found to be most efficient oxygendominated phosphors having thermoradiant efficiencies with excitation by low level ionizing radiation. Thermoluminescence response increases when the previous materials have hafnium and zirconium additives

  4. Giant onsite electronic entropy enhances the performance of ceria for water splitting

    DEFF Research Database (Denmark)

    Naghavi, S. Shahab; Emery, Antoine A.; Hansen, Heine Anton

    2017-01-01

    lanthanides, and reaches a maximum value of ≈4.7 kB per oxygen vacancy for Ce4+/Ce3+ reduction. This unique and large positive entropy source in ceria explains its excellent performance for high-temperature catalytic redox reactions such as water splitting. Our calculations also show that terbium dioxide has...... a high electronic entropy and thus could also be a potential candidate for solar thermochemical reactions....

  5. Preparation and photoluminescence characteristics of In(OH){sub 3}:xTb{sup 3+} obtained by Microwave-Assisted Hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Motta, F.V., E-mail: fabiana@ct.ufrn.br [DEMAT, CT, UFRN, Av. Sen. Salgado Filho 3000, CEP 59072-970 Natal, RN (Brazil); Marques, A.P.A. [UNIFESP, Rua Prof. Artur Riedel 275, CEP 09972-270 Diadema, SP (Brazil); Li, M.S. [IFSC, USP, Av. Trabalhador São Carlense 400, CEP 13566-590 São Carlos, SP (Brazil); Abreu, M.F.C. [LIEC, DQ, UFSCar, Via Washington Luiz, km 235, CEP 13565-905 São Carlos, SP (Brazil); Paskocimas, C.A.; Bomio, M.R.D. [DEMAT, CT, UFRN, Av. Sen. Salgado Filho 3000, CEP 59072-970 Natal, RN (Brazil); Souza, R.P. [DEP, CT, UFRN, Av. Sen. Salgado Filho 3000, CEP 59072-970 Natal, RN (Brazil); Varela, J.A. [LIEC, IQ, UNESP, Rua Francisco Degni s/n, CEP 14801-907 Araraquara, SP (Brazil); Longo, E. [LIEC, DQ, UFSCar, Via Washington Luiz, km 235, CEP 13565-905 São Carlos, SP (Brazil)

    2013-03-15

    Highlights: ► We report the preparation by Microwave-Hydrothermal method of In(OH){sub 3}:xTb{sup 3+}. ► Nanostructures were obtained at a low temperature. ► The crystallite size decreased with terbium doping level. ► The nucleation–dissolution–recrystallization mechanism is promoted by processing. ► This material is a highly promising candidate for photoluminescent applications. -- Abstract: Crystalline terbium-doped indium hydroxide structures were prepared by a rapid and efficient Microwave-Assisted Hydrothermal (MAH) method. Nanostructures were obtained at a low temperature. FE-SEM images confirm that these samples are composed of 3D nanostructures. XRD, optical diffuse reflectance and photoluminescence (PL) measurements were used to characterize the products. Emission spectra of terbium-doped indium hydroxide (In(OH){sub 3}:xTb{sup 3+}) samples under excitation (350.7 nm) presented broad band emission referent to the indium hydroxide matrix and {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4}, and {sup 5}D{sub 4} → {sup 7}F{sub 3} terbium transitions at 495, 550, 590 and 627 nm, respectively. Relative intensities of the Tb{sup 3+} emissions increased as the concentration of this ion increased from 0, 1, 2, 4 and 8 mol%, of Tb{sup 3+}, but the luminescence is drastically quenched for the In(OH){sub 3} matrix.

  6. Synthesis of Tb_4O_7 complexed with reduced graphene oxide for Rhodamine-B absorption

    International Nuclear Information System (INIS)

    Gao, Hui; Zhou, Yang; Chen, Keqin; Li, Xiaolong

    2016-01-01

    Highlights: • Tb–rGO composite was fabricated via a facile thermally reduction process. • The green and blue emissions were both observed in the composite. • The composite exhibited efficient absorption capability for Rhodamine-B. - Abstract: Tb_4O_7 complexed with reduced graphene oxide composite (Tb–rGO) had been designed and fabricated by a facile thermal reduction method. The formation of Tb_4O_7 particles and reduction of graphene oxide (GO) occurred simultaneously, and partial terbium ions would be complexed with rGO via oxygen-containing function groups on rGO sheets. Introducing of terbium ions could effectively tune the photoluminescence properties of rGO, and the composite exhibited the typical green emission of terbium ions as well as the blue self-luminescence of graphene entered at 440 nm. Moreover, Tb–rGO had demonstrated its high capability as an organic dye (Rhodamine-B) scavenger with high speed and efficiency. The findings showed the promising applications for large-scale removal of organic dye contaminants, especially in the field of waste water treatment.

  7. Synthesis of Tb{sub 4}O{sub 7} complexed with reduced graphene oxide for Rhodamine-B absorption

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Hui, E-mail: hope@lzu.edu.cn [School of Physical Science and Technology, Key Laboratory for Magnetism and Magnetic Materials of Ministry of Education, Lanzhou University, Lanzhou 730000 (China); Zhou, Yang; Chen, Keqin [School of Physical Science and Technology, Key Laboratory for Magnetism and Magnetic Materials of Ministry of Education, Lanzhou University, Lanzhou 730000 (China); Li, Xiaolong, E-mail: lixiaolong@sinap.ac.cn [Shanghai Synchrotron Radiation Facility, Shanghai Institute of Applied Physics, Chinese Academy of Sciences, Shanghai 201204 (China)

    2016-05-15

    Highlights: • Tb–rGO composite was fabricated via a facile thermally reduction process. • The green and blue emissions were both observed in the composite. • The composite exhibited efficient absorption capability for Rhodamine-B. - Abstract: Tb{sub 4}O{sub 7} complexed with reduced graphene oxide composite (Tb–rGO) had been designed and fabricated by a facile thermal reduction method. The formation of Tb{sub 4}O{sub 7} particles and reduction of graphene oxide (GO) occurred simultaneously, and partial terbium ions would be complexed with rGO via oxygen-containing function groups on rGO sheets. Introducing of terbium ions could effectively tune the photoluminescence properties of rGO, and the composite exhibited the typical green emission of terbium ions as well as the blue self-luminescence of graphene entered at 440 nm. Moreover, Tb–rGO had demonstrated its high capability as an organic dye (Rhodamine-B) scavenger with high speed and efficiency. The findings showed the promising applications for large-scale removal of organic dye contaminants, especially in the field of waste water treatment.

  8. Synthesis, structure and photoluminescence of novel lanthanide (Tb(III), Gd(III)) complexes with 6-diphenylamine carbonyl 2-pyridine carboxylate

    International Nuclear Information System (INIS)

    An Baoli; Gong Menglian; Cheah, Kok-Wai; Wong, Wai-Kwok; Zhang Jiming

    2004-01-01

    A novel organic ligand, 6-diphenylamine carbonyl 2-pyridine carboxylic acid (HDPAP), and the corresponding lanthanide complexes, tris(6-diphenylamine carbonyl 2-pyridine carboxylato) terbium(III) (Tb-DPAP) and tris(6-diphenylamine carbonyl 2-pyridine carboxylato) gadolinium(III) (Gd-DPAP) have been designed and synthesized. The crystal structure and photoluminescence of Tb-DPAP and Gd-DPAP have been studied. The results showed that the lanthanide complexes have electroneutral structures, and the solid terbium complex emits characteristic green fluorescence of Tb(III) ions at room temperature while the gadolinium complex emits the DPAP ligand phosphorescence. The lowest triplet level of DPAP ligand was calculated from the phosphorescence spectrum of Gd-DPAP in N,N-dimethyl formamide (DMF) dilute solution determined at 77 K, and the energy transfer mechanisms in the lanthanide complexes were discussed. The lifetimes of the 5 D 4 levels of Tb 3+ ions in the terbium complex were examined using time-resolved spectroscopy, and the values are 0.0153±0.0001 ms for solid Tb(DPAP) 3 ·11.5H 2 O and 0.074±0.007 ms for 2.5x10 -5 mol/l Tb-DPAP ethanol solution

  9. Synthesis, Photoluminescence Behavior of Green Light Emitting Tb(III) Complexes and Mechanistic Investigation of Energy Transfer Process.

    Science.gov (United States)

    Bala, Manju; Kumar, Satish; Devi, Rekha; Khatkar, Avni; Taxak, V B; Boora, Priti; Khatkar, S P

    2018-06-04

    A series of five new terbium(III) ion complexes with 4,4-difluoro-1-phenylbutane-1,3-dione (HDPBD) and anciliary ligands was synthesized. The composition and properties of complexes were analyzed by elemental analysis, IR, NMR, powder X-ray diffaraction, TG-DTG and photoluminescence spectroscopy. These complexes exhibited ligand sensitized green emission at 546 nm associated with 5 D 4  →  7 F 5 transitions of terbium ion in the emission spectra. The photoluminescence study manifested that the organic ligands act as antenna and facilitate the absorbed energy to emitting levels of Tb(III) ion efficiently. The enhanced luminescence intensity and decay time of ternary C2-C5 complexes observed due to synergistic effect of anciliary ligands. The CIE color coordinates of complexes came under the green region of chromaticity diagram. The mechanistic investigation of intramolecular energy transfer in the complexes was discussed in detail. These terbium(III) complexes can be thrivingly used as one of the green component in light emitting material and in display devices. Graphical Abstract Illustrate the sensitization process of the Tb ion and intramolecular energy transfer process in the Tb 3+ complex.

  10. Syntheses of optically efficient (La{sub 1-x-y}Ce{sub x}Tb{sub y})F{sub 3} nanocrystals via a hydrothermal method

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiang [Department of Mechanical and Aerospace Engineering, Princeton University, Princeton, NJ 08544 (United States); You Yumin; Ludescher, Richard D. [Department of Food Science, Rutgers University, New Brunswick, NJ 08901 (United States); Ju Yiguang, E-mail: yju@princeton.ed [Department of Mechanical and Aerospace Engineering, Princeton University, Princeton, NJ 08544 (United States)

    2010-06-15

    Optically efficient cerium and terbium doped lanthanide fluoride (La{sub 1-x-y}Ce{sub x}Tb{sub y})F{sub 3} nanocrystals with different doping concentrations have been synthesized by a hydrothermal route in the presence of ethylenediamine tetraacetic acid disodium salt (EDTA). The results showed that the formation of nanocrystals with different morphologies depends on terbium ion Tb{sup 3+} doping concentration, but independent of cerium ion Ce{sup 3+} doping concentration. With increase in Tb{sup 3+} doping concentration, the morphologies of nanocrystals evolved from a spherical shape to a plated-like one. In addition, both the photoluminescence quantum yield (PL QY) and the fluorescence lifetime of nanocrystals increased with the increase in Ce{sup 3+} doping concentration in cerium and terbium co-doped system. The PL QY reached up to 55%, and the lifetime up to 7.3 ms. Transmission electron microscopy (TEM), X-ray diffraction (XRD), selected area electron diffraction (SAED), X-ray fluorescence (XRF), energy dispersive spectroscopy (EDS), ultraviolet-visible (UV-vis) absorption, photoluminescence (PL) and infrared (IR) spectroscopies were employed to characterize the properties of nanocrystals. The growth mechanism of nanocrystals with different morphologies and optical properties of nanocrystals with different doping concentrations were investigated.

  11. The crystal structure and luminescence quenching of poly- and single-crystalline KYW{sub 2}O{sub 8}:Tb{sup 3+}

    Energy Technology Data Exchange (ETDEWEB)

    Schwung, Sebastian [Fachbereich Chemieingenieurwesen, Fachhochschule Münster, Stegerwaldstraße 39, 48565 Steinfurt (Germany); Rytz, Daniel, E-mail: rytz@fee-io.de [Forschungsinstitut für mineralische und metallische Werkstoffe-Edelsteine/ Edelmetalle-GmbH (FEE), Struthstraße 2, 55743 Idar-Oberstein (Germany); Heying, Birgit; Rodewald, Ute Ch.; Niehaus, Oliver [Institut für Anorganische und Analytische Chemie, Universität Münster, Corrensstrasse 30 48149 Münster (Germany); Enseling, David [Fachbereich Chemieingenieurwesen, Fachhochschule Münster, Stegerwaldstraße 39, 48565 Steinfurt (Germany); Jüstel, Thomas, E-mail: tj@fh-muenster.de [Fachbereich Chemieingenieurwesen, Fachhochschule Münster, Stegerwaldstraße 39, 48565 Steinfurt (Germany); Pöttgen, Rainer, E-mail: pottgen@uni-muenster.de [Institut für Anorganische und Analytische Chemie, Universität Münster, Corrensstrasse 30 48149 Münster (Germany)

    2015-10-15

    Terbium-substituted KYW{sub 2}O{sub 8} single crystals of high optical quality were grown by the top seeded solution growth technique. The degree of yttrium–terbium mixed occupancy was determined for two samples through structure refinements on the basis of single crystal X-ray diffractometer data. Temperature dependent magnetic susceptibility data underline the paramagnetic nature of terbium doped crystals. No magnetic ordering is evident down to 2 K. Luminescence measurements yield the typical excitation and emission spectra as expected for Tb{sup 3+} activated materials. The decay time of Tb{sup 3+} decreases linearly with the Tb{sup 3+} concentration, while the excess of thermal quenching does not change significantly. At about 405 K the decay time is reduced by roughly 50% relative to the low-temperature value, both for the powders as for the single crystals. - Highlights: • Single crystalline and powder series of K(Y,Tb)W{sub 2}O{sub 8.} • Refined XRD data of high quality crystals. • Linear decrease of the decay time with Tb{sup 3+} content.

  12. African Journals Online: Health

    African Journals Online (AJOL)

    Items 151 - 167 of 167 ... The mission of SSMJ is to publish research and clinical guidance that will ... Tanzania Dental Journal will consider for publication articles on original .... appropriate international medical and health organisations may ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 167 of 167 ... Vol 13, No 1 (2017), The practices and challenges of teacher educators' ... Mechanisms of Aggression in Secondary Schools of Jimma zone, Abstract PDF ... Development of the Area: The Case of Mekane Selam Town ...

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 167 of 167 ... ... Management in the Nigerian Building Construction Industry, Abstract ... A Case Study of Federal University of Technology, Minna, Nigeria, Abstract ... to Evaluate the Knowledge of Court Interpreters in Kenya, Abstract.

  15. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SAGPLIACSHAFAV Sbjct: 1 ... AMRQLASGVSVITAGKGSTRVGMTATAVTSLSATPPTLIVCLNQKSSAGPLIACSHAFAV 60 ... Query: 140 HAILVGRVVHTST...LPRKASLTYWQGSYV 167 ... HAILVGRVVHTSTLPRKASLTYWQGSYV Sbjct: 121 HAILVGRVVHTSTLPRKASLTYWQGSYV 148

  16. ORF Alignment: NT_033778 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 47 ... ILGGHNADIKLHPWMVQILQRGYHFCGGSLISSLRFGRYSGITPRYLCSSQYCSPFGPEI 106 ... ILGGHNADIKLHPWMVQILQ...RGYHFCGGSLISSLRFGRYSGITPRYLCSSQYCSPFGPEI Sbjct: 1 ... ILGGHNADIKLHPWMVQILQRGYHFCGGS...LISSLRFGRYSGITPRYLCSSQYCSPFGPEI 60 ... Query: 167 WGKXXXXXXXXXXXXXXXFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAE

  17. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 218 ... Query: 167 GRHRLMCGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL 226 ... ... ... GRHRLMCGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL Sbjct: 1 ... GRHRLM...CGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL 60 ... Query: 287 QHEPVLYGFLQNGKHPWYSDRKQTTIWNYDKPKRNKDH

  18. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DKPDCAAILAIDNGMIHLVQQYRY Sbjct: 1 ... DIKQLDSKVVYQNKWMTVREDKILRPSGAEGIYGVVDKPDCAAILAIDNGMIHLVQQYRY 60 ... Query: 123 YFASDLT...DVGNQLDSEEEDLITRAFSVEEFEQMMIDGTIKDCVTI 167 ... YFASDLTDVGNQLDSEEEDLITRAFSVEEFEQMMIDGTIKDCVTI Sbjct: 121 YFASDLTDVGNQLDSEEEDLITRAFSVEEFEQMMIDGTIKDCVTI 165

  19. Differences in Sleep Quality and Health-Related Quality of Life in Young Adults with Allergies and Asthma and Their Healthy Peers

    Science.gov (United States)

    Molzon, Elizabeth S.; Bonner, Margaret S.; Hullmann, Stephanie E.; Ramsey, Rachelle R.; Suorsa, Kristina I.; Chaney, John M.; Mullins, Larry L.

    2013-01-01

    Objective: The current study examined the relationship between sleep quality and health-related quality of life (HRQOL). Participants: Participants were 501 undergraduate students with allergies (167), asthma + allergies (167), or with no history of a chronic illness (167) completed study measures from August 2011 to April 2012. Methods: The…

  20. Development of the Career Indecision Profile: Factor Structure, Reliability, and Validity

    Science.gov (United States)

    Hacker, Jason; Carr, Andrea; Abrams, Matthew; Brown, Steven D.

    2013-01-01

    Prior research using a 167-item measure of career indecision (Career Indecision Profile-167 [CIP-167]) has suggested that career choice difficulties may be associated with four major sources of career indecision: neuroticism/negative affectivity, choice/commitment anxiety, lack of readiness, and interpersonal conflicts. The purpose of this study…