DEFF Research Database (Denmark)
Spichkin, Y.I.; Bohr, Jakob; Tishin, A.M.
1996-01-01
The temperature dependence of the Young modulus along the crystallographic axes b and c (E(b) and E(c)), and the internal friction of a terbium single crystal have been measured. At 4.2 K, E(b) and E(c) are equal to 38 and 84.5 GPa, respectively. The lattice part of the Young modulus and the Debye...... temperature has been calculated. The origin of the Young modulus anomalies arising at the transition to the magnetically ordered state is discussed....
Critical scattering of neutrons from terbium
DEFF Research Database (Denmark)
Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.
1968-01-01
The inelasticity of the critical scattering of neutrons in terbium has been measured above the Neél temperature at the (0, 0, 2−Q) satellite position. The results show that dynamic slowing down of the fluctuations does occur in a second‐order phase transition in agreement with the general theory...
Semiconductor composition containing iron, dysprosium, and terbium
Energy Technology Data Exchange (ETDEWEB)
Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.
2017-09-26
An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.
Energy Technology Data Exchange (ETDEWEB)
Kharlamova, M.V.; Kramberger, C.; Mittelberger, A. [University of Vienna, Faculty of Physics, Vienna (Austria)
2017-04-15
In the present work, the doping effect of terbium chloride, terbium bromide, and terbium iodide on single-walled carbon nanotubes (SWCNTs) was compared by Raman spectroscopy. A precise investigation of the doping-induced alterations of the Raman modes of the filled SWCNTs was conducted. The shifts of the components of the Raman modes and modification of their profiles allowed concluding that the inserted terbium halogenides have acceptor doping effect on the SWCNTs, and the doping efficiency increases in the line with terbium iodide, terbium bromide, and terbium chloride. (orig.)
Magnetocaloric effect of thin Terbium films
Mello, V. D.; Anselmo, D. H. A. L.; Vasconcelos, M. S.; Almeida, N. S.
2017-12-01
We report a theoretical study of the magnetocaloric effect of Terbium (Tb) thin films due to finite size and surface effects in the helimagnetic phase, corresponding to a temperature range from TC=219 K to TN=231 K, for external fields of the order of kOe. For a Tb thin film of 6 monolayers submitted to an applied field (ΔH =30 kOe, ΔH =50 kOe and ΔH = 70 kOe) we report a significative change in adiabatic temperature, ΔT / ΔH , near the Néel temperature, of the order ten times higher than that observed for Tb bulk. On the other hand, for small values of the magnetic field, large thickness effects are found. For external field strength around few kOe, we have found that the thermal caloric efficiency increases remarkably for ultrathin films. For an ultrathin film with 6 monolayers, we have found ΔT / ΔH = 43 K/T while for thicker films, with 20 monolayers, ΔT / ΔH = 22 K/T. Our results suggest that thin films of Tb are a promising material for magnetocaloric effect devices for applications at intermediate temperatures.
Femtosecond XUV spectroscopy of gadolinium and terbium
Energy Technology Data Exchange (ETDEWEB)
Carley, Robert; Frietsch, Bjoern; Doebrich, Kristian; Teichmann, Martin; Gahl, Cornelius; Noack, Frank [Max-Born-Institute, Berlin (Germany); Schwarzkopf, Olaf; Wernet, Philippe [Helmholtz-Zentrum fuer Materialien und Energie (BESSY II), Berlin (Germany); Weinelt, Martin [Max-Born-Institute, Berlin (Germany); Fachbereich Physik, Freie Universitaet, Berlin (Germany)
2011-07-01
We present recent results of time-resolved IR-pump-XUV-probe experiments on the ultrafast demagnetization of thin films of Gadolinium(0001) and Terbium(0001) on Tungsten(110). The experiments are the first to be done using a newly developed high-order harmonics (HHG) XUV beamline at the MBI. The beamline delivers monochromated XUV pulses of approximately 150 fs duration with a photon energy resolution of up to 150 meV. Following excitation by intense femtosecond infrared (IR) pulses, photoemission with 35 eV photons allows us to directly probe the 4f electrons and their interaction with the valence band, both in the bulk and at the surface, to follow the ultrafast magnetization dynamics in the Lanthanide metals. As signatures of ultrafast demagnetization of the metal by the IR pulse, we see for the first time, rapid strong reduction of the exchange splitting in the valence band. This is followed by a slower demagnetization due to the spin-lattice interaction.
Green fluorescence of terbium ions in lithium fluoroborate glasses ...
Indian Academy of Sciences (India)
Glasses; terbium ion; oscillator strengths; fluorescence; lifetimes; fibre lasers. 1. Introduction. Today glasses are most favourable engineering materials for abundant applications due to the wide ability of property altering by compositional modifications. The considerable examination of glass science to achieve required ...
Green fluorescence of terbium ions in lithium fluoroborate glasses ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science; Volume 39; Issue 3. Green fluorescence of terbium ions in lithium fluoroborate glasses for fibre lasers and display devices. G R DILLIP C MADHUKAR REDDY M RAJESH SHIVANAND CHAURASIA B DEVA PRASAD RAJU S W JOO. Volume 39 Issue 3 June 2016 pp 711-717 ...
Terahertz Cherenkov radiation from ultrafast magnetization in terbium gallium garnet
Gorelov, S. D.; Mashkovich, E. A.; Tsarev, M. V.; Bakunov, M. I.
2013-12-01
We report an experimental observation of terahertz Cherenkov radiation from a moving magnetic moment produced in terbium gallium garnet by a circularly polarized femtosecond laser pulse via the inverse Faraday effect. Contrary to some existing theoretical predictions, the polarity of the observed radiation unambiguously demonstrates the paramagnetic, rather than diamagnetic, nature of the ultrafast inverse Faraday effect. From measurements of the radiation field, the Verdet constant in the subpicosecond regime is ˜3-10 times smaller than its table quasistatic value.
40 CFR 148.5 - Waste analysis.
2010-07-01
... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Waste analysis. 148.5 Section 148.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) HAZARDOUS WASTE INJECTION RESTRICTIONS General § 148.5 Waste analysis. Generators of hazardous wastes that are...
19 CFR 148.4 - Accompanying articles.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Accompanying articles. 148.4 Section 148.4 Customs... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS General Provisions § 148.4 Accompanying articles. (a) Generally. Articles shall be considered as accompanying a passenger or brought in by him if the articles...
49 CFR 176.148 - Artificial lighting.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Artificial lighting. 176.148 Section 176.148... Requirements for Class 1 (Explosive) Materials Precautions During Loading and Unloading § 176.148 Artificial lighting. Electric lights, except arc lights, are the only form of artificial lighting permitted when...
Energy Technology Data Exchange (ETDEWEB)
Gaponenko, N. V., E-mail: nik@nano.bsuir.edu.by [Belarusian State University of Informatics and Radioelectronics (Belarus); Kortov, V. S. [Yeltsin Ural Federal University (Russian Federation); Orekhovskaya, T. I.; Nikolaenko, I. A. [Belarusian State University of Informatics and Radioelectronics (Belarus); Pustovarov, V. A.; Zvonarev, S. V.; Slesarev, A. I. [Yeltsin Ural Federal University (Russian Federation); Prislopski, S. Ya. [National Academy of Sciences of Belarus, Stepanov Institute of Physics (Belarus)
2011-07-15
Terbium-doped alumina xerogel layers are synthesized by the sol-gel method in pores of a porous anodic alumina film 1 {mu}m thick with a pore diameter of 150-180 nm; the film is grown on a silicon substrate. The fabricated structures exhibit terbium photoluminescence with bands typical of trivalent terbium terms. Terbium X-ray luminescence with the most intense band at 542 nm is observed for the first time for such a structure. Morphological analysis of the structure by scanning electron microscopy shows the presence of xerogel clusters in pore channels, while the main pore volume remains unfilled and pore mouths remain open. The data obtained confirm the promising applications of fabricated structures for developing matrix converters of X-rays and other ionizing radiations into visible light. The possibilities of increasing luminescence intensity in the matrix converter are discussed.
2016-02-01
AFRL-RX-WP-JA-2016-0323 OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS... AMERICA (STINFO COPY) AIR FORCE RESEARCH LABORATORY MATERIALS AND MANUFACTURING DIRECTORATE WRIGHT-PATTERSON AIR FORCE BASE, OH 45433-7750 AIR...OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS (POSTPRINT) 5a. CONTRACT NUMBER IN-HOUSE 5b
24 CFR 100.148 - Effective date.
2010-04-01
... DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Discrimination in Residential Real Estate-Related Transactions... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Effective date. 100.148 Section 100.148 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF...
Detection of biothiols in cells by a terbium chelate-Hg (II) system
Tan, Hongliang; Chen, Yang
2012-01-01
Great efforts have been devoted to the development of sensitive and specific analysis methods for biothiols because of their important roles in biological systems. We present a new detection system for biothiols that is based on the reversible quenching and restoration of fluorescence of terbium chelate caused by Hg2+ and thiol species. In the presence of biothiols, a restoration of fluorescence of terbium chelate after quenching by Hg2+ was observed due to the interaction of Hg2+ with thiol groups, and the restored fluorescence increased with the concentration of biothiols. This method was sensitive and selective for biothiols. The detection limit was 80 nM for glutathione, 100 nM for Hcy, and 400 nM for Cysteine, respectively. The terbium chelate-Hg (II) system was successfully applied to determine the levels of biothiols in cancer cells and urine samples. Further, it was also shown to be comparable to Ellman's assay. Compared to other fluorescence methods, the terbium chelate probe is advantageous because interference from short-lived nonspecific fluorescence can be efficiently eliminated due to the long fluorescence lifetime of terbium chelate, which allows for detection by time-resolved fluorescence. The terbium chelate probe can serve as a diagnostic tool for the detection of abnormal levels of biothiols in disease.
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFA148 (Link to dictyBase) - - - Contig-U16560-1 SFA148Z (Link... to Original site) - - SFA148Z 769 - - - - Show SFA148 Library SF (Link to library) Clone ID SFA148 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFA1-B/SFA148Q.Seq.d/ Representative seq. ID SFA14...8Z (Link to Original site) Representative DNA sequence >SFA148 (SFA148Q) /CSM/SF/SFA1-B/SFA148Q.Seq.d/ XXXXX.... 1 Translated Amino Acid sequence ---qxkxgfppxqqxfffggkqlkkwsfsfrxitfkrxppxplslx
Cryogenic temperature characteristics of Verdet constant of terbium sesquioxide ceramics
Snetkov, I. L.; Palashov, O. V.
2016-12-01
The dependence of the Verdet constant on temperature in the (80-300 K) range for a promising magneto-active material terbium sesquioxide Tb2O3 at the wavelengths of 405-1064 nm is considered. For each of the studied wavelengths, the Verdet constant of the material cooled down to the liquid nitrogen temperature increased by more than a factor of 3.2 as compared to the room temperature value. Similarly to the other paramagnetics, the increase follows the law ∼1/T. Approximations for the temperature dependence of the Verdet constant have been obtained and the value of 1/V·(dV/dT) has been estimated. This information is needed to determine the angle of rotation as well as the variation of the extinction ratio of a Faraday isolator with temperature and extremely important at creation a cryogenic Faraday devices.
Biogenic terbium oxide nanoparticles as the vanguard against osteosarcoma
Iram, Sana; Khan, Salman; Ansary, Abu Ayoobul; Arshad, Mohd; Siddiqui, Sahabjada; Ahmad, Ejaz; Khan, Rizwan H.; Khan, Mohd Sajid
2016-11-01
The synthesis of inner transition metal nanoparticles via an ecofriendly route is quite difficult. This study, for the first time, reports synthesis of terbium oxide nanoparticles using fungus, Fusarium oxysporum. The biocompatible terbium oxide nanoparticles (Tb2O3 NPs) were synthesized by incubating Tb4O7 with the biomass of fungus F. oxysporum. Multiple physical characterization techniques, such as UV-visible and photoluminescence spectroscopy, TEM, SAED, and zeta-potential were used to confirm the synthesis, purity, optical and surface characteristics, crystallinity, size, shape, distribution, and stability of the nanoemulsion of Tb2O3 NPs. The Tb2O3 NPs were found to inhibit the propagation of MG-63 and Saos-2 cell-lines (IC50 value of 0.102 μg/mL) and remained non-toxic up to a concentration of 0.373 μg/mL toward primary osteoblasts. Cell viability decreased in a concentration-dependent manner upon exposure to 10 nm Tb2O3 NPs in the concentration range 0.023-0.373 μg/mL. Cell toxicity was evaluated by observing changes in cell morphology, cell viability, oxidative stress parameters, and FACS analysis. Morphological examinations of cells revealed cell shrinkage, nuclear condensation, and formation of apoptotic bodies. The level of ROS within the cells-an indicator of oxidative stress was significantly increased. The induction of apoptosis at concentrations ≤ IC50 was corroborated by 4‧,6-diamidino-2-phenylindole dihydrochloride (DAPI) staining (DNA damage and nuclear fragmentation). Flow-cytometric studies indicated that the response was dose dependent with a threshold effect.
Autofluorescence-free Live-cell Imaging Using Terbium Nanoparticles.
Cardoso Dos Santos, Marcelina; Goetz, Joan; Bartenlian, Hortense; Wong, Ka-Leung; Charbonniere, Loïc Joanny; Hildebrandt, Niko
2018-02-20
Fluorescent nanoparticles (NPs) have become irreplaceable tools for advanced cellular and sub-cellular imaging. While very bright NPs require excitation with UV or visible light, which can create strong autofluorescence of biological components, NIR-excitable NPs without autofluorescence issues exhibit much lower brightness. Here, we show the application of a new type of surface-photosensitized terbium NPs (Tb-NPs) for autofluorescence-free intracellular imaging in live HeLa cells. Combination of exceptionally high brightness, high photostability, and long photoluminecence (PL) lifetimes for highly efficient suppression of the short-lived autofluorescence, allowed for time-gated PL imaging of intracellular vesicles over 72 h without toxicity and at extremely low Tb-NP concentrations down to 12 pM. Detection of highly resolved long-lifetime (ms) PL decay curves from small (~10 µm2) areas within single cells within a few seconds emphasized the unprecedented photophysical properties of Tb-NPs for live-cell imaging that extend well beyond currently available nanometric imaging agents.
Solar Thermochemical Hydrogen Production via Terbium Oxide Based Redox Reactions
Directory of Open Access Journals (Sweden)
Rahul Bhosale
2016-01-01
Full Text Available The computational thermodynamic modeling of the terbium oxide based two-step solar thermochemical water splitting (Tb-WS cycle is reported. The 1st step of the Tb-WS cycle involves thermal reduction of TbO2 into Tb and O2, whereas the 2nd step corresponds to the production of H2 through Tb oxidation by water splitting reaction. Equilibrium compositions associated with the thermal reduction and water splitting steps were determined via HSC simulations. Influence of oxygen partial pressure in the inert gas on thermal reduction of TbO2 and effect of water splitting temperature (TL on Gibbs free energy related to the H2 production step were examined in detail. The cycle (ηcycle and solar-to-fuel energy conversion (ηsolar-to-fuel efficiency of the Tb-WS cycle were determined by performing the second-law thermodynamic analysis. Results obtained indicate that ηcycle and ηsolar-to-fuel increase with the decrease in oxygen partial pressure in the inert flushing gas and thermal reduction temperature (TH. It was also realized that the recuperation of the heat released by the water splitting reactor and quench unit further enhances the solar reactor efficiency. At TH=2280 K, by applying 60% heat recuperation, maximum ηcycle of 39.0% and ηsolar-to-fuel of 47.1% for the Tb-WS cycle can be attained.
Folate Receptor Targeted Alpha-Therapy Using Terbium-149
Müller, Cristina; Haller, Stephanie; Dorrer, Holger; Köster, Ulli; Johnston, Karl; Zhernosekov, Konstantin; Türler, Andreas; Schibli, Roger
2014-01-01
Terbium-149 is among the most interesting therapeutic nuclides for medical applications. It decays by emission of short-range α-particles (Eα = 3.967 MeV) with a half-life of 4.12 h. The goal of this study was to investigate the anticancer efficacy of a 149Tb-labeled DOTA-folate conjugate (cm09) using folate receptor (FR)-positive cancer cells in vitro and in tumor-bearing mice. 149Tb was produced at the ISOLDE facility at CERN. Radiolabeling of cm09 with purified 149Tb resulted in a specific activity of ~1.2 MBq/nmol. In vitro assays performed with 149Tb-cm09 revealed a reduced KB cell viability in a FR-specific and activity concentration-dependent manner. Tumor-bearing mice were injected with saline only (group A) or with 149Tb-cm09 (group B: 2.2 MBq; group C: 3.0 MBq). A significant tumor growth delay was found in treated animals resulting in an increased average survival time of mice which received 149Tb-cm09 (B: 30.5 d; C: 43 d) compared to untreated controls (A: 21 d). Analysis of blood parameters rev...
Hardness and dielectric characteristics of flux grown terbium aluminate crystals
Energy Technology Data Exchange (ETDEWEB)
Sharma, K.K.; Kotru, P.N. [Jammu Univ. (India). Dept. of Physics; Tandon, R.P. [National Physical Laboratory, New Delhi (India); Wanklyn, B.M. [Clarendon Laboratory, University of Oxford, Oxford (United Kingdom)
1999-01-29
Results of indentation induced Vickers hardness testing and dielectric studies conducted on flux-grown terbium aluminate crystals are presented. It is shown that the Vickers hardness value (H{sub v}) is independent of indentation time, but depends on the applied load. Applying the concept of Hays and Kendall, the load independent values are estimated for (110) and (001) planes. Differential behaviour in the crack formation of two different planes (110) and (001) is observed, while (001) plane develops Palmqvist cracks in the whole load range of 10-100 g, (110) plane shows a transition from Palmqvist to median cracks at 70 g. The fracture toughness, brittleness index and yield strength are determined for both the planes. The hardness anisotropy is reported. The dielectric constant, dielectric loss and conductivity are shown to be dependent on temperature and frequency of the applied a.c. field. The dielectric constant versus temperature shows a transition peak at 230 C, which remains independent of the frequency of the applied a.c. field in the range 1 kHz-13 MHz. (orig.) 36 refs.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR
75 FR 148 - Economic Impact Policy
2010-01-04
... [Federal Register Volume 75, Number 1 (Monday, January 4, 2010)] [Notices] [Page 148] [FR Doc No: E9-31133] EXPORT-IMPORT BANK OF THE UNITED STATES Economic Impact Policy This notice is to inform the... comments on this transaction by e-mail to economic[email protected] or by mail to 811 Vermont Avenue, NW...
Thermoluminescence of cerium and terbium -doped calcium pyrophosphate
Energy Technology Data Exchange (ETDEWEB)
Roman L, J.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Lozano R, I. B.; Diaz G, J. A. I., E-mail: jesus.roman@nucleares.unam.mx [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, 11500 Mexico D. F. (Mexico)
2015-10-15
The aim of this work is to report the thermoluminescence (Tl) response of Calcium Pyrophosphate phosphor doped with Cerium and Terbium impurities (Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+}). The phosphors were synthesized using the co-precipitation method and annealed at 900 degrees C by two hours for obtain the β phase. The intentional doping with Ce and Tb ions was 1 at.% and 0.1 at.%, whereas in the EDS results the concentration of impurities was 0.39 at.% and 0.05 at.%, respectively. The superficial morphology of phosphor is mainly composed by thin wafers of different size. All samples were exposed to gamma rays from {sup 60}Co in the Gammacell-200 irradiator. The Tl response of the phosphor was measured from Rt up to 350 degrees C and under nitrogen atmosphere in a Harshaw TLD 3500 reader. The glow curves of the Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+} powders showed a broad intense Tl peak centered at 165 degrees C and a shoulder at approximate 260 degrees C was observed. A linear Tl response in the range of absorbed dose of 0.2 to 10 Gy was obtained. Tl glow curves were analyzed using the initial rise (IR)and computerized glow curve deconvolution methods to evaluate the kinetics parameters such as activation energy (E), frequency factor (s) and kinetic order (b). (Author)
Walter, Edward R H; Williams, J A Gareth; Parker, David
2017-12-14
In a macrocyclic terbium complex incorporating a biaryl sensitiser, the observed variation of emission lifetime is shown to be determined by the solubility of oxygen in the solvent system and the relative energy of the chromophore excited state, rather than any dependence on solvent viscosity.
19 CFR 148.90 - Foreign military personnel.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Foreign military personnel. 148.90 Section 148.90... TREASURY (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Personnel of Foreign Governments and International Organizations and Special Treatment for Returning Individuals § 148.90 Foreign military personnel...
19 CFR 148.23 - Examination and clearance of baggage.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Examination and clearance of baggage. 148.23 Section 148.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... § 148.32. (2) Works of art classifiable under subheadings 9701.10.00 or 9701.90.00, HTSUS. (3) Works of...
Lifescience Database Archive (English)
Full Text Available ignificant alignments: (bits) Value CHB148 (CHB148Q) /CSM/CH/CHB1-B/CHB148Q.Seq.d/ 54 5e-07 VSE827 (VSE827Q)...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N BV089946 |BV089946.
46 CFR 148.03-7 - During transport.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false During transport. 148.03-7 Section 148.03-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DANGEROUS CARGOES CARRIAGE OF SOLID HAZARDOUS MATERIALS IN BULK Minimum Transportation Requirements § 148.03-7 During transport. During the transport of a...
26 CFR 1.148-3 - General arbitrage rebate rules.
2010-04-01
... 1.148-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.148-3 General... allocable to the issue pursuant to the universal cap under § 1.148-6) or that ceases to be subject to the...
19 CFR 148.114 - Shipment of unaccompanied articles.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Shipment of unaccompanied articles. 148.114 Section 148.114 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... States § 148.114 Shipment of unaccompanied articles. One copy of the validated Customs Form 255 shall be...
46 CFR 148.03-3 - Direction and observation.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Direction and observation. 148.03-3 Section 148.03-3... HAZARDOUS MATERIALS IN BULK Minimum Transportation Requirements § 148.03-3 Direction and observation... be conducted only under the direction and observation of a person assigned or employed for such duty...
27 CFR 17.148 - Allowance of claims.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Allowance of claims. 17.148 Section 17.148 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... PRODUCTS Claims for Drawback § 17.148 Allowance of claims. (a) General. Except in the case of fraudulent...
Arginine-responsive terbium luminescent hybrid sensors triggered by two crown ether carboxylic acids
Energy Technology Data Exchange (ETDEWEB)
Jiang, Lasheng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Tang, Ke; Ding, Xiaoping [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Zhou, Zhan; Xiao, Rui [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China)
2013-12-01
Crown ether carboxylic acids constitute main building blocks for the synthesis of terbium containing covalent cross-linked luminescent materials. Both the complexes and the hybrid nanomaterials could exhibit remarkable green emissions in pure water. More importantly, they were found to have a profound effect on the luminescence responses to arginine compared with glutamic acid, histidine, tryptophan, threonine, tyrosine and phenylalanine in aqueous environment. The present study provided the possibility of using a host–guest mechanism as a way of signal transduction based on lanthanide supramolecular hybrid materials. - Highlights: • Crown ether carboxylic acids were found to sensitize terbium ions among a group of ethers. • The complexes and silica hybrid materials were both prepared and characterized. • They could exhibit remarkable green emissions in pure water.
Soulié, Marine; Latzko, Frédéric; Bourrier, Emmanuel; Placide, Virginie; Butler, Stephen J; Pal, Robert; Walton, James W; Baldeck, Patrice L; Le Guennic, Boris; Andraud, Chantal; Zwier, Jurriaan M; Lamarque, Laurent; Parker, David; Maury, Olivier
2014-07-07
A series of europium and terbium complexes based on a functionalized triazacyclononane carboxylate or phosphinate macrocyclic ligand is described. The influence of the anionic group, that is, carboxylate, methylphosphinate, or phenylphosphinate, on the photophysical properties was studied and rationalized on the basis of DFT calculated structures. The nature, number, and position of electron-donating or electron-withdrawing aryl substituents were varied systematically within the same phenylethynyl scaffold in order to optimize the brightness of the corresponding europium complexes and investigate their two-photon absorption properties. Finally, the europium complexes were examined in cell-imaging applications, and selected terbium complexes were studied as potential oxygen sensors. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe
Ramezani, Amir M.; Manzoori, Jamshid L.; Amjadi, Mohammad; Jouyban, Abolghasem
2012-01-01
A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb3+-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum resp...
Directory of Open Access Journals (Sweden)
Alexander S. Goryashchenko
2015-07-01
Full Text Available This article describes the genetically encoded caspase-3 FRET-sensor based on the terbium-binding peptide, cleavable linker with caspase-3 recognition site, and red fluorescent protein TagRFP. The engineered construction performs two induction-resonance energy transfer processes: from tryptophan of the terbium-binding peptide to Tb3+ and from sensitized Tb3+ to acceptor—the chromophore of TagRFP. Long-lived terbium-sensitized emission (microseconds, pulse excitation source, and time-resolved detection were utilized to eliminate directly excited TagRFP fluorescence and background cellular autofluorescence, which lasts a fraction of nanosecond, and thus to improve sensitivity of analyses. Furthermore the technique facilitates selective detection of fluorescence, induced by uncleaved acceptor emission. For the first time it was shown that fluorescence resonance energy transfer between sensitized terbium and TagRFP in the engineered construction can be studied via detection of microsecond TagRFP fluorescence intensities. The lifetime and distance distribution between donor and acceptor were calculated using molecular dynamics simulation. Using this data, quantum yield of terbium ions with binding peptide was estimated.
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSG148 (Link to dictyBase) - - - Contig-U16494-1 VSG148P (Link to Original site)...VSG148Z 176 VSG148P 384 - - Show VSG148 Library VS (Link to library) Clone ID VSG148 (Link to dictyBase)...AL115377 |AL115377.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 74 1e-09...AL114313 |AL114313.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 74 1e-09...AL114405 |AL114405.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 74 1e-09
Green light emission in aluminum oxide powders doped with different terbium concentrations
Energy Technology Data Exchange (ETDEWEB)
Mariscal B, L; Falcony, C. [IPN, Centro de Investigacion y de Estudios Avanzados, 07360 Ciudad de Mexico (Mexico); Carmona T, S.; Murrieta, H.; Sanchez A, M. A. [UNAM, Instituto de Fisica, 04510 Ciudad de Mexico (Mexico); Vazquez A, R. [IPN, Escuela Superior de Computo, 07738 Ciudad de Mexico (Mexico); Garcia R, C. M., E-mail: mariscal2005@gmail.com [UNAM, Facultad de Ciencias, 04510 Ciudad de Mexico (Mexico)
2016-11-01
Different emission intensities presented in aluminum oxide phosphors corresponding to different concentrations of doping performed with terbium are analyzed. The phosphors were synthesized by the evaporation technique and were characterized by photo and cathodoluminescence, X-ray diffraction and EDS techniques for different incorporation percentages of terbium as dopant; they show characteristic transitions in 494, 543, 587 and 622 nm, corresponding to {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4} and {sup 5}D{sub 4} → {sup 7}F{sub 3}, respectively when they are excited with λ{sub exc} = 380 nm wavelength at room temperature. The results of X-ray diffraction show the presence of α-Al{sub 2}O{sub 3} phases with peaks located at 2θ = 25.78, 35.34, 37.96, 43.56, 45.8, 52.74, 57.7, 61.5, 66.74, 68.44, 77.12 and 80.94, and the δ-Al{sub 2}O-3 phase 2θ = 32.82, 45.8, 61.36 and 66.74. These compounds were heat treated for two hours at 1100 degrees Celsius. EDS analyzes indicate that these compounds have close to 60% oxygen around of 40% aluminum in the presence of terbium as dopant which indicates a stoichiometry close to the expected one for alumina. (Author)
Llorent-Martínez, Eulogio J; Durán, Gema M; Ríos, Ángel; Ruiz-Medina, Antonio
2018-01-01
We propose an alternative approach for the development of analytical methods based on terbium-sensitized luminescence (TSL). TSL is based on the complexation between Tb(III) ions and fluorescent organic compounds that have appropriate functional groups to complex with Tb(III). We report the use of graphene quantum dot (GQDs) nanoparticles to improve the sensitivity and selectivity of TSL detection. GQDs can react with terbium ions through the carboxylic groups present in their structure. These Tb(III)-GQD complexes, formed in situ in aqueous solution, can be used as time-resolved luminescent probes. Ascorbic acid was selected as a target analyte to demonstrate the suitability of the proposed method. The selectivity of the TSL method was highly improved for most of the interferences tested. Under the optimum conditions [Tb(III) concentration 5 × 10-4 mol L-1, GQD concentration 4 mg L-1], a minimum 100% increase in selectivity was observed for several vitamins and common cations that may be present in the samples to be analyzed. In addition, the analytical signal showed a 30% enhancement with the use of GQDs compared with the use of merely Tb(III) ions, with a detection limit of 0.12 μg mL-1. The repeatability and intermediate precision were lower than 3% and 5%, respectively. From the results obtained, the implementation of GQDs in TSL can lead to the development of novel time-resolved luminescent probes with high analytical potential. Graphical abstract Quenching of Tb(III)-graphene quantum dot (GQD) luminescence by ascorbic acid (AA). TBL terbium-sensitized luminescence.
17 CFR 148.24 - Comments by other parties.
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Comments by other parties. 148... Procedures for Considering Applications § 148.24 Comments by other parties. Any party to an adjudicatory... served. A commenting party may not participate further in proceedings on the application unless the...
34 CFR 303.148 - Transition to preschool programs.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Transition to preschool programs. 303.148 Section 303....148 Transition to preschool programs. Each application must include a description of the policies and... this part to preschool or other appropriate services, including— (a) A description of how the families...
21 CFR 133.148 - Hard grating cheeses.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Hard grating cheeses. 133.148 Section 133.148 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... harmless preparation of enzymes of animal or plant origin capable of aiding in the curing or development of...
19 CFR 148.46 - Sale of exempted articles.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Sale of exempted articles. 148.46 Section 148.46... exempted articles. (a) Sale resulting in forfeiture. The following articles or their value (to be recovered... paragraph (b) of this section is followed: (1) Any jewelry or similar articles of personal adornment having...
19 CFR 148.104 - Frequency of use.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Frequency of use. 148.104 Section 148.104 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY... Frequency of use. (a) 30-day period. The flat rate of duty shall not apply to a person who has used the...
Fluorescence study of some terbium-oligopeptide complexes in methanolic solution.
Rabouan, S; Delage, J; Durand, W; Prognon, P; Barthes, D
2000-04-03
This study concerned the use of lanthanide chelates to detect glycyl-leucyl-phenylalanine (GLF) and its homologues. Spectroscopic analysis of peptides without or with terbium complexation revealed the formation of (LF)(3)(Tb)(2), (GF)(3)(Tb)(2), (GLF)(3)(Tb)(2) and (FL)(4)Tb, (FG)(4)Tb complexes with high stability constants in methanolic solutions (pK(d)>13). Lanthanide chelate emission displayed a large Stokes shift (>270 nm), which allowed Tb chelates of GLF and its derivatives to be used for detection purposes. However, this preliminary study indicated some important limitations associated with lanthanide chelation, such as high methanolic content.
Kostylev, Nikita; Goryachev, Maxim; Bushev, Pavel; Tobar, Michael E.
2017-07-01
Electromagnetic properties of single crystal terbium gallium garnet are characterised from room down to millikelvin temperatures using the whispering gallery mode method. Microwave spectroscopy is performed at low powers equivalent to a few photons in energy and conducted as functions of the magnetic field and temperature. A phase transition is detected close to the temperature of 3.5 K. This is observed for multiple whispering gallery modes causing an abrupt negative frequency shift and a change in transmission due to extra losses in the new phase caused by a change in complex magnetic susceptibility.
Nuclear excitation functions from 40 to 200 MeV proton irradiation of terbium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W., E-mail: jwengle@lanl.gov; Mashnik, Stepan G.; Parker, Lauren A.; Jackman, Kevin R.; Bitteker, Leo J.; Ullmann, John L.; Gulley, Mark S.; Pillai, Chandra; John, Kevin D.; Birnbaum, Eva R.; Nortier, Francois M.
2016-01-01
Nuclear formation cross sections are reported for 26 radionuclides, measured with 40–200 MeV proton irradiations of terbium foils. These data provide the basis for the production of medically relevant radionuclides (e.g., {sup 152}Tb, {sup 155}Tb, {sup 155}Eu, and {sup 156}Eu) and {sup 153}Gd, a potential source used in ongoing efforts to characterize stellar nucleosynthesis routes. Computational predictions from the ALICE2011, CEM03.03, Bertini, and INCL + ABLA codes are compared with newly measured data to contribute to the ongoing process of code development, and yields are calculated for selected radionuclides using measured data.
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSB148 (Link to dictyBase) - - - Contig-U16494-1 VSB148E (Link to Original site)...- - - - - - VSB148E 250 Show VSB148 Library VS (Link to library) Clone ID VSB148 (Link to dictyBase)...AL115377 |AL115377.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 54 0...AL114313 |AL114313.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 54 0...AL115802 |AL115802.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 54 0
Guo, Changchuan; Wang, Lei; Hou, Zhun; Jiang, Wei; Sang, Lihong
2009-05-01
A terbium-sensitized spectrofluorimetric method using an anionic surfactant, sodium dodecyl benzene sulfonate (SDBS), was developed for the determination of gatifloxacin (GFLX). A coordination complex system of GFLX-Tb 3+-SDBS was studied. It was found that SDBS significantly enhanced the fluorescence intensity of the complex (about 11-fold). Optimal experimental conditions were determined as follows: excitation and emission wavelengths of 331 and 547 nm, pH 7.0, 2.0 × 10 -4 mol l -1 terbium (III), and 2.0 × 10 -4 mol l -1 SDBS. The enhanced fluorescence intensity of the system (Δ If) showed a good linear relationship with the concentration of GFLX over the range of 5.0 × 10 -10 to 5.0 × 10 -8 mol l -1 with a correlation coefficient of 0.9996. The detection limit (3 σ) was determined as 6.0 × 10 -11 mol l -1. This method has been successfully applied to the determination of GFLX in pharmaceuticals and human urine/serum samples. Compared with most of other methods reported, the rapid and simple procedure proposed in the text offers higher sensitivity, wider linear range, and better stability. The interaction mechanism of the system is also studied by the research of ultraviolet absorption spectra, surface tension, solution polarity and fluorescence polarization.
Seitz, Michael; Do, King; Ingram, Andrew J.; Moore, Evan G.; Muller, Gilles; Raymond, Kenneth N.
2009-01-01
Abstract: Circulaly polarized luminescence from terbium(III) complexed and excited by chiral antenna ligands gives strong emission The modular synthesis of three new octadentate, enantiopure ligands are reported - one with the bidentate chelating unit 2-hydroxyisophthalamide (IAM) and two with 1-hydroxy-2-pyridinone (1,2-HOPO) units. A new design principle is introduced for the chiral, non-racemic hexamines which constitute the central backbones for the presented class of ligands. The terbium(III) complex of the IAM ligand, as well as the europium(III) complexes of the 1,2-HOPO ligands are synthesized and characterized by various techniques (NMR, UV, CD, luminescence spectroscopy). All species exhibit excellent stability and moderate to high luminescence efficiency (quantum yields ΦEu = 0.05–0.08 and ΦTb = 0.30–0.57) in aqueous solution at physiological pH. Special focus is put onto the properties of the complexes in regard to circularly polarized luminescence (CPL). The maximum luminescence dissymmetry factors (glum) in aqueous solution are high with |glum|max = 0.08 – 0.40. Together with the very favorable general properties (good stability, high quantum yields, long lifetimes), the presented lanthanide complexes can be considered as good candidates for analytical probes based on CPL in biologically relevant environments. PMID:19639983
Energy Technology Data Exchange (ETDEWEB)
Bel' tyukova, S.V.; Nazarenko, N.A.; Poluehktov, N.S.
1982-03-01
The complexes of europium and terbium with phenanthroline, ethylenediaminetetraacetate, nitrilotriacetate, some acids-phenol derivatives and ..beta..-diketones series have been used as an example to demonstrate that the value of the ratio of intensities on the two bands of europium(terbium) luminescence spectra - the one corresponding to the hypersensitive'' transition and the other, to the magnetic dipole one - can be used for determination of the complexes composition in solutions.
2010-07-01
... incorporate best available technology and recommended industry practices? 148.722 Section 148.722 Navigation... plan incorporate best available technology and recommended industry practices? Each applicant must... industry practices as directed in § 148.730. ...
Thermo-transferred thermoluminescence (TTTl) in potassium-yttrium double fluoride doped with terbium
Energy Technology Data Exchange (ETDEWEB)
Gallegos, A.; Rivera, T.; Diaz G, J. A. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Legaria 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Azorin, J. [Universidad Autonoma Metropolitana, Unidad Iztapalapa, San Rafael Atlixco No. 186, Col. Vicentina, 09340 Mexico D. F. (Mexico); Azorin, J. C. [Universidad de Guanajuato, Division de Ciencias e Ingenierias-Campus Leon, Lomas del Bosque No. 103, Col. Lomas del Campestre, 37000 Leon, Guanajuato (Mexico); Licona, R.; Rivas, F.; Hernandez C, G. [Benemerita Universidad Autonoma de Puebla, Facultad de Ciencias Quimicas, 14 Sur y San Claudio, Ciudad Universitaria, Puebla de Zaragoza, Puebla (Mexico); Khaidukov, N. [Institute of General and Inorganic Chemistry, Lenin SK 11 Prospect 31, Moscow 117907 (Russian Federation)
2011-02-15
This paper presents results of studying the thermo-transferred thermoluminescence (TTTl) phenomenon in potassium-yttrium double fluoride doped with terbium (K{sub 2}YF{sub 5:}Tb) at different impurity concentrations (0.8%, 0.95% and 0.99%). Previously to study the TTTl phenomenon, structural characterization and chemical composition of the materials were determined. The structural studies were conducted using a scanning electron microscope; meanwhile, chemical composition was analyzed using energy dispersive X-ray spectroscopy. Thermoluminescence kinetics was studied irradiating the samples with {sup 137}Cs gamma rays as well as with {sup 90}Sr/{sup 90}Y beta rays, analyzing the glow curves by the deconvolution method for obtaining the kinetic parameters. (Author)
The influence of pressure on the photoluminescence properties of a terbium-adipate framework
Spencer, Elinor C.; Zhao, Jing; Ross, Nancy L.; Andrews, Michael B.; Surbella, Robert G.; Cahill, Christopher L.
2013-06-01
The influence of pressure (over the 0-4.7 GPa range) on the photoluminescence emissions and crystal structure of the known 3D terbium-adipate metal-organic framework material Tb-GWMOF6 has been evaluated by high-pressure single-crystal X-ray diffraction and spectroscopic techniques. The results from this study show that this complex lanthanide framework structure undergoes three phase transitions within the 0-4 GPa pressure range that involve alterations in the number of symmetry independent Tb3+ ion sites within the crystal lattice. These pressure induced modifications to the structure of Tb-GWMOF6 lead to pronounced changes in the profiles of the 5D4→7F5 emission spectra of this complex.
Terbium Radionuclides for Theranostics Applications: A Focus On MEDICIS-PROMED
Cavaier, R. Formento; Haddad, F.; Sounalet, T.; Stora, T.; Zahi, I.
A new facility, named CERN-MEDICIS, is under construction at CERN to produce radionuclides for medical applications. In parallel, the MEDICIS-PROMED, a Marie Sklodowska-Curie innovative training network of the Horizon 2020 European Commission's program, is being coordinated by CERN to train young scientists on the production and use of innovative radionuclides and develop a network of experts within Europe. One program within MEDICIS-PROMED is to determine the feasibility of producing innovative radioisotopes for theranostics using a commercial middle-sized high-current cyclotron and the mass separation technology developed at CERN-MEDICIS. This will allow the production of high specific activity radioisotopes not achievable with the common post-processing by chemical separation. Radioisotopes of scandium, copper, arsenic and terbium have been identified. Preliminary studies of activation yield and irradiation parameters optimization for the production of Tb-149 will be described.
Dielectric and conducting behavior of gadolinium-terbium fumarate heptahydrate crystals
Shah, M. D.; Want, B.
2015-07-01
Gadolinium-terbium fumarate heptahydrate crystals were grown in silica gel by using single gel diffusion technique. The crystals were characterized by different physico-chemical techniques of characterization. Powder X-ray diffraction results showed that the grown material is purely crystalline in nature. Elemental analyses suggested the chemical formula of the compound to be Gd Tb (C4H2O4)3ṡ7H2O. Energy dispersive X-ray analysis confirmed the presence of Gd and Tb in the title compound. The dielectric and conductivity studies of the grown compound were carried as function of frequency of applied field and the temperature. The grown material showed a dielectric anomaly which was correlated with its thermal behavior. The ac conductivity of the material showed Jonscher's power law behavior: σ(ω)=σo+Aωs, with a temperature-dependent power exponent s(<1). The conductivity was found to be a function of temperature and frequency.
Bhardwaj, Neha; Bhardwaj, Sanjeev; Mehta, Jyotsana; Kim, Ki-Hyun; Deep, Akash
2016-12-15
The sensitive detection of dipicolinic acid (DPA) is strongly associated with the sensing of bacterial organisms in food and many types of environmental samples. To date, the demand for a sensitive detection method for bacterial toxicity has increased remarkably. Herein, we investigated the DPA detection potential of a water-dispersible terbium-metal organic framework (Tb-MOF) based on the fluorescence quenching mechanism. The Tb-MOF showed a highly sensitive ability to detect DPA at a limit of detection of 0.04nM (linear range of detection: 1nM to 5µM) and also offered enhanced selectivity from other commonly associated organic molecules. The present study provides a basis for the application of Tb-MOF for direct, convenient, highly sensitive, and specific detection of DPA in the actual samples. Copyright © 2016 Elsevier B.V. All rights reserved.
Chen, Yuxiang; Ma, Fang; Chen, Xiaoxiang; Dong, Bowei; Wang, Kang; Jiang, Shangda; Wang, Chiming; Chen, Xin; Qi, Dongdong; Sun, Haoling; Wang, Bingwu; Gao, Song; Jiang, Jianzhuang
2017-11-20
Bulky and strong electron-donating dibutylamino groups were incorporated onto the peripheral positions of one of the two phthalocyanine ligands in the bis(phthalocyaninato) terbium complex, resulting in the isolation of heteroleptic double-decker (Pc)Tb{Pc[N(C4H9)2]8} {Pc = phthalocyaninate; Pc[N(C4H9)2]8 = 2,3,9,10,16,17,23,24-octakis(dibutylamino)phthalocyaninate} with the nature of an unsymmetrical molecular structure, a square-antiprismatic coordination geometry, an intensified coordination field strength, and the presence of organic radical-f interaction. As a total result of all these factors, this sandwich-type tetrapyrrole lanthanide single-ion magnet (SIM) exhibits an overall enhanced magnetic performance including a high blocking temperature (TB) of 30 K and large effective spin-reversal energy barrier of Ueff = 939 K, rendering it the best sandwich-type tetrapyrrole lanthanide SIM reported thus far.
Ultralarge magneto-optic rotations and rotary dispersion in terbium gallium garnet single crystal.
Shaheen, Amrozia; Majeed, Hassaan; Anwar, Muhammad Sabieh
2015-06-10
We report systematically acquired data on the Verdet constant of terbium gallium garnet for wavelengths ranging from visible to near-infrared (405-830 nm) regime. Our experimental method of Stokes polarimetry is based on the Fourier decomposition of the received light intensity and allows unambiguous determination of both the Faraday rotation and the ellipticity of the emergent light. Temperature-dependent investigations in the range of 8-300 K extend earlier reports and verify the Verdet's constant direct dependence on the magnetization, whose first-order approximation is simply a manifestation of the Curie's law. Further, a least-squares fitting of the experimental data correlates well with theoretical predictions. At a wavelength of 405 nm and temperature of 8 K, the rotation is approximately 500°.
Terbium fluorescence as a sensitive, inexpensive probe for UV-induced damage in nucleic acids
Energy Technology Data Exchange (ETDEWEB)
El-Yazbi, Amira F.; Loppnow, Glen R., E-mail: glen.loppnow@ualberta.ca
2013-07-05
Graphical abstract: -- Highlights: •Simple, inexpensive, mix-and-read assay for positive detection of DNA damage. •Recognition of undamaged DNA via hybridization to a hairpin probe. •Terbium(III) fluorescence reports the amount of damage by binding to ssDNA. •Tb/hairpin is a highly selective and sensitive fluorescent probe for DNA damage. -- Abstract: Much effort has been focused on developing methods for detecting damaged nucleic acids. However, almost all of the proposed methods consist of multi-step procedures, are limited, require expensive instruments, or suffer from a high level of interferences. In this paper, we present a novel simple, inexpensive, mix-and-read assay that is generally applicable to nucleic acid damage and uses the enhanced luminescence due to energy transfer from nucleic acids to terbium(III) (Tb{sup 3+}). Single-stranded oligonucleotides greatly enhance the Tb{sup 3+} emission, but duplex DNA does not. With the use of a DNA hairpin probe complementary to the oligonucleotide of interest, the Tb{sup 3+}/hairpin probe is applied to detect ultraviolet (UV)-induced DNA damage. The hairpin probe hybridizes only with the undamaged DNA. However, the damaged DNA remains single-stranded and enhances the intrinsic fluorescence of Tb{sup 3+}, producing a detectable signal directly proportional to the amount of DNA damage. This allows the Tb{sup 3+}/hairpin probe to be used for sensitive quantification of UV-induced DNA damage. The Tb{sup 3+}/hairpin probe showed superior selectivity to DNA damage compared to conventional molecular beacons probes (MBs) and its sensitivity is more than 2.5 times higher than MBs with a limit of detection of 4.36 ± 1.2 nM. In addition, this probe is easier to synthesize and more than eight times cheaper than MBs, which makes its use recommended for high-throughput, quantitative analysis of DNA damage.
Fine- and hyperfine structure investigations of even configuration system of atomic terbium
Stefanska, D.; Elantkowska, M.; Ruczkowski, J.; Furmann, B.
2017-03-01
In this work a parametric study of the fine structure (fs) and the hyperfine structure (hfs) for the even-parity configurations of atomic terbium (Tb I) is presented, based in considerable part on the new experimental results. Measurements on 134 spectral lines were performed by laser induced fluorescence (LIF) in a hollow cathode discharge lamp; on this basis, the hyperfine structure constants A and B were determined for 52 even-parity levels belonging to the configurations 4f85d6s2, 4f85d26s or 4f96s6p; in all the cases those levels were involved in the transitions investigated as the lower levels. For 40 levels the hfs was examined for the first time, and for the remaining 12 levels the new measurements supplement our earlier results. As a by-product, also preliminary values of the hfs constants for 84 odd-parity levels were determined (the investigations of the odd-parity levels system in the terbium atom are still in progress). This huge amount of new experimental data, supplemented by our earlier published results, were considered for the fine and hyperfine structure analysis. A multi-configuration fit of 7 configurations was performed, taking into account second-order of perturbation theory, including the effects of closed shell-open shell excitations. Predicted values of the level energies, as well as of magnetic dipole and electric quadrupole hyperfine structure constants A and B, are quoted in cases when no experimental values are available. By combining our experimental data with our own semi-empirical procedure it was possible to identify correctly the lower and upper level of the line 544.1440 nm measured by Childs with the use of the atomic-beam laser-rf double-resonance technique (Childs, J Opt Soc Am B 9;1992:191-6).
Somasundaram, K.; Girija, K. G.; Sudarsan, V.; Selvin, P. Christopher; Vatsa, R. K.
2016-05-01
Tb3+ doped ZnGa2O4 nanophosphor (21 nm) has been synthesized via low temperature polyol route and subsequently thin films of the same were deposited on glass and ITO substrates by RF magnetron sputtering. The films were characterized by X-ray Diffraction and luminescence measurements. The XRD pattern showed that Tb3+ doped ZnGa2O4 nanophosphor has a cubic spinel phase. Luminescence behavior of the nanophosphor and as deposited sputtered film was investigated. The PL emission spectra of nanophosphor gave a broad ZnGa2O4 host emission band along with a strong terbium emission and the thin films showed only broad host emission band and there was no terbium ion emission.
Lotfi, Ali; Manzoori, Jamshid L
2016-11-01
In this study, a simple and sensitive spectrofluorimetric method is presented for the determination of fluoxetine based on the enhancing effect of silver nanoparticles (AgNPs) on the terbium-fluoxetine fluorescence emission. The AgNPs were prepared by a simple reduction method and characterized by UV-Vis spectroscopy and transmission electron microscopy. It was indicated that these AgNPs have a remarkable amplifying effect on the terbium-sensitized fluorescence of fluoxetine. The effects of various parameters such as AgNP and Tb(3+) concentration and the pH of the media were investigated. Under obtained optimal conditions, the fluorescence intensity of the terbium-fluoxetine-AgNP system was enhanced linearly by increasing the concentration of fluoxetine in the range of 0.008 to 19 mg/L. The limit of detection (b + 3s) was 8.3 × 10(-4) mg/L. The interference effects of common species found in real samples were also studied. The method had good linearity, recovery, reproducibility and sensitivity, and was satisfactorily applied for the determination of fluoxetine in tablet formulations, human urine and plasma samples. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Thomas, Sarah; Montgomery, Jeffrey; Tsoi, Georgiy; Vohra, Yogesh; Weir, Samuel; Tulk, Christopher; Moreira Dos Santos, Antonio
2013-06-01
Neutron diffraction and electrical transport measurements have been carried out on the heavy rare earth metal terbium at high pressures and low temperatures in order to elucidate its transition from a helical antiferromagnetic to a ferromagnetic ordered phase as a function of pressure. The electrical resistance measurements using designer diamonds show a change in slope as the temperature is lowered through the ferromagnetic Curie temperature. The temperature of the ferromagnetic transition decreases at a rate of -16.7 K/GPa till 3.6 GPa, where terbium undergoes a structural transition from hexagonal close packed (hcp) to an α-Sm phase. Above this pressure, the electrical resistance measurements no longer exhibit a change in slope. In order to confirm the change in magnetic phase suggested by the electrical resistance measurements, neutron diffraction measurements were conducted at the SNAP beamline at the Oak Ridge National Laboratory. Measurements were made at pressures to 5.3 GPa and temperatures as low as 90 K. An abrupt increase in peak intensity in the neutron diffraction spectra signaled the onset of magnetic order below the Curie temperature. A magnetic phase diagram of rare earth metal terbium will be presented to 5.3 GPa and 90 K based on these studies.
45 CFR 148.318 - Grant application review.
2010-10-01
... REQUIREMENTS FOR THE INDIVIDUAL HEALTH INSURANCE MARKET Grants to States for Operation of Qualified High Risk Pools § 148.318 Grant application review. (a) Executive Order 12372. This grant program is not listed by... States under part 100 of this title, which implements Executive Order 12372, “Intergovernmental Review of...
Phenotype abnormality: 148 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 148 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u654i decreased efficiency... in organ named hypocotyl during process named cell-cell adhesion ... hypocotyl ... decreased efficiency ... cell-cell adhesion ...
26 CFR 1.148-1 - Definitions and elections.
2010-04-01
... (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.148-1... section 1274. The issue price of bonds may not exceed their fair market value as of the sale date. Issuer... and interest payments within each bond year; and (2) Is depleted at least once each bond year, except...
19 CFR 148.43 - Tobacco products and alcoholic beverages.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Tobacco products and alcoholic beverages. 148.43....43 Tobacco products and alcoholic beverages. (a) For personal use. Fifty cigars, or 200 cigarettes, or 2 kilograms of smoking tobacco, and not exceeding 1 liter of alcoholic beverages may be passed...
19 CFR 148.111 - Written declaration for unaccompanied articles.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Written declaration for unaccompanied articles... of the United States § 148.111 Written declaration for unaccompanied articles. The baggage... covers articles which do not accompany him and: (a) The articles are entitled to free entry under the $1...
19 CFR 148.84 - Special treatment for returning individuals.
2010-04-01
... and International Organizations and Special Treatment for Returning Individuals § 148.84 Special treatment for returning individuals. (a) Except as otherwise provided by law, an individual returning to the... imported as an accommodation to others or for sale or other commercial use. ...
Directory of Open Access Journals (Sweden)
Aiyun Li
2014-01-01
Full Text Available α-Keto acid of pefloxacin mesylate (PFLX can form the complex with Terbium(III. The intramolecular energy from PFLX to Terbium(III ion takes place when excited, and thus Terbium(III excited state is formed and then emits the characteristic fluorescence of Terbium(III, locating at 490, 545, 580, and 620 nm. The second-order scattering (SOS peak at 545 nm also appears for the complex with the exciting wavelength of 273 nm. When the silver nanoparticles are added to the system, the luminescence intensity at 545 nm greatly increased. So, with the adding of nanoparticles to the Terbium(III-PFLX complex, not only is the intramolecular energy promoted but also the SOS intensity is enhanced. The experimental results show that it is the silver nanoparticles with certain size and certain concentration which can greatly enhance the fluorescence-SOS intensity, and the relative intensity at 545 nm is proportional to the amount of PFLX. Based on this phenomenon, a novel method for the determination of PFLX has been developed and applied to the determination of PFLX in capsule and serum samples.
Influence of crystalline structure on the luminescence properties of terbium orthotantalates
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Kisla P.F. [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil); Carmo, Alexandre P. [Instituto Federal Fluminense, Campus Cabo Frio, RJ 28909-971 (Brazil); Bell, Maria J.V. [Departamento de Física, Universidade Federal de Juiz de Fora, Juiz de Fora 36036-330, MG (Brazil); Dias, Anderson, E-mail: anderson_dias@iceb.ufop.br [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil)
2013-06-15
Terbium orthotantalate powders were produced with M-fergusonite type (I2/a) and M′-fergusonite type (P2/a) structures. The samples were studied by X-ray diffraction, Raman scattering, and photoluminescence measurements (emission and decay curves). The results showed that crystalline materials were obtained with all the 18 Raman-active modes predicted by group theory calculations. Also, it was observed through photoluminescence decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. Photoluminescence emission curves exhibited some variation in spectral shape, peak position, and relative intensity as a consequence of their different crystalline arrangements. The dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549.2 nm (M-type) and 543.0 nm (M′-type). Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively. M′-type materials seems to be the most suitable for luminescent devices and could be a potential green luminescent material due to the strongest emission if compared with the M-fergusonite type. -- Highlights: ► Terbium orthotantalates were prepared in two different crystalline structures: I2/a and P2/a. ► XRD and Raman scattering showed that the different space groups obtained were exhibited all the 18 Raman-active modes. ► PL decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. ► Dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549 nm (M-type) and 543 nm (M′-type). ► Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively.
Lapaev, Dmitry V.; Nikiforov, Victor G.; Safiullin, Georgy M.; Lobkov, Vladimir S.; Salikhov, Kev M.; Knyazev, Andrey A.; Galyametdinov, Yury G.
2014-11-01
The study of the terbium(III) and gadolinium(III) β-diketonate complexes by photoluminescence spectroscopy reveals considerable changes of the photophysical properties of the complexes under the UV laser irradiation. The measurements show the enhancement of the luminescence intensities in the vitrified transparent film of the terbium(III) complex as well as the gadolinium(III) complex under the 337 nm laser irradiation at room temperature. The irradiated film of the terbium(III) complex restores the initial photophysical properties after heating close to the melting temperature (∼353 K) and cooling. We observe no change of the luminescent properties of the irradiated film for months. These features can be used for the design of new lanthanide-based photostable systems with laser control of the luminescence intensity.
Ye, Zhiqiang; Tan, Mingqian; Wang, Guilan; Yuan, Jingli
2005-01-15
Silica-based functionalized terbium fluorescent nanoparticles were prepared, characterized and developed as a fluorescence probe for antibody labeling and time-resolved fluoroimmunoassay. The nanoparticles were prepared in a water-in-oil (W/O) microemulsion containing a strongly fluorescent Tb(3+) chelate, N,N,N(1),N(1)-[2,6-bis(3'-aminomethyl-1'-pyrazolyl)phenylpyridine] tetrakis(acetate)-Tb(3+) (BPTA-Tb(3+)), Triton X-100, octanol, and cyclohexane by controlling copolymerization of tetraethyl orthosilicate (TEOS) and 3-[2-(2-aminoethylamino)ethylamino]propyl-trimethoxysilane (AEPS) with ammonia water. The characterizations by transmission electron microscopy and fluorometric methods show that the nanoparticles are spherical and uniform in size, 45 +/- 3nm in diameter, strongly fluorescent with fluorescence quantum yield of 10% and a long fluorescence lifetime of 2.0ms. The amino groups directly introduced to the nanoparticle's surface by using AEPS in the preparation made the surface modification and bioconjugation of the nanoparticles easier. The nanoparticle-labeled anti-human alpha-fetoprotein antibody was prepared and used for time-resolved fluoroimmunoassay of alpha-fetoprotein (AFP) in human serum samples. The assay response is linear from 0.10ngml(-1) to about 100ngml(-1) with the detection limit of 0.10ngml(-1). The coefficient variations (CVs) of the method are less than 9.0%, and the recoveries are in the range of 84-98% for human serum sample measurements.
Highly efficient precipitation of phosphoproteins using trivalent europium, terbium, and erbium ions
Energy Technology Data Exchange (ETDEWEB)
Guezel, Yueksel; Rainer, Matthias; Mirza, Munazza Raza; Bonn, Guenther K. [Leopold-Franzens University, Institute of Analytical Chemistry and Radiochemistry, Innsbruck (Austria)
2012-05-15
This study describes a highly efficient method for the selective precipitation of phosphoproteins by trivalent europium, terbium, and erbium metal ions. These metal cations belong to the group of lanthanides and are known to be hard acceptors with an overwhelming preference for oxygen-containing anions such as phosphates to which they form very tight ionic bonds. The method could be successfully applied to specifically precipitate phosphoproteins from complex samples including milk and egg white by forming solid metal-protein complexes. Owing to the low solubility product of the investigated lanthanide salts, the produced metal-protein complexes showed high stability. The protein pellets were extensively washed to remove nonphosphorylated proteins and contaminants. For the analysis of proteins the pellets were first dissolved in 30 % formic acid and subjected to matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) MS. For peptide mass-fingerprint analysis the precipitated phosphoproteins were enzymatically digested using microwave-assisted digestion. The method was found to be highly specific for the isolation and purification of phosphoproteins. Protein quantification was performed by colorimetric detection of total precipitated phosphoproteins and revealed more than 95 % protein recovery for each lanthanide salt. (orig.)
A Terbium Sensitized Luminescence Method for the Assay of Flubiprofen in Pharmaceutical Formulations
Directory of Open Access Journals (Sweden)
Salma M.Z. Al-Kindy
2014-12-01
Full Text Available A sensitive time-resolved luminescence method for the determination of flubiprofen (FLP in methanol and in aqueous solution is described. The method is based on the luminescence sensitization of terbium (Tb3+ by the formation of a ternary complex with FLP in the presence of 4,7 diphenyl 1,10 phenanthroline (DPP as co-ligand, and Tween-20 as surfactant. The signal for Tb-FLP-DPP was monitored at λex = 285 nm and λem = 552 nm. Optimum conditions for the formation of the complex in an aqueous system were TRIS buffer, pH 8.0, DPP (2.5Å~10−7 M, Tween-20 (0.30% and 4Å~10-5 mol L-1 of Tb3+ which allowed the determination of 20–1000 ng mL-1 of FLP with a limit of detection (LOD of 10 ng mL-1 . The relative standard deviations of the method ranged between 0.6 and 1.4% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assays of FLP in pharmaceutical formulations and spiked tap water samples with average recoveries of 87% – 95%.
Energy Technology Data Exchange (ETDEWEB)
Wang Hong; Yi Chongyue; Li Xue; Fang Fang [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Yang Yajiang, E-mail: yjyang@mail.hust.edu.c [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China)
2011-04-15
Luminescence enhancement of terbium-ion prulifloxacin complexes (Tb(III)-PUFX) in supramolecular hydrogels formed by assembly of 1,3:2,4-di-O-benzylidene-D-sorbitol (DBS) was investigated by steady-state fluorescence, varying temperature fluorescence and time-resolved fluorescence. The luminescence images show that Tb(III)-PUFX were dispersed in the DBS gels. The luminescence intensity of Tb(III)-PUFX in the DBS gels was significantly increased in comparison with that in corresponding aqueous solutions. The varying temperature fluorescent spectra show that the luminescence intensity of Tb(III)-PUFX decreased with an increase in the temperature. This implies that the luminescence enhancement of Tb(III)-PUFX is related to the dissociation and the formation of the DBS assemblies. Time-resolved fluorescence measurements show slower rotational motion in DBS gels in comparison with that in the corresponding aqueous solutions. This may be ascribed to a unique microstructure of three-dimensional network formed by DBC aggregates, resulting in deactivation of the nonradiative relaxation. The images of field emission scanning electron microscopy and polarized optical microscopy indicate that the morphology of the DBS assemblies was not influenced upon addition of Tb(III)-PUFX to the DBS gels.
A Nanoscale Multiresponsive Luminescent Sensor Based on a Terbium(III) Metal-Organic Framework.
Dang, Song; Wang, Ting; Yi, Feiyan; Liu, Qinghui; Yang, Weiting; Sun, Zhong-Ming
2015-08-01
A nanoscale terbium-containing metal-organic framework (nTbL), with a layer-like structure and [H2 NMe2 ](+) cations located in the framework channels, was synthesized under hydrothermal conditions. The structure of the as-prepared sample was systematically confirmed by powder XRD and elemental analysis; the morphology was characterized by field-emission SEM and TEM. The photoluminescence studies revealed that rod-like nTbL exhibited bright-green emission, corresponding to (5)D4 →(7)FJ (J=6-3) transitions of the Tb(3+) ion under excitation. Further sensing measurements revealed that as-prepared nTbL could be utilized as a multiresponsive luminescent sensor, which showed significant and exclusive detection ability for Fe(3+) ions and phenylmethanol. These results highlight the practical applications of lanthanide-containing metal-organic frameworks as fluorescent probes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Wang, Ning; Duchamp, Martial; Dunin-Borkowski, Rafal E; Liu, Shiyu; Zeng, XianTing; Cao, Xun; Long, Yi
2016-01-26
Vanadium dioxide (VO2) is a well-known thermochromic material with large IR modulating ability, promising for energy-saving smart windows. The main drawbacks of VO2 are its high phase transition temperature (τ(c) = 68°C), low luminous transmission (T(lum)), and weak solar modulating ability (ΔT(sol)). In this paper, the terbium cation (Tb(3+)) doping was first reported to reduce τ(c) and increase T(lum) of VO2 thin films. Compared with pristine VO2, 2 at. % doping level gives both enhanced T(lum) and ΔT(sol) from 45.8% to 54.0% and 7.7% to 8.3%, respectively. The T(lum) increases with continuous Tb(3+) doping and reaches 79.4% at 6 at. % doping level, representing ∼73.4% relative increment compared with pure VO2. This has surpassed the best reported doped VO2 thin films. The enhanced thermochromic properties is meaningful for smart window applications of VO2 materials.
Achyuthan, Komandoor E; Arango, Dulce C; Carles, Elizabeth L; Cutler, Christopher E; Meyer, Lauren A; Brozik, Susan M
2009-07-01
We describe a metal transport system for investigating the interfacial interactions between the anionic surface charge of a gram-negative bacterium (Escherichia coli) and a trivalent cationic metal, Tb3+. We believe this is the first description of the uptake kinetics, sub- and intracellular distribution, and temporal fate of Tb3+ ion in E. coli. We used the luminescence of the terbium-dipicolinic acid chelate to study metal ion transport. The bacteria had a high tolerance for the metal (IC(50) = 4 mM Tb3+). Metal ion transport was passive and metabolism independent. The uptake kinetics rapidly reached a maximum within 15 min, followed by a stasis for 60 min, and declining thereafter between 120 and 240 min, resulting in a biphasic curve. During this period, greater than one-third of the metal ion was sequestered within the cell. Our choice of a safe Biosafety Level I E. coli bacteria and the relatively non-toxic Tb3+ metal represents a model system for luminescent investigations of biosorption, for studying bacterial-water interfacial chemistry and for the bioremediation of heavy metals and radionuclides.
Elantkowska, Magdalena; Ruczkowski, Jarosław; Sikorski, Andrzej; Dembczyński, Jerzy
2017-11-01
A parametric analysis of the hyperfine structure (hfs) for the even parity configurations of atomic terbium (Tb I) is presented in this work. We introduce the complete set of 4fN-core states in our high-performance computing (HPC) calculations. For calculations of the huge hyperfine structure matrix, requiring approximately 5000 hours when run on a single CPU, we propose the methods utilizing a personal computer cluster or, alternatively a cluster of Microsoft Azure virtual machines (VM). These methods give a factor 12 performance boost, enabling the calculations to complete in an acceptable time.
Spectrofluorimetric determination of human serum albumin using terbium-danofloxacin probe.
Ramezani, Amir M; Manzoori, Jamshid L; Amjadi, Mohammad; Jouyban, Abolghasem
2012-01-01
A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb(3+)-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb(3+)-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb(3+)-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH = 7.8, [Tb(3+)] = 8.5 × 10(-5) mol L(-1), [Dano] = 1.5 × 10(-4) mol L(-1). The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2 × 10(-6) - 1.3 × 10(-6) mol L(-1), 0.2 × 10(-6) - 1.4 × 10(-6) mol L(-1), and 0.2 × 10(-6) - 1 × 10(-6) mol L(-1), respectively. The detection limits (S/N = 3) for BSA, HSA, and plasma sample of HSA were 8.7 × 10(-8) mol L(-1), 6.2 × 10(-8) mol L(-1), and 8.1 × 10(-8) mol L(-1), respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.
Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe
Directory of Open Access Journals (Sweden)
Amir M. Ramezani
2012-01-01
Full Text Available A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA and bovine serum albumin (BSA using terbium-danofloxacin (Tb3+-Dano as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA. Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH=7.8, [Tb3+] =8.5×10−5 mol L−1, [Dano] =1.5×10−4 mol L−1. The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2×10−6−1.3×10−6 mol L−1, 0.2×10−6−1.4×10−6 mol L−1, and 0.2×10−6−1×10−6 mol L−1, respectively. The detection limits (S/N = 3 for BSA, HSA, and plasma sample of HSA were 8.7×10−8 mol L−1, 6.2×10−8 mol L−1, and 8.1×10−8 mol L−1, respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.
Directory of Open Access Journals (Sweden)
M Shaghaghi
2009-12-01
Full Text Available "nBackground and the Purpose of the Study: The aim of this study was development and validation of a simple, rapid and sensitive spectrofluorimetric method for determination of total flavonoids in two topical formulations of Calendula officinalis, Ziziphus Spina-christi and an oral drop of Hypiran perforatum L. The proposed method is based on the formation of terbium (Tb3+ "n-flavonoids (quercetin as a reference standard complex at pH 7.0, which has fluorescence intensely with maximum emission at 545 nm when excited at 310 nm. "nMethod "n: For ointments masses of topical formulations were weighed and added to ethanol-aqueous buffer (pH 10.0 and the resulting mixtures were shaken and then two phases were separated by centrifugation. Aqueous phases were filtered and then diluted with water. For Hypiran drops an appropriate portion was diluted with ethanol and then aliquots of sample or standard solutions were determined according to the experimental procedure. "nResults "n: Under the optimum conditions, total concentrations of flavonoids (as quercetin equivalent in three tested formulations were found to be 0.204 mg/g (for Dermatin cream, 0.476 mg/g (for Calendula ointment and 13.50 μg/ml (for Hypiran drops. Analytical recoveries from samples spiked with different amounts of quercetin were 96.1-104.0 % with RSD % of less than 3.5. Conclusion : The proposed method which requires a simple dissolution step without any matrix interferences provided high sensitivity and selectivity and was easily applied to determine total flavonoids in real samples of three investigated formulations with excellent reproducibility.
Energy Technology Data Exchange (ETDEWEB)
Tshabalala, Modiehi A.; Swart, Hendrik C.; Ntwaeaborwa, Odireleng M., E-mail: ntwaeab@ufs.ac.za [Department of Physics, University of the Free State, P.O Box 339, Bloemfontein 9300 South Africa (South Africa)
2014-03-15
White light emitting terbium (Tb{sup 3+}) and europium (Eu{sup 3+}) codoped strontium silicate (Sr{sub 2}SiO{sub 4}) phosphors were prepared by a solid state reaction process. The structure, particle morphology, chemical composition, ion distribution, photoluminescence (PL), and decay characteristics of the phosphors were analyzed by x-ray diffraction (XRD), scanning electron microscopy (SEM), time-of-flight secondary ion mass spectrometry (TOF-SIMS), and PL spectroscopy, respectively. The XRD data showed that our Sr{sub 2}SiO{sub 4} composed of two phases, namely, β-Sr{sub 2}SiO{sub 4} and α′-Sr{sub 2}SiO{sub 4}, and the α′-Sr{sub 2}SiO{sub 4} phase was more prominent than the β-Sr{sub 2}SiO{sub 4} phase. The SEM micrographs showed that the particles were agglomerated together and they did not have definite shapes. All ions (i.e., negative and positive) present in our materials were identified by TOF-SIMS. In addition, the chemical imaging performed with the TOF-SIMS demonstrated how the individual ions including the dopants (Eu{sup 3+} and Tb{sup 3+}) were distributed in the host lattice. White photoluminescence was observed when the Sr{sub 2}SiO{sub 4}:Tb{sup 3+}, Eu{sup 3+} phosphor was excited at 239 nm using a monochromatized xenon lamp as the excitation source. The phosphor exhibited fast decay lifetimes implying that it is not a good candidate for long afterglow applications.
27 CFR 20.148 - Manufacture of articles with completely denatured alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Manufacture of articles with completely denatured alcohol. 20.148 Section 20.148 Alcohol, Tobacco Products and Firearms ALCOHOL... ALCOHOL AND RUM Sale and Use of Completely Denatured Alcohol § 20.148 Manufacture of articles with...
26 CFR 1.148-5A - Yield and valuation of investments.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Yield and valuation of investments. 1.148-5A..., 1997 § 1.148-5A Yield and valuation of investments. (a) through (b)(2)(ii) . For guidance see § 1.148-5. (b)(2)(iii) Permissive application of single investment rules to certain yield restricted investments...
19 CFR 148.17 - Declaration on arrival incidental to further foreign travel.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Declaration on arrival incidental to further foreign travel. 148.17 Section 148.17 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Declarations § 148.17 Declaration on arrival incidental...
45 CFR 148.128 - State flexibility in individual market reforms-alternative mechanisms.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false State flexibility in individual market reforms-alternative mechanisms. 148.128 Section 148.128 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES... Requirements Relating to Access and Renewability of Coverage § 148.128 State flexibility in individual market...
26 CFR 1.148-10A - Anti-abuse rules and authority of Commissioner.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Anti-abuse rules and authority of Commissioner. 1.148-10A Section 1.148-10A Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... Prior to July 8, 1997 § 1.148-10A Anti-abuse rules and authority of Commissioner. (a) through (b)(1...
33 CFR 148.3 - What Federal agencies are responsible for implementing the Deepwater Port Act?
2010-07-01
... responsible for implementing the Deepwater Port Act? 148.3 Section 148.3 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DEEPWATER PORTS DEEPWATER PORTS: GENERAL General § 148.3 What Federal agencies are responsible for implementing the Deepwater Port Act? (a) Under...
47 CFR 80.148 - Watch on 156.8 MHz (Channel 16).
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Watch on 156.8 MHz (Channel 16). 80.148 Section 80.148 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO... Watches § 80.148 Watch on 156.8 MHz (Channel 16). Each compulsory vessel, while underway, must maintain a...
19 CFR 148.15 - Inclusion of articles not for personal or household use.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Inclusion of articles not for personal or household use. 148.15 Section 148.15 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... § 148.15 Inclusion of articles not for personal or household use. Articles not personal in character, or...
33 CFR 148.250 - Who must be served before a document is filed?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Who must be served before a document is filed? 148.250 Section 148.250 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Hearings § 148.250 Who must be served before a document is filed? Before a document may be filed by any...
33 CFR 148.252 - What is the procedure for serving a subpoena?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What is the procedure for serving a subpoena? 148.252 Section 148.252 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Hearings § 148.252 What is the procedure for serving a subpoena? (a) A party may submit a request for a...
33 CFR 148.705 - What is determined by the environmental evaluation?
2010-07-01
... environmental evaluation? 148.705 Section 148.705 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) DEEPWATER PORTS DEEPWATER PORTS: GENERAL Environmental Review Criteria for Deepwater Ports § 148.705 What is determined by the environmental evaluation? (a) The environmental criteria...
Decolorisation of disperse dark blue 148 with ozone
Eren, S.; Yetisir, I.; Eren, H. A.
2017-10-01
The aim of this study is decolorisation of CI Disperse Dark Blue 148 dye by ozone treatment which is one of the most attractive alternatives for solving the problem of color in textile dyeing effluents. A venturi injection system added dyeing chamber for getting ozone from the ozone generator. And additive (acetic acid and dispersing agent) put in the dyeing. After the coloration, the experimental color, chemical oxygen demand (COD), pH, temperature (°C) and conductivity (μS/cm) were measured. The results encourage the use of the system for decolorisation trials as well as dyebath effluent recycling.
Tanase, S.; Gallego, P.M.; Gelder, R. de; Fu, W.T.
2007-01-01
The reactions of pyridine-2,6-dicarboxamide with europium(III) and terbium(III) triflates led to the formation of mononuclear complexes of formula [Ln(pcam)(3)](CF3SO3)(3) (Ln = Eu 1, Tb 2; pcam stands for pyridine-2,6-dicarboxamide). From single-crystal X-ray diffraction analysis, the complexes
Yun, S J; Nam, K S
1998-01-01
Zinc sulfide (ZnS) and terbium-doped ZnS (ZnS:Tb) thin films were grown by traveling wave reactor atomic layer epitaxy (ALE). In the present work, ZnCl sub 2 , H sub 2 S, and tris (2,2,6,6-tetramethyl-3,5-heptandionato) terbium (Tb(tmhd) sub 3) were used as the precursors. The dependence of crystallinity and Cl content of ZnS films was investigated on the growth temperature. ZnS and ZnS:Tb films grown at temperatures ranging from 400 to 500 .deg. C showed a hexagonal-2H crystalline structure. The crystallinity of ZnS film was greatly enhanced as the temperature increased. At growth temperatures higher than 450.deg.C, the films showed preferred orientation with mainly (002) diffraction peak. The Cl content decreased from approximately 9 to 1 at.% with the increase in growth temperature from 400 to 500 .deg. C. The segregation of Cl near the surface region and the incorporation of O from Tb(tmhd) sub 3 during ALE process were also observed using Auger electron spectroscopy. The ALE-grown ZnS and ZnS:Tb films re...
Schlichting, Wolfgang; Stevens, Kevin; Foundos, Greg; Payne, Alexis
2017-10-01
Many scientific lasers and increasingly industrial laser systems operate in power regime, require high-performance optical isolators to prevent disruptive light feedback into the laser cavity. The optically active Faraday material is the key optical element inside the isolator. SYNOPTICS has been supplying the laser market with Terbium Gallium Garnet (TGG - Tb3Ga5O12) for many years. It is the most commonly used material for the 650-1100nm range and the key advantages for TGG include its cubic crystal structure for alignment free processing, little to no intrinsic birefringence, and ease of manufacture. However, for high-power laser applications TGG is limited by its absorption at 1064nm and its thermo-optic coefficient, dn/dT. Specifically, thermal lensing and depolarization effects become a limiting factor at high laser powers. While TGG absorption has improved significantly over the past few years, there is an intrinsic limit. Now, SYNOPTICS is commercializing the enhanced new crystal Potassium Terbium Fluoride KTF (KTb3F10) that exhibits much smaller nonlinear refractive index and thermo-optic coefficients, and still exhibits a Verdet constant near that of TGG. This cubic crystal has relatively low absorption and thermo-optic coefficients. It is now fully characterized and available for select production orders. At OPTIFAB in October 2017 we present recent results comparing the performance of KTF to TGG in optical isolators and show SYNOPTICS advances in large volume crystal growth and the production ramp up.
Directory of Open Access Journals (Sweden)
Devender Singh
2016-12-01
Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.
Synthesis and luminescent study of Ce{sup 3+}-doped terbium-yttrium aluminum garnet
Energy Technology Data Exchange (ETDEWEB)
Dotsenko, V.P., E-mail: ssclab@ukr.net [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Berezovskaya, I.V.; Zubar, E.V.; Efryushina, N.P. [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Poletaev, N.I.; Doroshenko, Yu.A. [Institute of Combustion and Advanced Technologies, Mechnikov Odessa National University, Dvoryanskaya 2, 65082 Odessa (Ukraine); Stryganyuk, G.B. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine); HASYLAB at DESY, Notkestrasse 85, 22607 Hamburg (Germany); Voloshinovskii, A.S. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine)
2013-02-15
Highlights: Black-Right-Pointing-Pointer Ce{sup 3+}-doped garnets (TYAG) were prepared using nanostructured reagents. Black-Right-Pointing-Pointer The Ce{sup 3+} ions cause a very efficient yellow emission of the samples. Black-Right-Pointing-Pointer The reasons for the long wavelength position of this emission are discussed. Black-Right-Pointing-Pointer Contribution from Al atoms to the conduction band of TYAG is quite essential. - Abstract: Terbium-yttrium aluminum garnets (TYAG) doped with Ce{sup 3+} ions have been prepared by solid state reactions between nanostructured oxides of aluminum and rare earths. The luminescent properties of Ce{sup 3+} ions in (Tb{sub 0.8}Y{sub 0.2}){sub 3(1-x)}Ce{sub 3x}Al{sub 5}O{sub 12} (x = 0.03) have been studied upon excitation in the 2-20 eV region. The substitution of Tb{sup 3+} for Y{sup 3+} in the garnet structure results in broadening the emission band and shifting its maximum towards the longer wavelengths. It was found that in addition to the 4f{sup n} {yields} 4f{sup n-1}5d excitation bands of Ce{sup 3+} and Tb{sup 3+} ions, the excitation spectra for the Ce{sup 3+} emission contain broad bands at 6.73 and {approx}9.5 eV. These bands are attributed to the Ce{sup 3+}-bound exciton formation and O 2p {yields} Al 3s, 3p transitions, respectively. In contrast to the predictions based on the results of electronic structure calculations on Y{sub 3}Al{sub 5}O{sub 12} and Tb{sub 4}Al{sub 2}O{sub 9}, the threshold of interband transitions in TYAG is at high energies ( Greater-Than-Or-Slanted-Equal-To 7.3 eV), and contributions from Al{sub tetr} and Al{sub oct} atoms to the conduction-band density of states are evaluated as quite essential.
Energy Technology Data Exchange (ETDEWEB)
Thuéry, Pierre, E-mail: pierre.thuery@cea.fr
2015-07-15
Terbium nitrate was reacted with 1,3-adamantanedicarboxylic acid (LH{sub 2}) under solvo-hydrothermal conditions with either N,N-dimethylformamide (DMF) or N,N-dimethylacetamide (DMA) as organic solvents. Hydrolysation of the latter co-solvents resulted in the formation of formate or acetate ions, which are present as co-ligands in the 1D coordination polymer [Tb(L)(HCOO)(H{sub 2}O){sub 2}] (1) and the 2D assembly [Tb(L)(CH{sub 3}COO)(H{sub 2}O)] (2). The increase in dimensionality in the latter arises from the higher connectivity provided by acetate versus formate, the L{sup 2−} ligand being bis-chelating in both cases. The complex [Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 5}][Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 4}]·3H{sub 2}O (3), another 1D species, crystallizes alongside crystals of 2. Further addition of cucurbit[6]uril (CB6), with DMF as co-solvent, gave the two complexes [Tb{sub 2}(L){sub 2}(CB6)(H{sub 2}O){sub 6}](NO{sub 3}){sub 2}·6H{sub 2}O (4) and [H{sub 2}NMe{sub 2}]{sub 2}[Tb(L)(HCOO){sub 2}]{sub 2}·CB6·3H{sub 2}O (5). Complex 4 crystallizes as a 3D framework in which Tb(L){sup +} chains are connected by tetradentate CB6 molecules, while 5 unites a carboxylate-bridged anionic 2D planar assembly and layers of CB6 molecules with counter-cations held at both portals. - Graphical abstract: One- to three-dimensional assemblies are formed in terbium(III) complexes with 1,3-adamantanedicarboxylate obtained under solvo-hydrothermal conditions, these species including formate or acetate co-ligands formed in situ, or additional cucurbit[6]uril molecules. - Highlights: • We report structures of terbium(III) complexes with 1,3-adamantanedicarboxylate. • Solvents able to generate co-ligands or counter-ions in situ have been used. • A 3D species including additional cucurbituril molecules is decribed. • One species displays an alternation of metal–organic and organic sheets.
Majeed, Hassaan; Shaheen, Amrozia; Anwar, Muhammad Sabieh
2013-10-21
We report the complete determination of the polarization changes caused in linearly polarized incident light due to propagation in a magneto-optically active terbium gallium garnet (TGG) single crystal, at temperatures ranging from 6.3 to 300 K. A 28-fold increase in the Verdet constant of the TGG crystal is seen as its temperature decreases to 6.3 K. In contrast with polarimetry of light emerging from a Faraday material at room temperature, polarimetry at cryogenic temperatures cannot be carried out using the conventional fixed polarizer-analyzer technique because the assumption that ellipticity is negligible becomes increasingly invalid as temperature is lowered. It is shown that complete determination of light polarization in such a case requires the determination of its Stokes parameters, otherwise inaccurate measurements will result with negative implications for practical devices.
Geho, Mikio; Takagi, Takashi; Chiku, Shinichiro; Fujii, Takashi
2005-07-01
We have recently reported the successful growth of incongruently melting terbium aluminum garnet (Tb3Al5O12; TAG) single crystals by the hybrid laser FZ (floating zone) method. Optical property evaluations confirmed a high transmittance and a larger Verdet constant than conventional Tb3Ga5O12 (TGG) crystals and/or Faraday glasses. In this study, we attempted to design, fabricate, and evaluate optical isolators in visible light through near-infrared (NIR) regions using TAG crystals. A finite element method (FEM) simulation of possible models led us to the preferable one based on a radially magnetized magnet. To realize this, we employed a pseudo-radially magnetized magnet. The target wavelengths of the prototype device were 408, 808, and 1064 nm. The typical extinction ratio was more than 30 dB and the insertion loss was less than 0.3 dB for AR-coated devices.
Innocenzi, Valentina; Ippolito, Nicolò Maria; De Michelis, Ida; Medici, Franco; Vegliò, Francesco
2016-12-15
Terbium and rare earths recovery from fluorescent powders of exhausted lamps by acid leaching with hydrochloric acid was the objective of this study. In order to investigate the factors affecting leaching a series of experiments was performed in according to a full factorial plan with four variables and two levels (4 2 ). The factors studied were temperature, concentration of acid, pulp density and leaching time. Experimental conditions of terbium dissolution were optimized by statistical analysis. The results showed that temperature and pulp density were significant with a positive and negative effect, respectively. The empirical mathematical model deducted by experimental data demonstrated that terbium content was completely dissolved under the following conditions: 90 °C, 2 M hydrochloric acid and 5% of pulp density; while when the pulp density was 15% an extraction of 83% could be obtained at 90 °C and 5 M hydrochloric acid. Finally a flow sheet for the recovery of rare earth elements was proposed. The process was tested and simulated by commercial software for the chemical processes. The mass balance of the process was calculated: from 1 ton of initial powder it was possible to obtain around 160 kg of a concentrate of rare earths having a purity of 99%. The main rare earths elements in the final product was yttrium oxide (86.43%) following by cerium oxide (4.11%), lanthanum oxide (3.18%), europium oxide (3.08%) and terbium oxide (2.20%). The estimated total recovery of the rare earths elements was around 70% for yttrium and europium and 80% for the other rare earths. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Arnaud, N.; Georges, J
2003-01-10
The luminescent properties of terbium complexes with furosemide (FR), flufenamic (FF) acid, tolfenamic (TF) acid and mefenamic (MF) acid have been investigated in aqueous solutions. For all four compounds, complexation occurs when the carboxylic acid of the aminobenzoic group is dissociated and is greatly favoured in the presence of trioctylphosphine oxide as co-ligand and Triton X-100 as surfactant. Under optimum conditions, luminescence of the lanthanide ion is efficiently sensitised and the lifetime of the {sup 5}D{sub 4} resonance level of terbium in the complex is ranging between 1 and 1.9 ms, against 0.4 ms for the aqua ion. The sensitivity of the method for the determination of anthranilic acid derivatives is improved by one to two orders of magnitude with respect to that achieved using native fluorescence or terbium-sensitised luminescence in methanol. The limits of detection are 2x10{sup -10}, 5x10{sup -10} and 2x10{sup -9} mol l{sup -1} for flufenamic acid, furosemide and tolfenamic acid, and mefenamic acid, respectively, with within-run RSD values of less than 1%. The method has been applied to the determination of flufenamic acid in spiked calf sera with and without sample pretreatment. Depending on the method and the analyte concentration, the recovery was ranging between 83 and 113% and the lowest concentration attainable in serum samples was close to 1x10{sup -7} mol l{sup -1}.
26 CFR 1.148-4 - Yield on an issue of bonds.
2010-04-01
... (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.148-4 Yield on... hedged bond, the contract is deemed terminated for its fair market value as of the issue date of the... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Yield on an issue of bonds. 1.148-4 Section 1...
47 CFR 25.148 - Licensing provisions for the Direct Broadcast Satellite Service.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Licensing provisions for the Direct Broadcast Satellite Service. 25.148 Section 25.148 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... Licensing provisions for the Direct Broadcast Satellite Service. (a) License terms. License terms for DBS...
Lafi, Feras Fawzi
2017-03-03
Ochrobactrum intermedium strain SA148 is a plant growth-promoting bacterium isolated from sandy soil in the Jizan area of Saudi Arabia. Here, we report the 4.9-Mb draft genome sequence of this strain, highlighting different pathways characteristic of plant growth promotion activity and environmental adaptation of SA148.
2010-10-01
... (excluding stainless steel). 148.04-13 Section 148.04-13 Shipping COAST GUARD, DEPARTMENT OF HOMELAND... stainless steel). (a) This section applies to the stowage and transportation in bulk of hazardous materials... steel). However, unmanned barges on which the article is stowed for or transported on a voyage entirely...
19 CFR 148.22 - Examination of air travelers' baggage in foreign territory.
2010-04-01
... territory. 148.22 Section 148.22 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND... territory. (a) Examination and surrender of declaration. When places have been established in a foreign... the Customs territory of the United States. When baggage is examined in foreign territory, the baggage...
40 CFR 148.3 - Dilution prohibited as a substitute for treatment.
2010-07-01
... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Dilution prohibited as a substitute for treatment. 148.3 Section 148.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... prohibited as a substitute for treatment. The prohibition of § 268.3 shall apply to owners or operators of...
45 CFR 148.122 - Guaranteed renewability of individual health insurance coverage.
2010-10-01
... insurance coverage. 148.122 Section 148.122 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS REQUIREMENTS FOR THE INDIVIDUAL HEALTH INSURANCE MARKET... health insurance coverage. (a) Applicability. This section applies to all health insurance coverage in...
33 CFR 148.217 - How can a State be designated as an adjacent coastal State?
2010-07-01
... concerning the risk of damage to the coastal environment of the State; and (4) Explain why the State believes the risk of damage to its coastal environment is equal to or greater than the risk to a State... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD...
27 CFR 478.148 - Armor piercing ammunition intended for sporting or industrial purposes.
2010-04-01
... intended for sporting or industrial purposes. 478.148 Section 478.148 Alcohol, Tobacco Products, and... ammunition intended for sporting or industrial purposes. The Director may exempt certain armor piercing... for any such ammunition which is primarily intended for sporting purposes or intended for industrial...
The R148.3 Gene Modulates Caenorhabditis elegans Lifespan and Fat Metabolism
Directory of Open Access Journals (Sweden)
Catherine Roy-Bellavance
2017-08-01
Full Text Available Despite many advances, the molecular links between energy metabolism and longevity are not well understood. Here, we have used the nematode model Caenorhabditis elegans to study the role of the yet-uncharacterized gene R148.3 in fat accumulation and lifespan. In wild-type worms, a R148.3p::GFP reporter showed enhanced expression throughout life in the pharynx, in neurons, and in muscles. Functionally, a protein fusing a predicted 22 amino acid N-terminal signal sequence (SS of R148.3 to mCherry displayed robust accumulation in coelomyocytes, indicating that R148.3 is a secreted protein. Systematic depletion of R148.3 by RNA interference (RNAi at L1 but not at young-adult stage enhanced triglyceride accumulation, which was associated with increased food uptake and lower expression of genes involved in lipid oxidation. However, RNAi of R148.3 at both L1 and young-adult stages robustly diminished mean and maximal lifespan of wild-type worms, and also abolished the long-lived phenotypes of eat-2 and daf-2/InsR mutants. Based on these data, we propose that R148.3 is an SS that modulates fat mass and longevity in an independent manner.
The R148.3 Gene Modulates Caenorhabditis elegans Lifespan and Fat Metabolism.
Roy-Bellavance, Catherine; Grants, Jennifer M; Miard, Stéphanie; Lee, Kayoung; Rondeau, Évelyne; Guillemette, Chantal; Simard, Martin J; Taubert, Stefan; Picard, Frédéric
2017-08-07
Despite many advances, the molecular links between energy metabolism and longevity are not well understood. Here, we have used the nematode model Caenorhabditis elegans to study the role of the yet-uncharacterized gene R148.3 in fat accumulation and lifespan. In wild-type worms, a R148.3p::GFP reporter showed enhanced expression throughout life in the pharynx, in neurons, and in muscles. Functionally, a protein fusing a predicted 22 amino acid N-terminal signal sequence (SS) of R148.3 to mCherry displayed robust accumulation in coelomyocytes, indicating that R148.3 is a secreted protein. Systematic depletion of R148.3 by RNA interference (RNAi) at L1 but not at young-adult stage enhanced triglyceride accumulation, which was associated with increased food uptake and lower expression of genes involved in lipid oxidation. However, RNAi of R148.3 at both L1 and young-adult stages robustly diminished mean and maximal lifespan of wild-type worms, and also abolished the long-lived phenotypes of eat-2 and daf-2/InsR mutants. Based on these data, we propose that R148.3 is an SS that modulates fat mass and longevity in an independent manner. Copyright © 2017 Roy-Bellavance et al.
Souza, E R; Mazali, I O; Sigoli, F A
2014-01-01
This work reports on the synthesis, crystallographic determination and spectroscopic characterization of gadolinium(III), terbium(III) and europium(III) 3-mercaptopropionate complexes, aqua-tris(3-mercaptopropionate)lanthanide(III)--[Ln(mpa)3(H2O)]. The Judd-Ofelt intensity parameters were experimentally determined from emission spectrum of the [Eu(mpa)3(H2O)]complex and they were also calculated from crystallographic data. The complexes are coordination polymers, where the units of each complex are linked together by carboxylate groups leading to an unidimensional and parallel chains that by chemical interactions form a tridimensional framework. The emission spectrum profile of the [Eu(mpa)3(H2O)] complex is discussed based on point symmetry of the europium(III) ion, that explains the bands splitting observed in its emission spectrum. Photoluminescent analysis of the [Gd(mpa)3(H2O)] complex show no efficient ligand excitation but an intense charge transfer band. The excitation spectra of the [Eu(mpa)3(H2O)] and [Tb(mpa)3(H2O)] complexes do not show evidence of energy transfer from the ligand to the excited levels of these trivalent ions. Therefore the emission bands are originated only by direct f-f intraconfigurational excitation of the lantanide(III) ions.
Energy Technology Data Exchange (ETDEWEB)
Jia Zhen [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Department of Chemistry, Dezhou University, Dezhou 253023 (China); Yang Jinghe [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)]. E-mail: yjh@sdu.edu.cn; Wu Xia [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Wang Fei [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Guo Changying [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Liu Shufang [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)
2006-12-15
It is found that in hexamethylene tetramine (HMTA)-HCl buffer of pH=8.00, proteins can enhance the fluorescence of terbium (III) (Tb{sup 3+})-2-thenoyltrifluoroacetone (TTA)-sodium dodecyl benzene sulfonate (SDBS) system. Based on this, a sensitive method for the determination of proteins is proposed. The experiments indicate that under the optimum conditions, the enhanced fluorescence intensity is in proportion to the concentration of proteins in the range of 4.0x10{sup -9}-7.5x10{sup -6}g/mL for bovine serum albumin (BSA), 5.0x10{sup -9}-1.5x10{sup -5}g/mL for human serum albumin (HSA), 1.0x10{sup -8}-7.5x10{sup -6}g/mL for egg albumin (EA). Their detection limits (S/N=3) are 0.5, 0.8 and 2.0ng/mL, respectively. The interaction mechanism is also studied.
Directory of Open Access Journals (Sweden)
Niko Hildebrandt
2011-10-01
Full Text Available Förster resonance energy transfer (FRET from luminescent terbium complexes (LTC as donors to semiconductor quantum dots (QDs as acceptors allows extraordinary large FRET efficiencies due to the long Förster distances afforded. Moreover, time-gated detection permits an efficient suppression of autofluorescent background leading to sub-picomolar detection limits even within multiplexed detection formats. These characteristics make FRET-systems with LTC and QDs excellent candidates for clinical diagnostics. So far, such proofs of principle for highly sensitive multiplexed biosensing have only been performed under optimized buffer conditions and interactions between real-life clinical media such as human serum or plasma and LTC-QD-FRET-systems have not yet been taken into account. Here we present an extensive spectroscopic analysis of absorption, excitation and emission spectra along with the luminescence decay times of both the single components as well as the assembled FRET-systems in TRIS-buffer, TRIS-buffer with 2% bovine serum albumin, and fresh human plasma. Moreover, we evaluated homogeneous LTC-QD FRET assays in QD conjugates assembled with either the well-known, specific biotin-streptavidin biological interaction or, alternatively, the metal-affinity coordination of histidine to zinc. In the case of conjugates assembled with biotin-streptavidin no significant interference with the optical and binding properties occurs whereas the histidine-zinc system appears to be affected by human plasma.
Energy Technology Data Exchange (ETDEWEB)
Liang, Jinfu, E-mail: liang.shi2007@163.com [School of Physics and Electronic Science, Guizhou Normal University, Guiyang 550001 (China); Chen, Weizhong, E-mail: wzchen@nju.edu.cn [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China); Wang, Xun; Yang, Jing; Chen, Zhan [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China)
2016-12-16
Highlights: • Time-resolved spectra of SBSL were obtained for Tb{sup 3+} ions emission lines. • Mass exchange between inside and outside of SL bubble was probed via Tb{sup 3+} ions lines. • The argon rectification hypothesis was tested by time-resolved spectra of SBSL. • The rate of mass exchange inside an SBSL bubble increases with increasing sound pressure. - Abstract: Spectra of single-bubble sonoluminescence (SBSL) were obtained for Tb{sup 3+} ions emission lines from bubbles in an aqueous solution of terbium chloride (TbCl{sub 3}). The spectra provide experimental evidence to prove that an air bubble driven by strong ultrasound will not eventually become a rectified pure argon bubble, which is not as predicted by the argon rectification hypothesis. The time-resolved spectra of SBSL show a mass exchange of material such as Tb{sup 3+} ions between the inside and outside of the bubble. With increasing sound pressure, the rate of mass exchange and the SBSL intensity increases.
Directory of Open Access Journals (Sweden)
Peter Robaschik
2014-11-01
Full Text Available The optical and electrical properties of terbium(III bis(phthalocyanine (TbPc2 films on cobalt substrates were studied using variable angle spectroscopic ellipsometry (VASE and current sensing atomic force microscopy (cs-AFM. Thin films of TbPc2 with a thickness between 18 nm and 87 nm were prepared by organic molecular beam deposition onto a cobalt layer grown by electron beam evaporation. The molecular orientation of the molecules on the metallic film was estimated from the analysis of the spectroscopic ellipsometry data. A detailed analysis of the AFM topography shows that the TbPc2 films consist of islands which increase in size with the thickness of the organic film. Furthermore, the cs-AFM technique allows local variations of the organic film topography to be correlated with electrical transport properties. Local current mapping as well as local I–V spectroscopy shows that despite the granular structure of the films, the electrical transport is uniform through the organic films on the microscale. The AFM-based electrical measurements allow the local charge carrier mobility of the TbPc2 thin films to be quantified with nanoscale resolution.
Senthil Kumar, Kuppusamy; Schäfer, Bernhard; Lebedkin, Sergei; Karmazin, Lydia; Kappes, Manfred M; Ruben, Mario
2015-09-21
We report on the synthesis of tridentate-nitrogen pyrazole-pyridine-tetrazole (L(1)H) and pyrazole-pyridine-triazole (L(2)H) ligands and their complexation with lanthanides (Ln = Gd(iii), Eu(iii) and Tb(iii)) resulting in stable, charge-neutral complexes Ln(L(1))3 and Ln(L(2))3, respectively. X-ray crystallographic analysis of the complexes with L(1) ligands revealed tricapped trigonal coordination geometry around the lanthanide ions. All complexes show bright photoluminescence (PL) in the solid state, indicating efficient sensitization of the lanthanide emission via the triplet states of the ligands. In particular, the terbium complexes show high PL quantum yields of 65 and 59% for L(1) and L(2), respectively. Lower PL efficiencies of the europium complexes (7.5 and 9%, respectively) are attributed to large energy gaps between the triplet states of the ligands and accepting levels of Eu(iii). The triplet state energy can be reduced by introducing an electron withdrawing (EW) group at the 4 position of the pyridine ring. Such substitution of L(1)H with a carboxylic ester (COOMe) EW group leads to a europium complex with increased PL quantum yield of 31%. A comparatively efficient PL of the complexes dissolved in ethanol indicates that the lanthanide ions are shielded against nonradiative deactivation via solvent molecules.
Kaur, Kuldeep; Saini, Shivender Singh; Malik, Ashok Kumar; Singh, Baldev
2012-10-01
An efficient molecularly imprinted solid phase extraction (MISPE)-spectrofluorimetric method was developed to sensitively determine danofloxacin (DAN) in milk samples. Solid phase extraction procedure using MISPE cartridges was first performed on milk samples and then spectrofluorimetric determination was done at 546 nm using an excitation wavelength of 285 nm in presence of terbium and sodium dodecyl benzene sulfonate (SDBS). It was found that SDBS significantly enhanced the fluorescence intensity of the DAN-Tb3+ complex. Various factors affecting the fluorescence intensity of DAN-Tb3+-SDBS system were studied and conditions were optimized. The enhanced fluorescence intensity of the system (ΔF) showed a good linear relationship with the concentration of DAN over the range of 8.4 × 10-9-3.4 × 10-7 mol L-1 with a correlation coefficient of 0.9996. The detection limit was determined as 2.0 × 10-9 mol L-1 and the limit of quantification was determined as 6.5 × 10-9 mol L-1. The MISPE-spectrofluorimetric procedure was successfully applied to the determination of DAN in milk samples. The method is simple, rapid, sensitive and allows interference free determination of DAN in complex fluorescent matrices like milk. The method can be used to determine whether the DAN residues in milk exceed MRLs or not.
Study of quantum dot based on tin/yttrium mixed oxide doped with terbium to be used as biomarker
Energy Technology Data Exchange (ETDEWEB)
Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b, E-mail: claudiakodaira@yahoo.co [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f; Nunes, Luiz Antonio O., E-mail: luizant@ifsc.usp.b [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica. Dept. de Fisica e Informatica
2009-07-01
Quantum dots (semiconductors nanocrystals) have brought a promising field to develop a new generation of luminescent biomarkers. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. These luminescent dots are functionalized with biomolecules. For the luminophore particle to be connect with biologicals molecules (for example covalent antibody) is necessary a previous chemical treatment to modify luminophore particle surface and this process is called functionalization. A prior chemical treatment with changes on the surface luminophore particle is necessary to couple the luminophore to biological molecules. This process can be used as coating which can protect these particles from being dissolved by acid as well as provide functional groups for biological conjugation. This work presents a photoluminescence study of nanoparticles based on tin/yttrium mixed oxides doped with terbium (SnO{sub 2}/Y{sub 2}O{sub 3}:Tb{sup 3+}), synthesized by coprecipitation method. The nanoparticles were submitted to thermal treatment and characterized by X-Ray Powder Diffraction (XRD) that showed cassiterite phase formation and the influence of thermal treatment on nanoparticles structures. These nanoparticles going to be functionalized with a natural polysaccharide (chitosan) in order to form microspheres. These microspheres going to be irradiated with gamma radiation to sterilization and it can be evaluated if the nanoparticles are resistant to irradiation and they do not lose functionality with this process. (author)
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Fishmeal or scrap, ground or pelletized; fishmeal or scrap, ground and pelletized (mixture). 148.04-9 Section 148.04-9 Shipping COAST GUARD, DEPARTMENT OF... Additional Requirements for Certain Material § 148.04-9 Fishmeal or scrap, ground or pelletized; fishmeal or...
33 CFR 148.246 - When is a document considered filed and where should I file it?
2010-07-01
... filed and where should I file it? 148.246 Section 148.246 Navigation and Navigable Waters COAST GUARD... Formal Hearings § 148.246 When is a document considered filed and where should I file it? (a) If a document to be filed is submitted by mail, it is considered filed on the date it is postmarked. If a...
MicroRNA-148b promotes proliferation of hair follicle cells by targeting NFAT5
Directory of Open Access Journals (Sweden)
Wanbao YANG,Qinqun LI,Bo SU,Mei YU
2016-03-01
Full Text Available MicroRNAs (miRNAs, small non-coding RNAs, are involved in many aspects of biological processes. Previous studies have indicated that miRNAs are important for hair follicle development and growth. In our study, we found by qRT-PCR that miR-148b was significantly upregulated in sheep wool follicle bulbs in anagen phase compared with the telogen phase of the hair follicle cycle. Overexpression of miR-148b promoted proliferation of both HHDPC and HHGMC. By using the TOPFlash system we demonstrated that miR-148b could activate Wnt/β-catenin pathway and b-catenin, cycD, c-jun and PPARD were consistently upregulated accordingly. Furthermore, transcript factor nuclear factor of activated T cells type 5 (NFAT5 and Wnt10b were predicted to be the target of miR-148b and this was substantiated using a Dual-Luciferase reporter system. Subsequently NFAT5 was further identified as the target of miR-148b using western blotting. These results were considered to indicate that miR-148b could activate the Wnt/β-catenin signal pathway by targeting NFAT5 to promote the proliferation of human hair follicle cells.
Lewis, E.; O'Keeffe, S.; Grattan, M.; Hounsell, A.; McCarthy, D.; Woulfe, P.; Cronin, J.; Mihai, L.; Sporea, D.; Santhanam, A.; Agazaryan, N.
2014-05-01
A PMMA based plastic optical fibre sensor for use in real time radiotherapy dosimetry is presented. The optical fibre tip is coated with a scintillation material, terbium-doped gadolinium oxysulfide (Gd2O2S:Tb), which fluoresces when exposed to ionising radiation (X-Ray). The emitted visible light signal penetrates the sensor optical fibre and propagates along the transmitting fibre at the end of which it is remotely monitored using a fluorescence spectrometer. The results demonstrate good repeatability, with a maximum percentage error of 0.5% and the response is independent of dose rate.
Sun, L; Jiang, S; Marciante, J R
2010-06-07
A compact all-fiber Faraday isolator and a Faraday mirror are demonstrated. At the core of each of these components is an all-fiber Faraday rotator made of a 4-cm-long, 65-wt%-terbium-doped silicate fiber. The effective Verdet constant of the terbium-doped fiber is measured to be -32 rad/(Tm), which is 27 x larger than that of silica fiber. This effective Verdet constant is the largest value measured to date in any fiber and is 83% of the Verdet constant of commercially available crystal used in bulk optics-based isolators. Combining the all-fiber Faraday rotator with fiber polarizers results in a fully fusion spliced all-fiber isolator whose isolation is measured to be 19 dB. Combining the all-fiber Faraday rotator with a fiber Bragg grating results in an all-fiber Faraday mirror that rotates the polarization state of the reflected light by 88 +/- 4 degrees .
Welch, Jan M; Müller, Danny; Knoll, Christian; Wilkovitsch, Martin; Giester, Gerald; Ofner, Johannes; Lendl, Bernhard; Weinberger, Peter; Steinhauser, Georg
2017-10-16
The crystallization of terbium 5,5'-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H 2 O) 7 ZT] 2 ZT⋅10 H 2 O is isostructural to light lanthanide (Ce-Gd) 5,5'-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5'-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H 2 O) 8 ] 2 ZT 3 ⋅6 H 2 O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10 8 -fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microcopy. In addition, the inclusion properties of terbium 5,5'-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
The Atacama Cosmology Telescope: Extragalactic Sources at 148 GHz in the 2008 Survey
Marriage, T. A.; Juin, J. B.; Lin, Y. T.; Marsden, D.; Nolta, M. R.; Partridge, B.; Ade, P. A. R.; Aguirre, P.; Amiri, M.; Appel, J. W.;
2011-01-01
We report on extragalactic sources detected in a 455 square-degree map of the southern sky made with data at a frequency of 148 GHz from the Atacama Cosmology Telescope 2008 observing season. We provide a catalog of 157 sources with flux densities spanning two orders of magnitude: from 15 mJy to 1500 mJy. Comparison to other catalogs shows that 98% of the ACT detections correspond to sources detected at lower radio frequencies. Three of the sources appear to be associated with the brightest cluster galaxies of low redshift X-ray selected galaxy clusters. Estimates of the radio to mm-wave spectral indices and differential counts of the sources further bolster the hypothesis that they are nearly all radio sources, and that their emission is not dominated by re-emission from warm dust. In a bright (> 50 mJy) 148 GHz-selected sample with complete cross-identifications from the Australia Telescope 20 GHz survey, we observe an average steepening of the spectra between .5, 20, and 148 GHz with median spectral indices of alp[ha (sub 5-20) = -0.07 +/- 0.06, alpha (sub 20-148) -0.39 +/- 0.04, and alpha (sub 5-148) = -0.20 +/- 0.03. When the measured spectral indices are taken into account, the 148 GHz differential source counts are consistent with previous measurements at 30 GHz in the context of a source count model dominated by radio sources. Extrapolating with an appropriately rescaled model for the radio source counts, the Poisson contribution to the spatial power spectrum from synchrotron-dominated sources with flux density less than 20 mJy is C(sup Sync) = (2.8 +/- 0.3) x 1O (exp-6) micro K(exp 2).
19 CFR 148.55 - Exemption for articles bearing American trademark.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Exemption for articles bearing American trademark... § 148.55 Exemption for articles bearing American trademark. (a) Application of exemption. An exemption... 42 of the Act of July 5, 1946 (60 Stat. 440; 15 U.S.C. 1124), because the trademark has been...
26 CFR 1.148-9 - Arbitrage rules for refunding issues.
2010-04-01
... TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.148... construed and is available only if it does not result in a greater burden on the market for tax-exempt bonds... allocations of proceeds, bonds, and investments to determine transferred proceeds, temporary periods...
21 CFR 146.148 - Reduced acid frozen concentrated orange juice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Reduced acid frozen concentrated orange juice. 146... Canned Fruit Juices and Beverages § 146.148 Reduced acid frozen concentrated orange juice. (a) Reduced acid frozen concentrated orange juice is the food that complies with the requirements for composition...
29 CFR 784.148 - General scope of processing, freezing, and curing activities.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false General scope of processing, freezing, and curing... Exemptions Provisions Relating to Fishing and Aquatic Products Processing, Freezing, and Curing § 784.148 General scope of processing, freezing, and curing activities. Processing, freezing, and curing embrace a...
19 CFR 148.3 - Customs treatment after transiting the Panama Canal.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Customs treatment after transiting the Panama... § 148.3 Customs treatment after transiting the Panama Canal. Passengers' baggage and effects and... Panama Canal are subject to Customs examination and treatment in the same manner as arrivals from any...
19 CFR 148.32 - Vehicles, aircraft, boats, teams and saddle horses taken abroad.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Vehicles, aircraft, boats, teams and saddle horses... for Returning Residents § 148.32 Vehicles, aircraft, boats, teams and saddle horses taken abroad. (a) Admission free of duty. Automobiles and other vehicles, aircraft, boats, teams and saddle horses, together...
26 CFR 1.148-10 - Anti-abuse rules and authority of Commissioner.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Anti-abuse rules and authority of Commissioner... Bonds § 1.148-10 Anti-abuse rules and authority of Commissioner. (a) Abusive arbitrage device—(1) In.... (c) Anti-abuse rules on excess gross proceeds of advance refunding issues—(1) In general. Except as...
33 CFR 148.305 - What is included in a deepwater port license?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What is included in a deepwater... HOMELAND SECURITY (CONTINUED) DEEPWATER PORTS DEEPWATER PORTS: GENERAL Licenses § 148.305 What is included in a deepwater port license? A deepwater port license contains information about the licensee and the...
7 CFR 457.148 - Fresh market pepper crop insurance provisions.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Fresh market pepper crop insurance provisions. 457.148... pepper crop insurance provisions. The fresh market pepper crop insurance provisions for the 1999 and... Fresh Market Pepper Crop Provisions If a conflict exists among the policy provisions, the order of...
34 CFR 300.148 - Placement of children by parents when FAPE is at issue.
2010-07-01
... Their Parents in Private Schools When Fape Is at Issue § 300.148 Placement of children by parents when.... Disagreements between the parents and a public agency regarding the availability of a program appropriate for... §§ 300.504 through 300.520. (c) Reimbursement for private school placement. If the parents of a child...
(148C/T), hyperfibrinogenemia and ischemic stroke in young adult
African Journals Online (AJOL)
Association of β-fibrinogen promoter gene polymorphism (148C/T), hyperfibrinogenemia and ischemic stroke in young adult patients. ... Physical and neurological examinations, brain computed tomography, plasma fibrinogen levels and blood biochemistry tests were assessed within seven days after the onset of symptoms.
19 CFR 148.89 - Property of public international organizations and foreign governments.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Property of public international organizations and... Personnel of Foreign Governments and International Organizations and Special Treatment for Returning Individuals § 148.89 Property of public international organizations and foreign governments. (a) Exemption...
Gregório, Thaiane; Giese, Siddhartha O K; Nunes, Giovana G; Soares, Jaísa F; Hughes, David L
2017-02-01
Two new mononuclear cationic complexes in which the TbIII ion is bis-chelated by the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane (H3LEt, C6H14O3) were prepared from Tb(NO3)3·5H2O and had their crystal and mol-ecular structures solved by single-crystal X-ray diffraction analysis after data collection at 100 K. Both products were isolated in reasonable yields from the same reaction mixture by using different crystallization conditions. The higher-symmetry complex dinitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) nitrate di-meth-oxy-ethane hemisolvate, [Tb(NO3)2(H3LEt)2]NO3·0.5C4H10O2, 1, in which the lanthanide ion is 10-coordinate and adopts an s-bicapped square-anti-prismatic coordination geometry, contains two bidentate nitrate ions bound to the metal atom; another nitrate ion functions as a counter-ion and a half-mol-ecule of di-meth-oxy-ethane (completed by a crystallographic twofold rotation axis) is also present. In product aqua-nitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) dinitrate, [Tb(NO3)(H3LEt)2(H2O)](NO3)2, 2, one bidentate nitrate ion and one water mol-ecule are bound to the nine-coordinate terbium(III) centre, while two free nitrate ions contribute to charge balance outside the tricapped trigonal-prismatic coordination polyhedron. No free water mol-ecule was found in either of the crystal structures and, only in the case of 1, di-meth-oxy-ethane acts as a crystallizing solvent. In both mol-ecular structures, the two tripodal ligands are bent to one side of the coordination sphere, leaving room for the anionic and water ligands. In complex 2, the methyl group of one of the H3LEt ligands is disordered over two alternative orientations. Strong hydrogen bonds, both intra- and inter-molecular, are found in the crystal structures due to the number of different donor and acceptor groups present.
Directory of Open Access Journals (Sweden)
Egor A Shitikov
Full Text Available The Mycobacterium tuberculosis (MTB Beijing family isolates are geographically widespread, and there are examples of Beijing isolates that are hypervirulent and associated with drug resistance. One-fourth of Beijing genotype isolates found in Russia belong to the B0/W148 group. The aim of the present study was to investigate features of these endemic strains on a genomic level. Four Russian clinical isolates of this group were sequenced, and the data obtained was compared with published sequences of various MTB strain genomes, including genome of strain W-148 of the same B0/W148 group. The comparison of the W-148 and H37Rv genomes revealed two independent inversions of large segments of the chromosome. The same inversions were found in one of the studied strains after deep sequencing using both the fragment and mate-paired libraries. Additionally, inversions were confirmed by RFLP hybridization analysis. The discovered rearrangements were verified by PCR in all four newly sequenced strains in the study and in four additional strains of the same Beijing B0/W148 group. The other 32 MTB strains from different phylogenetic lineages were tested and revealed no inversions. We suggest that the initial largest inversion changed the orientation of the three megabase (Mb segment of the chromosome, and the second one occurred in the previously inverted region and partly restored the orientation of the 2.1 Mb inner segment of the region. This is another remarkable example of genomic rearrangements in the MTB in addition to the recently published of large-scale duplications. The described cases suggest that large-scale genomic rearrangements in the currently circulating MTB isolates may occur more frequently than previously considered, and we hope that further studies will help to determine the exact mechanism of such events.
Shitikov, Egor A; Bespyatykh, Julia A; Ischenko, Dmitry S; Alexeev, Dmitry G; Karpova, Irina Y; Kostryukova, Elena S; Isaeva, Yulia D; Nosova, Elena Y; Mokrousov, Igor V; Vyazovaya, Anna A; Narvskaya, Olga V; Vishnevsky, Boris I; Otten, Tatiana F; Zhuravlev, Viacheslav Iu; Zhuravlev, Valery Y; Yablonsky, Peter K; Ilina, Elena N; Govorun, Vadim M
2014-01-01
The Mycobacterium tuberculosis (MTB) Beijing family isolates are geographically widespread, and there are examples of Beijing isolates that are hypervirulent and associated with drug resistance. One-fourth of Beijing genotype isolates found in Russia belong to the B0/W148 group. The aim of the present study was to investigate features of these endemic strains on a genomic level. Four Russian clinical isolates of this group were sequenced, and the data obtained was compared with published sequences of various MTB strain genomes, including genome of strain W-148 of the same B0/W148 group. The comparison of the W-148 and H37Rv genomes revealed two independent inversions of large segments of the chromosome. The same inversions were found in one of the studied strains after deep sequencing using both the fragment and mate-paired libraries. Additionally, inversions were confirmed by RFLP hybridization analysis. The discovered rearrangements were verified by PCR in all four newly sequenced strains in the study and in four additional strains of the same Beijing B0/W148 group. The other 32 MTB strains from different phylogenetic lineages were tested and revealed no inversions. We suggest that the initial largest inversion changed the orientation of the three megabase (Mb) segment of the chromosome, and the second one occurred in the previously inverted region and partly restored the orientation of the 2.1 Mb inner segment of the region. This is another remarkable example of genomic rearrangements in the MTB in addition to the recently published of large-scale duplications. The described cases suggest that large-scale genomic rearrangements in the currently circulating MTB isolates may occur more frequently than previously considered, and we hope that further studies will help to determine the exact mechanism of such events.
Directory of Open Access Journals (Sweden)
Mohammad Hossein Arbab Zavar
2016-11-01
Full Text Available Polypyrrole modified electrode prepared by electropolymerization of pyrrole in the presence of a complexing ligand, dibenzo-18-crown-6(DB18C6, was prepared and investigated as a Tb3+-selective electrode in acetonitrile. The potentiometric response of the electrode was linear within the Tb3+ concentration range 1 × 10−5–1 × 10−2 M with a Nernstian slope of 20.9 mVdecade−1 in AN. The electrode was applied to study the complexation of the terbium(III ion in acetonitrile with such other basic aprotic solvent molecules (D as dimethyl sulfoxide, N,N-dimethyl formamide, propylene carbonate and pyridine. The successive complex formation constant (βi and Gibbs energies of transfer (ΔGtr of Tb3+ in AN in relation to such D were obtained.
Directory of Open Access Journals (Sweden)
Belén Fernández
2016-02-01
Full Text Available We report the in situ formation of two novel metal-organic frameworks based on terbium and dysprosium ions using azobenzene-4,4′-dicarboxylic acid (H2abd as ligand, synthesized by soft hydrothermal routes. Both materials show isostructural three-dimensional networks with channels along a axis and display intense photoluminescence properties in the solid state at room temperature. Textural properties of the metal-organic frameworks (MOFs have been fully characterized although no appreciable porosity was obtained. Magnetic properties of these materials were studied, highlighting the dysprosium material displays slightly frequency-dependent out of phase signals when measured under zero external field and under an applied field of 1000 Oe.
2010-04-01
... United Nations and the Organization of American States. 148.88 Section 148.88 Customs Duties U.S. CUSTOMS... members of the staff of the United Nations and the Organization of American States, and their personal... United Nations member nation as the principal resident representative to the United Nations of such...
43 CFR 30.148 - Will interest or penalties charged after the date of death be paid?
2010-10-01
... date of death be paid? Interest or penalties charged against claims after the date of death will not be... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Will interest or penalties charged after the date of death be paid? 30.148 Section 30.148 Public Lands: Interior Office of the Secretary of the...
33 CFR 148.240 - How does a State or a person intervene in a formal hearing?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How does a State or a person intervene in a formal hearing? 148.240 Section 148.240 Navigation and Navigable Waters COAST GUARD... issues; and (3) Designate the name and address of a person who can be served if the petition is granted...
2010-04-01
... foreign governments and public international organizations. 148.86 Section 148.86 Customs Duties U.S... foreign governments and public international organizations. Office supplies and equipment and other..., and other representatives of foreign governments or of personnel of public international organizations...
GPER mediated estradiol reduces miR-148a to promote HLA-G expression in breast cancer
Energy Technology Data Exchange (ETDEWEB)
Tao, Sifeng, E-mail: taosifeng@aliyun.com; He, Haifei; Chen, Qiang; Yue, Wenjie
2014-08-15
Highlights: • E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells. • GPER mediates the E2-induced increase of miR-148a in MCF-7 and MDA-MB-231 cells. • E2-GPER regulates the expression of HLA-G by miR-148a. - Abstract: Breast cancer is the most common malignant diseases in women. miR-148a plays an important role in regulation of cancer cell proliferation and cancer invasion and down-regulation of miR-148a has been reported in both estrogen receptor (ER) positive and triple-negative (TN) breast cancer. However, the regulation mechanism of miR-148a is unclear. The role of estrogen signaling, a signaling pathway is important in development and progression of breast cancer. Therefore, we speculated that E2 may regulate miR-148a through G-protein-coupled estrogen receptor-1 (GPER). To test our hypothesis, we checked the effects of E2 on miR-148a expression in ER positive breast cancer cell MCF-7 and TN cancer cell MDA-MB-231. Then we used GPER inhibitor G15 to investigate whether GPER is involved in regulation of E2 on miR-148a. Furthermore, we analyzed whether E2 affects the expression of HLA-G, which is a miR-148a target gene through GPER. The results showed that E2 induces the level of miR-148a in MCF-7 and MDA-MB-231 cells, GPER mediates the E2-induced increase in miR-148a expression in MCF-7 and MDA-MB-231 cells and E2-GPER regulates the expression of HLA-G by miR-148a. In conclusion, our findings offer important new insights into the ability of estrogenic GPER signaling to trigger HLA-G expression through inhibiting miR-148a that supports immune evasion in breast cancer.
Study of the radiative strength function in /sup 148,150/Sm
Energy Technology Data Exchange (ETDEWEB)
Becvar, F.; Montero-Cabrera, M.E.; Rigol, J.; Telezhnikov, S.A.; Hiep, H.T.
1987-07-01
The spectra of ..gamma.. rays accompanying neutron capture by the nuclei /sup 147//sup ,//sup 149/Sm is isolated resonances have been measured by the time-of-flight method in the IBR-30 reactor. Absolute intensities have been obtained for a number of transitions. From a combination of the results of the present work and published data we have determined the radiative strength function of the nuclei /sup 148/Sm and /sup 150/Sm for E1 transitions in the ..gamma..-ray energy region 5--7.5 MeV. The values obtained are 2.8 and 1.7 times smaller than the respective values expected from extrapolation of the Lorentz curves of the giant electric dipole resonance. An analysis of the behavior of the radiative strength function of nuclei with A = 148--157 is carried out.
Fast neutron scattering on Gallium target at 14.8 MeV
Han, R; Chen, Z; Nie, Y; Liu, X; Zhang, S; Ren, P; Jia, B; Tian, G; Luo, F; Lin, W; Liu, J; Shi, F; Huang, M; Ruan, X; Ren, J; Zhou, Z; Huang, H; Bao, J; Zhang, K; Hu, B
2014-01-01
Benchmarking of evaluated nuclear data libraries was performed for $\\sim 14.8$ MeV neutrons on Gallium targets. The experiments were performed at China Institute of Atomic Energy(CIAE). Solid samples of natural Gallium (3.2 cm and 6.4 cm thick) were bombarded by $\\sim 14.8$ MeV neutrons and leakage neutron energy spectra were measured at 60$^{\\circ}$ and 120$^{\\circ}$. The measured spectra are rather well reproduced by MCNP-4C simulations with the CENDL-3.1, ENDF/B-VII and JENDL-4.0 evaluated nuclear data libraries, except for the inelastic contributions around $E_{n} = 10-13$ MeV. All three libraries significantly underestimate the inelastic contributions. The inelastic contributions are further studied, using the Talys simulation code and the experimental spectra are reproduced reasonably well in the whole energy range by the Talys calculation, including the inelastic contributions.
Dasari, Srikanth; Patra, Ashis K
2015-12-14
The europium(III) and terbium(III) complexes, namely [Eu(dpq)(DMF)2(NO3)3] (1), [Eu(dppz)2(NO3)3] (2), [Tb(dpq)(DMF)2Cl3] (3), and [Tb(dppz)(DMF)2Cl3] (4), where dipyrido[3,2-d:2',3'-f]quinoxaline (dpq in 1 and 3), dipyrido[3,2-a:2',3'-c]phenazine (dppz in 2 and 4) and N,N'-dimethylformamide (DMF) have been isolated, characterized from their physicochemical data, luminescence studies and their interaction with DNA, serum albumin protein and photo-induced DNA cleavage activity are studied. The X-ray crystal structures of complexes 1-4 show discrete mononuclear Ln(3+)-based structures. The Eu(3+) in [Eu(dpq)(DMF)2(NO3)3] (1) and [Eu(dppz)2(NO3)3] (2) as [Eu(dppz)2(NO3)3]·dppz (2a) adopts a ten-coordinated bicapped dodecahedron structure with a bidentate N,N-donor dpq ligand, two DMF and three NO3(-) anions in 1 and two bidentate N,N-donor dppz ligands and three NO3(-) anions in 2. Complexes 3 and 4 show a seven-coordinated mono-capped octahedron structure where Tb(3+) contains bidentate dpq/dppz ligands, two DMF and three Cl(-) anions. The complexes are highly luminescent in nature indicating efficient photo-excited energy transfer from the dpq/dppz antenna to Ln(3+) to generate long-lived emissive excited states for characteristic f → f transitions. The time-resolved luminescence spectra of complexes 1-4 show typical narrow emission bands attributed to the (5)D0 → (7)F(J) and (5)D4 → (7)F(J) f-f transitions of Eu(3+) and Tb(3+) ions respectively. The number of inner-sphere water molecules (q) was determined from luminescence lifetime measurements in H2O and D2O confirming ligand-exchange reactions with water in solution. The complexes display significant binding propensity to the CT-DNA giving binding constant values in the range of 1.0 × 10(4)-6.1 × 10(4) M(-1) in the order 2, 4 (dppz) > 1, 3 (dpq). DNA binding data suggest DNA groove binding with the partial intercalation nature of the complexes. All the complexes also show binding propensity (K(BSA)
Octupole correlations in the odd-[ital Z] nuclei [sup 148-151]Eu
Energy Technology Data Exchange (ETDEWEB)
Jongman, J.R.; Bacelar, J.C.S.; Urban, W.; Noorman, R.F.; van Pol, J.; Steenbergen, T.; de Voigt, M.J.A. (Kernfysisch Versneller Instituut, 9747 AA Groningen (Netherlands)); Nyberg, J.; Sletten, G. (Neils Bohr Institute, Riso, 4000 Roskilde (Denmark)); Dionisio, J.; Vieu, C. (Centre de Spectrometrie Nucleaire et Spectrometrie de Masse, 91405 Orsay (France))
1994-12-01
The effects of octupole correlations in the [ital Z]=63 nuclei [sup 148[minus]151]Eu are studied. The persistency of octupole instability through the transitional region of near-spherical ([ital N][le]85) towards prolate nuclei ([ital N][ge]88) is established and discussed. Intrinsic dipole moments, which are experimentally inferred from the measured electric dipole transition rates observed between parity doublets, are used to characterize the strength of the octupole correlations.
Sequences of digestible lysine for gilts from 60 to 148 days of age
Directory of Open Access Journals (Sweden)
Veredino Louzada da Silva Júnior
2015-01-01
Full Text Available The experiment was conducted to evaluate five nutritional plans based on sequences of standardized ileal digestible lysine: 0.90-0.80-0.70, 1.00-0.90-0.80, 1.10-1.00-0.90, 1.20-1.10-1.00, and 1.30-1.20-1.10% fed to gilts from 60 to 99, 129 to 100, and 130 to 148 days of age, respectively. Eighty commercial hybrid gilts, selected for lean gain, with initial weight of 23.46±0.27kg were allotted in a randomized block design, with five treatments, eight replicates, and two pigs per experimental unit. No effect (P>0.05 of the nutritional plans was verified on daily feed intake, daily weight gain and feed conversion. The nutritional plans had no influence (P>0.05 on any of the carcass traits evaluated (carcass yield, meat amount, and meat yield. The nutritional plan of 0.90-0.80-0.70% standardized ileal digestible lysine fed to gilts from 60 to 99, 100 to 129, and 130 to 148 days of age, respectively, meets the standardized ileal digestible lysine requirements of gilts from 60 to 148 days of age.
Sodium reduction during cardiopulmonary bypass: Plasma-Lyte 148 versus trial fluid as pump primes.
Morgan, Thomas J; Presneill, Jeffrey J; Davies, Paul G; Power, Gerald; Venkatesh, Balasubramanian
2015-12-01
We compared effects on plasma sodium concentrations plus calculated plasma tonicity of two "balanced" crystalloid solutions used as 2 L pump primes during cardiopulmonary bypass (CPB): Plasma-Lyte 148 (sodium concentration, 140 mmol/L; potassium concentration, 5 mmol/L) versus a bicarbonate-balanced fluid (sodium concentration, 140 mmol/L; potassium concentration, 0 mmol/L). We analysed pooled data from two prospective interventional studies performed in university-affiliated hospitals, from 50 patients undergoing elective cardiac surgery. Participants were allocated equally to Plasma-Lyte 148 or bicarbonate-balanced fluid, with plasma electrolytes measured by direct ion selective electrodes immediately before bypass (pre-CPB), within 3 minutes of commencement (T2), and before bypass cessation (end-CPB). Plasma sodium fell at T2 in 46 patients (92%) (Psodium decreased by 3.0 mmol/L (SD, 1.7 mmol/L), and with bicarbonate-balanced fluid it decreased by 2.2 mmol/L (SD, 1.1 mmol/L) (P=0.002). The mean tonicity fell by >5 mOsm/kg for both groups (Psodium for both groups remained reduced by >2 mmol/L (PsodiumSodium reductions were common with both priming solutions, but more severe with Plasma-Lyte 148. Crystalloid priming solutions require sodium concentrations>140mmol/L to ensure normonatraemia throughout CPB.
DEFF Research Database (Denmark)
Jensen, J.; Houmann, Jens Christian Gylden
1975-01-01
The selection rules for the linear couplings between magnons and phonons propagating in the c direction of a simple basal-plane hcp ferromagnet are determined by general symmetry considerations. The acoustic-optical magnon-phonon interactions observed in the heavy-rare-earth metals have been expl...... by Liu. The coupled magnon—transverse-phonon system for the c direction of Tb is analyzed in detail, and the strengths of the couplings are deduced as a function of wave vector by combining the experimental studies with the theory....
DEFF Research Database (Denmark)
Jensen, J.; Houmann, Jens Christian Gylden; Bjerrum Møller, Hans
1975-01-01
The energies of spin waves propagating in the c direction of Tb have been studied by inelastic neutron scattering, as a function of a magnetic field applied along the easy and hard directions in the basal plane, and as a function of temperature. From a general spin Hamiltonian, consistent...... with the symmetry, we deduce the dispersion relation for the spin waves in a basal-plane ferromagnet. This phenomenological spin-wave theory accounts for the observed behavior of the magnon energies in Tb. The two q⃗-dependent Bogoliubov components of the magnon energies are derived from the experimental results...
Zhang, Qiangqiang; Chen, Xuebo; Cui, Ganglong; Fang, Wei-Hai; Thiel, Walter
2014-08-11
Fluorescence emission of wild-type green fluorescent protein (GFP) is lost in the S65T mutant, but partly recovered in the S65T/H148D double mutant. These experimental findings are rationalized by a combined quantum mechanics/molecular mechanics (QM/MM) study at the QM(CASPT2//CASSCF)/AMBER level. A barrierless excited-state proton transfer, which is exclusively driven by the Asp148 residue introduced in the double mutant, is responsible for the ultrafast formation of the anionic fluorescent state, which can be deactivated through a concerted asynchronous hula-twist photoisomerization. This causes the lower fluorescence quantum yield in S65T/H148D compared to wild-type GFP. Hydrogen out-of-plane motion plays an important role in the deactivation of the S65T/H148D fluorescent state. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Association of APE1 Gene Asp148Glu Variant with Digestive Cancer: A Meta-Analysis.
Li, He; Zou, Jing; Mi, Jia; Wei, Xiaodan; Zhao, Dongmei; Zhang, Shuping; Tian, Geng
2015-08-21
Apurinic/apyrimidinic endonuclease-1 (APE1) is a rate-limiting enzyme in DNA base excision repair and has been implicated in carcinogenesis. In this study, we summarize available data to examine the susceptibility of APE1 gene Asp148Glu variant to digestive cancer via a meta-analysis. Study selection and data abstraction were conducted independently by 2 authors. Random-effects model was utilized to pool effect estimates. Heterogeneity and publication bias were addressed. Sixteen articles involving 4916 digestive cancer patients and 7748 controls were qualified for this meta-analysis. Overall association showed an indicative association between Asp148Glu variant and digestive cancer under allelic (odds ratio or OR=1.11; 95% confidence interval or CI: 0.99-1.25; P=0.074) and dominant (OR=1.18; 95% CI: 1.00-1.40; P=0.056) models, with strong evidence of heterogeneity. Deviation from Hardy-Weinberg equilibrium was an obvious source of heterogeneity. In subgroup analyses by cancer sites, this variant was significantly associated with the increased risk for hepatocellular cancer under allelic (OR=1.50; 95% CI: 1.25-1.80; P<0.001) and homozygous genotypic (OR=1.55; 95% CI: 1.02-2.29; P=0.028) models. There were low probabilities of publication bias for the above comparisons. The results of this meta-analysis collectively suggest that APE1 gene Asp148Glu variant is not a risk-conferring factor for digestive cancer. Further large and well-designed studies are required.
Analysis of road accidents on NH-1 between RD 98km to 148km
Goel, Gourav; Sachdeva, S.N.
2016-01-01
The present study deals with the characteristics and trend of road accidents on a selected stretch of NH-1 between RD 98 km and 148 km. Four year road accident data from 2007 to 2010 of 50 km long stretch was collected which includes the period when construction of 6-laning project started on NH-1. The paper also brings forth the result of widening project on road accidents. The data was analyzed to identify cause of accidents, nature of accidents and type of injury, type of vehicles involved...
Lobb, Eric C
2016-07-08
Version 6.3 of the RITG148+ software package offers eight automated analysis routines for quality assurance of the TomoTherapy platform. A performance evaluation of each routine was performed in order to compare RITG148+ results with traditionally accepted analysis techniques and verify that simulated changes in machine parameters are correctly identified by the software. Reference films were exposed according to AAPM TG-148 methodology for each routine and the RITG148+ results were compared with either alternative software analysis techniques or manual analysis techniques in order to assess baseline agreement. Changes in machine performance were simulated through translational and rotational adjustments to subsequently irradiated films, and these films were analyzed to verify that the applied changes were accurately detected by each of the RITG148+ routines. For the Hounsfield unit routine, an assessment of the "Frame Averaging" functionality and the effects of phantom roll on the routine results are presented. All RITG148+ routines reported acceptable baseline results consistent with alternative analysis techniques, with 9 of the 11 baseline test results showing agreement of 0.1mm/0.1° or better. Simulated changes were correctly identified by the RITG148+ routines within approximately 0.2 mm/0.2° with the exception of the Field Centervs. Jaw Setting routine, which was found to have limited accuracy in cases where field centers were not aligned for all jaw settings due to inaccurate autorotation of the film during analysis. The performance of the RITG148+ software package was found to be acceptable for introduction into our clinical environment as an automated alternative to traditional analysis techniques for routine TomoTherapy quality assurance testing.
miR-148a-3p Mediates Notch Signaling to Promote the Differentiation and M1 Activation of Macrophages
Directory of Open Access Journals (Sweden)
Fei Huang
2017-10-01
Full Text Available The Notch pathway plays critical roles in the differentiation and polarized activation of macrophages; however, the downstream molecular mechanisms underlying Notch activity in macrophages remain elusive. Our previous study has identified a group of microRNAs that mediate Notch signaling to regulate macrophage activation and tumor-associated macrophages (TAMs. In this study, we demonstrated that miR-148a-3p functions as a novel downstream molecule of Notch signaling to promote the differentiation of monocytes into macrophages in the presence of granulocyte macrophage colony-stimulating factor (GM-CSF. Meanwhile, miR-148a-3p promoted M1 and inhibited M2 polarization of macrophages upon Notch activation. Macrophages overexpressing miR-148a-3p exhibited enhanced ability to engulf and kill bacteria, which was mediated by excessive production of reactive oxygen species (ROS. Further studies using reporter assay and Western blotting identified Pten as a direct target gene of miR-148a-3p in macrophages. Macrophages overexpressing miR-148a-3p increased their ROS production through the PTEN/AKT pathway, likely to defend against bacterial invasion. Moreover, miR-148a-3p also enhanced M1 macrophage polarization and pro-inflammatory responses through PTEN/AKT-mediated upregulation of NF-κB signaling. In summary, our data establish a novel molecular mechanism by which Notch signaling promotes monocyte differentiation and M1 macrophage activation through miR-148a-3p, and suggest that miR-148a-3p-modified monocytes or macrophages are potential new tools for the treatment of inflammation-related diseases.
MicroRNA-148a Suppresses Invasion and Metastasis of Human Non-Small-Cell Lung Cancer
Directory of Open Access Journals (Sweden)
Jing Li
2015-11-01
Full Text Available Background/Aims: microRNAs (miRNAs are noncoding RNAs that regulate multiple targets through either the degradation of mRNAs or the inhibition of protein translation, thereby altering several functions simultaneously. Growing evidence indicates that miRNAs are involved in carcinogenesis and tumor progression in non-small-cell lung cancer (NSCLC. Methods: In this study, the mRNA expression levels of miR-148a were examined in NSCLC cell lines and patient specimens using quantitative reverse transcription-PCR. The functions of miR-148a in migration/invasion and lung metastasis formation were determined by using transwell and tail vein injection assays, respectively. Results: We demonstrated that miR-148a was down-regulated in NSCLC metastatic samples, and its expression was suppressed in NSCLC compared with the corresponding nonmalignant lung tissues. Clinical analysis indicated that miR-148a expression was lower in NSCLC patients compared with nonmalignant lung tissues . Decreased miR-148a was significantly associated with tumor node metastasis stage and lymph node metastasis. Furthermore, functional assays showed that miR-148a expression suppressed NSCLC cell invasive and migratory abilities in vitro and suppressed cancer metastasis in vivo, while inhibition of miR-148a enhanced NSCLC cell invasion and lung metastasis formation in a mouse model. Conclusions: Evidence from this study demonstrated that miR-148a exerts tumor-suppressive effects in NSCLC and suggests a new therapeutic option for NSCLC.
Energy Technology Data Exchange (ETDEWEB)
Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)
2003-06-01
The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus
Kelley, K C
2004-01-01
At the Los Alamos Neutron Science Center accelerator complex, protons are accelerated to 800 MeV and directed to two tungsten targets, Target 4 at the Weapons Neutron Research facility and the 1L target at the Lujan Center. The Department of Energy requires hazard classification analyses to be performed on these targets and places limits on certain radionuclide inventories in the targets to avoid characterizing the facilities as “nuclear facilities.” Gadolinium-148 is a radionuclide created from the spallation of tungsten. Allowed isotopic inventories are particularly low for this isotope because it is an alpha-particle emitter with a 75-year half-life. The activity level of Gadolinium-148 is low, but it encompasses almost two-thirds of the total dose burden for the two tungsten targets based on present yield estimates. From a hazard classification standpoint, this severely limits the lifetime of these tungsten targets. The cross section is not well-established experimentally and this is t...
Non-collective high-spin states in /sup 148/Dy
Energy Technology Data Exchange (ETDEWEB)
Dines, E.L.
1985-04-01
General physical concepts regarding nuclear high-spin states are given. The high-spin states in /sup 148/Dy(Z = 66, N = 82) were produced via the reaction /sup 112/Cd(Pb-backed)(/sup 40/Ar,4n) at E/sub lab/ = 175, at the 88-inch Cyclotron at Lawrence Berkeley Laboratory. Methods for placing gates on various transitions above and below the 480 nsec isomer at 10/sup +/(known from previous work), as well as for calculating transition intensities and their associated errors, are given. Calculations of angular correlations for multiple ..gamma..-ray cascades, assuming non-zero-width distributions in m-states for some given spin state, were done and compared to experimental values. Analysis of RF - Ge and Ge - Ge TAC spectra for transitions above the 480 nsec isomer implied lifetimes of less than or equal to 5 nsec (except for the 327.2 keV transition). Using such analysis, some 19 new ..gamma..-ray transitions were discovered above the isomer, thereby extending the /sup 148/Dy level scheme up to spin I = 31 h-bar. Assignments of spins and parities for the new levels are made based on information obtained from angular correlations and the lifetime limits. Previous work on the 11 transitions below the 480 nsec isomer is confirmed.
Xue, Shi-Fan; Lu, Ling-Fei; Wang, Qi-Xian; Zhang, Shengqiang; Zhang, Min; Shi, Guoyue
2016-09-01
Cysteine (Cys) and histidine (His) both play indispensable roles in many important biological activities. An enhanced Cys level can result in Alzheimer's and cardiovascular diseases. Likewise, His plays a significant role in the growth and repair of tissues as well as in controlling the transmission of metal elements in biological bases. Therefore, it is meaningful to detect Cys and His simultaneously. In this work, a novel terbium (III) coordination polymer-Cu (II) ensemble (Tb(3+)/GMP-Cu(2+)) was proposed. Guanosine monophosphate (GMP) can self-assemble with Tb(3+) to form a supramolecular Tb(3+) coordination polymer (Tb(3+)/GMP), which can be suited as a time-resolved probe. The fluorescence of Tb(3+)/GMP would be quenched upon the addition of Cu(2+), and then the fluorescence of the as-prepared Tb(3+)/GMP-Cu(2+) ensemble would be restored again in the presence of Cys or His. By incorporating N-Ethylmaleimide and Ni(2+) as masking agents, Tb(3+)/GMP-Cu(2+) was further exploited as an integrated logic system and a specific time-resolved fluorescent "turn-on" assay for simultaneously sensing His and Cys was designed. Meanwhile it can also be used in plasma samples, showing great potential to meet the need of practical application. Copyright © 2016 Elsevier B.V. All rights reserved.
Wang, Jun; Han, Tao; Lang, Tianchun; Tu, Mingjing; Peng, Lingling
2015-11-01
Cerium-doped terbium-yttrium aluminum garnet phosphors were synthesized using the solid-state reaction method. The crystalline phase, morphology, and photoluminescence properties were characterized by x-ray diffraction (XRD), scanning electron microscope (SEM), and fluorescence spectrophotometer, respectively. The XRD results indicate that with an increase of the amount of x (Tb3+), all of the samples have a pure garnet crystal structure without secondary phases. The SEM images reveal that the samples are composed of sphere-like crystallites, which exhibit different degrees of agglomeration. The luminescent properties of Ce ions in )Al5O12∶Ce0.1 have been studied, and it was found that the emission band shifted toward a longer wavelength. The redshift is attributed to the lowering of the 5d energy level centroid of Ce, which can be explained by the nephelauxetic effect and compression effect. These phosphors were coated on blue light-emitting diode (LED) chips to fabricate white light-emitting diodes (WLEDs), and their color-rendering indices, color temperatures, and luminous efficiencies were measured. As a consequence of the addition of Tb, the blue LED pumped )Al5O12∶Ce0.1 phosphors WLEDs showed good optical properties.
Sun, Changxia; Yang, Jinghe; Wu, Xia; Liu, Shufang; Su, Benyu
2004-08-01
The co-luminescence effect in a terbium-gadolinium-protein-sodium dodecyl benzene sulfonate (SDBS) system is reported here. Based on it, the sensitive quantitative analysis of protein at nanogram levels is established. The co-luminescence mechanism is studied using fluorescence, resonance light scattering (RLS), absorption spectroscopy and NMR measurement. It is considered that protein could be unfolded by SDBS, then a efficacious intramolecular fluorescent energy transfer occurs from unfolded protein to rare earth ions through SDBS acting as a "transfer bridge" to enhance the emission fluorescence of Tb3+ in this ternary complex of Tb-SDBS-BSA, where energy transfer from protein to SDBS by aromatic ring stacking is the most important step. Cooperating with the intramolecular energy transfer above is the intermolecular energy transfer between the simultaneous existing complexes of both Tb3+ and Gd3+. The fluorescence quantum yield is increased by an energy-insulating sheath, which is considered to be another reason for the resulting enhancement of the fluorescence. Förster theory is used to calculate the distribution of enhancing factors and has led to a greater understanding of the mechanisms of energy transfer.
Gao, Zhi-hua; Wang, Shu-ping; Liu, Cui-ge; Ma, Rui-xia; Wang, Rui-fen
2006-04-01
Seven ternary complexes of Tb(III) were synthesized with benzoic acid (BA), o-, m-, p-methylbenzoic acid (o-MBA, m-MBA, p-MBA), and o-, m-, p-methoxybenzoic acid (o-MOBA, m-MOBA, p-MOBA) as the first ligand, and 1,10-phenanthroline (phen) as the second ligand. The content of C, H and N were measured by using a Flash-EA model 1112 elemental analyzer. Excitation and luminescence spectra of the title solid complexes were recorded by using a Hitachi F-4500 fluorescence spectrophotometer at room temperature. The effects of different varieties and different positions of replacing benzoic acid as the first ligand on fluorescence properties of the ternary complexes of terbium were discussed. The results indicated that the intensity of 5D4-->7F6 (489 nm) and 5D4-->7F5 (545 nm) of substituting benzoic acid complexes was stronger than benzoic acid. Three ternary complexes of Tb(III) with o-, m-, p-methylbenzoic acid showed emission intensity in the consecution: Tb(o-MBA)3 phenMOBA)3phen x H2O>Tb(m-MOBA)3phen x H2O>Tb(p-MOBA)3 phen.
Directory of Open Access Journals (Sweden)
Anand Prakash Maurya
2016-01-01
Full Text Available Purpose: The present study was aimed to investigate the genetic context, association with IS26 and horizontal transmission of SHV-148 among Escherichia coli in Tertiary Referral Hospital of India. Methodology: Phenotypic characterisation of extended-spectrum beta-lactamases (ESBLs was carried out as per CLSI criteria. Molecular characterisation of blaSHVand integron was carried out by polymerase chain reaction (PCR assay and confirmed by sequencing. Linkage of IS26 with blaSHV-148was achieved by PCR. Purified products were cloned on pGEM-T vector and sequenced. Strain typing was performed by pulsed field gel electrophoresis with Xba I digestion. Transferability experiment and antimicrobial susceptibility was performed. Results: A total of 33 isolates showed the presence of SHV-148 variant by sequencing and all were Class 1 integron borne. PCR and sequencing results suggested that all blaSHV-148 showed linkage with IS26 and were present in the upstream portion of the gene cassette and were also horizontally transferable through F type of Inc group. Susceptibility results suggest that tigecycline was most effective. Conclusion: The present study reports for the first time of SHV-148 mediated extended spectrum cephalosporin resistance from India. Association of their resistance gene with IS26 and Class 1 integron and carriage within IncF plasmid signifies the potential mobilising unit for the horizontal transfer.
Maurya, Anand Prakash; Das Talukdar, Anupam; Chanda, Debadatta Dhar; Chakravarty, Atanu; Bhattacharjee, Amitabha
2016-01-01
The present study was aimed to investigate the genetic context, association with IS26 and horizontal transmission of SHV-148 among Escherichia coli in Tertiary Referral Hospital of India. Phenotypic characterisation of extended-spectrum beta-lactamases (ESBLs) was carried out as per CLSI criteria. Molecular characterisation of blaSHVand integron was carried out by polymerase chain reaction (PCR) assay and confirmed by sequencing. Linkage of IS26 with blaSHV-148was achieved by PCR. Purified products were cloned on pGEM-T vector and sequenced. Strain typing was performed by pulsed field gel electrophoresis with Xba I digestion. Transferability experiment and antimicrobial susceptibility was performed. A total of 33 isolates showed the presence of SHV-148 variant by sequencing and all were Class 1 integron borne. PCR and sequencing results suggested that all blaSHV-148 showed linkage with IS26 and were present in the upstream portion of the gene cassette and were also horizontally transferable through F type of Inc group. Susceptibility results suggest that tigecycline was most effective. The present study reports for the first time of SHV-148 mediated extended spectrum cephalosporin resistance from India. Association of their resistance gene with IS26 and Class 1 integron and carriage within IncF plasmid signifies the potential mobilising unit for the horizontal transfer.
Two- to one-phonon E3 transition strength in 148Gd
Piiparinen, M.; Kleinheinz, P.; Blomqvist, J.; Virtanen, A.; Ataç, A.; Müller, D.; Nyberg, J.; Ramsøy, T.; Sletten, G.
1993-01-01
In a plunger experiment the mean life of the (νf26×3-×3-)12+ state at 3.981 MeV in 14864Gd84 was measured at τ=83(10) ps, giving 77(11)BW for the 1286 keV 12+-->9- E3 transition rate, confirming the double-octupole character of the 12+ state. The observed deviations in energy and transition rate from harmonic vibration are shown to be caused by the exclusion principle acting between nucleons in the two phonons and are related to the dominant contributions to the 148Gd octupole phonon of the low-lying Δl=Δj=3 proton and neutron in-shell 3- excitations which are of vital significance for the octupole mode in open-shell nuclei.
Determination of the nuclear magnetic moments of 145–148Eu by low-temperature nuclear orientation
Directory of Open Access Journals (Sweden)
F.G. van den Berg
1983-01-01
Full Text Available Nuclear orientation measurements down to 2 mK have been performed on sources of 145–148Eu in SmFe2. The gamma-ray anisotropy yields the nuclear magnetic moments of the europium nuclei with A = 145, 146, 147and148 to be 1.1 ± 0.3 μN, 0.70 ± 0.07 μN, 1.0 ± 0.1 μN and 1.33 ± 0.06 μN, respectively.
Rafik, Besbes; Noureddine, Ouerfelli; Abderabbou, Abdelmanef; Habib, Latrous
2010-03-01
We have continued the studies on the trivalent ions of the 4f and 5f elements. In this paper, we compare the transport properties (self-diffusion coefficient) of the trivalent aquo ions over two ranges of concentrations (0 — 2×10-3M) and (2×10-3 — 1.5M). Self-diffusion coefficients, D, of the trivalent f-element aquo ion series have been determined in aqueous background electrolytes of Gd(NO3)3 and Nd(ClO4)3, at pH=2.5 (HNO3, HClO4) and at 25°C using the open-end capillary method (O.E.C.M.). This method measures the transportation time of ions across a fixed distance. In this paper, we complete a measurement of self-diffusion coefficient for terbium. We optimized the pH to avoid hydrolysis, ion-pairing and complexation of the trivalent 4f and 5f ions. The variation of D versus √C is not linear for dilute solutions (0 — 2×10-3M) and quasi-linear in moderate concentrations (C<=1.5 M). Similar behavior was observed for Tb, as compared with those for Bk, Eu and Gd. We complete the comparison variation of D/D° versus √C for all studied 4f and 5f elements from concentration 0 to 1.5M and we obtained the same variation with √C for all studied elements. All 4f and 5f elements studied follow the Nernst-Hartley expression.
Lindén, Stina; Singh, Manish Kumar; Wegner, K David; Regairaz, Marie; Dautry, François; Treussart, François; Hildebrandt, Niko
2015-03-21
Fluorescence imaging of cells and subcellular compartments is an essential tool to investigate biological processes and to evaluate the development and progression of diseases. In particular, protein-protein interactions can be monitored by Förster resonance energy transfer (FRET) between two proximal fluorophores that are attached to specific recognition biomolecules such as antibodies. We investigated the membrane expression of E- and N-cadherins in three different cell lines used as model systems to study epithelial to mesenchymal transition (EMT) and a possible detection of circulating tumour cells (CTCs). EMT is a key process in cancer metastasis, during which epithelial markers (such as E-cadherin) are down-regulated in the primary tumour whereas mesenchymal markers (such as N-cadherin) are up-regulated, leading to enhanced cell motility, intravasation, and appearance of CTCs. Various FRET donor-acceptor pairs and protein recognition strategies were utilized, in which Lumi4-Tb terbium complexes (Tb) and different organic dyes were conjugated to several distinct E- and N-cadherin-specific antibodies. Pulsed excitation of Tb at low repetition rates (100 Hz) and time-gated (TG) imaging of both the Tb-donor and the dye-acceptor photoluminescence (PL) allowed efficient detection of the EMT markers as well as FRET in the case of sufficient donor-acceptor proximity. Efficient FRET was observed only between two E-cadherin-specific antibodies and further experiments indicated that these antibodies recognized the same E-cadherin molecule, suggesting a limited accessibility of cadherins when they are clustered at adherens junctions. The investigated Tb-to-dye FRET systems provided reduced photobleaching compared to the AlexaFluor 488-568 donor-acceptor pair. Our results demonstrate the applicability and advantages of Tb-based TG FRET for efficient and stable imaging of antibody-antibody interactions on different cell lines. They also reveal the limitations of
Directory of Open Access Journals (Sweden)
Angélique eLEVOYE
2015-11-01
Full Text Available Although G protein-coupled receptor (GPCR internalization has long been considered a major aspect of the desensitization process that tunes ligand responsiveness, internalization is also involved in receptor resensitization and signaling, as well as the ligand scavenging function of some atypical receptors. Internalization thus contributes to the diversity of GPCR-dependent signaling, and its dynamics and quantification in living cells has generated considerable interest. We developed a robust and sensitive assay to follow and quantify ligand-induced and constitutive GPCR internalization but also receptor recycling in living cells. This assay is based on diffusion-enhanced resonance energy transfer (DERET between cell surface GPCRs labeled with a luminescent terbium cryptate donor and a fluorescein acceptor present in the culture medium. GPCR internalization results in a quantifiable reduction of energy transfer. This method yields a high signal-to-noise ratio due to time-resolved measurements. For various GPCRs belonging to different classes, we demonstrated that constitutive and ligand-induced internalization could be monitored as a function of time and ligand concentration, thus allowing accurate quantitative determination of kinetics of receptor internalization but also half-maximal effective or inhibitory concentrations of compounds. In addition to its selectivity and sensitivity, we provided evidence that DERET-based internalization assay is particularly suitable for characterizing biased ligands. Furthermore, the determination of a Z’-factor value of 0.45 indicates the quality and suitability of DERET-based internalization assay for high-throughput screening (HTS of compounds that may modulate GPCRs internalization.
Directory of Open Access Journals (Sweden)
Thaiane Gregório
2015-01-01
Full Text Available The reaction of terbium(III nitrate pentahydrate in acetonitrile with N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (H2bbpen, previously deprotonated with triethylamine, produced the mononuclear compound [N,N′-bis(2-oxidobenzyl-κO-N,N′-bis(pyridin-2-ylmethyl-κNethylenediamine-κ2N,N′](nitrato-κ2O,O′terbium(III, [Tb(C28H28N4O2(NO3]. The molecule lies on a twofold rotation axis and the TbIII ion is eight-coordinate with a slightly distorted dodecahedral coordination geometry. In the symmetry-unique part of the molecule, the pyridine and benzene rings are both essentially planar and form a dihedral angle of 61.42 (7°. In the molecular structure, the N4O4 coordination environment is defined by the hexadentate bbpen ligand and the bidentate nitrate anion. In the crystal, a weak C—H...O hydrogen bond links molecules into a two-dimensional network parallel to (001.
MC148 encoded by human molluscum contagiosum poxvirus is an antagonist for human but not murine CCR8
DEFF Research Database (Denmark)
Lüttichau, H R; Gerstoft, J; Schwartz, T W
2001-01-01
The viral CC chemokines MC148, encoded by the poxvirus molluscum contagiosum, and viral macrophage inflammatory protein (vMIP)-I and vMIP-II, encoded by human herpesvirus 8, were probed on the murine CC receptor (CCR) 8 in parallel with human CCR8. In calcium mobilization assays, vMIP-I acted...
A common variant of PNPLA3 (p.I148M is not associated with alcoholic chronic pancreatitis.
Directory of Open Access Journals (Sweden)
Jonas Rosendahl
Full Text Available BACKGROUND: Chronic pancreatitis (CP is an inflammatory disease that in some patients leads to exocrine and endocrine dysfunction. In industrialized countries the most common aetiology is chronic alcohol abuse. Descriptions of associated genetic alterations in alcoholic CP are rare. However, a common PNPLA3 variant (p.I148M is associated with the development of alcoholic liver cirrhosis (ALC. Since, alcoholic CP and ALC share the same aetiology PNPLA3 variant (p.I148M possibly influences the development of alcoholic CP. METHODS: Using melting curve analysis we genotyped the variant in 1510 patients with pancreatitis or liver disease (961 German and Dutch alcoholic CP patients, 414 German patients with idiopathic or hereditary CP, and 135 patients with ALC. In addition, we included in total 2781 healthy controls in the study. RESULTS: The previously published overrepresentation of GG-genotype was replicated in our cohort of ALC (p-value <0.0001, OR 2.3, 95% CI 1.6-3.3. Distributions of genotype and allele frequencies of the p.I148M variant were comparable in patients with alcoholic CP, idiopathic and hereditary CP and in healthy controls. CONCLUSIONS: The absence of an association of PNPLA3 p.I148M with alcoholic CP seems not to point to a common pathway in the development of alcoholic CP and alcoholic liver cirrhosis.
2010-10-01
... INDIVIDUAL HEALTH INSURANCE MARKET Requirements Relating to Access and Renewability of Coverage § 148.120 Guaranteed availability of individual health insurance coverage to certain individuals with prior group... furnishes health insurance coverage in the individual market must meet the following requirements with...
2012-12-12
... Foreign-Trade Zones Board Foreign-Trade Zone 148--Knoxville, TN, Toho Tenax America, Inc. (Carbon Fiber...), located in Rockwood, Tennessee, with authority to manufacture carbon fiber for export and oxidized... manufacture carbon fiber for the U.S. market; the request for such authority will continue to be reviewed by...
VizieR Online Data Catalog: Observation of 148 young stars toward NGC 1980 (Kounkel+, 2017)
Kounkel, M.; Hartmann, L.; Calvet, N.; Megeath, T.
2017-09-01
We conducted observations using the Inamori-Magellan Areal Camera and Spectrograph (IMACS) on the Magellan Baade telescope. Observations were done using the f/2 camera with the 300 line grism at a blaze angle of 17.5° and slit width of 0.6". In this configuration, the typical resolution is 4Å, and the spectral coverage is approximately 4000-9000Å. We observed four fields toward NGC1980 using the multi-slit mode on 2016 January 7. We targeted 280 sources identified by Bouy et al. 2014 (Cat. J/A+A/564/A29) with r<21mag, of which 212 sources had probabilities of membership (P) greater than 50%. The exposure time was 5*10 minutes per field for the first three fields, and the last field had the exposure time of 8*10 minutes. The weather conditions deteriorated rapidly over the course of the night, therefore, while the first field had the full sensitivity, the last field, even with the increased exposure time, yielded little in terms of the number of sources detected. Partially because of this, we have detected only 148 sources (see Table1). (1 data file).
DEFF Research Database (Denmark)
Lüttichau, H R; Lewis, I C; Gerstoft, J
2001-01-01
The viral chemokine antagonist vMIP-II encoded by human herpesvirus 8 (HHV8) and MC148 encoded by the poxvirus - Molluscum contagiosum - were tested against the newly identified chemokine receptor CCR10. As the CCR10 ligand ESkine / CCL27 had the highest identity to MC148 and because both...
DEFF Research Database (Denmark)
Rembeck, Karolina; Maglio, Cristina; Lagging, Martin
2012-01-01
ABSTRACT: BACKGROUND: Hepatic steatosis in HCV patients has been postulated as a risk factor associated with a higher frequency of fibrosis and cirrhosis. A single genetic variant, PNPLA3 I148M, has been widely associated with increased hepatic steatosis. Previous studies of the PNPLA3 I148M sequ...
Chen, Li-Zhen; Xin, Yong-Ning; Geng, Ning; Jiang, Man; Zhang, Ding-Ding; Xuan, Shi-Ying
2015-01-21
Patatin-like phospholipase domain-containing 3 (PNPLA3 or adiponutrin) displays anabolic and catabolic activities in lipid metabolism, and has been reported to be significantly associated with liver fat content. Various studies have established a strong link between the 148 isoleucine to methionine protein variant (I148M) of PNPLA3 and liver diseases, including nonalcoholic fatty liver disease (NAFLD). However, detailed demographic and ethnic characteristics of the I148M variant and its role in the development of nonalcoholic fatty liver fibrosis have not been fully elucidated. The present review summarizes the current knowledge on the association between the PNPLA3 I148M variant and NAFLD, and especially its role in the development of nonalcoholic fatty liver fibrosis. First, we analyze the impact of demographic and ethnic characteristics of the PNPLA3 I148M variant and the presence of metabolic syndrome on the association between PNPLA3 I148M and NAFLD. Then, we explore the role of the PNPLA3 I148M in the development of nonalcoholic fatty liver fibrosis, and hypothesize the underlying mechanisms by speculating a pro-fibrogenic network. Finally, we briefly highlight future research that may elucidate the specific mechanisms of the PNPLA3 I148M variant in fibrogenesis, which, in turn, provides a theoretical foundation and valuable experimental data for the clinical management of nonalcoholic fatty liver fibrosis.
Directory of Open Access Journals (Sweden)
Jun Cheng
2012-02-01
Full Text Available Fibrodysplasia ossificans progressiva (FOP is a rare congenital disorder of skeletal malformations and progressive extraskeletal ossification. There is still no effective treatment for FOP. All FOP individuals harbor conserved point mutations in ACVR1 gene that are thought to cause ACVR1 constitutive activation and activate BMP signal pathway. The constitutively active ACVR1 is also found to be able to cause endothelial-to-mesenchymal transition (EndMT in endothelial cells, which may cause the formation of FOP lesions. MicroRNAs (miRNAs play an essential role in regulating cell differentiation. Here, we verified that miR-148a directly targeted the 3' UTR of ACVR1 mRNA by reporter gene assays and mutational analysis at the miRNA binding sites, and inhibited ACVR1 both at the protein level and mRNA level. Further, we verified that miR-148a could inhibit the mRNA expression of the Inhibitor of DNA binding (Id gene family thereby suppressing the BMP signaling pathway. This study suggests miR-148a is an important mediator of ACVR1, thus offering a new potential target for the development of therapeutic agents against FOP.
Directory of Open Access Journals (Sweden)
Dougald M. Monroe
2016-01-01
Full Text Available The goal of these studies was to extensively characterize the first recombinant FIX therapeutic corresponding to the threonine-148 (Thr-148 polymorph, IXINITY (trenonacog alfa [coagulation factor IX (recombinant]. Gel electrophoresis, circular dichroism, and gel filtration were used to determine purity and confirm structure. Chromatographic and mass spectrometry techniques were used to identify and quantify posttranslational modifications. Activity was assessed as the ability to activate factor X (FX both with and without factor VIIIa (FVIIIa and in a standard clotting assay. All results were consistent across multiple lots. Trenonacog alfa migrated as a single band on Coomassie-stained gels; activity assays were normal and showed 97% γ-carboxylation and underwent the appropriate structural change upon binding calcium ions. Trenonacog alfa was activated normally with factor XIa (FXIa; once activated it bound to FVIIIa and FXa. When activated to FIXa, it was inhibited efficiently by antithrombin. Glycosylation patterns were similar to plasma-derived FIX with sialic acid content consistent with the literature reports of good pharmacokinetic performance. These studies have shown that trenonacog alfa is a highly pure product with a primary sequence and posttranslational modifications consistent with the common Thr-148 polymorphism of plasma-derived FIX.
Microscopic description of the even-even 140-148Ba isotopes using BM, IBM and IVBM
Ahmed, Imad M.; Flaiyh, Ghaith N.; Kassim, Huda H.; Abdullah, Hewa Y.; Hossain, I.; Sharrad, Fadhil I.
2017-02-01
A description of the even-even Ba isotopes for A = 140 to 148 in framework of Bohr-Mottelson model, interacting boson model and interacting vector boson model are carried out. The E-GOS curve ( E γ/ I and the ratio between the energies of the ( I + 2) and ( I) states ( r( I + 2)/ I) as a function of the spin ( I have been drawn to determine the property of the ground-state band. The positive ground-state band of 140-148Ba has been calculated using Bohr-Mottelson model, interacting boson model and interacting vector boson model, while the negative-parity band of 140-148Ba has been calculated using Bohr-Mottelson model and interacting vector boson model only. The reduced transition probabilities B( E2) of these nuclei were calculated. The parameters of the best fit to the measured data are determined. The potential energy surfaces (PESs) to the IBM Hamiltonian have been obtained using the intrinsic coherent state.
Heritability of cardiovascular and personality traits in 6,148 Sardinians.
Directory of Open Access Journals (Sweden)
Giuseppe Pilia
2006-08-01
Full Text Available In family studies, phenotypic similarities between relatives yield information on the overall contribution of genes to trait variation. Large samples are important for these family studies, especially when comparing heritability between subgroups such as young and old, or males and females. We recruited a cohort of 6,148 participants, aged 14-102 y, from four clustered towns in Sardinia. The cohort includes 34,469 relative pairs. To extract genetic information, we implemented software for variance components heritability analysis, designed to handle large pedigrees, analyze multiple traits simultaneously, and model heterogeneity. Here, we report heritability analyses for 98 quantitative traits, focusing on facets of personality and cardiovascular function. We also summarize results of bivariate analyses for all pairs of traits and of heterogeneity analyses for each trait. We found a significant genetic component for every trait. On average, genetic effects explained 40% of the variance for 38 blood tests, 51% for five anthropometric measures, 25% for 20 measures of cardiovascular function, and 19% for 35 personality traits. Four traits showed significant evidence for an X-linked component. Bivariate analyses suggested overlapping genetic determinants for many traits, including multiple personality facets and several traits related to the metabolic syndrome; but we found no evidence for shared genetic determinants that might underlie the reported association of some personality traits and cardiovascular risk factors. Models allowing for heterogeneity suggested that, in this cohort, the genetic variance was typically larger in females and in younger individuals, but interesting exceptions were observed. For example, narrow heritability of blood pressure was approximately 26% in individuals more than 42 y old, but only approximately 8% in younger individuals. Despite the heterogeneity in effect sizes, the same loci appear to contribute to variance
Heritability of Cardiovascular and Personality Traits in 6,148 Sardinians
Scuteri, Angelo; Orrú, Marco; Albai, Giuseppe; Dei, Mariano; Lai, Sandra; Usala, Gianluca; Lai, Monica; Loi, Paola; Mameli, Cinzia; Vacca, Loredana; Deiana, Manila; Olla, Nazario; Masala, Marco; Cao, Antonio; Najjar, Samer S; Terracciano, Antonio; Nedorezov, Timur; Sharov, Alexei; Zonderman, Alan B; Abecasis, Gonçalo R; Costa, Paul; Lakatta, Edward; Schlessinger, David
2006-01-01
In family studies, phenotypic similarities between relatives yield information on the overall contribution of genes to trait variation. Large samples are important for these family studies, especially when comparing heritability between subgroups such as young and old, or males and females. We recruited a cohort of 6,148 participants, aged 14–102 y, from four clustered towns in Sardinia. The cohort includes 34,469 relative pairs. To extract genetic information, we implemented software for variance components heritability analysis, designed to handle large pedigrees, analyze multiple traits simultaneously, and model heterogeneity. Here, we report heritability analyses for 98 quantitative traits, focusing on facets of personality and cardiovascular function. We also summarize results of bivariate analyses for all pairs of traits and of heterogeneity analyses for each trait. We found a significant genetic component for every trait. On average, genetic effects explained 40% of the variance for 38 blood tests, 51% for five anthropometric measures, 25% for 20 measures of cardiovascular function, and 19% for 35 personality traits. Four traits showed significant evidence for an X-linked component. Bivariate analyses suggested overlapping genetic determinants for many traits, including multiple personality facets and several traits related to the metabolic syndrome; but we found no evidence for shared genetic determinants that might underlie the reported association of some personality traits and cardiovascular risk factors. Models allowing for heterogeneity suggested that, in this cohort, the genetic variance was typically larger in females and in younger individuals, but interesting exceptions were observed. For example, narrow heritability of blood pressure was approximately 26% in individuals more than 42 y old, but only approximately 8% in younger individuals. Despite the heterogeneity in effect sizes, the same loci appear to contribute to variance in young and old
Cao, Li-Hui; Shi, Fang; Zhang, Wen-Min; Zang, Shuang-Quan; Mak, Thomas C W
2015-10-26
A water-stable luminescent terbium-based metal-organic framework (MOF), {[Tb(L1 )1.5 (H2 O)]⋅3 H2 O}n (Tb-MOF), with rod-shaped secondary building units (SBUs) and honeycomb-type tubular channels has been synthesized and structurally characterized by single-crystal X-ray diffraction. The high green emission intensity and the microporous nature of the Tb-MOF indicate that it can potentially be used as a luminescent sensor. In this work, we show that Tb-MOF can selectively sense Fe(3+) and Al(3+) ions from mixed metal ions in water through different detection mechanisms. In addition, it also exhibits high sensitivity for 2,4,6-trinitrophenol (TNP) in the presence of other nitro aromatic compounds in aqueous solution by luminescence quenching experiments. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)
2017-10-16
The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Chen, Yong; Min, Lingfeng; Ren, Chuanli; Xu, Xingxiang; Yang, Jianqi; Sun, Xinchen; Wang, Tao; Wang, Fang; Sun, Changjiang; Zhang, Xizhi
2017-01-01
Lung cancer is the leading cause of cancer death in the world, and aberrant expression of miRNA is a common feature during the cancer initiation and development. Our previous study showed that levels of miRNA-148a assessed by quantitative real-time polymerase chain reaction (qRT-PCR) were a good prognosis factor for non-small cell lung cancer (NSCLC) patients. In this study, we used high-throughput formalin-fixed and paraffin-embedded (FFPE) lung cancer tissue arrays and in situ hybridization (ISH) to determine the clinical significances of miRNA-148a and aimed to find novel target of miRNA-148a in lung cancer. Our results showed that there were 86 of 159 patients with low miRNA-148a expression and miRNA-148a was significantly down-regulated in primary cancer tissues when compared with their adjacent normal lung tissues. Low expression of miRNA-148a was strongly associated with high tumor grade, lymph node (LN) metastasis and a higher risk of tumor-related death in NSCLC. Lentivirus mediated overexpression of miRNA-148a inhibited migration and invasion of A549 and H1299 lung cancer cells. Furthermore, we validated Wnt1 as a direct target of miRNA-148a. Our data showed that the Wnt1 expression was negatively correlated with the expression of miRNA-148a in both primary cancer tissues and their corresponding adjacent normal lung tissues. In addition, overexpression of miRNA-148a inhibited Wnt1 protein expression in cancer cells. And knocking down of Wnt-1 by siRNA had the similar effect of miRNA-148a overexpression on cell migration and invasion in lung cancer cells. In conclusion, our results suggest that miRNA-148a inhibited cell migration and invasion through targeting Wnt1 and this might provide a new insight into the molecular mechanisms of lung cancer metastasis.
Kim, Juri; Lee, Hye-Yeon; Lee, Kyu-Ho; Park, Soon-Jung
2017-07-01
Giardia lamblia is a unicellular organism, showing a polarity with two nuclei and cytoskeletal structures. Accurate positioning of these organelles is essential for division of G. lamblia, which is poorly understood. Giardia lamblia end-binding 1 (GlEB1) protein and G. lamblia aurora kinase (GlAK) have been shown to modulate microtubule (MT) distribution during cytokinesis. A direct association between GlEB1 and GlAK was demonstrated. Like GlEB1, GlAK was also found at nuclear envelopes and median bodies of G. lamblia. In vitro kinase assays using Giardia lysates immunoprecipitated with anti-GlAK antibodies or recombinant GlAK suggested that GlEB1 is a substrate of GlAK. Site-directed mutagenesis indicated that threonine-205 in GlAK was auto-phosphorylated and that GlAK phosphorylated serine (Ser)-148 in GlEB1. Ectopic expression of a mutant GlEB1 (with conversion of Ser-148 into alanine of GlEB1) resulted in an increased number of Giardia cells with division defects. Treatment of G. lamblia with an AK inhibitor triggered cytokinesis defects, and ectopic expression of a phospho-mimetic mutant GlEB1 (with conversion of Ser-148 into aspartate) rescued the defects in Giardia cell division caused by the AK inhibitor. These results suggested that phosphorylation of GlEB1 played a role in cytokinesis in G. lamblia. © 2016 The Author(s) Journal of Eukaryotic Microbiology © 2016 International Society of Protistologists.
Directory of Open Access Journals (Sweden)
Rembeck Karolina
2012-09-01
Full Text Available Abstract Background Hepatic steatosis in HCV patients has been postulated as a risk factor associated with a higher frequency of fibrosis and cirrhosis. A single genetic variant, PNPLA3 I148M, has been widely associated with increased hepatic steatosis. Previous studies of the PNPLA3 I148M sequence variant in HCV infected individuals have reported an association between this variant and prevalence of steatosis, fibrosis, and cirrhosis. To evaluate the impact of PNPLA3 I148M variant on metabolic traits and treatment response in HCV genotype 2 and 3 infected patients. Methods Three hundred and eighty-two treatment naïve HCV genotype 2 or 3 infected patients were included in a phase III, open label, randomized, multicenter, investigator-initiated trial (the NORDynamIC study, in which pretreatment liver biopsies were mandatory. PNPLA3I148M genotyping was performed in a total of 359 Caucasian patients. Results In HCV genotype 2 infected patients carrying the PNPLA3 148M allele, there was significantly increased insulin resistance (P = 0.023 and lower viral load (P = 0.005 at baseline as well as the first seven days of antiviral treatment. These results were not observed in HCV genotype 3 infected patients. Conclusions Our results suggest a possible association between the PNPLA3 148M allele and insulin resistance as well as baseline viral load in HCV genotype 2, but not in genotype 3.
Sodium terbium(III polyphosphate
Directory of Open Access Journals (Sweden)
Abdelghani Oudahmane
2010-04-01
Full Text Available Single crystals of the title compound, NaTb(PO34, were obtained by solid-state reaction. This compound belongs to type II of long-chain polyphosphates with the general formula AIBIII(PO34. It is isotypic with the NaNd(PO34 and NaEr(PO34 homologues. The crystal structure is built up of infinite crenelated chains of corner-sharing PO4 tetrahedra with a repeating unit of four tetrahedra. These chains, extending parallel to [100], are linked by isolated TbO8 square antiprisms, forming a three-dimensional framework. The Na+ ions are located in channels running along [010] and are surrounded by six oxygen atoms in a distorted octahedral environment within a cut-off distance <2.9 Å.
Directory of Open Access Journals (Sweden)
Chong Chen
2015-01-01
Full Text Available Purpose. This study aims to compare the accuracy of intraocular lens power calculation formulas in eyes with long axial lengths from Chinese patients subjected to cataract surgery. Methods. A total of 148 eyes with an axial length of >26 mm from 148 patients who underwent phacoemulsification with intraocular lens implantation were included. The Haigis, Hoffer Q, Holladay 1, and SRK/T formulas were used to calculate the refractive power of the intraocular lenses and the postoperative estimated power. Results. Overall, the Haigis formula achieved the lowest level of median absolute error 1.025 D (P33 mm, and median absolute errors were significantly higher for those eyes than eyes with axial length = 26.01–30.00 mm. Absolute error was correlated with axial length for the SRK/T (r=0.212, P=0.010 and Hoffer Q (r=0.223, P=0.007 formulas. For axial lengths > 33 mm, eyes exhibited a postoperative hyperopic refractive error. Conclusions. The Haigis and SRK/T formulas may be more suitable for calculating intraocular lens power for eyes with axial lengths ranging from 26 to 33 mm. And for axial length over 33 mm, the Haigis formula could be more accurate.
Solovieva, Natalia; Mushkin, Alexander; Manicheva, Olga; Vishnevsky, Boris; Zhuravlev, Viacheslav; Narvskaya, Olga
2015-01-01
Extrapulmonary and, in particular, spinal tuberculosis (TB) constitutes a minor but significant part of the total TB incidence. In spite of this, almost no studies on the genetic diversity and drug resistance of Mycobacterium tuberculosis isolates from spinal TB patients have been published to date. Here, we report results of the first Russian and globally largest molecular study of M. tuberculosis isolates recovered from patients with tuberculous spondylitis (TBS). The majority of 107 isolates were assigned to the Beijing genotype (n = 80); the other main families were T (n = 11), Ural (n = 7), and LAM (n = 4). Multidrug resistance (MDR) was more frequently found among Beijing (90.5%) and, intriguingly, Ural (71.4%) isolates than other genotypes (5%; P Russia shows that TBS and PTB Beijing strains follow the same paradigm of acquisition of rifampin (RIF) and isoniazid (INH) resistance. The 24-locus mycobacterial interspersed repetitive unit–variable-number tandem-repeat (MIRU-VNTR) subtyping of 80 Beijing isolates further discriminated them into 24 types (Hunter Gaston index [HGI] = 0.83); types 100-32 and 94-32 represented the largest groups. A genotype of Russian successful clone B0/W148 was identified in 30 of 80 Beijing isolates. In conclusion, this study highlighted a crucial impact of the Beijing genotype and the especially prominent role of its MDR-associated successful clone B0/W148 cluster in the development of spinal MDR-TB in Russian patients. PMID:25645851
Directory of Open Access Journals (Sweden)
Temelli Ozlem
2009-05-01
Full Text Available Adenocarcinomas are the most common cause of malignancy in pleura fluids. Usual primary sites include the lung, breast, gastrointestinal tract, and genitourinary tracts. Predicting the site of origin of an adenocarcinoma can be difficult due to overlapping morphologic characteristics. We investigated the use of alkaline phosphatase (AP, Cytokeratin7 (CK7 Cytokeratin8 (CK8 to distinguish adenocarcinomas of lung in 148 body cavity fluid samples. Overall results for primary lung adenocarcinomas, demonstrated CK8 reactivity in 106 (72% of 148 cases. 95 primary lung carcinoma samples (65% were positive for CK7. AP was expressed in 81% of primary lung adenocarcinomas. Positive immunoreactivity for AP was characterized by a red, diffusely apical cytoplasmic staining in tumor cells that ocurred singly or in groups. There was a significant difference between AP, CK 7 and CK 8 expressions in primary lung adenocarcinomas (P=0.02; Chi-squared test. The sensitivity of AP, CK8, CK7 as a marker for primary lung adenocarcinomas were 82%, 72%, 64%, respectively. Thus the AP positive staining largely confirmed the cytologic diagnosis of lung adenocarcinoma.
Serpil, Oĝuztüzün; Meral, Atay; Müzeyyen, Ozhavzali; Ozlem, Temelli; Umit, Yirtici; Mustafa, Türk; Ziya, Atay
2009-01-01
Adenocarcinomas are the most common cause of malignancy in pleura fluids. Usual primary sites include the lung, breast, gastrointestinal tract, and genitourinary tracts. Predicting the site of origin of an adenocarcinoma can be difficult due to overlapping morphologic characteristics. We investigated the use of alkaline phosphatase (AP), Cytokeratin7 (CK7) Cytokeratin8 (CK8) to distinguish adenocarcinomas of lung in 148 body cavity fluid samples. Overall results for primary lung adenocarcinomas, demonstrated CK8 reactivity in 106 (72%) of 148 cases. 95 primary lung carcinoma samples (65%) were positive for CK7. AP was expressed in 81% of primary lung adenocarcinomas. Positive immunoreactivity for AP was characterized by a red, diffusely apical cytoplasmic staining in tumor cells that ocurred singly or in groups. There was a significant difference between AP, CK 7 and CK 8 expressions in primary lung adenocarcinomas (P=0.02; Chi-squared test). The sensitivity of AP, CK8, CK7 as a marker for primary lung adenocarcinomas were 82%, 72%, 64%, respectively. Thus the AP positive staining largely confirmed the cytologic diagnosis of lung adenocarcinoma.
Directory of Open Access Journals (Sweden)
Maria Claudia da Silva Antunes de Souza
2016-10-01
Full Text Available The paper has for object the analysis of the Bill n. 4.148/08, which significantly changes the way the labeling of GM foods, replacing the currently existing symbol by a phrase inserted between other label data. It is the goal of the reserach to show that this proposal, beyond a mere legislative amendment least, is embedded in a much larger context and is living proof of the hypothesis of Professor Ulrich Beck that socially recognized risks would be subject and object of definitions disputes much less depend on scientific knowledge of what actually the political game that involves power, money, information and media space. In addition, it follows the assertion in response to the problem of the research that, in the light of the sustainability paradigm, the PL 4.148/08 represents an environmental setback and itself a threat to the construction of this new ethical imperative. In the methodology we used the inductive method in the investigation phase; in the data processing phase the Cartesian method and in the research report was employed the inductive base. They were also triggered the techniques of reference, category, operational concepts, bibliographic research and book report.
Identification of transcription factors ZmMYB111and ZmMYB148 involved in phenylpropanoid metabolism
Directory of Open Access Journals (Sweden)
Junjie eZhang
2016-02-01
Full Text Available Maize is the leading crop worldwide in terms of both planting area and total yields, but environmental stresses cause significant losses in productivity. Phenylpropanoid compounds play an important role in plant stress resistance; however, the mechanism of their synthesis is not fully understood, especially in regard to the expression and regulation of key genes. Phenylalanine ammonia-lyase (PAL is the first key enzyme involved in phenylpropanoid metabolism, and it has a significant effect on the synthesis of important phenylpropanoid compounds. According to the results of sequence alignments and functional prediction, we selected two conserved R2R3-MYB transcription factors as candidate genes for the regulation of phenylpropanoid metabolism. The two candidate R2R3-MYB genes, which we named ZmMYB111and ZmMYB148, were cloned, and then their structural characteristics and phylogenetic placement were predicted and analyzed. In addition, a series of evaluations were performed, including expression profiles, subcellular localization, transcription activation, protein-DNA interaction, and transient expression in maize endosperm. Our results indicated that both ZmMYB111 and ZmMYB148 are indeed R2R3-MYB transcription factors and that they may play a regulatory role in PAL gene expression.
Energy Technology Data Exchange (ETDEWEB)
Mallinson, Paul I. [Vancouver General Hospital, Radiology Department, Vancouver (Canada); Vancouver General Hospital, Clinical Fellow in Musculoskeletal Radiology, Vancouver, BC (Canada); Reagan, Adrian C.; Munk, Peter L.; Ouellette, Hugue; Nicolaou, Savvas [Vancouver General Hospital, Radiology Department, Vancouver (Canada); Coupal, Tyler [McMaster University, De Groote School of Medicine, Hamilton, Ontario (Canada)
2014-03-15
Clinical detection of gout can be difficult due to co-existent and mimicking arthropathies and asymptomatic disease. Understanding of the distribution of urate within the body can aid clinical diagnosis and further understanding of the resulting pathology. Our aim was to determine this distribution of urate within the extremities in patients with gout. All patients who underwent a four-limb dual-energy computed tomography (DECT) scan for suspected gout over a 2-year period were identified (n = 148, 121 male, 27 female, age range, 16-92 years, mean = 61.3 years, median = 63 years). The reports of the positive cases were retrospectively analyzed and the locations of all urate deposition recorded and classified by anatomical location. A total of 241 cases met the inclusion criteria, of which 148 cases were positive. Of these, 101 (68.2 %) patients had gout in the foot, 81 (56.1 %) in the knee, 79 (53.4 %) in the ankle, 41 (27.7 %) in the elbow, 25 (16.9 %) in the hand, and 25 (16.9 %) in the wrist. The distribution was further subcategorized for each body part into specific bone and soft tissue structures. In this observational study, we provide for the first time a detailed analysis of extremity urate distribution in gout, which both supports and augments to the current understanding based on clinical and microscopic findings. (orig.)
Directory of Open Access Journals (Sweden)
Colin N A Palmer
Full Text Available Obesity is highly associated with elevated serum triglycerides, hepatic steatosis and type 2 diabetes (T2D. The I148M (rs738409 genetic variant of patatin-like phospholipase domain-containing 3 gene (PNPLA3 is known to modulate hepatic triglyceride accumulation, leading to steatosis. No association between PNPLA3 I148M genotype and T2D in Europeans has been reported. Aim of this study is to examine the relationship between PNPLA3 I148M genotypes and serum triglycerides, insulin resistance and T2D susceptibility by testing a gene-environment interaction model with severe obesity.PNPLA3 I148M was genotyped in a large obese cohort, the SOS study (n = 3,473 and in the Go-DARTS (n = 15,448, a T2D case-control study. Metabolic parameters were examined across the PNPLA3 I148M genotypes in participants of the SOS study at baseline and at 2- and 10-year follow up after bariatric surgery or conventional therapy. The associations with metabolic parameters were validated in the Go-DARTS study. Serum triglycerides were found to be lower in the PNPLA3 148M carriers from the SOS study at baseline and from the Go-DARTS T2D cohort. An increased risk for T2D conferred by the 148M allele was found in the SOS study (O.R. 1.09, 95% C.I. 1.01-1.39, P = 0.040 and in severely obese individuals in the Go-DARTS study (O.R. 1.37, 95% C.I. 1.13-1.66, P = 0.001. The 148M allele was no longer associated with insulin resistance or T2D after bariatric surgery in the SOS study and no association with the 148M allele was observed in the less obese (BMI<35 individuals in the Go-DARTS study (P for interaction = 0.002. This provides evidence for the obesity interaction with I48M allele and T2D risk in a large-scale cross-sectional and a prospective interventional study.Severely obese individuals carrying the PNPLA3 148M allele have lower serum triglyceride levels, are more insulin resistant and more susceptible to T2D. This study supports the hypothesis that obesity
Mechakra, Asma; Vincent, Yohann; Chevalier, Philippe; Millat, Gilles; Ficker, Eckhard; Jastrzebski, Marek; Poulin, Hugo; Pouliot, Valérie; Chahine, Mohamed; Christé, Georges
2014-02-25
A variant of the ether-à-go-go related channel (hERG), p.Arg148Trp (R148W) was found at heterozygous state in two infants who died from sudden infant death syndrome (SIDS), one with documented prolonged QTc and Torsade de Pointes (TdP), and in an adult woman with QTc >500 ms, atrioventricular block and TdP. This variant was previously reported in cases of severe ventricular arrhythmia but very rarely in control subjects. Its classification as mutation or polymorphism awaited electrophysiological characterization. The properties of this N-terminal, proximal domain, hERG variant were explored in Xenopus oocytes injected with the same amount of RNA encoding for either hERG/WT or hERG/R148W or their equimolar mixture. The human ventricular cell (TNNP) model was used to test the effects of changes in hERG current. R148W alone produced a current similar to the WT (369 ± 76 nA (mean ± SEM), n=13 versus 342 ± 55 nA in WT, n=13), while the co-expression of 1/2 WT+1/2 R148W lowered the current by 29% versus WT (243 ± 35 nA, n=13, phERG current as evidenced here when co-expressing the hERG/R148W variant with the WT may have predisposed to the observed long QT syndrome and associated TdP. Therefore, the heterozygous carriers of hERG/R148W may be at risk of cardiac sudden death. Copyright © 2013 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Marcin Krawczyk
2015-01-01
Full Text Available Introduction. The common adiponutrin (PNPLA3 variant p.Ile148Met is associated with liver injury. Here, we investigate the association of this polymorphism with hepatic and metabolic traits in a pediatric cohort. Patients and Methods. The study cohort comprised 142 German children (age 5–9 years, 98 overweight, 19 children with NAFLD. Results. Overweight children presented with increased serum ALT (P=0.001 and GGT (P<0.001 activities. ALT activities differed significantly (P=0.02 between carriers of different PNPLA3 genotypes in the entire study cohort, in normal weight children (P=0.02 and in children younger than 7 years (P=0.02. Carriers of the prosteatotic PNPLA3 genotype p.148Met/Met displayed higher ALT activities as compared to children with the frequent genotype p.148Ile/Ile (P=0.01. The BMI was however a stronger predictor of ALT activities compared to the PNPLA3 genotype (P<0.001 and P=0.06, resp.. The variant was associated with increased serum glucose levels (P=0.01 and HOMA index (P=0.02 in carriers of the p.148Ile/Met genotype but did not affect other metabolic traits or the presence of NAFLD. Discussion. The frequent PNPLA3 variant p.Ile148Met is associated with serum ALT activities already at a young age.
Transcriptional regulation of mouse alpha A-crystallin gene in a 148kb Cryaa BAC and its derivates
Directory of Open Access Journals (Sweden)
Yang Ying
2008-09-01
Full Text Available Abstract Background αA-crystallin is highly expressed in the embryonic, neonatal and adult mouse lens. Previously, we identified two novel distal control regions, DCR1 and DCR3. DCR1 was required for transgenic expression of enhanced green fluorescent protein, EGFP, in lens epithelium, whereas DCR3 was active during "late" stages of lens primary fiber cell differentiation. However, the onset of transgenic EGFP expression was delayed by 12–24 hours, compared to the expression of the endogenous Cryaa gene. Results Here, we used bacterial artificial chromosome (BAC and standard transgenic approaches to examine temporal and spatial regulation of the mouse Cryaa gene. Two BAC transgenes, with EGFP insertions into the third coding exon of Cryaa gene, were created: the intact αA-crystallin 148 kb BAC (αA-BAC and αA-BAC(ΔDCR3, which lacks approximately 1.0 kb of genomic DNA including DCR3. Expression of EGFP in the majority of both BAC transgenics nearly recapitulated the endogenous expression pattern of the Cryaa gene in lens, but not outside of the lens. The number of cells expressing αA-crystallin in the lens pit was higher compared to the number of cells expressing EGFP. Next, we generated additional lines using a 15 kb fragment of αA-crystallin locus derived from αA-BAC(ΔDCR3, 15 kb Cryaa/EGFP. A 15 kb region of Cryaa/EGFP supported the expression pattern of EGFP also in the lens pit. However, co-localization studies of αA-crystallin and EGFP indicated that the number of cells that showed transgenic expression was higher compared to cells expressing αA-crystallin in the lens pit. Conclusion We conclude that a 148 kb αA-BAC likely contains all of the regulatory regions required for αA-crystallin expression in the lens, but not in retina, spleen and thymus. In addition, while the 15 kb Cryaa/EGFP region also supported the expression of EGFP in the lens pit, expression in regions such as the hindbrain, indicate that additional genomic
Hammond, Naomi E; Bellomo, Rinaldo; Gallagher, Martin; Gattas, David; Glass, Parisa; Mackle, Diane; Micallef, Sharon; Myburgh, John; Saxena, Manoj; Taylor, Colman; Young, Paul; Finfer, Simon
2017-09-01
0.9% sodium chloride (saline) is the most commonly administered resuscitation fluid on a global basis but emerging evidence suggests that its high chloride content may have important adverse effects. To describe the study protocol for the Plasma- Lyte 148 v Saline study, which will test the hypothesis that in critically ill adult patients the use of Plasma-Lyte 148 (a buffered crystalloid solution) for fluid therapy results in different 90-day all-cause mortality when compared with saline. We will conduct this multicentre, blinded, randomised controlled trial in approximately 50 intensive care units in Australia and New Zealand. We will randomly assign 8800 patients to either Plasma-Lyte 148 or saline for all resuscitation fluid, maintenance fluid and compatible drug dilution therapy while in the ICU for up to 90 days after randomisation. The primary outcome is 90-day all-cause mortality; secondary outcomes include mean and peak creatinine concentration, incidence of renal replacement therapy, incidence and duration of vasoactive drug treatment, duration of mechanical ventilation, ICU and hospital length of stay, and quality of life and health services use at 6 months. The PLUS study will provide high-quality data on the comparative safety and efficacy of Plasma-Lyte 148 compared with saline for resuscitation and compatible crystalloid fluid therapy in critically ill adult patients.
2010-07-01
...: GENERAL Environmental Review Criteria for Deepwater Ports § 148.707 What type of criteria will be used in... any of its shoreside support facilities. (b) The environmental evaluation will be applied to the... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What type of criteria will be...
Marriage, Tobias A.; Acquaviva, Viviana; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John William; Barrientos, L. Felipe; Battistelli, Elia S.; Bond, J. Richard; Brown, Ben;
2011-01-01
We report on 23 clusters detected blindly as Sunyaev-Zel'dovich (SZ) decrements in a 148 GHz, 455 deg (exp 2) map of the southern sky made with data from the Atacama Cosmology Telescope 2008 observing season. All SZ detections announced in this work have confirmed optical counterparts. Ten of the clusters are new discoveries. One newly discovered cluster, ACT-CL 10102-4915, with a redshift of 0.75 (photometric), has an SZ decrement comparable to the most massive systems at lower redshifts. Simulations of the cluster recovery method reproduce the sample purity measured by optical follow-up. In particular, for clusters detected with a signal-to-noise ratio greater than six, simulations are consistent with optical follow-up that demonstrated this subsample is 100% pure, The simulations further imply that the total sample is 80% complete for clusters with mass in excess of 6 x 10(exp 14) solar masses referenced to the cluster volume characterized by 500 times the critical density. The Compton gamma-X-ray luminosity mass comparison for the 11 best-detected clusters visually agrees with both self-similar and non-adiabatic, simulation-derived scaling laws,
Triangulated categories (AM-148)
Neeman, Amnon
2014-01-01
The first two chapters of this book offer a modern, self-contained exposition of the elementary theory of triangulated categories and their quotients. The simple, elegant presentation of these known results makes these chapters eminently suitable as a text for graduate students. The remainder of the book is devoted to new research, providing, among other material, some remarkable improvements on Brown''s classical representability theorem. In addition, the author introduces a class of triangulated categories""--the ""well generated triangulated categories""--and studies their properties. This
Hedmer, Maria; Kåredal, Monica; Gustavsson, Per; Rissler, Jenny
2013-01-01
Carbon nanotubes (CNTs) can be seen as graphene sheets rolled to form cylinders. CNTs may be categorised as single- (SWCNT) or multi-walled (MWCNT). Due to the small size, the number of particles as well as the surface area per mass unit is extremely high. CNTs are highly diverse, differing with respect to e.g., diameter, length, chiral angles, chemical functionalisation, purity, stiffness and bulk density. Today, CNTs are utilised primarily for the reinforcement of composite polymers, but th...
Uno, Megumi; Phansroy, Nichanan; Aso, Yuji; Ohara, Hitomi
2017-08-01
Shewanella oneidensis MR-1 generates electricity from lactic acid, but cannot utilize starch. On the other hand, Streptococcus bovis 148 metabolizes starch and produces lactic acid. Therefore, two methods were trialed for starch-fueled microbial fuel cell (MFC) in this study. In electric generation by two-step fermentation (EGT) method, starch was first converted to lactic acid by S. bovis 148. The S. bovis 148 were then removed by centrifugation, and the fermented broth was preserved for electricity generation by S. oneidensis MR-1. Another method was electric generation by parallel fermentation (EGP) method. In this method, the cultivation and subsequent fermentation processes of S. bovis 148 and S. oneidensis MR-1 were performed simultaneously. After 1, 2, and 3 terms (5-day intervals) of S. oneidensis MR-1 in the EGT fermented broth of S. bovis 148, the maximum currents at each term were 1.8, 2.4, and 2.8 mA, and the maximum current densities at each term were 41.0, 43.6, and 49.9 mW/m2, respectively. In the EGP method, starch was also converted into lactic acid with electricity generation. The maximum current density was 140-200 mA/m2, and the maximum power density of this method was 12.1 mW/m2. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Duval, G.
1998-07-01
Electricite de France (EdF) wishes to establish a physical communication link between his clients and the EdF centres. The final link, i.e. between the high/low voltage transformation substation and the residential clients, being ensured by carrier currents. With this aim, an analysis and a modeling of the low voltage network at the carrier frequencies (3 kHz - 148.5 kHz) has been performed. This work has been carried out in parallel with an experiment involving 3500 apparatuses that use carrier currents. The diversity of the French low voltage networks and the limitations imposed by the EN50065-1 standard about the use of carrier currents in Europe do not favour the development of such carrier current systems. Disturbing voltages and localized impedances represent the main difficulties to get round. Inside accommodations, domotic carrier currents have a reduced range but a higher disturbance amplitude because of the proximity of appliances. A differential mode to common mode conversion phenomenon has been evidenced which generates network couplings and important electromagnetic fields. Energy lines and cables have been analyzed using numerical models. Load peaks have been analyzed using statistical tools in order to take into account the daily fluctuations. The modeling of the network is made in two steps: a double-wire model is considered first. Then a three-phase model is developed which analyzes the inter-phases coupling and the effect of the distribution of clients' loads on each phase. The results of this model are conformable with measurements except for underground networks. As perspectives of future works and beyond todays standard framework, the techniques that allow a sensible increase of communication flow rates have been reviewed. (J.S.)
Deniz, R; Ozen, G; Yilmaz-Oner, S; Alibaz-Oner, F; Erzik, C; Aydin, S Z; Inanc, N; Eren, F; Bayalan, F; Direskeneli, H; Atagunduz, P
2015-06-01
Observed low prevalence of SLE among familial Mediterranean fever (FMF) patients in several large cohorts suggests a possible protective effect of the MEFV mutations from SLE. In contrast, SLE patient carriers for the common MEFV mutations had rather complex disease expression with an increased frequency of febrile episodes and pleurisy and a decreased renal complication rate. Our aim was to investigate the prevalence of MEFV gene mutations in patients with SLE and their effect on organ involvement in a well-defined group of biopsy-proven SLE nephritis patients. The prevalence of four MEFV gene mutations (M694V, M680I, V726A and E148Q) was investigated in 114 SLE patients and effect on disease severity was analyzed in patients with biopsy-proven SLE nephritis. None of the SLE patients fulfilled the revised Tel-Hashomer criteria. Fourteen of 114 SLE patients (12.2%) were found to carry at least one MEFV mutation. A single patient in the SLE-Nephritis group was compound heterozygous for M694V/M680I mutations and only one patient in the SLE-Mild group was homozygous for E148Q mutation. Carrier frequency was similar to controls in SLE patients (12.2 vs 18.8%, p = 0.34). After the exclusion of the less penetrant E148Q mutation, re-analysis revealed an association between exon 10 mutations and SLE nephritis (p = 0.050, odds ratio (OR) = 4.16, 95% confidence interval (CI) = 1.04-16.6). Carrier rate for the E148Q mutation decreased in the SLE group (controls vs. SLE = 20/186 vs. 3/114, p = 0.08) and E148Q mutation was absent in SLE nephritis (controls vs. SLE nephritis = 20/186 vs. 0/47, p = 0.016, OR = 11.69, 95% CI = 0.69-197.13). Carrier rate for the studied MEFV mutations was slightly lower in the SLE group, which is in agreement with previous observations that FMF may confer some protection from SLE. Exon 10 mutations were associated with SLE nephritis after the exclusion of the E148Q mutation. The significance of the E148Q as a
Castillo-García, M L; Aguilar-Caballos, M P; Gómez-Hens, A
2015-12-18
A new magnetic dispersive solid-phase extraction approach based on Eu- and Tb-coated magnetic nanocomposites, combined with ultra-high performance liquid chromatography with fluorometric detection, is reported for the extraction and simultaneous determination of veterinary antibiotics. The method is aimed at monitoring of potential residues of three tetracyclines, namely oxytetracycline, tetracycline, chlortetracycline and three acidic quinolones, such as oxolinic acid, nalidixic acid and flumequine, chosen as model analytes, in animal muscle samples. The nanocomposites were obtained by synthesizing magnetic nanoparticles by a co-precipitation method and their coating with terbium and europium ions. The limits of detection obtained using standard solutions were: 1.0, 1.5, 3.8, 0.25, 0.7 and 1.2ngmL(-1), which corresponds to 3.3, 5.0, 12.7, 0.8, 2.3 and 4.0μgkg(-1) for oxytetracycline, tetracycline, chlortetracycline, oxolinic acid, nalidixic acid and flumequine, respectively, in meat samples. The precision values, obtained in the presence of the sample matrix, were in the ranges 0.12-2.0% and 2.6-15.4% for retention times and areas, respectively. The selectivity of the method was checked by assaying different veterinary drugs, finding that most of them did not interfere at the same concentration levels as that of analytes. A recovery study was performed in the presence of chicken and pork muscle samples, which provided values in the range of 61.5-102.6%. Copyright © 2015 Elsevier B.V. All rights reserved.
Weinberg, Laurence; Chiam, Elizabeth; Hooper, James; Liskaser, Frank; Hawkins, Angela Kim; Massie, Denise; Ellis, Andrew; Tan, Chong O; Story, David; Bellomo, Rinaldo
2017-11-01
The mechanisms of acid-base changes during cardiopulmonary bypass (CPB) remain unclear. We tested the hypothesis that, when used as CPB pump prime solutions, Plasma-Lyte 148 (PL) and Hartmann's solution (HS) have differential mechanisms of action in their contribution to acid-base changes. We performed a prospective, double-blind, randomized trial in adult patients undergoing elective cardiac surgery with CPB. Participants received a CPB prime solution of 2000 mL, with either PL or HS. The primary endpoint was the standard base excess (SBE) value measured at 60 minutes after full CPB flows (SBE60min). Secondary outcomes included changes in SBE, pH, chloride, sodium, lactate, gluconate, acetate, strong ion difference and strong ion gap at two (T2min), five (T5min), ten (T10min), thirty (T30min) and sixty (T60min) minutes on CPB. The primary outcome was measured using a two-tailed Welch's t-test. Repeated measures ANOVA was used to test for differences between time points. Twenty-five participants were randomized to PL and 25 to HS. Baseline characteristics, EURO and APACHE scores, biochemistry, hematology and volumes of cardioplegia were similar. Mean (SD) SBE at T60min was -1.3 (1.4) in the PL group and -0.1 (2.7) in the HS group; p=0.55. No significant differences in SBE between the groups was observed during the first 60 minutes (p=0.48). During CPB, there was hyperacetatemia and hypergluconatemia in the PL group and hyperlactatemia and hyperchloremia in the HS group. No significant difference between the groups in plasma bicarbonate levels and total weak acid levels were found. Complications and intensive care unit and hospital length of stays were similar. During CPB, PL and HS did not cause a significant metabolic acidosis. There was hyperacetatemia and hypergluconatemia with PL and hyperchloremia and hyperlactatemia with HS. These physiochemical effects appear clinically innocuous.
Weinberg, L; Pearce, B; Sullivan, R; Siu, L; Scurrah, N; Tan, C; Backstrom, M; Nikfarjam, M; McNicol, L; Story, D; Christophi, C; Bellomo, R
2015-12-01
The acid-base, biochemical and hematological effects of crystalloid solutions have not been comprehensively evaluated in patients with liver resection. multicenter, prospective, double-blind randomized controlled trial investigating the biochemical effects of Hartmann's solution (HS) or Plasmalyte-148 (PL) in 60 patients undergoing major liver resection. base excess immediately after surgery. changes in blood biochemistry and hematology. At completion of surgery, patients receiving HS had equivalent mean standard base excess (-1.7±2.2 vs. -0.9±2.3 meq/L; P=0.17) to those treated with PL. However, patients treated with HS were more hyperchloremic (difference 1.7 mmol/L, 95% CI: 0.2 to 3.2, P=0.03) and hyperlactatemic (difference 0.8 mmol/L, 95% CI: 0.2 to 1.3; P=0.01). In contrast, patients receiving PL had higher mean plasma magnesium levels and lower ionized calcium levels. There were no significant differences in pH, bicarbonate, albumin and phosphate levels. Immediately after surgery, mean PT and aPTT were significantly lower in the PL group. Intraoperatively, the median (IQR) blood loss in the PL group was 300 mL (200:413) vs. 500 mL (300:638) in the HS group (P=0.03). Correspondingly, the postoperative hemoglobin was higher in the PL group. Total complications were more frequent in the HS Group (56% vs. 20%, relative risk 2.8; 95% CI: 1.3 to 6.1; P=0.007). In liver resection patients, HS and PL led to similar base excess values but different post operative plasma biochemistry and hematology values. Understanding of these effects may help clinicians individualize fluid therapy in these patients.
Fan, Lin; Wang, Fengyou; Liang, Junhui; Yao, Xin; Fang, Jia; Zhang, Dekun; Wei, Changchun; Zhao, Ying; Zhang, Xiaodan
2017-01-01
A rising candidate for upgrading the performance of an established narrow-bandgap solar technology without adding much cost is to construct the tandem solar cells from a crystalline silicon bottom cell and a high open-circuit voltage top cell. Here, we present a four-terminal tandem solar cell architecture consisting of a self-filtered planar architecture perovskite top cell and a silicon heterojunction bottom cell. A transparent ultrathin gold electrode has been used in perovskite solar cells to achieve a semi-transparent device. The transparent ultrathin gold contact could provide a better electrical conductivity and optical reflectance-scattering to maintain the performance of the top cell compared with the traditional metal oxide contact. The four-terminal tandem solar cell yields an efficiency of 14.8%, with contributions of the top (8.98%) and the bottom cell (5.82%), respectively. We also point out that in terms of optical losses, the intermediate contact of self-filtered tandem architecture is the uppermost problem, which has been addressed in this communication, and the results show that reducing the parasitic light absorption and improving the long wavelength range transmittance without scarifying the electrical properties of the intermediate hole contact layer are the key issues towards further improving the efficiency of this architecture device. Project supported by the International Cooperation Projects of the Ministry of Science and Technology (No. 2014DFE60170), the National Natural Science Foundation of China (Nos. 61474065, 61674084), the Tianjin Research Key Program of Application Foundation and Advanced Technology (No. 15JCZDJC31300), the Key Project in the Science & Technology Pillar Program of Jiangsu Province (No. BE2014147-3), and the 111 Project (No. B16027).
Baltruskeviciene, Edita; Schveigert, Diana; Stankevicius, Vaidotas; Mickys, Ugnius; Zvirblis, Tadas; Bublevic, Jaroslav; Suziedelis, Kestutis; Aleknavicius, Eduardas
2017-09-01
MiRNAs are often deregulated in colorectal cancer and might function as tumor suppressors or as oncogenes. They participate in controlling key signaling pathways involved in proliferation, invasion and apoptosis and may serve as prognostic and predictive markers. In this study we aimed to evaluate the role of miRNA-148a and miRNA-625-3p in metastatic colorectal cancer. Fifty-four patients with a first-time diagnosed CRC receiving FOLFOX ± Bevacizumab were involved in the study. Tumor samples underwent routine pathology examination including evaluation for tumor budding and KRAS. MiRNA-148a and miRNA-625-3p expression analysis was done by RT-PCR. Associations between expression of both miRNAs and clinico-pathological factors, treatment outcomes and survival were analyzed. Both miRNA-148a and miRNA-625-3p were down-regulated in the tumors compared to normal colonic mucosa. Significantly lower expression of both miRNAs was noticed in tumors with budding phenomenon compared to tumors without it (median values of miRNA-148a were 0.314 and 0.753 respectively, p = 0.011, and 0.404 and 0.620 respectively for miRNA-625-3p, p = 0.036). Significantly lower expression of miRNA-625-3p was detected in rectal tumors, compared to tumors in the colon (median 0.390 and 0.665 respectively, p = 0.037). Progression free survival was significantly lower in patients with high miRNA-148a expression (6 and 9 months respectively, p = 0.033), but there were no significant differences in PFS for miRNA-625-3p and in overall survival for both miRNAs. There was a significant relationship between low miRNA-148a and miRNA-625-3p expression and tumor budding, which is thought to represent epithelial-mesenchymal transition. Both studied miRNAs may be associated with a more aggressive phenotype and could be the potential prognostic and predictive biomarkers in CRC. Further investigation is needed to confirm miRNAs involvement in EMT, and their prognostic and predictive value.
Amiel, S; Nir-El, Y; Shmid, M
1976-01-01
The neutron nuclides /sup 147; 148/Ba were produced in the thermal neutron induced fission of /sup 235/U. A new surface ionization integrated target ion source operating at temperatures in the region of 1800 degrees C permits the measurement of half-lives of isotopes down to about 0.1 sec due to the very fast release of atoms from the target. Isotopes of Rb, Sr, Cs, and Ba were separated by positive surface ionization and their half-lives measured using beta activity detected by a silicon surface barrier detector with a depletion depth of 300 mu . The isotopes /sup 147/Ba and /sup 148/Ba were identified for the first time and their half-lives were found to be 0.72+or-0.07 sec and 0.47+or-0.20 sec, respectively. (0 refs).
Energy Technology Data Exchange (ETDEWEB)
Kidnay, A.J.; Yesavage, V.F.
1978-12-01
Experimental measurements were completed on a naphtha sample (1046) furnished by the Pittsburg and Midway Coal Mining Company. A total of 38 measurements were made in the temperature region 148 to 459/sup 0/F, and at pressures of 100 and 300 psia. Additional analytical work was also completed on the SRC-I naphtha whose enthalpy measurements were reported in previous progress reports. Comparisons are given between the experimental SRC-I naphtha enthalpies and the available petroleum enthalpy correlations.
Nobili, Valerio; Bedogni, Giorgio; Donati, Benedetta; Alisi, Anna; Valenti, Luca
2013-10-01
The aim of this secondary analysis of a randomized controlled trial was to test whether the I148M variant of Patatin-like phospholipase domain-containing protein-3 (PNPLA3) is associated with the response to docosahexaenoic acid (DHA) in children with non-alcoholic fatty liver disease (NAFLD). Sixty children with NAFLD were randomized in equal numbers to DHA 250 mg/day, DHA 500 mg/day or placebo. Coherently with the primary analysis, the probability of more severe steatosis after 24 months of DHA supplementation was 50% lower [95% confidence interval (CI) -59% to -42%)] in the combined DHA 250 and 500 mg/day groups versus placebo. The present secondary analysis revealed an independent effect of PNPLA3 status on the response to DHA. In fact, the probability of more severe steatosis was higher (37%, 95% CI 26-48%) for the PNPLA3 M/M versus I/M genotype and lower (-12%, 95% CI -21% to -3%) for the I/I versus I/M genotype (Somers' D for repeated measures). We conclude that the 148M allele of PNPLA3 is associated with lower response, and the 148I allele with greater response, to DHA supplementation in children with NAFLD.
Arslanow, Anita; Stokes, Caroline S; Weber, Susanne N; Grünhage, Frank; Lammert, Frank; Krawczyk, Marcin
2016-03-01
Non-alcoholic fatty liver disease (NAFLD) is becoming the most prevalent liver disorder. The PNPLA3 (adiponutrin) variant p.I148M has been identified as common genetic modifier of NAFLD. Our aim was to assess the relationships between genetic risk and non-invasively measured liver fat content. Hepatic steatosis was quantified by transient elastography, using the controlled attenuation parameter (CAP) in 174 patients with chronic liver diseases (50% women, age 18-77 years). In addition, a cohort of 174 gender-matched healthy controls (50% women, age 32-77 years) was recruited. The PNPLA3 mutation as well as the novel NAFLD-predisposing genetic variant (TM6SF2 p.E167K) were genotyped with allele-specific probes. The PNPLA3 genotype correlated significantly (P = 0.001) with hepatic CAP measurements. The p.148M risk allele increased the odds of developing liver steatosis (OR = 2.39, P = 0.023). In multivariate models, BMI and PNPLA3 mutation were both independently associated with CAP values (P CAP values. The PNPLA3 p.I148M variant represents the most important prosteatotic genetic risk factor. NAFLD carriers of this variant should be followed up carefully, with elastography and CAP being ideally suited for this purpose. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Sanna Siltanen
Full Text Available ARLTS1 is a recently characterized tumor suppressor gene at 13q14.3, a region frequently deleted in both sporadic and hereditary prostate cancer (PCa. ARLTS1 variants, especially Cys148Arg (T442C, increase susceptibility to different cancers, including PCa. In this study the role of Cys148Arg substitution was investigated as a risk factor for PCa using both genetic and functional analysis. Cys148Arg genotypes and expression of the ARLTS1 were explored in a large set of familial and unselected PCa cases, clinical tumor samples, xenografts, prostate cancer cell lines and benign prostatic hyperplasia (BPH samples. The frequency of the variant genotype CC was significantly higher in familial (OR = 1.67, 95% CI = 1.08-2.56, P = 0.019 and unselected patients (OR = 1.52, 95% CI = 1.18-1.97, P = 0.001 and the overall risk was increased (OR = 1.54, 95% CI = 1.20-1.98, P = 0.0007. Additional analysis with clinicopathological data revealed an association with an aggressive disease (OR = 1.28, 95% CI = 1.05-∞, P = 0.02. The CC genotype of the Cys148Arg variant was also contributing to the lowered ARLTS1 expression status in lymphoblastoid cells from familial patients. In addition significantly lowered ARLTS1 expression was observed in clinical tumor samples compared to BPH samples (P = 0.01. The ARLTS1 co-expression signature based on previously published microarray data was generated from 1587 cancer samples confirming the low expression of ARLTS1 in PCa and showed that ARLTS1 expression was strongly associated with immune processes. This study provides strong confirmation of the important role of ARLTS1 Cys148Arg variant as a contributor in PCa predisposition and a potential marker for aggressive disease outcome.
Directory of Open Access Journals (Sweden)
Ohyashiki JH
2014-08-01
Full Text Available Junko H Ohyashiki,1 Kazushige Ohtsuki,1 Izuru Mizoguchi,2 Takayuki Yoshimoto,2 Seiichiro Katagiri,3 Tomohiro Umezu,1,4 Kazuma Ohyashiki3,4 1Department of Molecular Oncology, Institute of Medical Science, 2Department of Immunoregulation, Institute of Medical Science, 3Department of Hematology, 4Department of Molecular Science, Tokyo Medical University, Tokyo, Japan Background: A subset of patients with chronic myeloid leukemia (CML can sustain a complete molecular response after discontinuing imatinib mesylate (IM. We focused on microRNAs (miRNAs, with the aim of finding a molecular biomarker to discriminate which patients can safely and successfully discontinue IM use. Methods: To identify miRNAs that showed altered expression in patients who had discontinued IM (STOP-IM group, we first screened miRNA expression of peripheral blood mononuclear cells by using a TaqMan miRNA array on samples from five unselected patients from the STOP-IM group, seven CML patients receiving IM (IM group, and five healthy volunteers. We then performed miRNA quantification in 49 CML patients with deep molecular response. Mann–Whitney U and chi-square tests were used to determine statistical significance for comparisons between the control (healthy volunteers and test groups (STOP-IM and IM groups. Multiple groups were compared by one-way analysis of variance. Results: Downregulation of miR-148b was noted in patients in the STOP-IM group and in a subset of the IM group. We then subdivided the IM patients into two groups: one with downregulated miR-148b expression (IM-1; less than the cut-off value and the other without downregulated miR-148b expression (IM-2; greater than the cut-off value. The number of patients who had a sustained stable molecular response was significantly lower in IM-2 group. This group also had a significantly lower percentage of natural killer cells. Conclusion: Downregulated miR-148 may contribute to immune surveillance in STOP-IM patients
Energy Technology Data Exchange (ETDEWEB)
Hasselfield, Matthew; Hlozek, Renée [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Hilton, Matt [Astrophysics and Cosmology Research Unit, School of Mathematics, Statistics and Computer Science, University of KwaZulu-Natal, Durban, 4041 (South Africa); Marriage, Tobias A.; Crichton, Devin; Gralla, Megan B. [Dept. of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218-2686 (United States); Addison, Graeme E.; Halpern, Mark [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC, V6T 1Z4 (Canada); Barrientos, L. Felipe; Dünner, Rolando [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificía Universidad Católica, Casilla 306, Santiago 22 (Chile); Battaglia, Nicholas [Department of Physics, Carnegie Mellon University, Pittsburgh, PA 15213 (United States); Battistelli, Elia S. [Department of Physics, University of Rome ' ' La Sapienza' ' , Piazzale Aldo Moro 5, I-00185 Rome (Italy); Bond, J. Richard; Hajian, Amir; Hincks, Adam D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON, M5S 3H8 (Canada); Das, Sudeep [High Energy Physics Division, Argonne National Laboratory, 9700 S Cass Avenue, Lemont, IL 60439 (United States); Devlin, Mark J.; Dicker, Simon R. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Dunkley, Joanna [Department of Astrophysics, Oxford University, Oxford, OX1 3RH (United Kingdom); Fowler, Joseph W., E-mail: mhasse@astro.princeton.edu, E-mail: hiltonm@ukzn.ac.za, E-mail: marriage@pha.jhu.edu [NIST Quantum Devices Group, 325 Broadway Mailcode 817.03, Boulder, CO 80305 (United States); and others
2013-07-01
We present a catalog of 68 galaxy clusters, of which 19 are new discoveries, detected via the Sunyaev-Zel'dovich effect (SZ) at 148 GHz in the Atacama Cosmology Telescope (ACT) survey on the celestial equator. With this addition, the ACT collaboration has reported a total of 91 optically confirmed, SZ detected clusters. The 504 square degree survey region includes 270 square degrees of overlap with SDSS Stripe 82, permitting the confirmation of SZ cluster candidates in deep archival optical data. The subsample of 48 clusters within Stripe 82 is estimated to be 90% complete for M{sub 500c} > 4.5 × 10{sup 14}M{sub s}un and redshifts 0.15 < z < 0.8. While a full suite of matched filters is used to detect the clusters, the sample is studied further through a ''Profile Based Amplitude Analysis'' using a statistic derived from a single filter at a fixed θ{sub 500} = 5.'9 angular scale. This new approach incorporates the cluster redshift along with prior information on the cluster pressure profile to fix the relationship between the cluster characteristic size (R{sub 500}) and the integrated Compton parameter (Y{sub 500}). We adopt a one-parameter family of ''Universal Pressure Profiles'' (UPP) with associated scaling laws, derived from X-ray measurements of nearby clusters, as a baseline model. Three additional models of cluster physics are used to investigate a range of scaling relations beyond the UPP prescription. Assuming a concordance cosmology, the UPP scalings are found to be nearly identical to an adiabatic model, while a model incorporating non-thermal pressure better matches dynamical mass measurements and masses from the South Pole Telescope. A high signal to noise ratio subsample of 15 ACT clusters with complete optical follow-up is used to obtain cosmological constraints. We demonstrate, using fixed scaling relations, how the constraints depend on the assumed gas model if only SZ measurements are used, and
Tatar, Erhan; Uslu, Adam; Simsek, Cenk; Aykas, Ahmet; Bozkaya, Giray; Imamoglu, Cetin
2017-02-01
Fever of unknown origin is a rare condition after solid organ transplant and is generally associated with atypical infections (eg, tuberculosis, fungal infections) and/or lymphoproliferative disorders. Here, we present a kidney transplant patient with a late diagnosis of E148Q mutation-positive familial Mediterranean fever as the cause of fever of unknown origin. A 22-year-old female patient with a previous history of 4 years of hemodialysis and unknown primary renal disease received a deceased-donor kidney transplant at our center 5 years previously. She had an uneventful course in the first 3 years following transplant. After this period, she was hospitalized 3 times during a 4-month period with fever, nausea, vomiting, and atypical abdominal pain. At that time, hemogram results were unremarkable, except for mild leukocytosis and slightly elevated acute-phase reactants; blood, urine, and throat cultures were negative, and there were no remarkable findings on imaging tests. Fever was controlled within 48 hours by administering empiric ampicillin-sulbactam therapy and discontinuing immunosuppressive treatment except steroids. Three successive hospital admissions owing to similar complaints suggested periodic fever syndrome, and therapy with 1 g/day colchicine led to an excellent clinical response with no recurrence of fever or other symptoms. An FMF gene mutation analysis revealed heterozygous E148Q mutation positivity. Continuing the current treatment regimen, the patient did well during at approximately 1.5 years of follow-up. In the Mediterranean region population, familial Mediterranean fever should be considered in the diagnosis of fever of unknown origin in patients who have undergone renal transplant. E148Q mutation-positive familial Mediterranean fever has a subclinical course and renal manifestations that differ from AA amyloidosis during childhood and may be responsible for de novo familial Mediterranean fever after renal transplantation.
Energy Technology Data Exchange (ETDEWEB)
Heinrichs, Dave [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beller, Tim [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Burch, Jennifer [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cummings, Rick [National Security Technologies, LLC. (NSTec), Mercury, NV (United States) Nevada National Security Site; Duluc, Matthieu [Inst. de Radioprotection et de Sûrete Nucleaire (ISRN), Fontenay-aux-Roses (France); Gadd, Milan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Goda, Joetta [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hickman, David [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McAvoy, Doug [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rathbone, Bruce [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sullivan, Randy [Savannah River Site (SRS), Aiken, SC (United States); Trompier, Francois [Inst. de Radioprotection et de Sûrete Nucleaire (ISRN), Fontenay-aux-Roses (France); Veinot, Ken [Y-12 National Security Complex, Oak Ridge, TN (United States); Ward, Dann [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Will, Rashelle [National Security Technologies, LLC. (NSTec), Mercury, NV (United States) Nevada National Security Site; Wilson, Chris [Atomic Weapons Establishment (AWE), Berkshire (United Kingdom); Zieziulewicz, Thomas [Knolls Atomic Power Lab. (KAPL), Niskayuna, NY (United States)
2014-09-30
This document is the Final Design (CED-2) Report for IER-148, “International Inter-comparison Exercise for Nuclear Accident Dosimetry at the DAF Using Godiva-IV.” The report describes the structure of the exercise consisting of three irradiations; identifies the participating laboratories and their points of contact; provides the details of all dosimetry elements and their placement in proximity to Godiva-IV on support stands or phantoms ; and lists the counting and spectroscopy equipment each laboratory will utilize in the Mercury NAD Lab. The exercise is tentatively scheduled for one week in August 2015.
Sadler, M E; Abaev, V V; Allgower, C; Barker, A; Bekrenev, V; Bircher, C; Briscoe, W J; Cadman, R; Carter, C; Clajus, M; Comfort, J R; Craig, K; Daugherity, M; Draper, B; Grosnick, D P; Hayden, S; Huddleston, J; Isenhower, D; Jerkins, M; Joy, M; Knecht, N; Koetke, D D; Kozlenko, N; Kruglov, S; Kycia, T; Lolos, G J; Lopatin, I; Manley, D M; Manweiler, R; Marusic, A; McDonald, S; Nefkens, B M K; Olmsted, J; Papandreou, Z; Peaslee, D; Peterson, J; Phaisangittisakul, N; Prakhov, S N; Price, J W; Ramírez, A; Robinson, C; Shafi, A; Spinka, H; Stanislaus, S; Starostin, A; Staudenmaier, H M; Strakovsky, I I; Supek, I; Tippens, W B; Watson, S
2004-01-01
Measured values of the differential cross section for pion-nucleon charge exchange are presented at momenta 148, 174, 188, 212, 238, 271, 298, and 323 MeV/c, a region dominated by the Delta resonance. Complete angular distributions were obtained using the Crystal Ball detector at the Alternating Gradient Synchrotron (AGS) at Brookhaven National Laboratory (BNL). Statistical uncertainties of the differential cross sections are typically 2-6%, exceptions being the results at the lowest momentum and at the most forward measurements of the five lowest momenta. We estimate the systematic uncertainties to be 3-6%.
Energy Technology Data Exchange (ETDEWEB)
Kidnay, A.J.; Yesavage, V.F.
1978-12-01
Experimental measurements were completed on a naphtha sample (1046) furnished by the Pittsburgh and Midway Coal Mining Company. A total of 38 measurements were made in the temperature region 148 to 459/sup 0/F, and at pressures of 100 and 300 psia. Additional analytical work was completed on the SRC-I naphtha whose enthalpy measurements were reported previously. Comparisons are given between the experimental SRC-I naphtha enthalpies and the available enthalpy data on petroleum fractions, including Kesler and Lee's correlation of these data. (LTN)
Feng, Lu; Perepelov, Andrei V; Zhao, Guang; Shevelev, Sergei D; Wang, Quan; Senchenkova, Sof'ya N; Shashkov, Alexander S; Geng, Yunqi; Reeves, Peter R; Knirel, Yuriy A; Wang, Lei
2007-01-01
Shigella dysenteriae type 1 is the most virulent serotype of Shigella. Enterotoxigenic Escherichia coli O148 is pathogenic and can cause diarrhoea. The following structure was established for the tetrasaccharide repeating unit of the E. coli O148 O antigen: -->3)-alpha-L-Rhap-(1-->3)-alpha-L-Rhap-(1-->2)-alpha-D-Glcp-(1-->3)-alpha-D-GlcpNAc-(1-->. This differs from the structure reported earlier for S. dysenteriae type 1 by having a glucose (Glc) residue in place of a galactose (Gal) residue. The two bacteria also have the same genes for O antigen synthesis, with the same organization and high level of DNA identity, except that in S. dysenteriae type 1 wbbG is interrupted by a deletion, and a galactosyltransferase gene wbbP located on a plasmid is responsible for the transfer of galactose to make a novel antigenic epitope of the O antigen. The S. dysenteriae type 1 O antigen was reconstructed by replacing the E. coli O148 wbbG gene with the wbbP gene, and it had the LPS structure and antigenic properties of S. dysenteriae type 1, indicating that the S. dysenteriae type 1 O antigen evolved from that of E. coli O148. It was also confirmed that wbbG of E. coli O148 is a glucosyltransferase gene, and two serotype-specific genes of E. coli O148 and S. dysenteriae type 1 were identified.
Lan, Chang-Lin; Zhang, Yi; Lv, Tao; Xie, Bao-Lin; Peng, Meng; Yao, Ze-En; Chen, Jin-Gen; Kong, Xiang-Zhong
2017-04-01
The 232Th(n, γ)233Th neutron capture reaction cross sections were measured at average neutron energies of 14.1 MeV and 14.8 MeV using the activation method. The neutron flux was determined using the monitor reaction 27Al(n,α)24Na. The induced gamma-ray activities were measured using a low background gamma ray spectrometer equipped with a high resolution HPGe detector. The experimentally determined cross sections were compared with the data in the literature, and the evaluated data of ENDF/B-VII.1, JENDL-4.0u+, and CENDL-3.1. The excitation functions of the 232Th(n,γ)233Th reaction were also calculated theoretically using the TALYS1.6 computer code. Supported by Chinese TMSR Strategic Pioneer Science and Technology Project-The Th-U Fuel Physics Term (XDA02010100) and National Natural Science Foundation of China (11205076, 21327801)
Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben;
2010-01-01
We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results dearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ACDM cosmological model. At l > 3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8(sigma) level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.
Salcuni, Silvia; Lis, Adriana; Parolin, Laura; Mazzeschi, Claudia
2007-01-01
This project provides information on how nonpatient children perform on the Rorschach test, administered and scored following Exner's guidelines (1995). Lis, Parolin, Zennaro, and Mazzeschi (2001) previously reported initial data for 70 nonpatient children living in Italy who were administered this instrument by graduate and postgraduate students in a 2-year research course at the Psychotherapy School of the University of Padua between July 1998 and February 2001. The current study is an extension of that work and includes information on an additional 153 participants gathered between November 2002 and December 2006. The total number of participants includes 223 individuals, 75 5-7-year-old children in the first level of elementary school, and 148 8-11-year-old children in the second level of elementary school. Exclusion criteria are described, and interrater reliability statistics at the response level for scoring segments are reported using percent agreement and iota. Rorschach Comprehensive System (CS) findings are presented.
Cross section measurements for {sup 75}As isotope at neutron energies from 13.5 to 14.8 MeV
Energy Technology Data Exchange (ETDEWEB)
Tuo Fei; Ji Toujie; Luo Junhua [School of Nuclear Science and Technology, Lanzhou University, Lanzhou, Gansu Province 730000 (China); Kong Xiangzhong [School of Nuclear Science and Technology, Lanzhou University, Lanzhou, Gansu Province 730000 (China)], E-mail: kongxz@lzu.edu.cn; Liu Rong; Jiang Li [Institute of Nuclear Physics and Chemistry, China Academy of Engineering Physics, Mianyang, Sichuan Province 621900 (China)
2007-11-15
Cross sections which is relevant in research of neutron transmutation doping of some important semiconducting materials were measured at neutron energies from 13.5 to 14.8 MeV for the reactions {sup 75}As(n, 2n){sup 74}As, {sup 75}As(n, p){sup 75m+g}Ge, {sup 75}As(n, {alpha}){sup 72m+g}Ga by activation relative to the {sup 27}Al(n, {alpha}){sup 24}Na reaction. Measurements were carried out by {gamma}-detection using a coaxial HPGe detector. Natural realgar (As{sub 2}S{sub 2}) powder of 99.9% purity was used as samples. Fast neutrons were produced by the T(d, n){sup 4}He reaction. The results obtained are compared with existing data.
Morales, Estefanía; González-Valdez, Abigail; Servín-González, Luis; Soberón-Chávez, Gloria
2017-07-03
Pseudomonas aeruginosa is an opportunistic pathogen that presents a complex regulatory network called 'quorum-sensing', which is responsible for the transcription of genes coding for several traits implicated in its pathogenicity. Strain 148 is a dolphin isolate that has been shown to produce quorum-sensing-regulated virulence traits and to be virulent in a mouse model, despite the fact that it contains a 20-kbp deletion that eliminates from the chromosome the lasR gene and the lasI promoter. LasR is a key quorum-sensing transcriptional regulator that, when coupled with the autoinducer 3-oxo-dodecanoyl homoserine lactone (3O-C12-HSL) produced by LasI, activates transcription of genes coding for some virulence-associated traits such as elastase, lasI, rhlI and rhlR. RhlR is also a key quorum-sensing transcriptional regulator that, when interacting with the autoinducer butanoyl homoserine lactone (C4-HSL) that is produced by the synthase RhlI, activates the genes involved in the synthesis of some virulence-associated traits, as rhamnolipids and pyocyanin. We describe that in P. aeruginosa 148, the LasR/3O-C12-HSL-independent rhlR transcriptional activation is due to the release of the negative effect of Vfr (a CRP-ortholog) caused by the insertion of an IS element in vfr, and that rhlI transcription is driven from the rhlR promoter, forming the rhlR-I operon. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Gooden, Matthew; Arnold, Charles; Bhike, Megha; Bredeweg, Todd; Fowler, Malcolm; Krishichayan; Tonchev, Anton; Tornow, Werner; Stoyer, Mark; Vieira, David; Wilhelmy, Jerry
2017-09-01
Under a joint collaboration between TUNL-LANL-LLNL, a set of absolute fission product yield measurements has been performed. The energy dependence of a number of cumulative fission product yields (FPY) have been measured using quasi-monoenergetic neutron beams for three actinide targets, 235U, 238U and 239Pu, between 0.5 and 14.8 MeV. The FPYs were measured by a combination of fission counting using specially designed dual-fission chambers and γ-ray counting. Each dual-fission chamber is a back-to-back ionization chamber encasing an activation target in the center with thin deposits of the same target isotope in each chamber. This method allows for the direct measurement of the total number of fissions in the activation target with no reference to the fission cross-section, thus reducing uncertainties. γ-ray counting of the activation target was performed on well-shielded HPGe detectors over a period of two months post irradiation to properly identify fission products. Reported are absolute cumulative fission product yields for incident neutron energies of 0.5, 1.37, 2.4, 3.6, 4.6, 5.5, 7.5, 8.9 and 14.8 MeV. Preliminary results from thermal irradiations at the MIT research reactor will also be presented and compared to present data and evaluations. This work was performed under the auspices of the U.S. Department of Energy by Los Alamos National Security, LLC under contract DE-AC52-06NA25396, Lawrence Livermore National Laboratory under contract DE-AC52-07NA27344 and by Duke University and Triangle Universities Nuclear Laboratory through NNSA Stewardship Science Academic Alliance grant No. DE-FG52-09NA29465, DE-FG52-09NA29448 and Office of Nuclear Physics Grant No. DE-FG02-97ER41033.
Spectroscopic analysis of lithium terbium tetrafluoride
DEFF Research Database (Denmark)
Christensen, H.P.
1978-01-01
. The rare-earth site in LiTbF4 possesses S4 symmetry, which allows six crystal-field parameters. ζ and the six Bim were varied to obtain the best agreement with the experimentally observed levels. Keeping F2=434 cm-1 fixed, a fit with a standard deviation of 12 cm-1 was obtained at 10 K with the following...... were calculated by diagonalizing an effective spin-orbit and crystal-field Hamiltonian in an LS basis. H=Σλi(L→·S→)i+ΣαiΣBimOim, where the parameters λi are functions of the spin-orbit parameter ζ and the Slater parameter F2. The Oim and αi are Racah operators and reduced matrix elements, respectively...
Inelastic critical scattering of neutrons from terbium
DEFF Research Database (Denmark)
Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.
1967-01-01
We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition.......We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition....
Directory of Open Access Journals (Sweden)
Fei Jiang
Full Text Available Hepatocellular carcinoma (HCC is the third leading cause of cancer-related mortality worldwide. Current standard practices for treatment of HCC are less than satisfactory because of cancer stem cells (CSCs-mediated post-surgical recurrence. For this reason, targeting the CSCs or the cancer cells with CSCs-like properties has become a new approach for the treatment of HCC. GLA exhibits anti-tumor effects in that it attenuates the proliferation, migration, invasion, and angiogenesis of human cancer cells. However, the functions of GLA in the regulation of CSCs-like properties in HCC cells, and the molecular mechanisms underlying in remain obscure. Here we found that GLA attenuated the CSCs-like properties by the microRNA-148a (miR-148a-mediated inhibition of transforming growth factor beta (TGF-β/SMAD2 signal pathway in HCC cell lines (HepG2, Huh-7, and MHCC97H. Indeed, GLA inhibited the activations/expressions of both TGFβ-induced and the endogenous SMAD2. Further, GLA improved the expression of miR-148a in a dose/time-dependent manner. MiR-148a, which targeted the SMAD2-3'UTR, decreased the expression and function of SMAD2. Knockdown of miR-148a abolished the GLA-induced inhibition of TGF-β/SMAD2 signal pathway and the CSCs-like properties in HCC cells. Our study found a novel mechanism that GLA inhibits the CSCs-like properties of HCC cells by miR-148a-mediated inhibition of TGF-β/SMAD2 signal pathway, which may help to identify potential targets for the therapies of HCC.
Yang, Anning; Zhang, Huiping; Sun, Yue; Wang, Yanhua; Yang, Xiaoming; Yang, Xiaoling; Zhang, Hui; Guo, Wei; Zhu, Guangrong; Tian, Jue; Jia, Yuexia; Jiang, Yideng
2016-10-01
Inflammation and dysregulated lipid metabolism are involved in the pathogenesis of preeclampsia, and fatty acid binding protein 4 (FABP4) is known to regulate both inflammation and lipid metabolism. In the present study, we elucidated the role of FABP4 using in vitro and in vivo models of preclampsia. We found increased expression of FABP4 in the placenta of preeclamptic rats, which was further confirmed in HTR-8 cells, an extravillous trophoblast cell line, treated with L-NAME. Overexpression of FABP4 in HTR-8 cells resulted in upregulated expression of pro-inflammatory cytokines IL-6 and TNF-α, and increased lipid accumulation, suggesting that FABP4 plays a role in preeclampsia. Furthermore, downregulation of methylation in the promotor resulted in increased FABP4 expression, which was mediated by downregulated DNA methyltransferase 1 (DNMT1). Bioinformatics analysis showed that miR-148a/152 regulated the expression of DNMT1, and additional in vitro studies revealed that miR-148a/152 inhibited DNMT1 expression by directly binding to its 3'-UTR. Interestingly, DNMT1 enhanced the expression of miR-148a/152 by downregulation of methylation in its promotor. Taken together, our results showed that FABP4 may be involved in the pathogenesis of preeclampsia, and the expression of FABP4 is enhanced by miR-148a/152 mediated inhibition of DNMT1 expression. Copyright © 2016 Elsevier Ltd. All rights reserved.
Qiu, B.; Nakano, T.; Chen, S.; Wang, J.; Fu, L. L.; Klein, P.
2016-12-01
With the use of Ka-band radar interferometry, the Surface Water and Ocean Topography (SWOT) satellite will improve the measured sea surface height (SSH) resolution down to the spectral wavelength of 15km, allowing us to investigate for the first time the upper oceancirculation variability at the submesoscale range on the global scale. By analyzing repeat shipboardAcoustic Doppler Current Profiler (ADCP) measurements along 137°E, as well as the 1/48-deg MITgcm simulation output, in the northwest Pacific, we demonstrate that the observed/modeled upper ocean velocities are comprised of balanced geostrophic motions and unbalanced ageostrophic wave motions. The length scale, Lc, that separates the dominance between these two types of motions is found to depend sensitively on the energy level of local mesoscale eddy variability. In the eddy-abundant western boundary current region of Kuroshio, Lc can be shorter than 15km, whereas Lc exceeds 200km along the path of relatively stable North Equatorial Current. Judicious separation between the balanced and unbalanced surface ocean signals will both be a challenge and opportunity for the SWOT mission.
Nie, Y. B.; Ruan, X. C.; Ren, J.; Zhang, S.; Han, R.; Bao, J.; Huang, H. X.; Ding, Y. Y.; Wu, H. C.; Liu, P.; Zhou, Z. Y.
2017-09-01
In order to make benchmark validation of the nuclear data for gallium (Ga), tungsten (W) and beryllium (Be) in existing modern evaluated nuclear data files, neutron leakage spectra in the range from 0.8 to 15 MeV from slab samples were measured by time-of-flight technique with a BC501 scintillation detector. The measurements were performed at China Institute of Atomic Energy (CIAE) using a D-T neutron source. The thicknesses of the slabs were 0.5 to 2.5 mean free path for 14.8 MeV neutrons, and the measured angles were chosen to be 60∘ and 120∘. The measured spectra were compared with those calculated by the continuous energy Monte-Carlo transport code MCNP, using the data from the CENDL-3.1, ENDF/B-VII.1 and JENDL-4.0 nuclear data files, the comparison between the experimental and calculated results show that: The results from all three libraries significantly underestimate the cross section in energy range of 10-13 MeV for Ga; For W, the calculated spectra using data from CENDL-3.1 and JENDL-4.0 libraries show larger discrepancies with the measured ones, especially around 8.5-13.5 MeV; and for Be, all the libraries led to underestimation below 3 MeV at 120∘.
Angelov, Angel; Pham, Vu Thuy Trang; Übelacker, Maria; Brady, Silja; Leis, Benedikt; Pill, Nicole; Brolle, Judith; Mechelke, Matthias; Moerch, Matthias; Henrissat, Bernard; Liebl, Wolfgang
2017-12-11
The discovery of novel and robust enzymes for the breakdown of plant biomass bears tremendous potential for the development of sustainable production processes in the rapidly evolving new bioeconomy. By functional screening of a metagenomic library from a volcano soil sample a novel thermostable endo-β-glucanase (EngU) which is unusual with regard to its module architecture and cleavage specificity was identified. Various recombinant EngU variants were characterized. Assignment of EngU to an existing glycoside hydrolase (GH) family was not possible. Two regions of EngU showed weak sequence similarity to proteins of the GH clan GH-A, and acidic residues crucial for catalytic activity of EngU were identified by mutation. Unusual, a carbohydrate-binding module (CBM4) which displayed binding affinity for β-glucan, lichenin and carboxymethyl-cellulose was found as an insertion between these two regions. EngU hydrolyzed β-1,4 linkages in carboxymethyl-cellulose, but displayed its highest activity with mixed linkage (β-1,3-/β-1,4-) glucans such as barley β-glucan and lichenin, where in contrast to characterized lichenases cleavage occurred predominantly at the β-1,3 linkages of C4-substituted glucose residues. EngU and numerous related enzymes with previously unknown function represent a new GH family of biomass-degrading enzymes within the GH-A clan. The name assigned to the new GH family is GH148.
Energy Technology Data Exchange (ETDEWEB)
Duamet, B.; Igashira, Masayuki; Mizumachi, Mari; Mizuno, Satoshi; Hori, Jun-ichi; Masuda, Koji; Ohsaki, Toshiro [Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology, Tokyo (Japan)
1999-10-01
The neutron capture cross sections and capture {gamma}-ray spectra of {sup 147,148,149,150,152,154}Sm were measured in the neutron energy region of 10 to 90 keV and at 550 keV. A neutron time-of-flight method was adopted with a 1.5-ns pulsed neutron source by the {sup 7}Li(p, n){sup 7}Be reaction and with a large anti-Compton NaI(Tl) {gamma}-ray spectrometer. A pulse-height weighting technique was applied to observed capture {gamma}-ray pulse-height spectra to derive capture yields. The capture cross sections were obtained with the error of about 5% by using the standard capture cross sections of {sup 197}Au. The present results were compared with the evaluated values of JENDL-3.2 and previous measurements. The capture {gamma}-ray spectra were obtained by unfolding the observed capture {gamma}-ray pulse-height spectra. An anomalous shoulder was cleary observed around 3 MeV in the {gamma}-ray spectra of {sup 150,152,154}Sm, and the energy position of the shoulder was consistent with the systematics obtained in our previous work. (author)
Directory of Open Access Journals (Sweden)
Privas Edwin
2016-01-01
Full Text Available The effective Neodymium cumulative fission yields for 235U have been measured in the fast reactor PHENIX relatively to the 235U fission cross-section. The data were derived from isotope-ratio measurements obtained in the frame of the PROFIL-1, PROFIL-2A and PROFIL-2B programs. The interpretations of the experimental programs were performed with the ERANOS code in association with the Joint Evaluated Fission and Fusion library JEFF-3.1.1. Final results for 143Nd, 145Nd, 146Nd, 148Nd and 150Nd were 5.61%, 3.70%, 2.83%, 1.64% and 0.66%, respectively. The relative uncertainties attached to each of the cumulative fission yields lie between 2.1% and 2.4%. The main source of uncertainty is due to the fluence scaling procedure (<2%. The uncertainties on the Neodymium capture cross-sections provide a contribution lower than 1%. The energy dependence of the fission yields was studied with the GEF code from the thermal energy to 20 MeV. Neutron spectrum average corrections, deduced from GEF calculations, were applied to our effective fission yields with the aim of estimating fission yields at 400 keV and 500 keV, as given in the International Evaluated Nuclear Data Files (JEFF, ENDF/B and JENDL. The neutron spectrum average correction calculated for the PROFIL results remains lower than 1.5%.
Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV
Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.
2017-10-01
The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.
Alexander, K; Northrup, N; Clarke, D; Lindell, H; Laver, T
2018-02-15
Engineering controls (EC, facility and equipment barriers between hazards and people) are used to avoid exposure to chemotherapy drugs. In this study, American College of Veterinary Internal Medicine board-certified veterinary oncologists were surveyed about their use of containment primary EC (C-PEC) and supplemental EC (closed system transfer devices, CSTD). The survey was completed by 148 (38%) of practicing diplomates. All used EC. Both C-PEC and CSTD were used at 92% of hospitals; however, US Pharmacopoeial Convention Chapter (USP ) standards were met at only 19% of hospitals and oncologists did not know the type of C-PEC at 18% of hospitals. Next, surface contamination and EC use were assessed with environmental surveillance for carboplatin, cyclophosphamide, doxorubicin, and vincristine in 20 veterinary specialty hospitals using a commercially available kit. No contamination with carboplatin, doxorubicin, or vincristine was detected, however, there was contamination with cyclophosphamide at 4 hospitals. Based on this study, most veterinary oncologists use C-PEC and CSTD, but few meet USP standards. Current measures appear effective for preventing contamination with IV drugs, but additional measures are needed for oral drugs. © 2018 John Wiley & Sons Ltd.
African Journals Online (AJOL)
USER
2015-06-01
Jun 1, 2015 ... ABSTRACT. Graviola (Annona muricata) Nigeria it is commonly called “Mama” in Hausa language is a tropical plant found in Nigeria in the Sudan- Guinea Savannah vegetation zone has been reported to be used in the treatment of various types of ailments. The present study investigated the antibacterial ...
African Journals Online (AJOL)
DR. AMIN
2011-06-01
Jun 1, 2011 ... pathogens were isolated using Blood and Chocolate agar plates and identified biochemically except the Acid Fast Bacilli (AFB) which was tested in all the HIV positive samples by Ziehl Neelson staining technique. The fungal pathogens were isolated using Sabouraud Dextrose Agar (SDA) with antibiotics ...
African Journals Online (AJOL)
DR. AMIN
2011-06-01
Jun 1, 2011 ... Ethical clearances from Aminu Kano Teaching Hospital Kano (AKTH) and Hospitals Management. Board, Kano State ... isolated among the 72 HIV positive patients were 139 as follows: Streptococcus pneumoniae (4%),. Klebsiella ... on HIV/AIDS and. Sexually transmitted infections, Federal government of.
Fowler, J. W.; Acquaviva, V.; Ade, P. A. R.; Aguirre, P.; Amiri, M.; Appel, J. W.; Barrientos, L. F.; Bassistelli, E. S.; Bond, J. R.; Brown, B.;
2010-01-01
We present a measurement of the angular power spectrum of the cosmic microwave background (CMB) radiation observed at 148 GHz. The measurement uses maps with 1.4' angular resolution made with data from the Atacama Cosmology Telescope (ACT). The observations cover 228 deg(sup 2) of the southern sky, in a 4 deg. 2-wide strip centered on declination 53 deg. South. The CMB at arc minute angular scales is particularly sensitive to the Silk damping scale, to the Sunyaev-Zel'dovich (SZ) effect from galaxy dusters, and to emission by radio sources and dusty galaxies. After masking the 108 brightest point sources in our maps, we estimate the power spectrum between 600 less than l less than 8000 using the adaptive multi-taper method to minimize spectral leakage and maximize use of the full data set. Our absolute calibration is based on observations of Uranus. To verify the calibration and test the fidelity of our map at large angular scales, we cross-correlate the ACT map to the WMAP map and recover the WMAP power spectrum from 250 less than l less than 1150. The power beyond the Silk damping tail of the CMB (l approximately 5000) is consistent with models of the emission from point sources. We quantify the contribution of SZ clusters to the power spectrum by fitting to a model normalized to sigma 8 = 0.8. We constrain the model's amplitude A(sub sz) less than 1.63 (95% CL). If interpreted as a measurement of as, this implies sigma (sup SZ) (sub 8) less than 0.86 (95% CL) given our SZ model. A fit of ACT and WMAP five-year data jointly to a 6-parameter ACDM model plus point sources and the SZ effect is consistent with these results.
Directory of Open Access Journals (Sweden)
A. Berchet
2017-09-01
Full Text Available Hourly NOx concentrations were simulated for the city of Zürich, Switzerland, at 10 m resolution for the years 2013–2014. The simulations were generated with the nested mesoscale meteorology and micro-scale dispersion model system GRAMM–GRAL (versions v15.12 and v14.8 by applying a catalogue-based approach. This approach was specifically designed to enable long-term city-wide building-resolving simulations with affordable computation costs. It relies on a discrete set of possible weather situations and corresponding steady-state flow and dispersion patterns that are pre-computed and then matched hourly with actual meteorological observations. The modelling system was comprehensively evaluated using eight sites continuously monitoring NOx concentrations and 65 passive samplers measuring NO2 concentrations on a 2-weekly basis all over the city. The system was demonstrated to fulfil the European Commission standards for air pollution modelling at nearly all sites. The average spatial distribution was very well represented, despite a general tendency to overestimate the observed concentrations, possibly due to a crude representation of traffic-induced turbulence and to underestimated dispersion in the vicinity of buildings. The temporal variability of concentrations explained by varying emissions and weather situations was accurately reproduced on different timescales. The seasonal cycle of concentrations, mostly driven by stronger vertical dispersion in summer than in winter, was very well captured in the 2-year simulation period. Short-term events, such as episodes of particularly high and low concentrations, were detected in most cases by the system, although some unrealistic pollution peaks were occasionally generated, pointing at some limitations of the steady-state approximation. The different patterns of the diurnal cycle of concentrations observed in the city were generally well captured as well. The evaluation confirmed the
Berchet, Antoine; Zink, Katrin; Oettl, Dietmar; Brunner, Jürg; Emmenegger, Lukas; Brunner, Dominik
2017-09-01
Hourly NOx concentrations were simulated for the city of Zürich, Switzerland, at 10 m resolution for the years 2013-2014. The simulations were generated with the nested mesoscale meteorology and micro-scale dispersion model system GRAMM-GRAL (versions v15.12 and v14.8) by applying a catalogue-based approach. This approach was specifically designed to enable long-term city-wide building-resolving simulations with affordable computation costs. It relies on a discrete set of possible weather situations and corresponding steady-state flow and dispersion patterns that are pre-computed and then matched hourly with actual meteorological observations. The modelling system was comprehensively evaluated using eight sites continuously monitoring NOx concentrations and 65 passive samplers measuring NO2 concentrations on a 2-weekly basis all over the city. The system was demonstrated to fulfil the European Commission standards for air pollution modelling at nearly all sites. The average spatial distribution was very well represented, despite a general tendency to overestimate the observed concentrations, possibly due to a crude representation of traffic-induced turbulence and to underestimated dispersion in the vicinity of buildings. The temporal variability of concentrations explained by varying emissions and weather situations was accurately reproduced on different timescales. The seasonal cycle of concentrations, mostly driven by stronger vertical dispersion in summer than in winter, was very well captured in the 2-year simulation period. Short-term events, such as episodes of particularly high and low concentrations, were detected in most cases by the system, although some unrealistic pollution peaks were occasionally generated, pointing at some limitations of the steady-state approximation. The different patterns of the diurnal cycle of concentrations observed in the city were generally well captured as well. The evaluation confirmed the adequacy of the catalogue
Patel, Vishal; Carrion, Katrina; Hollands, Andrew; Hinton, Andrew; Gallegos, Thomas; Dyo, Jeffrey; Sasik, Roman; Leire, Emma; Hardiman, Gary; Mohamed, Salah A.; Nigam, Sanjay; King, Charles C.; Nizet, Victor; Nigam, Vishal
2015-01-01
Bicuspid aortic valves calcify at a significantly higher rate than normal aortic valves, a process that involves increased inflammation. Because we have previously found that bicuspid aortic valve experience greater stretch, we investigated the potential connection between stretch and inflammation in human aortic valve interstitial cells (AVICs). Microarray, quantitative PCR (qPCR), and protein assays performed on AVICs exposed to cyclic stretch showed that stretch was sufficient to increase expression of interleukin and metalloproteinase family members by more than 1.5-fold. Conditioned medium from stretched AVICs was sufficient to activate leukocytes. microRNA sequencing and qPCR experiments demonstrated that miR-148a-3p was repressed in both stretched AVICs (43% repression) and, as a clinical correlate, human bicuspid aortic valves (63% reduction). miR-148a-3p was found to be a novel repressor of IKBKB based on data from qPCR, luciferase, and Western blot experiments. Furthermore, increasing miR-148a-3p levels in AVICs was sufficient to decrease NF-κB (nuclear factor kappa-light-chain-enhancer of activated B cells) signaling and NF-κB target gene expression. Our data demonstrate that stretch-mediated activation of inflammatory pathways is at least partly the result of stretch-repression of miR-148a-3p and a consequent failure to repress IKBKB. To our knowledge, we are the first to report that cyclic stretch of human AVICs activates inflammatory genes in a tissue-autonomous manner via a microRNA that regulates a central inflammatory pathway.—Patel, V., Carrion, K., Hollands, A., Hinton, A., Gallegos, T., Dyo, J., Sasik, R., Leire, E., Hardiman, G., Mohamed, S. A., Nigam, S., King, C. C., Nizet, V., Nigam V. The stretch responsive microRNA miR-148a-3p is a novel repressor of IKBKB, NF-κB signaling, and inflammatory gene expression in human aortic valve cells. PMID:25630970
Directory of Open Access Journals (Sweden)
Haichong Wu
2018-02-01
Full Text Available IFN-τ, a type I interferon produced by the trophoblasts of ruminants, has various important immune functions, including effects on the expression of major histocompatibility complex (MHC class I (MHC-I. A previous study has reported that IFN-τ promotes the expression of MHC-I molecules on endometrial cells. However, the immunological mechanisms by which IFN-τ regulates MHC-I molecules remain unknown. Here, we investigated which microRNA (miRNAs may be involved in the regulation of MHC-I molecule expression and function in bovine endometrial epithelial cells (bEECs. By using TargetScan 6.2 and http://www.microRNA.org, two miRNAs were suggested to target the 3′UTR of the bovine MHC-I heavy chain: bta-miR-148b and bta-miR-152. Dual luciferase reporter and miRNA mimic/inhibitor assays suggested that bta-miR-148b/152 were negatively correlated with bovine MHC-I heavy chain genes. The function of the MHC-I heavy chain was then investigated using qRT-PCR, ELISA, western blotting, immunofluorescence, and RNA interference assays in primary bEECs and an endometrial epithelial cell line (BEND. The results demonstrated that bta-miR-148b/152 could promote TLR4-triggered inflammatory responses by targeting the bovine MHC-I heavy chain, and the MHC-I molecule negatively regulated TLR4-induced inflammatory reactions may through the Fps-SHP-2 pathway. Our discovery offers novel insight into negative regulation of the TLR4 pathway and elucidates the mechanism by which bovine MHC-I molecules control congenital inflammatory reactions.
Energy Technology Data Exchange (ETDEWEB)
Naceur, Benhadria, E-mail: nacer1974@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Abdelkader, Elaziouti, E-mail: elaziouti_a@yahoo.com [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Dr Moulay Tahar University, Saida (Algeria); Nadjia, Laouedj, E-mail: nlaouedj@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Dr Moulay Tahar University, Saida (Algeria); Sellami, Mayouf, E-mail: Mourad7dz@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria); Noureddine, Bettahar, E-mail: nbettahar2001@yahoo.fr [Laboratory of Inorganic Materials Chemistry and Application, Department of Materials Engineering, University of Science and Technology of Oran (USTO M.B), BP 1505, El M’naouar, 31000 Oran (Algeria)
2016-02-15
Graphical abstract: Heterogeneous photo Fenton process with dye sensitized mechanism of RhB by Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} compound. - Highlights: • Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} (BSCO) catalyst was synthesized by improved solid state reaction method. • BSCO/H{sub 2}O{sub 2}/UVA and BSCO/H{sub 2}O{sub 2}/SL catalyst systems exhibit excellent photocatalytic activities for rhodamine B. • The photocatalytic degradation was preceded via heterogeneous photo Fenton mechanism process. • ·OH radicals are the main reactive species for the degradation of RhB. - Abstract: Novel nanostructure pyrochlore Bi{sub 1.56}Sb{sub 1.48}Co{sub 0.96}O{sub 7} was successfully synthesized via solid state reaction method in air. The as-synthesized photocatalyst was characterized by X-ray diffraction, Scanning electron microscopy and UV–vis diffuse reflectance spectroscopy techniques. The results showed that the BSCO was crystallized with the pyrochlore-type structure, cubic crystal system and space group Fd3m. The average particle size and band gap for BSCO were D = 76.29 nm and E{sub g} = 1.50 eV respectively. Under the optimum conditions for discoloration of the dye: initial concentration of 20 mg L{sup −1} RhB, pH 7, 25 °C, 0.5 mL H{sub 2}O{sub 2} and BSCO/dye mass ration of 1 g L{sup −1}, 97.77 and 90.16% of RhB were removed with BSCO/H{sub 2}O{sub 2} photocatalytic system within 60 min of irradiation time under UVA- and SL irradiations respectively. Pseudo-second-order kinetic model gave the best fit, with highest correlation coefficients (R{sup 2} ≥ 0.99). On the base of these results, the mechanism of the enhancement of the discoloration efficiency was discussed. .
Uthailak, Naphatsamon; Mahamad, Pornpimol; Chittavanich, Pamorn; Yanarojana, Somchai; Wijagkanalan, Wassana; Petre, Jean; Panbangred, Watanalai
2017-05-01
CRM197 is a diphtheria toxin (DT) mutant (G52E) which has been used as a carrier protein for conjugate vaccines. However, it still possesses cytotoxicity toward mammalian cells. The goal of this project was to produce a non-toxic and soluble CRM197EK through introduction of triple amino acid substitutions (K51E/G52E/E148K) in Escherichia coli. The expression of CRM197EKTrxHis was optimized and co-expressed with different molecular chaperones. The soluble CRM197EKTrxHis was produced at a high concentration (97.33 ± 17.47 μg/ml) under the optimal condition (induction with 0.1 mM IPTG at 20 °C for 24 h). Cells containing pG-Tf2, expressing trigger factor and GroEL-GroES, accumulated the highest amount of soluble CRM197EKTrxHis at 111.24 ± 10.40 μg/ml after induction for 24 h at 20 °C. The soluble CRM197EKTrxHis still possesses nuclease activity and completely digest λDNA at 25 and 37 °C with 8- and 4-h incubation, respectively. Molecular modeling of diphtheria toxin, CRM197 and CRM197EK indicated that substitutions of two amino acids (K51E/E148K) may cause poor NAD binding, consistent with the lack of toxicity. Therefore, CRM197EK might be used as a new potential carrier protein. However, further in vivo study is required to confirm its roles as functional carrier protein in conjugate vaccines.
Inelastic scattering of neutrons by spin waves in terbium
DEFF Research Database (Denmark)
Bjerrum Møller, Hans; Houmann, Jens Christian Gylden
1966-01-01
Measurements of spin-wave dispersion relations for magnons propagating in symmetry directions in ferromagnetic Tb; it is first experiment to give detailed information on magnetic excitations in heavy rare earths; Tb was chosen for these measurements because it is one of few rare-earth metals whic...... does not have very high thermal-neutron capture cross section, so that inelastic neutron scattering experiments can give satisfactory information on magnon dispersion relations....
Coherent magnetic structures in terbium/holmium superlattices
DEFF Research Database (Denmark)
Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.
1997-01-01
Neutron-scattering techniques have been used to investigate the magnetic properties of three Tb/Ho superlattices grown by molecular-beam epitaxy. It is revealed that for temperatures in the range T = 10 to T-N(Ho)approximate to 130 K, there is a basal-plane ferromagnetic alignment of Tb moments w...
Directory of Open Access Journals (Sweden)
Mohamad Anuri Ghazali
2013-01-01
Full Text Available This study reports the findings of resistivity surveys which were conducted at the initiation area of debris flow at KM 9, Fraser’s Hill Gap road (FT148. The study involves three slope parallel survey lines and two lines perpendicular to the slope face. The parallel lines are FH01, FH02, and FH03, while the lines FH04 and FH05 are perpendicular. A granite body was detected at the central part of the east line and is nearest to the ground surface along FH02. The existence of low resistivity zones within the granite body is interpreted as highly fractured, water conducting zones. These zones are continuous as they have been detected in both the east-west as well as the north-south lines. The residual soil layer is relatively thin at zones where weathered granite dominates the slope face of the failure mass. The weak layer is relatively thick with an estimated thickness of 80 m and water flow occurs at the base of it. The high water flow recorded from the horizontal drains further supports the possible existence of these highly fractured, water conducting zones located within the granite. The shallow fractured granite is virtually “floating” above the water saturated zone and therefore is considered unstable.
Directory of Open Access Journals (Sweden)
Sirikul Manochantr
2017-01-01
Full Text Available Mesenchymal stromal cells (MSCs offering valuable anticipations for the treatment of degenerative diseases. They can be found in many tissues including amnion. MSCs from amnion (AM-MSCs can differentiate into osteoblast similar to that of bone marrow-derived MSCs (BM-MSCs. However, the ability is not much efficient compared to BM-MSCs. This study aimed to examine the effects of BMP-2 and miRNAs on osteogenic differentiation of AM-MSCs compared to those of BM-MSCs. The osteogenic differentiation capacity after miRNA treatment was assessed by ALP expression, ALP activity, and osteogenic marker gene expression. The results showed that the osteogenic differentiation capacity increased after BMP-2 treatment both in AM-MSCs and BM-MSCs. MiR-31, miR-106a, and miR-148a were downregulated during the osteogenic differentiation. After transfection with anti-miRNAs, ALP activity and osteogenic genes were increased over the time of differentiation. The data lead to the potential for using AM-MSCs as an alternative source for bone regeneration. Moreover, the information of miRNA expression and function during osteogenic differentiation may be useful for the development of new therapeutics or enhanced an in vitro culture technique required for stem cell-based therapies in the bone regeneration.
African Journals Online (AJOL)
pc
2017-06-01
Jun 1, 2017 ... Others include pharmaceuticals, food additives, cosmetics, drugs and dyes. Some of these can be carcinogenic(Mitchell, 1992; Wilson and Jones, 1992;. Alexander, 1994; Pepper et al., 2006). These chemicals are produced in industrial processes such as gasification / liquefaction of fuels, catalytic cracking,.
32 CFR 148.13 - Responsibilities.
2010-07-01
... that implementation encourages reporting of instances of non-compliance, without fear of reprisal, and each reported instance is aggressively acted upon. (d) The Director, Information Security Oversight Office (ISOO), consistent with his assigned responsibilities under Executive Order 12829, serves as the...
2010-07-01
... facilities. The SPB Staff will publish a comprehensive directory of agency points of contact. (b) After... random, and be based upon risk-management principles. Security Reviews may be conducted “for cause”, to... the effectiveness of interagency reciprocity implementation. Administration of the survey shall be...
Publications | Page 148 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Innovative policies and new technologies that reduce water waste are helping countries across the Middle East and North Africa deal with chronic water shortages. ... Fighting Eviction: Tribal Land Rights and Research-in-Action. A new book ... As the United Nations International Year of Water Cooperation gets underway,.
45 CFR 148.220 - Excepted benefits.
2010-10-01
... insurance. These benefits include the following: (1) Limited scope dental or vision benefits. These benefits are dental or vision benefits that are limited in scope to a narrow range or type of benefits that are... expected to be chronic. (3) Coverage only for a specified disease or illness (for example, cancer policies...
2010-07-01
... maintaining the secure posture of shared facilities will reduce the aggregate costs, promote interoperability... Energy or the Chairman of the Nuclear Regulatory Commission under the Atomic Energy Act of 1954, as...
2010-01-01
... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...
19 CFR 148.81 - General provisions.
2010-04-01
... be exempt also from the payment of any internal revenue tax imposed upon or by reason of importation. ... (CONTINUED) PERSONAL DECLARATIONS AND EXEMPTIONS Personnel of Foreign Governments and International... accorded only if reciprocal privileges are granted by the foreign government involved to U.S. personnel of...
Publications | Page 148 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...
Reference: 148 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available nori et al. 2004 Jul. Plant Mol. Biol. 55(4):567-77. 4-Hydroxybenzoate polyprenyl diphosphate transferase (4...HPT) is the key enzyme that transfers the prenyl side chain to the benzoquione frame in ubiquinone (UQ) bios...ynthesis. The Arabidopsis AtPPT1 cDNA encoding 4HPT was cloned by reverse transcr...the function of the gene was determined. Heterologous expression of the AtPPT1 gene enabled restoration of the re...HPT activity. The mitochondrial fraction that was prepared from the yeast mutant, which expressed the AtPPT1
Unit 148 - World Wide Web Basics
148, CC in GIScience; Yeung, Albert K.
2000-01-01
This unit explains the characteristics and the working principles of the World Wide Web as the most important protocol of the Internet. Topics covered in this unit include characteristics of the World Wide Web; using the World Wide Web for the dissemination of information on the Internet; and using the World Wide Web for the retrieval of information from the Internet.
Iacono, Fabrizio; Prezioso, Domenico; Di Lauro, Giovanni; Romeo, Giuseppe; Ruffo, Antonio; Illiano, Ester; Amato, Bruno
2012-01-01
Over the past years laser technology has played a predominant role in prostate surgery, for the treatment of benign prostate hypertrophy (BPH). Various laser devices have been introduced in clinical practice, showing good results in terms of complications and urodynamic outcomes efficacy compared with TURP and Open Prostatectomy.In this study we describe the efficacy and the safety profile of a novel laser technique, ThuLEP (Thulium Laser Enucleation of Prostate) that permits a complete anatomical endoscopic enucleation of prostatic adenoma independently to prostate size. 148 patients with a mean age of 68.2 years were enrolled between September 2009 and March 2012 (36 months), and treated for BPH with ThuLEP. Every patient was evaluated at base line according to: Digital Rectal Examination (DRE), prostate volume, Post-Voided volume (PVR), International Prostate Symptoms Score (I-PSS), International Index of Erectile Function-5 (IIEF-5), Quality of Life (QoL), PSA values, urine analysis and urine culture, uroflowmetry. The same evaluation was conducted after a 12 month follow-up. ThuLEP was performed by 2 expert surgeons. Our data showed a better post-operative outcome in terms of catheter removal, blood loss, TURP syndrome, clot retention and residual tissue compared to large series of TURP and OP. Only 1.3% of patients had bladder wall injury during morcellation. I-PSS, Qmax, Prostate Volume, QoL and PVR showed a highly significant improvement at 12 month follow-up in comparison to preoperative assessment. ThuLEP represent an innovative option in patients with BPH. It is a size independent surgical endoscopic technique and it can be considered the real alternative, at this time, to TURP and even more to Open Prostatectomy for large prostate, with a complete removal of adenoma and with a low complication rate.
Fassih, Malika; Abada, Redallah; Rouadi, Sami; Mahtar, Mohamed; Roubal, Mohamed; Essaadi, Mustapha; El Kadiri, Mohamed Fatmi
2014-01-01
Les tumeurs des glandes salivaires sont rares, elles représentent moins de 3% de l'ensemble des tumeurs. Les tumeurs bénignes sont les plus fréquentes dominées par l'adénome pléomorphe, la glande parotide reste la localisation la plus commune. L'objectif de ce travail est d’évaluer la contribution des 3 méthodes d'imagerie: échographie, TDM et IRM dans la différentiation entre tumeur maligne et lésion bénigne. C'est une étude rétrospective à propos de 148 cas de tumeurs des glandes salivaires collectés sur 5 ans. Les paramètres étudiés étaient l’âge, le sexe du patient, le motif de consultation, les données de l'examen clinique, les données de l'imagerie. Chacun des critères radiologiques utilisés pour déterminer la nature de la tumeur a été analysée et corrélé avec les données de l'histologie. L'analyse s'est basée sur le test du X2 et le calcul du p. Nous avons calculé la sensibilité, la spécificité et l'efficacité diagnostique pour chaque modalité. La localisation parotidienne était prédominante (80%), les tumeurs bénignes ont représenté 76%, dominés par l'adénome pléomorphe. L’échographie a révélé que seulement la présence de quelques critères prédisent le caractère malin de la masse: les limites floues, irrégulières, et la présence d'adénopathies (p < 0,05). A la TDM, seules les limites floues de la masse et l'extension aux tissus adjacents étaient des indicateurs de malignité. A l'IRM, l'irrégularité des contours, l'hyposignal et le signal intermédiaire en séquences T1 et T2, et l'extension aux tissus avoisinants étaient en faveur de la malignité. La corrélation entre résultats de l'imagerie et diagnostic histologique a révélé la supériorité de l'IRM par rapport au scanner et à l’échographie, en termes de sensibilité, spécificité et efficacité diagnostique. L’évaluation préopératoire des tumeurs des glandes salivaires est devenue un challenge pour les ORL et les
Hawthorne, P. J.
1976-01-01
Data obtained in wind tunnel test OA148 are presented. The objectives of the test series were to: (1) obtain pressure distributions, forces and moments over the vehicle 5 orbiter in the thermal area energy management (TAEM) and approach phases of flight; (2) obtain elevon and rudder hinge moments in the TAEM and approach phases of flight; (3) obtain body flap and elevon loads for verification of loads balancing with integrated pressure distributions; and (4) obtain pressure distributions near the short OMS pods in the high subsonic, transonic and low supersonic Mach number regimes.
148 decentralization for national development in nigeria from a ...
African Journals Online (AJOL)
Ike Odimegwu
entrepreneurship in order to enlarge multi economic relations for national development. It concluded by recommending Israelite egalitarian system of stewardship and accountability for a decentralization of economic control towards improvement of the rural constituent regions. There should also be fund from the Federal.
Lifescience Database Archive (English)
Full Text Available 853 |BI435853.1 EST538614 P. infestans-challenged potato leaf, compatible reaction Solanum tuberosum cDNA cl...one PPCCL22 5' sequence, mRNA sequence. 48 0.29 1 BG591390 |BG591390.1 EST499232 P. infestans-challenged... 48 0.29 1 BI435340 |BI435340.1 EST538101 P. infestans-challenged leaf Solanum tuberosum cDNA clone PPCCD08
Lifescience Database Archive (English)
Full Text Available 2001. 6. 1 Translated Amino Acid sequence ---DAKSATPAPASSAPAAPVAPAVSSTPVESKKGPGLGAVFGELSKGDGVTSGLKKVTN D...Amino Acid sequence (All Frames) Frame A: ---DAKSATPAPASSAPAAPVAPAVSSTPVESKKGPGLGAVFGELSKGDGVTSGLKKVTN D
11 CFR 100.148 - Volunteer activity for candidate.
2010-01-01
... for Federal office, provided that the payment is not for the use of broadcasting, newspapers, magazines, billboards, direct mail or similar types of general public communication or political advertising...
Lifescience Database Archive (English)
Full Text Available 5) (NFKB1) gene, complete cds. 34 0.085 4 BZ175628 |BZ175628.1 CH230-348M8.TJ CHORI-230 Segment 2 Rattus nor...46 0.33 3 BH346715 |BH346715.1 CH230-54D1.TV CHORI-230 Segment 1 Rattus norvegicu
Lifescience Database Archive (English)
Full Text Available |AI067329.1 EST209007 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNAS63...|AI067953.1 EST209642 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNCH20...|AI067936.1 EST209624 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNCG92...54 0.002 1 BU776849 |BU776849.1 SJEDDD08 SJE Schistosoma japonicum cDNA, mRNA sequence. 54 0.002 1 AI067312...|AI067312.1 EST208990 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNAS44
Lifescience Database Archive (English)
Full Text Available Acid sequence KPNLYIYIFNKKKKKKKTNYSKKMTXTNIDINSLNIKEKEEKEEGLIKDKSKKELKKLQK QQYKQQKKQEKKNNKVNKVINEGVP...ktl*iisc**slfti--- Frame C: KPNLYIYIFNKKKKKKKTNYSKKMTXTNIDINSLNIKEKEEKEEGLIKDKSKKELKKLQK QQYKQQKKQEKKNNKVNKVINEGVP
Lifescience Database Archive (English)
Full Text Available *kkmtdnwdkeklakkaaeglknakntassyasgi naskdqlnsnfknikenissnlnnakhtieenvhnaqrtgyppkvpapgsnkfigflalg vfg...*kkmtdnwdkeklakkaaeglknakntassya sginaskdqlnsnfknikenissnlnnakhtieenvhnaqrtgyppkvpapgsnkfigfl algvfglfawkf*kxkk
Publications | Page 148 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
TICs en las PYMES de Centroamérica : Impacto de la adopción de las tecnologías de la información y la comunicación. La révolution numérique, les technologies de l'information et de la communication (TIC) et la mondialisation font peser de nouvelles menaces sur la performance des micro, petites et moyennes ...
What we do | Page 148 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Electronic Health Delivery using Open Source Software and Personal Digital Assistants (Argentina and Colombia). This project aims to strengthen primary healthcare delivery to vulnerable populations through the use of information and communication technology (ICT), specifically, personal digital assistants (PDAs) and ...
Lifescience Database Archive (English)
Full Text Available DHEVLAIGYGTYQGQDYFLV KNSWSTNWGMDGYVYMARNDNNLCGVSSQATYPIPTKN*issinpin Translated Amino Acid sequence (All Fra...mes) Frame A: ne*ihfiiiishiimctcssttpscstilyerfiqysifqyc*tn*inl*fs**ssiy*c lqwygyyhqllqsr*yiqcrss*i*yglyhypr
Lifescience Database Archive (English)
Full Text Available Amino Acid sequence ---SEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKKIQ NMDPHELYTYAKEIQAPLE...tke k*iisi Frame B: ---SEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKKIQ NMDPHELYTYAKEIQAPLE
Uniforms and Dress-Code Policies. ERIC Digest Number 148.
Lumsden, Linda
This digest examines schools' dress-code policies and discusses the legal considerations and research findings about the effects of such changes. Most revisions to dress codes involve the use of uniforms, typically as a way to curb school violence and create a positive learning environment. A recent survey of secondary school principals found that…
75 FR 2894 - Withdrawal of Regulatory Guide 1.148
2010-01-19
... by the American Society of Mechanical Engineers/ American National Standards Institute (ASME/ANSI... Operated Valve (MOV) actuators). ASME/ANSI Standard N278.1-1975 has been superseded by ASME QME-1, which... Mechanical Equipment for Nuclear Power Plants,'' which endorses ASME QME-1. II. Further Information The...
Lifescience Database Archive (English)
Full Text Available ents: (bits) Value N CB292163 |CB292163.1 UCRCS01_04ac07_g1 Washington Navel orange cold acclimated flavedo ...WORKING DRAFT SEQUENCE, in ordered pieces. 34 0.27 2 CB292162 |CB292162.1 UCRCS01_04ac07_b1 Washington Navel orange cold acclimate
Lifescience Database Archive (English)
Full Text Available 13. 40 3e-08 10 AE017308 |AE017308.1 Mycoplasma mobile 163K complete genome. 34 7e-08 30 dna update 2005...Value AE017308_486( AE017308 |pid:none) Mycoplasma mobile 163K complete ... 50 2e-04 ( Q25802 ) RecName:
South of Sahara | Page 148 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
This brief showcases the research carried out by the International Livestock Research Institute to explore the gender implications of livestock ownership on poverty ... Language English. Lorsqu'elles gèrent leurs propres revenus, les femmes peuvent jouir d'un plus grand pouvoir de négociation, réduire la violence conjugale ...
Lifescience Database Archive (English)
Full Text Available ic acid sequences characterized by their enhanced expression in good prognostic human neuroblastoma upon comparison between good...ated in human neuroblastoma with good prognosis, in comparion between human neuroblastoma with good prognosi
26 CFR 148.1-5 - Constructive sale price.
2010-04-01
... for cooking, warming, or keeping warm food or beverages for consumption on the premises; (c) Taxable... industries: (a) Taxable automobile trucks (consisting of automobile truck bodies and chassis); (b) Taxable automobile buses (consisting of automobile bus bodies and chassis); (c) Taxable truck and bus trailers and...
49 CFR 1.48 - Delegations to Federal Highway Administrator.
2010-10-01
... design, construction and maintenance, traffic control devices, identification and surveillance of accident locations, and highway-related aspects of pedestrian and bicycle safety. (6) Exercise the...
All projects related to | Page 148 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Childhood obesity rates in South America are steadily increasing. Topic: SOUTH AMERICA, LATIN AMERICA, MEDIA, FOOD CONSUMPTION, ADVERTISING, MATERNAL AND CHILD HEALTH. Region: Argentina. Program: Food, Environment, and Health. Total Funding: CA$ 258,800.00. Promoting Inclusive, Accountable ...
What we do | Page 148 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Because of the prevalence and intensity of poverty, populations in sub-Saharan Africa are highly vulnerable to the negative impacts of climate change, particularly those who depend on an environment that is already degraded. Ghana, Mali, Mozambique, Tanzania, Uganda, Zambia, Zimbabwe, North Of Sahara, South Of ...
46 CFR 148.01-7 - Permitted cargoes.
2010-10-01
... open flames. Sodium nitrate Oxidizing material If involved in a fire will greatly intensify the burning of combustible materials. Sodium nitrate, potassium nitrate mixture; 67 pct Sodium nitrate, 30 pct... cause self heating and the evolution of flammable gas. Aluminum nitrate Oxidizing materials If involved...
Lifescience Database Archive (English)
Full Text Available egg. 42 5e-06 3 CF446374 |CF446374.1 EST682719 normalized cDNA library of onion Allium cepa cDNA clone ACAH...Y76, mRNA sequence. 64 5e-06 1 CF440839 |CF440839.1 EST677184 normalized cDNA library of onion Allium cepa c
Lifescience Database Archive (English)
Full Text Available tempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 64 length of database: 80,480,566 effective... HSP length: 16 effective length of query: 48 effective ...length of database: 78,918,790 effective search space: 3788101920 effective search space used: 3788101920 T:...of query: 64 length of database: P,794,892,705 effective HSP length: 21 effective length of query: 43 effe...ctive length of database: P,261,936,330 effective search space: 1387263262190 effective
2012-12-26
... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE..., until February 26, 2013. Submissions (original and one electronic copy) shall be addressed to the Board's Executive Secretary at: Foreign-Trade Zones Board, U.S. Department of Commerce, Room 21013, 1401...
Photoluminescence studies of a Terbium(III) complex as a fluorescent probe for DNA detection
Energy Technology Data Exchange (ETDEWEB)
Khorasani-Motlagh, Mozhgan, E-mail: mkhorasani@chem.usb.ac.ir; Noroozifar, Meissam; Niroomand, Sona; Moodi, Asieh
2013-11-15
The photoluminescence properties of a Tb(III) complex of the form [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] (phen=1,10-phenanthroline) in different solvents are presented. It shows the characteristic luminescence of the corresponding Ln{sup 3+} ion in the visible region. The emission intensity of this complex in coordinating solvent is higher than non-coordinating one. The suggested mechanism for the energy transfer between the ligand and Tb{sup 3+} ion is the intramolecular energy transfer mechanism. The interactions of the Tb(III) complex with fish salmon DNA are studied by fluorescence spectroscopy, circular dichroism study and viscosity measurements. The results of fluorescence titration reveal that DNA strongly quenches the intrinsic fluorescence of the complex through a static quenching procedure. The binding constant (K{sub b}) of the above metal complex at 25 °C is determined by the fluorescence titration method and it is found to be (8.06±0.01)×10{sup 3} M{sup −1}. The thermodynamic parameters (ΔH{sup 0}>0, ΔS{sup 0}>0 and ΔG{sup 0}<0) indicate that the hydrophobic interactions play a major role in DNA–Tb complex association. The results support the claim that the title complex bonds to FS-DNA by a groove mode. -- Highlights: • Photoluminescence of [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] in different solvents are studied. • Tb(III) complex shows good binding affinity to FS DNA with K{sub b}=(8.06±0.01)×10{sup 3} M{sup −1}. • Viscosity of DNA almost unchanged by increasing amount of Tb complex. • CD spectrum of DNA has a little change with increasing amount of Tb complex. • Thermodynamic parameters indicate that the binding reaction is entropically driven.
Lanthanides in Nuclear Medicine. The Production of Terbium-149 by Heavy Ion Beams
Dmitriev, S N; Zaitseva, N G; Maslov, O D; Molokanova, L G; Starodub, G Ya; Shishkin, S V; Shishkina, T V
2001-01-01
Among radioactive isotopes of lanthanide series elements, finding the increasing using in nuclear medicine, alpha-emitter {149}Tb (T_{1/2} = 4.118 h; EC 76.2 %; beta^+ 7.1 %; alpha 16.7 %) is considered as a perspective radionuclide for radioimmunotherapy. The aim of the present work is to study experimental conditions of the {149}Tb production in reactions Nd({12}C, xn){149}Dy (4.23 min; beta^+, EC)\\to {149}Tb when the Nd targets have been irradiated by heavy ions of carbon. On the basis of results of formation and decay of {149}Dy\\to{149}Tb evaluation of the {149}Tb activity, is made which can be received under optimum conditions (enriched {142}Nd target, {12}C ions with the energy 120 MeV and up to current 100 mu A, time of irradiating 8-10 hours). Under these conditions {149}Tb can be obtained up to 30 GBq (up to 0.8 Ci).
Poly[[aqua-?3-picolinato-?2-picolinato-dipicolinatopotassium(I)terbium(III)] 2.5-hydrate
Filipe A. Almeida Paz; João Rocha; Jacek Klinowski; Tito Trindade; Nogueira,Helena I. S.; Soares-Santos, Paula C. R.; Cunha-Silva, Lu?s
2008-01-01
In the title compound, [KTb(C6H4NO2)4(H2O)]·2.5H2O, each Tb3+ centre is coordinated by four N and five O atoms from five distinct picolinate ligands in a geometry resembling a highly distorted tricapped trigonal prism. One of the ligands establishes a skew bridge between neighbouring Tb3+ centres, leading to the formation of one-dimensional anionic polymeric chains, {[(C6H4NO2)4Tb]−}n, running along the direction [010]. Each K+ cation is seven-coordinated by six O atoms from one an...
Spin waves in terbium. III. Magnetic anisotropy at zero wave vector
DEFF Research Database (Denmark)
Houmann, Jens Christian Gylden; Jensen, J.; Touborg, P.
1975-01-01
The energy gap at zero wave vector in the spin-wave dispersion relation of ferromagnetic. Tb has been studied by inelastic neutron scattering. The energy was measured as a function of temperature and applied magnetic field, and the dynamic anisotropy parameters were deduced from the results....... The axial anisotropy is found to depend sensitively on the orientation of the magnetic moments in the basal plane. This behavior is shown to be a convincing indication of considerable two-ion contributions to the magnetic anisotropy at zero wave vector. With the exception of the sixfold basal...... the effects of zero-point deviations from the fully aligned ground state, and we tentatively propose polarization-dependent two-ion couplings as their origin....
Structural and Magnetic Anisotropy in Amorphous Terbium-Iron Thin Films
Hufnagel, Todd Clayton
1995-01-01
High density, removable media magnetooptic disk drives have recently begun to make significant gains in the information mass storage market. The media in these disks are amorphous rare-earth/transition-metal (RE-TM) alloys. One vital property of these materials is a large perpendicular magnetic anisotropy; that is, an easy axis of magnetization which is perpendicular to the plane of the film. A variety of theories, sometimes contradictory, have been proposed to account for this surprising presence of an anisotropic property in an amorphous material. Recent research indicates that there is an underlying atomic-scale structural anisotropy which is responsible for the observed magnetic anisotropy. Several different types of structural anisotropy have been proposed to account for the observed magnetic anisotropy, including pair-ordering anisotropy (anisotropic chemical short-range order) and bond orientation anisotropy (an anisotropy in coordination number or distances independent of chemical ordering). We have studied the structural origins of perpendicular magnetic anisotropy in amorphous Tb-Fe thin films by employing high-energy and anomalous dispersion x-ray scattering. The as-deposited films show a clear structural anisotropy, with a preference for Tb-Fe near neighbors to align in the out-of-plane direction. These films also have a large perpendicular magnetic anisotropy. Upon annealing, the magnetic anisotropy energy drops significantly, and we see a corresponding reduction in the structural anisotropy. The radial distribution functions indicate that the number of Tb-Fe near-neighbors increases in the in-plane direction, but does not change in the out-of-plane direction. Therefore, the distribution of Tb-Fe near-neighbors becomes more uniform upon annealing. We propose that the observed reduction in perpendicular magnetic anisotropy energy is a result of this change in structure. Our results support the pair -ordering anisotropy model of the structural anisotropy in amorphous Tb-Fe thin films. We see no evidence to support the bond orientation anisotropy model.
Luminescence properties of terbium-doped Li3PO4 phosphor for ...
Indian Academy of Sciences (India)
Antonov-Romanovskii et al [2] firstly suggested applications of OSL for personal dosime- try. This technique got momentum for personnel dosime- try after the development of α-Al2O3:C. OSL properties of α-Al2O3:C have been investigated for personnel dosimetry, environmental dosimetry, medical dosimetry and space.
Luminescence properties of terbium-doped Li3PO4 phosphor for ...
Indian Academy of Sciences (India)
The powder X-ray diffraction (PXRD), photoluminescence (PL) emission and excitation spectra, thermoluminescence (TL) and optically stimulated luminescence (OSL) were measured. The particle size was calculated using the Debye Scherrer formula and found to be 79.42 nm. PL emission spectra of Li 3 PO 4 :Tb 3 + ...
Charge-transfer-based terbium MOF nanoparticles as fluorescent pH sensor for extreme acidity.
Qi, Zewan; Chen, Yang
2017-01-15
Newly emerged metal organic frameworks (MOFs) have aroused the great interest in designing functional materials by means of its flexible structure and component. In this study, we used lanthanide Tb 3+ ions and small molecular ligands to design and assemble a kind of pH-sensitive MOF nanoparticle based on intramolecular-charge-transfer effect. This kind of made-to-order MOF nanoparticle for H + is highly specific and sensitive and could be used to fluorescently indicate pH value of strong acidic solution via preset mechanism through luminescence of Tb 3+ . The long luminescence lifetime of Tb 3+ allows eliminating concomitant non-specific fluorescence by time-revised fluorescence techniques, processing an advantage in sensing H + in biological media with strong autofluorescence. Our method showed a great potential of MOF structures in designing and constructing sensitive sensing materials for specific analytes directly via the assembly of functional ions/ligands. Copyright © 2016 Elsevier B.V. All rights reserved.
Assessment of terbium (III) as a luminescent probe for the detection of tuberculosis biomarkers
Energy Technology Data Exchange (ETDEWEB)
Bamogo, W. [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Mugherli, L. [CEA, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Banyasz, A. [CNRS, IRAMIS, LIDyL/Laboratoire Francis Perrin, URA 2453, F-91191 Gif-sur-Yvette (France); Novelli-Rousseau, A.; Mallard, F. [BioMérieux SA, F-38000 Grenoble (France); Tran-Thi, T.-H., E-mail: thu-hoa.tran-thi@cea.fr [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France)
2015-10-08
A detection method for nicotinic acid, a specific metabolite marker of Mycobacterium tuberculosis present in cultures and patients' breath, is studied in complex solutions containing other metabolites and in biological media such as urine, saliva and breath condensate. The method is based on the analysis of the luminescence increase of Tb{sup 3+} complexes in the presence of nicotinic acid due to the energy transfer from the excited ligand to the lanthanide ion. It is shown that other potential markers found in M. tuberculosis culture supernatant, such as methyl phenylacetate, p-methyl anisate, methyl nicotinate and 2-methoxy biphenyl, can interfere with nicotinic acid via a competitive absorption of the excitation photons. A new strategy to circumvent these interferences is proposed with an upstream trapping of volatile markers preceding the detection of nicotinic acid in the liquid phase via the luminescence of Tb{sup 3+} complexes. The cost of the method is evaluated and compared with the Xpert MTB/RIF test endorsed by the World Health Organization. - Highlights: • Nicotinic acid, a specific marker of M. tuberculosis, can be detected via luminescence. • The detection limit with a commercial phosphorimeter is 0.4 µmol·L{sup -1}. • Other metabolites of M. tuberculosis can interfere via absorbed excitation light. • The interference can be removed via trapping of the most volatile metabolites. • A breath analysis procedure's cost is compared with the Xpert TBM/RIF test.
A highly porous luminescent terbium-organic framework for reversible anion sensing
Energy Technology Data Exchange (ETDEWEB)
Wong, K.L.; Law, G.L.; Wong, W.T. [Department of Chemistry, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Yang, Y.Y. [School of Chemistry and Chemical Engineering, Sun Yat-Sen University, Guangzhou 510275 (China)
2006-04-18
Unique tailored porous frameworks incorporating a lanthanide metal center have been designed to function as chemical detectors. A flexible multidentate ligand, mucic acid, is used to differentiate between several anions, thus creating an organic framework that is ideally suited for applications in gas separation, sensors, and chemical switches. (Abstract Copyright [2006], Wiley Periodicals, Inc.)
Montañez Huamán, Liz Margarita
2016-01-01
En el presente trabajo de investigación se ha estudiado propiedades estequiometrias, estructurales y de emisión de luz de semiconductor de amplio ancho de banda dopados con terbio. La difracción de rayos-X en ángulo rasante confirma el estado amorfo de las películas. Los espectros de absorción infrarroja muestran la formación de óxidos en las películas y la espectroscopia de foto-electrones de rayos-X revela la formación de oxinitruro de aluminio y oxicarburo de silicio. Las pe...
Synthesis and characterization of terbium-doped SrSnO3 pigments
Czech Academy of Sciences Publication Activity Database
Dohnalová, Ž.; Gorodylova, N.; Šulcová, P.; Vlček, Milan
2014-01-01
Roč. 40, č. 8 (2014), s. 12637-12645 ISSN 0272-8842 Institutional support: RVO:61389013 Keywords : pigments * solid state reaction * perovskites Subject RIV: CA - Inorganic Chemistry Impact factor: 2.605, year: 2014
An optical material for the detection of β-hydroxybutyrate based on a terbium complex
Wang, Xiaomiao; Chen, Huili; Li, Hua
2014-02-01
A novel Tb3+ complex (Tb(C14H10O4)ṡCl, TbL2) based on benzoic acid (L+H) was successfully synthesized, and gave a weak green emission in methanol-water (V:V, 4:1, pH 4.49). With the addition of β-hydroxybutyrate (β-HB) to a semi-aqueous solution of TbL2, an increment of the luminescent intensity at 545 nm assigned to 5D4 → 7F5 transition of Tb3+ was measured, which was evident to the naked eye. The response showed high selectivity for β-HB compared with other common anions including Cl-, NO3-, CO32-, PO43-, HPO42-, HPO4-, CO42-, PO74-, SO42-, lactate, AcO-, citrate, malate therefore it has the potential to be applied as a luminescent sensor for β-HB.
Energy Technology Data Exchange (ETDEWEB)
Akbar, Rifat [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India); Baral, Minati [Department of Chemistry, National Institute of Technology Kurukshetra, Haryana 136119 (India); Kanungo, B K, E-mail: b.kanungo@gmail.com [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India)
2015-11-15
The photophysical properties of adduct of a novel nonadentate tripodal ligand, 5,5′-(2-(((8-hydroxyquinolin-5-yl)methylamino)methyl)-2-methylpropane-1, 3-diyl)bis(azanediyl)bis(methylene diquinolin-8-ol, (TAME5OX), with Eu{sup 3+} and Tb{sup 3+} metal ions have been probed for photonics applications. The absorption spectroscopy of these complexes show remarkable spectral changes due to characteristic lanthanide transitions, which support the use of TAME5OX as a sensitive optical pH based sensor to detect Ln{sup 3+} metal ions in biological systems. In addition, these complexes have also been shown to exhibit strong green fluorescence allowing simultaneous sensing within the visible region under physiological pH in competitive medium for both Eu{sup 3+} and Tb{sup 3+} ions. The intense fluorescence from these compounds were revealed to intermittently get quenched under acidic as well as basic conditions due to the photoinduced intramolecular electron transfer from excited 8-hydroxyquinoline (8-HQ) moiety to metal ion, just an opposite process. This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensor. The thermodynamic stability and aqueous coordination chemistry of the chelator with the said lanthanide ions have also been probed by potentiometric, UV–visible and fluorescence spectrophotometric method. TAME5OX has been found to form two protonated complexes [Ln(H{sub 5}L)]{sup 5+} and [Ln(H{sub 4}L)]{sup 4+} below pH 2.5 with both metal ions, which consecutively deprotonates through one proton process with rise of pH. The formation constants (log β{sub 11n}) of neutral complexes have been determined to be 33.51 and 32.16 with pLn (pLn=−log[Ln{sup 3+}]) values of 16.14 and 19.48 for Eu{sup 3+} and Tb{sup 3+} ions, respectively, calculated at pH 7.4, indicating TAME5OX is a good lanthanide synthetic chelator. The emission lifetimes of the Eu{sup 3+} and Tb{sup 3+} complexes recorded in D{sub 2}O and H{sub 2}O suggest the presence of water molecules in the first coordination sphere of the metal ions. NMR titrations were carried out to determine the stoichiometry of chelates. The complexe's coordination geometries were optimized by using PM7 as sparkle/PM7 model. The theoretical electronic behavior was evaluated to support the experimental findings, based on ZINDO/S methodology at configuration interaction with single excitations (CIS) level. These results emphasize the capability of the use of the theoretical models in prediction of geometries and all other calculations of compounds containing lanthanide ions and create new interesting possibilities for the design in-silico of novel and highly efficient lanthanide–organic edifice. - Highlights: • Photophysical behavior of Eu{sup 3+} and Tb{sup 3+} complexes of TAME5OX has been investigated. • This tripodal ligand forms thermodynamically stable Ln{sup 3+} complexes. • These compounds exhibit strong green fluorescence under physiological pH. • Green fluorescence gets quenched under acidic and basic conditions, due to PET process. • This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensors.
Wieg, A. T.; Kodera, Y.; Wang, Z.; Imai, T.; Dames, C.; Garay, J. E.
2012-09-01
Thermal management continues to be one of the major challenges in the development of high powered light sources such as solid state lasers. In particular, the relatively low thermal conductivity of standard photoluminescent (PL) materials limits the overall power output and/or duty cycle. We present a method based on current activated pressure assisted densification for the fabrication of high thermal conductivity PL materials: rare earth doped polycrystalline bulk aluminum nitride. Specifically, the ceramics are translucent and are doped with Tb3+, allowing for emission in the visible. Remarkably, the ceramics have a room temperature thermal conductivity of 94 W/(m K) which is almost seven times higher than that of the state of the art host material, Nd-doped yttrium aluminum garnet. These light emitting properties coupled with very high thermal conductivity should enable the development of a wide variety of more powerful light sources.
Energy Technology Data Exchange (ETDEWEB)
De la Cruz B, C. C.; Monroy G, F. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)], e-mail: fabiola.monroy@inin.gob.mx
2009-10-15
This paper presents the development of a methodology for extractive resins preparation to base of HDEHP, which allows to separation of Tb from Gd generating an own technology of preparation of these resins. The study included the extractive resins preparation from 6 different supports: kieselguhr Dg, alumina, red volcanic rock, chiluca, quarry and fluorite; two treatment types of of supports and varied concentrations of HDEHP extractant (di(2-etil hexyl) orthophosphoric acid), in order to determine which resin has improved efficiency of Gd and Tb separation, and radionuclide purity of {sup 161}Tb. Resins were prepared to base of kieselguhr to determine the most appropriate silicon deposition process. Two silicon deposition treatments were realized: treatment I , by contact with silicon deposition solution (dimethyldichlorosilane / heptane 1:30) and treatment II by contact with vapors of dimethyldichlorosilane in vacuum. The extractant retention was carried out to different concentrations of HDEHP / acetone: 1:4, 1:8, 1:15, 1:20, 1:30 and 1:40. According to the results, there is not direct relation of HDEHP concentration used in extractive resins preparation to base of kieselguhr over the efficiency of Gd and Tb separation and of radionuclide purity of {sup 161}Tb. The effect of support in the efficiency of Gd and Tb separation was studied to prepare resins with the supports kieselguhr, alumina, quarry, chiluca, volcanic rock and fluorite, using the silicon deposition treatment II for the supports and a concentration of HDEHP / acetone 1:20, for extractant retention. Only resins based on kieselguhr could separate to Gd from Tb quantitatively, the resin at a concentration of HDEHP / Acetone 1:20 was the best results obtained in Gd and Tb separation, achieving a separation efficiency greater than 90% and a radionuclide purity higher than 99%. (Author)
Swavey, Shawn
2010-01-01
Undergraduate laboratories rarely involve lanthanide coordination chemistry. This is unfortunate in light of the ease with which many of these complexes are made and the interesting and instructive photophysical properties they entail. The forbidden nature of the 4f transitions associated with the lanthanides is overcome by incorporation of…
Kumar, Brijesh; Kaur, Gagandeep; Rai, S. B.
2017-12-01
Tb doped polyvinyl alcohol: polyvinyl pyrrolidone blends with dibenzoylmethane (DBM) and 1, 10 Phenanthroline (Phen) have been prepared by solution cast technique. Bond formation amongst the ligands and Tb3 + ions in the doped polymer has been confirmed employing Fourier Transform Infrared (FTIR) techniques. Optical properties of the Tb3 + ions have been investigated using UV-Vis absorption, excitation and fluorescence studies excited by different radiations. Addition of dimethylbenzoate and 1, 10 Phenanthroline to the polymer blend increases the luminescence from Tb3 + ions along with energy transfer from the polymer blend itself. Luminescence decay curve analysis affirms the non-radiative energy transfer from DBM and Phen to Tb3 + ions, which is identified as the reason behind this enhancement. The fluorescence decay time of PVA-PVP host decreases from 6.02 ns to 2.31 ns showing an evidence of energy transfer from the host blend to the complexed Tb ions. Similarly the lifetime of DBM and Phen and both in the blend reduces in the complexed system showing the feasibility of energy transfer from these excited DBM and Phen to Tb3 + and is proposed as the cause of the above observations. These entire phenomena have been explained by the energy level diagram.
Xia, Tifeng; Song, Tao; Zhang, Gege; Cui, Yuanjing; Yang, Yu; Wang, Zhiyu; Qian, Guodong
2016-12-19
A series of isomorphic lanthanide metal-organic frameworks (MOFs) Ln(TATAB)⋅(DMF) 4 (H 2 O)(MeOH) 0.5 (LnTATAB, Ln=Eu, Tb, Sm, Dy, Gd; H 3 TATAB=4,4',4''-s-triazine-1,3,5-triyltri-p-aminobenzoic acid) have been solvothermally synthesized and structurally characterized. Among these MOFs, TbTATAB exhibits good water stability and a high fluorescence quantum yield. Because mercury ions (Hg 2+ ) have a high affinity to nitrogen atoms, and the space between multiple nitrogen atoms from triazine and imino groups is suitable for interacting with Hg 2+ ions, TbTATAB shows highly selective and sensitive detection of Hg 2+ in aqueous solution with a detection limit of 4.4 nm. Furthermore, it was successfully applied to detect Hg 2+ ions in natural water samples. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Gas-driven microturbine [Continuation-in-part of application Serial No. 08/773,148
Energy Technology Data Exchange (ETDEWEB)
Sniegowski, Jeffrey J.; Rodgers, Murray S.; McWhorter, Paul J.; Aeschliman, Daniel P.; Miller, William M.
1999-07-14
The present invention is directed to a means of fabricating a gas-driven microturbine that is capable of providing autonomous propulsion in which the rapidly moving gases are directed through a micromachined turbine to power mechanical, electrical, or electromechanical devices by direct mechanical linkage of turbo-electric generator components in a domain ranging from tenths of micrometers to thousands of micrometers. By optimally selecting monopropellants or bipropellants to be the fuel set, a more efficient gas-driven microturbine can be realized from the increased mass flow rate of the gas stream due to the higher combustion reaction energies of these fuel sets. Additionally, compressed gas can be utilized to provide a high-flow gas stream for the gas-driven microturbine. The present invention is adaptable to many defense and non-defense applications, including the provision of mechanical power for miniature devices such as fans, geared mechanisms, mechanical linkages, actuators, bio-medical procedures, manufacturing, industrial, aviation, computers, safety systems, and electrical generators.
45 CFR 148.180 - Prohibition of discrimination based on genetic information.
2010-10-01
... respect to D (family medical history of Type 2 diabetes). (e) Limitation on requesting or requiring... manifested disease or disorder of family members, which as family medical history constitutes genetic... adult onset diabetes mellitus (Type 2 diabetes). B provides this information voluntarily and not in...
33 CFR 148.710 - What environmental conditions must be satisfied?
2010-07-01
... to prevent or minimize adverse impacts on the marine environment (33 U.S.C. 1503(c)(3), 1504(f) and..., environmental quality, protection from the threat of terrorist attack and other subversive activity against...
33 CFR 148.5 - How are terms used in this subchapter defined?
2010-07-01
... mooring. Hot work means work that produces heat or fire, such as riveting, welding, burning, or other fire... Submerged Lands Act, 43 U.S.C. 1311. License means a license issued under this part to own, construct, and... submerged turret loading buoys that can pump oil or natural gas and that has one or more of the following...
D.A. Masolo Debating the Autonomy of Reason pp119-148
African Journals Online (AJOL)
D.A. Masolo
she lives by a different set of cultural traditions, or because he or she claims to be of a different ethnic ... being, and dismembered body parts of these innocent victims of sheer murder are used for ritual purposes. ...... any theory of the self will be abstract, but it does not have to be a construct of an entity that is out of touch with.
26 CFR 1.148-7 - Spending exceptions to the rebate requirement.
2010-04-01
... grading and landscaping, necessary to transform it into a park. The costs of the improvements are properly... for the facility qualify as construction expenditures. Example 6. Park land. City D issues bonds to...
33 CFR 148.105 - What must I include in my application?
2010-07-01
... opinion by a registered professional engineer specializing in soil mechanics concerning: (1) The... certificate of formation; the partnership agreement or articles of association; the current by-laws; the... latter survey will require more extensive analysis of the soil, and detailed study to determine its...
78 FR 148 - Additional Designations of Individuals Pursuant to Executive Order 13581
2013-01-02
... Office of Foreign Assets Control Additional Designations of Individuals Pursuant to Executive Order 13581... Treasury's Office of Foreign Assets Control (``OFAC'') is publishing the names of three individuals whose... Director of OFAC of the five individuals identified in this notice pursuant to Executive Order 13581 is...
The risk of going abroad in sickle cell disease: a study of 148 adults.
Stankovic Stojanovic, K; Lionnet, F; Girot, R; Lescure, F X; Pialoux, G; Le Loup, G
2011-06-01
Going abroad is considered to be a risk for acute complications in patients with sickle cell disease (SCD). Our objective was to describe the risk in our cohort of adult SCD patients. Complications occurring during a trip were recorded from adults with SCD seen at a routine visit in a referral centre and during hospitalizations for acute complications. One hundred and eight patients participated; mean age=26.8 (± SD 7.3; range 18-56) years. Eighty-two patients travelled in the previous year, half of them in Africa. Among patients going to endemic areas, 68% of patients received chemoprophylaxis against malaria. Health problems occurred in 53 (65%) travellers: vaso-occlusive crisis (VOC) (68%), fever (19%), diarrhoea (19%), broncho-pulmonary symptoms (11%), headaches (8%), vomiting (6%), and cutaneous wound (4%). Sixteen patients required hospitalization; no specific infection was diagnosed. The prevalence of VOC during the trip was higher than the frequency of VOC during the year before. Patients who developed severe complications were not the most symptomatic patients from SCD. Our study showed that going abroad is associated with a large number of acute complications in adults with SCD. Complications were mostly VOC, and severity was unpredictable. Prevention should be improved. Copyright © 2011 Royal Society of Tropical Medicine and Hygiene. Published by Elsevier Ltd. All rights reserved.
20 CFR 702.148 - Insurance carriers' and self-insured employers' responsibilities.
2010-04-01
..., employers and insurance carriers are given the authority to monitor their claims in the special fund as outlined in paragraph (c) of this section. For purposes of monitoring these claims, employers and insurance... claim. Similarly, employers and insurance carriers can initiate proceeding to modify an award of...
1990-05-01
energ7y for an overomowtbh (141. This work was sapported by’he.lpartmest ofPCro-t-CC-’F D53) r. Jules Soatbort, contract monitor, for which muon...found, indicating a single crystalline material. The patterns, however, are verN sensitive to small non-uniform lattice strains which can be detected to
7 CFR 905.148 - Reports of special purpose shipments under certificates of privilege.
2010-01-01
... (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts... loading point; destination, consignee; the inspection certificate number; and any other information deemed...
Page 1 | § 148 Pradip Niyogi However, it seems that with increasing ...
Indian Academy of Sciences (India)
- tion equation (1a). This point has been discussed further in § 11 of the present paper. Spreiter & Alksne (1955) solved (13a) iteratively. Their procedure has been reported in detail in Ferrari & Tricomi (1968) and Niyogi (1977). Starting with a.
2010-01-04
... No: E9-31154] FEDERAL COMMUNICATIONS COMMISSION Notice of Public Information Collection Being Reviewed by the Federal Communications Commission, Comments Requested December 28, 2009. SUMMARY: The Federal Communications Commission, as part of its continuing effort to reduce paperwork burden invites the...
34 CFR 668.148 - Additional criteria for the approval of certain tests.
2010-07-01
... the American Educational Research Association, the American Psychological Association, and the... from the American Psychological Association, Inc., 750 First Street, N.W., Washington, DC 20026; and (v... specific guidelines set forth in the American Psychological Association's Guidelines for Computer-based...
The antimicrobial peptide SAAP-148 combats drug-resistant bacteria and biofilms
de Breij, Anna; Riool, Martijn; Cordfunke, Robert A.; Malanovic, Nermina; de Boer, Leonie; Koning, Roman I.; Ravensbergen, Elisabeth; Franken, Marnix; van der Heijde, Tobias; Boekema, Bouke K.; Kwakman, Paulus H. S.; Kamp, Niels; El Ghalbzouri, Abdelouahab; Lohner, Karl; Zaat, Sebastian A. J.; Drijfhout, Jan W.; Nibbering, Peter H.
2018-01-01
Development of novel antimicrobial agents is a top priority in the fight against multidrug-resistant (MDR) and persistent bacteria. We developed a panel of synthetic antimicrobial and antibiofilm peptides (SAAPs) with enhanced antimicrobial activities compared to the parent peptide, human
ATP Changes the Fluorescence Lifetime of Cyan Fluorescent protein via an Interaction with His148
Borst, J.W.; Willemse, M.; Slijkhuis, R.; Krogt, G.; Laptenok, S.; Jalink, K.; Wieringa, B.; Fransen, J.A.M.
2010-01-01
Recently, we described that ATP induces changes in YFP/CFP fluorescence intensities of Fluorescence Resonance Energy Transfer (FRET) sensors based on CFP-YFP. To get insight into this phenomenon, we employed fluorescence lifetime spectroscopy to analyze the influence of ATP on these fluorescent
ATP changes the fluorescence lifetime of cyan fluorescent protein via an interaction with His148.
Borst, J.W.; Willemse, M.P.; Slijkhuis, R.; Krogt, G. van der; Laptenok, S.P.; Jalink, K.; Wieringa, B.; Fransen, J.A.M.
2010-01-01
Recently, we described that ATP induces changes in YFP/CFP fluorescence intensities of Fluorescence Resonance Energy Transfer (FRET) sensors based on CFP-YFP. To get insight into this phenomenon, we employed fluorescence lifetime spectroscopy to analyze the influence of ATP on these fluorescent
Yeast Interacting Proteins Database: YDL239C, YDR148C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available YDL239C ADY3 Protein required for spore wall formation, thought to mediate assembly...239C Bait gene name ADY3 Bait description Protein required for spore wall formation, thought to mediate asse
(PNPLA3) I148M polymorphism and liver damage in chronic
African Journals Online (AJOL)
Amal M.H. Mackawy
2015-06-23
Jun 23, 2015 ... Abstract Hepatitis C virus (HCV) has been associated with high prevalence of steatosis and fibro- sis. The impact of single-nucleotide polymorphisms (SNP) of patatin-like phospholipase domain- containing protein 3 (PNPLA3) on the development of steatosis and fibrosis is not clarified for. Egyptian patients ...
Page 1 148 K. Visweswara Rao and T. R. Seshadri a methoxyl ...
Indian Academy of Sciences (India)
In about 10 minutes a pale cream-coloured solid separated out in good yield. It was filtered, washed with ice-cold dilute hydrochloric acid and ice Water and drid in a vacuum desiccator. Yield, 7 g. On crystal- lising from anhydrous benzene it came out as big colourless rectangular tablets melting at 153-4 (Found: C, 61.5; H, ...
40 CFR 148.10 - Waste specific prohibitions-solvent wastes.
2010-07-01
... Xylene Table B Benzene 2-Ethoxyethanol 2-Nitropropane 1,1,2-Trichloroethane ... (2) If an exemption from a prohibition has been granted in response to a petition under subpart C of... tetrachloride Chlorobenzene Cresols and cresylic acid Cyclohexanone 1,2-dichlorobenzene Ethyl acetate Ethyl...
26 CFR 1.148-2 - General arbitrage yield restriction rules.
2010-04-01
....g., equipment lease financings in which the issuer purchases equipment in exchange for an... periods set forth in this paragraph (e), the proceeds and replacement proceeds of an issue may be invested... are invested in higher yielding investments. If an issue has more than a de minimis amount of original...
148 Patriarchy and Resource Control in Nigeria: A Reading of Ben ...
African Journals Online (AJOL)
USER
formation. While other developed capitalist countries have replaced clan and tribe relations in resource control, Nigeria is still deep in patriarchal character in resource control. The framework for the paper is based on Karl Marx's Historical Materialism which explains the role of history in material or resources production. The.
33 CFR 148.737 - What environmental statutes must an applicant follow?
2010-07-01
... Government Through Leadership in Environmental Management, E.O. 13148, 65 FR 24595; 63 FR 49643; Historic..., 42, U.S.C. 201, et. seq.; Toxic Substances Control Act (TSCA), 7 U.S.C. 136, et. seq.; and Wild and...
PS1-48: Where to Find Inpatient Utilization Data in Clarity
Gul, Jamila
2012-01-01
Background/Aims Clarity is the reporting database for Epic data. Clarity was created to extract data from the Epic production server Chronicles and store it in a relational database and a dedicated reporting servers. Clarity can reside on variance platforms such as Teradata or Oracle. Most tables in Clarity are updated nightly by a feed from Chronicles. There are also weekly and monthly updates for the more static tables. Queries and reports generated from Clarity can be are very comprehensive and can be challenging. This presentation is targeted to programmers on how to look for IP diagnosis, procedures, events and data flow in Clarity.
7 CFR 800.148 - Maintenance and retention of records on organization, staffing, and budget.
2010-01-01
... shall consist of the following documents: (1) If it is a business organization, the location of its principal office; (2) if it is a corporation, a copy of the articles of incorporation, the names and... by the Office of Management and Budget under control number 0580-0011) ...
2010-04-01
... 12567 Oct. 2, 1986. Council of Europe in Respect of the Group of States Against Corruption (GRECO) 13240... 11, 1946. International Boundary and Water Commission, United States & Mexico 12467 Mar. 2, 1984...
Page 1 148 K. Satyanarayana Murty and T. R. Seshadri The ready ...
Indian Academy of Sciences (India)
0; OCH3, 30.9%. CaoH26O, (OCH3), requires C, 71 -1; H, 6:6; OCH3, 21.6%.) Direct Methylation of Gossypol. (a) With diazomethane.—Gossypol (1 g.) was dissolved in absolute methyl alcohol (30 c.c.) and the clear solution was treated with a ...
26 CFR 1.148-0 - Scope and table of contents.
2010-04-01
... student loan bonds. (h) Qualified hedging transactions. (1) In general. (2) Qualified hedge defined. (3... period. (4) Consistent redemption assumptions on purpose investments. (5) Student loan special allowance... general. (2) Relationship of spending exceptions. (3) Spending exceptions not mandatory. (b) Rules...
Yeast Interacting Proteins Database: YFR049W, YDR148C [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available prey as bait (0) Literature on bait (YPD) 11 Literature on prey (YPD) 15 Literature shared by bait and...and prey 1 Literature sharing score 2 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,YPD)
Yeast Interacting Proteins Database: YPR148C, YDL237W [Yeast Interacting Proteins Database
Lifescience Database Archive (English)
Full Text Available this prey as bait (0) Literature on bait (YPD) 3 Literature on prey (YPD) 3 Literature shared by bait and...and prey 3 Literature sharing score 4 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,YPD)
Ce que nous faisons | Page 148 | CRDI - Centre de recherches pour ...
International Development Research Centre (IDRC) Digital Library (Canada)
Le CRDI finance des études de recherche dans les pays en voie de développement en vue de produire un changement durable à grande échelle. Pour que le savoir devienne un outil permettant de résoudre des problèmes urgents :
33 CFR 148.715 - How is an environmental review conducted?
2010-07-01
... SECURITY (CONTINUED) DEEPWATER PORTS DEEPWATER PORTS: GENERAL Environmental Review Criteria for Deepwater... following two parts: (a) An evaluation of the proposal's completeness of environmental information and... mitigate its probable environmental impacts. This evaluation will assess the applicant's consideration of...
26 CFR 1.148-5 - Yield and valuation of investments.
2010-04-01
... costs or expenses paid, directly or indirectly, to purchase, carry, sell, or retire the investment... than carrying costs, such as separately stated brokerage or selling commissions, but not legal and... purpose investment means— (1) Costs or expenses paid, directly or indirectly, to purchase, carry, sell, or...
Energy Technology Data Exchange (ETDEWEB)
Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)
2014-10-15
The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)
Xue, Dongxu
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Guillerm, Vincent
2014-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Xue, Dongxu
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Xue, Dongxu
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Assen, Ayalew H.
2016-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Xue, Dongxu
2015-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Directory of Open Access Journals (Sweden)
David J. Williams
2003-07-01
Full Text Available Detailed crystal structures and 1H-NMR characteristics of some alkylaminephthalimides, including dendritic polyphthalimides, are reported. These investigations were undertaken in order to obtain a better understanding of the relationship between solid-state supramolecular interactions, their persistence in solution and associated dynamics of magnetically hypersensitive phthalimide aromatic AA'BB'-AA'XX' proton NMR resonances. Some alkylamine phthalimides feature folded molecular geometries, which we attribute to n-À interactions among proximal amine-phthalimide sites; those alkylamine-phthalimides that have no possibility for such interactions feature fully extended phthalimide functionalities. Accordingly, alkylamine phthalimide compounds with folded solid-state geometries feature solvent and temperature dependent hypersensitive AA'BB'-AA'XX' 1H-NMR line profiles, which we attribute to the n-À interactions. Luminescence of Eu3+(5D0 and Tb3+(5D4 states show well defined metal ion environments in their complexes with dendritic phthalimides, as well as relatively weak phthalimide-lanthanide(III interactions.
Liu, Shufang; Yang, Jinghe; Wu, Xia; Su, Benyu; Sun, Changxia; Wang, Feng
2004-10-08
It is found that Tb(3+) can react with tryptophan (Trp) and sodium dodecyl benzene sulfonate (SDBS), and emits the intrinsic fluoresence of Tb(3+). The fluorescence intensity can be enhanced by La(3+), Gd(3+), Lu(3+), Sc(3+) and Y(3+), among which Gd(3+) has the greatest enhancement. This is a new co-luminescence system. The studies indicate that in the Tb-Gd-Trp-SDBS system, there is both Tb-Trp-SDBS and Gd-Trp-SDBS complexes, and they aggregate together and form a large congeries. The fluorescence enhancement of the Tb-Gd-Trp-SDBS system is considered to originate from intramolecular and intermolecular energy transfers, and the energy-insulating sheath effect of Gd-Trp-SDBS complex. Under the optimum conditions, the enhanced intensity of fluorescence is in proportion to the concentration of Trp in the range from 4x10(-8) to 4x10(-5)moll(-1). The detection limit is 10(-9)moll(-1). The proposed method is one of the most sensitive fluoremetries of Trp.
Zhang, Hui-Jie; Fan, Rui-Qing; Wang, Xin-Ming; Wang, Ping; Wang, Yu-Lei; Yang, Yu-Lin
2015-02-14
Poly(methylmethacrylate) (PMMA) doped with Tb-based imidazole derivative coordination polymer {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) (1) (L = N,N'-bis(acetoxy)biimidazole) was synthesized and its photophysical properties were studied. The L'(L' = N,N'-bis(ethylacetate)biimidazole) ligand was synthesized by an N-alkylation reaction process followed by ester hydrolysis to produce ligand L. Polymer 1 and ligand L' have been characterized by (1)H NMR and IR spectroscopy, elemental analysis, PXRD and X-ray single-crystal diffraction. Coordination polymer 1 is the first observation of a CdCl(2) structure constructed with hydroxy groups and decorated by ligand L in lanthanide N-heterocyclic coordination polymers. In the 2D layered structure of 1, each Tb3 metal center is connected with three Tb1 and three Tb2 metal centers by seven hydroxyl groups in different directions, resulting in a six-membered ring. After doping, not only the luminescence intensity and lifetime enhanced, but also their thermal stability was increased in comparison with 1. When 1 was doped into poly(methylmethacrylate) (1@PMMA), polymer film materials were formed with the PMMA polymer matrix (w/w = 2.5%-12.5%) acting as a co-sensitizer for Tb(3+) ions. The luminescence intensity of the Tb(3+) emission at 544 nm increases when the content of Tb(3+) was 10%. The lifetime of 1@PMMA (914.88 μs) is more than four times longer than that of 1 (196.24 μs). All τ values for the doped polymer systems are higher than coordination polymer 1, indicating that radiative processes are operative in all the doped polymer films. This is because PMMA coupling with the O-H oscillators from {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) can suppress multiphonon relaxation. According to the variable-temperature luminescence (VT-luminescence) investigation, 1@PMMA was confirmed to be a stable green luminescent polymer film material.
Horii, Yoji; Horie, Yusuke; Katoh, Keiichi; Breedlove, Brian K; Yamashita, Masahiro
2018-01-16
Synthesis, structures, and magnetic properties of α-butoxy-substituted phthalocyaninato double-decker complexes Tb(α-obPc)2 (1-) (α-obPc: dianion of 1,4,8,11,15,18,22,25-octa(n-butoxy)phthalocyaninato) with protonated (1H), deprotonated (1[HDBU]), and diprotonated forms (1H2+) are discussed. X-ray analysis was used to confirm the position of the proton in 1H, and it was revealed that the protonation induced asymmetric distortion in 1H. In contrast, 1[HDBU] was distorted in a highly symmetric windmill-like fashion. 1H is arranged in a slipped column array in the crystal packing, whereas 1[HDBU] is arranged in a one-dimensional fashion, in which the magnetic easy axes of 1[HDBU] lie along the same line. From direct-current (dc) magnetic measurements, ferromagnetic Tb-Tb interactions occur in both 1H and 1[HDBU], and magnetic hysteresis was observed. However, the area of the magnetic hysteresis in 1[HDBU] is larger than that in 1H, meaning that magnetic relaxation time (τ) is longer in 1[HDBU]. In addition, the results of alternating-current magnetic measurements in a zero dc magnetic field indicate that τ of 1[HDBU] is longer as compared to 1H. In other words, protonation/deprotonation affects not only the molecular structures and crystal packing but also the single-molecule magnet properties.
Ye, Junwei; Bogale, Raji F; Shi, Yangwei; Chen, Yanzhen; Liu, Xigang; Zhang, Siqi; Yang, Yaoyao; Zhao, Jianzhang; Ning, Guiling
2017-06-07
A stable 3D Tb III -based metal-organic framework [Tb(BPDC) 2 ]⋅(CH 3 ) 2 NH 2 (DUT-101) was synthesized, and it is the first efficient dual-channel luminescence sensor for aqueous UO 2 2+ ions. DUT-101 contains an anionic three-dimensional framework and protonated dimethylamine molecules embedded within the channels. The intense green emission of DUT-101 could be highly selectively and sensitively quenched by UO 2 2+ ions even in the presence of other competing metal ions. A possible sensing mechanism was proposed based on both suppression of luminescence resonance energy transfer and enhancement of intermolecular electron transfer. Furthermore, visual green fluorescent test papers based on DUT-101 were fabricated and could be used to discriminate UO 2 2+ ions among various metal ions. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Zhang Fang; Liu Fei
2008-01-01
In the title complex, [CuTb(C19H20N2O4)(NO3)3]·CH3COCH3, the CuII atom is four-coordinated by two O atoms and two N atoms from the deprotonated Schiff base in a square-planar geometry, while the TbIII atom is ten-coordinated by four O atoms from the deprotonated Schiff base and six O atoms from three bidentate nitrate anions. The compound is isostructural with the previously reported GdIII analogue [Elmali & Elerman (2004). Z. Naturforsch. Teil B, 59, 535–540], which was described ...
Directory of Open Access Journals (Sweden)
Chainok Kittipong
2016-01-01
Full Text Available The title compound, poly[(μ3-formato(μ4-oxalatoterbium(III], [Tb(CHO2(C2O4]n, is a three-dimensional coordination polymer, and is isotypic with the LaIII, CeIII and SmIII analogues. The asymmetric unit contains one TbIII ion, one formate anion (CHO2− and half of an oxalate anion (C2O42−, the latter being completed by application of inversion symmetry. The TbIII ion is nine-coordinated in a distorted tricapped trigonal–prismatic manner by two chelating carboxylate groups from two C2O42− ligands, two carboxylate oxygen atoms from another two C2O42− ligands and three oxygen atoms from three CHO2− ligands, with the Tb—O bond lengths and the O—Tb—O bond angles ranging from 2.4165 (19 to 2.478 (3 Å and 64.53 (6 to 144.49 (4°, respectively. The CHO2− and C2O42− anions adopt μ3-bridging and μ4-chelating-bridging coordination modes, respectively, linking adjacent TbIII ions into a three-dimensional 12-connected fcu topology with point symbol (324.436.56. The title compound exhibits thermal stability up to 623 K, and also displays strong green photoluminescence in the solid state at room temperature.
Energy Technology Data Exchange (ETDEWEB)
Rathbone, Bruce A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Morley, Shannon M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Stephens, John A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2017-05-01
The Pacific Northwest National Laboratory (PNNL) participated in a criticality accident dosimetry intercomparison exercise held at the Nevada National Security Site (NNSS) May 24-27, 2016. The exercise was administered by Lawrence Livermore National Laboratory (LLNL) and consisted of three exposures performed using the Godiva-IV critical assembly housed in the Device Assembly Facility (DAF) located on the NNSS site. The exercise allowed participants to test the ability of their nuclear accident dosimeters to meet the performance criteria in ANSI/HPS N13.3-2013, Dosimetry for Criticality Accidents and to obtain new measurement data for use in revising dose calculation methods and quick sort screening methods where appropriate. PNNL participated with new prototype Personal Nuclear Accident Dosimeter (PNAD) and Fixed Nuclear Accident Dosimeter (FNAD) designs as well as the existing historical PNAD design. The new prototype designs incorporate optically stimulated luminescence (OSL) dosimeters in place of thermoluminescence dosimeters (TLDs), among other design changes, while retaining the same set of activation foils historically used. The default dose calculation methodology established decades ago for use with activation foils in PNNL PNADs and FNADs was used to calculate neutron dose results for both the existing and prototype dosimeters tested in the exercise. The results indicate that the effective cross sections and/or dose conversion factors used historically need to be updated to accurately measure the operational quantities recommended for nuclear accident dosimetry in ANSI/HPS N13.3-2013 and to ensure PNAD and FNAD performance meets the ANSI/HPS N13.3-2013 performance criteria. The operational quantities recommended for nuclear accident dosimetry are personal absorbed dose, Dp(10), and ambient absorbed dose, D*(10).
SU-E-T-148: Benchmarks and Pre-Treatment Reviews: A Study of Quality Assurance Effectiveness
Energy Technology Data Exchange (ETDEWEB)
Lowenstein, J; Nguyen, H; Roll, J; Walsh, A; Tailor, A; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)
2015-06-15
Purpose: To determine the impact benchmarks and pre-treatment reviews have on improving the quality of submitted clinical trial data. Methods: Benchmarks are used to evaluate a site’s ability to develop a treatment that meets a specific protocol’s treatment guidelines prior to placing their first patient on the protocol. A pre-treatment review is an actual patient placed on the protocol in which the dosimetry and contour volumes are evaluated to be per protocol guidelines prior to allowing the beginning of the treatment. A key component of these QA mechanisms is that sites are provided timely feedback to educate them on how to plan per the protocol and prevent protocol deviations on patients accrued to a protocol. For both benchmarks and pre-treatment reviews a dose volume analysis (DVA) was performed using MIM softwareTM. For pre-treatment reviews a volume contour evaluation was also performed. Results: IROC Houston performed a QA effectiveness analysis of a protocol which required both benchmarks and pre-treatment reviews. In 70 percent of the patient cases submitted, the benchmark played an effective role in assuring that the pre-treatment review of the cases met protocol requirements. The 35 percent of sites failing the benchmark subsequently modified there planning technique to pass the benchmark before being allowed to submit a patient for pre-treatment review. However, in 30 percent of the submitted cases the pre-treatment review failed where the majority (71 percent) failed the DVA. 20 percent of sites submitting patients failed to correct their dose volume discrepancies indicated by the benchmark case. Conclusion: Benchmark cases and pre-treatment reviews can be an effective QA tool to educate sites on protocol guidelines and to minimize deviations. Without the benchmark cases it is possible that 65 percent of the cases undergoing a pre-treatment review would have failed to meet the protocols requirements.Support: U24-CA-180803.
TRICARE and VA Health Care: Impact of the Patient Protection and Affordable Care Act (P.L. 111-148)
2010-04-22
care regarding the annual fee imposed by PPACA on certain manufacturers and importers of branded prescription drugs, as well as the a new excise tax imposed...be set to reach a certain revenue target each year. 30 In addition, under PPACA a new excise tax of 2.3% will be imposed on the
A common variant of PNPLA3 (p.I148M) is not associated with alcoholic chronic pancreatitis.
Rosendahl, J.; Tonjes, A.; Schleinitz, D.; Kovacs, P.; Wiegand, J.; Ruffert, C.; Jesinghaus, M.; Schober, R.; Herms, M.; Grutzmann, R.; Schulz, H.U.; Stickel, F.; Werner, J.; Bugert, P.; Bluher, M.; Stumvoll, M.; Bohm, S.; Berg, T. van den; Wittenburg, H.; Mossner, J.; Morsche, R.H.M. te; Derikx, M.; Keim, V.; Witt, H.; Drenth, J.P.H.
2012-01-01
BACKGROUND: Chronic pancreatitis (CP) is an inflammatory disease that in some patients leads to exocrine and endocrine dysfunction. In industrialized countries the most common aetiology is chronic alcohol abuse. Descriptions of associated genetic alterations in alcoholic CP are rare. However, a
24 CFR 943.148 - What procurement standards apply to PHAs selecting partners for a joint venture?
2010-04-01
... nonprofit) or part 85 of this title (if the entity is a State or local government) with respect to its... would not otherwise be available to the PHA on the open market (e.g., planning expertise, program...
2010-11-30
... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE... the subsequent 15-day period, until February 4, 2011. Submissions (original and one electronic copy... Commerce, Room 2111, 1401 Constitution Ave., NW., Washington, DC 20230. For further information, contact...
Page 1 s Bull. Mater. Sci., Vol. 15, No. 2, April 1992, pp. 143-148. (C ...
Indian Academy of Sciences (India)
Abstract. CulnSe21-x)S, thin films were deposited by spray pyrolysis. Lattice parameters a and c, for all composition parameters X, were calculated from the Phillips X-ray diffractometer. The structure remained tetragonal chalcopyrite throughout. Optical band gap (E) was determined for the composition parameter X from the ...
Bayard, Olivier
1979-01-01
The magnet system of the CERN 400 GeV accelerator is the largest pulsed load in operation on the European 400 kV network. The author describes briefly the network configuration and the nature of the load. The reactive power compensator used to contain the voltage fluctuations and harmonic distortions within 0.6%, and the precautions taken by CERN to reduce reactive power and to avoid instabilities are studied in more detail. The use of a second compensator for operating the accelerator at higher energy is discussed. (0 refs).
Energy Technology Data Exchange (ETDEWEB)
Mosimann, Pascal J., E-mail: pascal.mosimann@chuv.ch [Department of Diagnostic and Interventional Radiology, Centre Hospitalier Universitaire Vaudois, University of Lausanne, Rue du Bugnon 46, 1011 Lausanne (Switzerland); Richarme, Delphine; Becce, Fabio; Knoepfli, Anne-Sophie; Mino, Vincent; Meuli, Reto [Department of Diagnostic and Interventional Radiology, Centre Hospitalier Universitaire Vaudois, University of Lausanne, Rue du Bugnon 46, 1011 Lausanne (Switzerland); Theumann, Nicolas [Department of Radiology, Clinique Hirslanden Bois-Cerf, 1006 Lausanne (Switzerland)
2012-09-15
Purpose: To evaluate the influence of shorter- and longer-acting intra-articular anaesthetics on post-arthrographic pain. Materials and methods: 154 consecutive patients investigated by MR or CT arthrographies were randomly assigned to one of the following groups: 1 – intra-articular contrast injection only; 2 – lidocain 1% adjunction; or 3 – bupivacain 0.25% adjunction. Pain was assessed before injection, at 15 min, 4 h, 1 day and 1 week after injection by visual analogue scale (VAS). Results: At 15 min, early mean pain score increased by 0.96, 0.24 and 0 in groups 1, 2 and 3, respectively. Differences between groups 1 and 3 and 1 and 2 were statistically significant (p = 0.003 and 0.03, respectively), but not between groups 2 and 3 (p = 0.54). Delayed mean pain score increase was maximal at 4 h, reaching 1.60, 1.22 and 0.29 in groups 1, 2 and 3, respectively. Differences between groups 1 and 2 and 2 and 3 were statistically significant (p = 0.002 and 0.02, respectively), but not between groups 1 and 2 (p = 0.46). At 24 h and 1 week, the interaction of local anaesthetics with increase in pain score was no longer significant. Results were independent of age, gender and baseline VAS. Conclusion: Intra-articular anaesthesia may significantly reduce post-arthrographic pain. Bupivacain seems to be more effective than lidocain to reduce both early and delayed pain.
2010-10-06
... employees) consist of two sites in Rockwood, Tennessee: Site 1 (20 acres, 192,932 sq. ft. of enclosed space... metric tons combined annually) for export and the domestic market. The company manufactures standard...
Ashley M. L. Brown. Sexuality in Role-Playing Games. N.Y.; L.: Routledge, 2015. 148 p.
Ольга Владимировна Воробьева
2016-01-01
Монография Эшли Браун “Sexuality in Role-playing Games” содержит анализ эротического и сексуального поведения игроков и персонажей в словесных и компьютерных ролевых играх. В фокусе внимания автора находятся мотивация игроков к созданию эротических контекстов для своих персонажей во время игры, регламентация внутриигрового сексуального поведения внешними (от создателей игры) и внутренними (от самих игроков) правилами, а также влияние сексуального поведения персонажей на внеигровую, повседневн...
Energy Technology Data Exchange (ETDEWEB)
Menemenlis, N.; Huneault, M. [IREQ, Varennes, QC (Canada); Robitaille, A. [Hydro-Quebec Production, Dir. Planification de la production eolienne, Direction Generale, Montreal, QC (Canada)
2010-07-01
Integrating wind power into the operations-planning horizon of 1 to 48 hours ahead, a challenge facing utilities is how to cope with wind forecast uncertainties, in addition to existing inherent uncertainties of load forecast errors and unavailability of generation. Utilities counter forecast uncertainties by maintaining operational reserves to ensure a high level of reliability to the system. With the advent of wind generation, additional reserves are required to cover the incremental uncertainties. In this paper, we fine tune a methodology for calculating additional balancing reserves which had reproduced accurately only an average scenario. Here, several wind forecast errors distributions are introduced corresponding to different wind forecast levels. These distributions are approximated by gamma-like distributions with time-varying parameters. The results show that modeling uncertainties as a function of wind generation levels impacts significantly the balancing reserves and associated risk, and justifies the necessity to veer towards a dynamic computation of dynamic balancing reserves that consider the imminent wind generation forecast. (orig.)
Alezi, Dalal
2015-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
BASIC RESEARCH ON THE SEPARATION OF SCANDIUM YTTRIUM, AND THE RARE EARTHS BY SOLVENT EXTRACTION.
RARE EARTH ELEMENTS, * SOLVENT EXTRACTION ), (*CHELATE COMPOUNDS, RARE EARTH ELEMENTS), PURIFICATION, ATOMIC SPECTROSCOPY, SCANDIUM, YTTRIUM, PRASEODYMIUM, SAMARIUM, EUROPIUM, GADOLINIUM, TERBIUM, FLUORINE COMPOUNDS, KETONES
Khan, Muhammad Naeem; Shah, Jasmin; Jan, Muhammad Rasul; Lee, Sang Hak
2013-01-01
A simple, sensitive, and accurate spectrofluorimetric method was developed for the determination of citalopram in bulk and pharmaceutical preparations. The method is based on the enhancement of the weak fluorescence signal (FL) of the Tb (III)-citalopram system in the presence of silver nanoparticles. Fluorescence intensities were measured at 555 nm after excitation at 281 nm. Prepared silver nanoparticles (AgNPs) were characterized by UV-Visible spectra and transmission electron microscopy (TEM). Various factors affecting the formation of citalopram-Tb (III)-AgNPs complexes were studied and optimized. The fluorescence intensity versus concentration plot was linear over the range 0.02-14 μg mL(-1), with an excellent correlation coefficient of 0.9978. The limit of detection (LOD) and limit of quantification (LOQ) were found to be 7.15 × 10(-6) μg mL(-1) and 2.38 × 10(-5) μg mL(-1) respectively. The proposed method was found to have good reproducibility with a relative standard deviation of 3.66% (n = 6). The interference effects of common excipients found in pharmaceutical preparations were studied. The developed method was validated statistically by performing recoveries studies and successfully applied for the assay of citalopram in bulk powder and pharmaceutical preparations. Percent recoveries were found to range from 98.98% to 100.97% for bulk powder and from 96.57% to 101.77% for pharmaceutical preparations.
Driscoll, Christopher R; Reid, Brodie L; McIldowie, Matthew J; Muzzioli, Sara; Nealon, Gareth L; Skelton, Brian W; Stagni, Stefano; Brown, David H; Massi, Massimiliano; Ogden, Mark I
2011-04-07
A novel methodology to prepare transparent luminescent hybrid materials is reported. Using a calixarene ionophore as a PMMA cross-linker avoids problems, such as phase segregation, and produces a polymer monolith that can be loaded with the metal ion required for luminescence post-synthesis. This approach is versatile and will simplify the production of such materials.
Xue, Dongxu
2013-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Alezi, Dalal
2015-01-01
An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.
Singh, Laishram Priyobarta; Singh, Ningthoujam Premananda; Srivastava, Sri Krishna
2015-04-14
SnO2:5Tb (SnO2 doped with 5 at% Tb(3+)) nanoparticles were synthesised by a polyol method and their luminescence properties at different annealing temperatures were studied. Characterization of nanomaterials was done by X-ray diffraction (XRD), Fourier transformation infrared spectroscopy (FTIR), transmission electron microscopy (TEM) and vibrating sample magnetometry (VSM). XRD studies indicate that the prepared nanoparticles were of tetragonal structures. Upon Tb(3+) ion incorporation into SnO2, Sn(4+) changes to Sn(2+) and, on annealing again at higher temperature, Sn(2+) changes to Sn(4+). The prepared nanoparticles were spherical in shape. Sn-O vibrations were found from the FTIR studies. In photoluminescence studies, the intensity of the emission peaks of Tb(3+) ions increases with the increase of annealing temperature, and emission spectra lie in the region of white emission in the CIE diagram. CCT calculations show that the SnO2:5Tb emission lies in cold white emission. Quantum yields up to 38% can be obtained for 900 °C annealed samples. SnO2:5Tb nanoparticles were well incorporated into the PVA polymer and such a material incorporated into the polymer can be used for display devices. The SnO2:5Tb/Fe3O4 nanohybrid was prepared and investigated for hyperthermia applications at different concentrations of the nanohybrid. This achieves a hyperthermia temperature (42 °C) under an AC magnetic field. The hybrid nanomaterial SnO2:5Tb/Fe3O4 was found to exhibit biocompatibility with HeLa cells (human cervical cancer cells) at concentrations up to 74% for 100 μg L(-1). Also, this nanohybrid shows green emission and thus it will be helpful in tracing magnetic nanoparticles through optical imaging in vivo and in vitro application.
Directory of Open Access Journals (Sweden)
Emy Niyama
2004-04-01
Full Text Available These films were obtained by dip coating. Parameters like dislocation velocity; number of deposits, suspension concentration, and number of deposits followed or not by heat treatment between each deposit and calcination temperature were evaluated for establishing the best homogeneity. The obtained films were characterized in terms of their morphology, optical quality and photoluminescence by scanning electron microscopy (SEM, UV-vis absorption spectrophotometry and luminescence spectroscopy, respectively. The morphologic and luminescent characteristics showed dip coating as good laboratory technique for development of thin films for optical applications.
2010-07-01
... of States, political subdivision of the State, or an agency or instrumentality, including a wholly... marketing oil; (ii) Not an affiliate of a person engaged in producing, refining, or marketing oil; or (iii) Not an affiliate of a person engaged in producing, refining, or marketing oil; and then (3) Any other...
Thompson, Denise K; Clark, Mary Jo; Howland, Lois C; Mueller, Mary-Rose
2011-08-01
On March 23, 2010, President Obama signed the Patient Protection and Affordable Care Act, setting in motion a historic and, for many, a long-awaited radical change to the current American health care system. Section 2951 of the PPACA addresses provision and funding of maternal, infant, and early childhood home visiting programs. The purpose of this article is to acquaint the reader with the legislative odyssey of home visitation services to at-risk prenatal and postpartum women and children as delineated in the PPACA and to discuss the nursing practice and research implications of this landmark legislation. Few question the need for more rigorous methodology in all phases of home visitation research. Public health nursing may provide the comprehensive approach to evaluating effective home visitation programs.
Synthesis and characterization of spherical Tb-MCM-41
Energy Technology Data Exchange (ETDEWEB)
Pires, Luiza H.O., E-mail: lulenapires@hotmail.co [Universidade Federal do Para, Instituto de Ciencias Exatas e Naturais, Laboratorio de Catalise e Oleoquimica, CP 479, CEP 66075-110, Belem, PA (Brazil); Queiroz, Renan M.; Souza, Ruth P.; Costa, Carlos E.F. da; Zamian, Jose R. [Universidade Federal do Para, Instituto de Ciencias Exatas e Naturais, Laboratorio de Catalise e Oleoquimica, CP 479, CEP 66075-110, Belem, PA (Brazil); Weber, Ingrid T. [Universidade Federal de Pernambuco, Centro de Ciencias Exatas e da Natureza, Av. Prof. Luis Barros Freire, s/n, Cidade Universitaria, 50670-901 Recife, PE (Brazil); Filho, Geraldo N. da Rocha [Universidade Federal do Para, Instituto de Ciencias Exatas e Naturais, Laboratorio de Catalise e Oleoquimica, CP 479, CEP 66075-110, Belem, PA (Brazil)
2010-02-04
Spherical MCM-41 was synthesized at room temperature and functionalized by means of direct synthesis method. Evidence for the terbium presence in the silica matrix was obtained by means of EDX. Scanning electron microscopy (SEM) micrographs showed that terbium incorporation did not change significantly MCM-41 morphology. The maintenance of the hexagonal structure was confirmed by X-ray diffraction (XRD) pattern analysis. The cell parameter increase and the surface area decrease, observed by N{sub 2} adsorption-desorption technique, were taken as evidence of terbium introduction inside the MCM-41 framework. By FT-IR spectra it was found that the main features of the silica framework were maintained. The presence of a strong absorption band centered at ca. 220 nm in the diffuse reflectance UV-vis spectra could indicate the presence of tetra-coordinated terbium in the silica network of Tb-MCM-41 samples.
Therapeutic use of radioactive isotopes
Caroline Duc
2013-01-01
In December, researchers from ISOLDE-CERN, the Paul Scherrer Institute (PSI) and the Institut Laue-Langevin (ILL) published the results of an in vivo study which successfully proved the effectiveness of four terbium isotopes for diagnosing and treating cancerous tumours. Four terbium isotopes suitable for clinical purposes. “ISOLDE is the only installation capable of supplying terbium isotopes of such purity and intensity in the case of three out of the four types used in this study,” explains Karl Johnson, a physicist at ISOLDE. “Producing over a thousand different isotopes, our equipment offers the widest choice of isotopes in the world!” Initially intended for fundamental physics research, ISOLDE has diversified its activities over time to invest in various projects in the materials science, biochemistry and nuclear medicine fields. The proof-of-concept study has confirmed that the four terbium isotopes 149Tb, 152Tb, 155Tb produ...
Thermal History Using Microparticle Trap Luminescence
2012-06-01
and thermoluminescence of terbium-activated silicates and aluminates " . Radiat. Meas. 43, 323-326 (2008). HDTRA1-07-1-0016 University of...of terbium-activated silicates and aluminates " . 15th Solid State Dosimetry Conference, Delft, The Netherlands, July 8-13 (2007). 2 INTRODUCTION...increased to 500°C until combustion occurred (- 7 min). The remaining powder was collected, crushed in a agate mortar, and annealed (typically at 900
Alçiçek, M. Cihat; Mayda, Serdar; Demirel, F. Arzu
2017-10-01
The study by Aksoy and Aksarı (2016); (1) omits key fossil localities resulting in erroneous age estimates for their rock units, and (2) excludes and/or refers incorrectly pre-existing key studies in their research field. As the study is based on no age data, their proposal of NW-SE directed crustal extension that transitions to transtension is flawed. In this comment we summarize pre-existing age data and highlight its vital importance for yielding accurate information on the evolution of the Burdur Basin.
2016-10-07
This book represents the first attempt to create a children's nursing theory that involves giving children with illnesses or disabilities access to childhoods as close as possible to those of their peers.
Canadell, L; Martín-Loeches, I; Díaz, E; Trefler, S; Grau, S; Yebenes, J C; Almirall, J; Olona, M; Sureda, F; Blanquer, J; Rodriguez, A
2015-05-01
To determine the degree of antiviral treatment recommendations adherence and its impact to critical ill patients affected by influenza A(H1N1)pdm09 mortality. Secondary analysis of prospective study. Intensive care (UCI). Patients with influenza A(H1N1)pdm09 in the 2009 pandemic and 2010-11 post-Pandemic periods. Adherence to recommendations was classified as: Total (AT); partial in doses (PD); partial in time (PT), and non-adherence (NA). Viral pneumonia, obesity and mechanical ventilation were considered severity criteria for the administration of high antiviral dose. The analysis was performed using t-test or «chi» square. Survival analysis was performed and adjusted by Cox regression analysis. A total of 1,058 patients, 661 (62.5%) included in the pandemic and 397 (37.5%) in post-pandemic period respectively. Global adherence was achieved in 41.6% (43.9% and 38.0%; P=.07 respectively). Severity criteria were similar in both periods (68.5% vs. 62.8%; P=.06). The AT was 54.7% in pandemic and 36.4% in post-pandemic period respectively (P<.01). The NA (19.7% vs. 11.3%; P<.05) and PT (20.8% vs. 9.9%, P<.01) was more frequent in the post-pandemic period. The mortality rate was higher in the post-pandemic period (30% vs. 21.8%, P<.001). APACHE II (HR=1.09) and hematologic disease (HR=2.2) were associated with a higher mortality and adherence (HR=0.47) was a protective factor. A low degree of adherence to the antiviral treatment was observed in both periods. Adherence to antiviral treatment recommendations was associated with lower mortality rates and should be recommended in critically ill patients with suspected influenza A(H1N1)pdm09. Copyright © 2014 Elsevier España, S.L.U. and SEMICYUC. All rights reserved.
Directory of Open Access Journals (Sweden)
J.A. Sarralde
2012-04-01
Conclusiones: La ECMO es útil para pacientes con insuficiencia respiratoria refractaria a medidas convencionales incluidos en lista de espera, así como para aquellos que precisen circulación extracorpórea para realización del trasplante pulmonar, disminuyendo las posibles complicaciones y aumentando la supervivencia.
Energy Technology Data Exchange (ETDEWEB)
Souza, A.S., E-mail: adelmosaturnino@hotmail.com [Departamento de Química Fundamental, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil); Nunes, L.A. [Instituto de Física de São Carlos, Universidade de São Paulo, 13560-970 São Carlos, SP (Brazil); Felinto, M.C.F.C. [Instituto de Pesquisas Energéticas e Nucleares-IPEN, 05505-800 São Paulo, SP (Brazil); Brito, H.F. [Instituto de Química, Universidade de São Paulo, 05508-900 São Paulo, SP (Brazil); Malta, O.L. [Departamento de Química Fundamental, Universidade Federal de Pernambuco, 50670-901 Recife, PE (Brazil)
2015-11-15
In this work we discuss the observed Tb{sup 3+} ion luminescence quenching, due to the relative ligand low lying triplet state energy, in the [Tb(tta){sub 3} (H{sub 2}O){sub 2}] compound at low and room temperature (tta=thenoyltrifluoroacetonate). Theoretical energy transfer rates, for both multipolar and exchange mechanisms, were calculated and discussed on the basis of selection rules and energy mismatch conditions from the [Tb(tta){sub 3} (H{sub 2}O){sub 2}] emission spectra. We have concluded that the exchange mechanism by far dominates, in the present case, and that the long first excited state {sup 7}F{sub 5} lifetime (in the millisecond scale) plays a crucial role in the Tb{sup 3+} luminescence quenching. - Highlights: • The energy exchange between the ligand T{sub 1} and Tb{sup 3+5}D{sub 4} levels occur by the exchange interaction. • The Tb{sup 3+} first excited {sup 7}F{sub 5} level plays a crucial role in this process due to its long lifetime. • At room temperature the energy exchanged between the {sup 5}D{sub 4} level of the Tb{sup 3+} ion and the T{sub 1} of the ligand is lost via the intersystem crossing T{sub 1} → S{sub 0} channel.
Chandrasekhar, Vadapalli; Bag, Prasenjit; Speldrich, Manfred; van Leusen, Jan; Kögerler, Paul
2013-05-06
Sequential reaction of Mn(II) and lanthanide(III) salts with a new multidentate ligand, 2,2'-(2-hydroxy-3-methoxy-5-methylbenzylazanediyl)diethanol (LH3), containing two flexible ethanolic arms, one phenolic oxygen, and a methoxy group afforded heterometallic tetranuclear complexes [Mn2Dy2(LH)4(μ-OAc)2](NO3)2·2CH3OH·3H2O (1), [Mn2Gd2(LH)4(μ-OAc)2](NO3)2·2CH3OH·3H2O (2), [Mn2Tb2(LH)4(μ-OAc)2](NO3)2·2H2O·2CH3OH·Et2O (3), and [Mn2Ho2(LH)4(μ-OAc)2]Cl2·5CH3OH (4). All of these dicationic complexes possess an arch-like structural topology containing a central Mn(III)-Ln-Ln-Mn(III) core. The two central lanthanide ions are connected via two phenolate oxygen atoms. The remaining ligand manifold assists in linking the central lanthanide ions with the peripheral Mn(III) ions. Four doubly deprotonated LH(2-) chelating ligands are involved in stabilizing the tetranuclear assembly. A magnetochemical analysis reveals that single-ion effects dominate the observed susceptibility data for all compounds, with comparably weak Ln···Ln and very weak Ln···Mn(III) couplings. The axial, approximately square-antiprismatic coordination environment of the Ln(3+) ions in 1-4 causes pronounced zero-field splitting for Tb(3+), Dy(3+), and Ho(3+). For 1 and 3, the onset of a slowing down of the magnetic relaxation was observed at temperatures below approximately 5 K (1) and 13 K (3) in frequency-dependent alternating current (AC) susceptibility measurements, yielding effective relaxation energy barriers of ΔE = 16.8 cm(-1) (1) and 33.8 cm(-1) (3).
Directory of Open Access Journals (Sweden)
Valentina V. Utochnikova
2012-01-01
Full Text Available The new reactive chemical vapor deposition (RCVD method has been proposed for thin film deposition of luminescent nonvolatile lanthanide aromatic carboxylates. This method is based on metathesis reaction between the vapors of volatile lanthanide dipivaloylmethanate (Ln(dpm3 and carboxylic acid (HCarb orH2Carb′ and was successfully used in case of HCarb. Advantages of the method were demonstrated on example of terbium benzoate (Tb(bz3 and o-phenoxybenzoate thin films, and Tb(bz3 thin films were successfully examined in the OLED with the following structure glass/ITO/PEDOT:PSS/TPD/Tb(bz3/Ca/Al. Electroluminescence spectra of Tb(bz3 showed only typical luminescent bands, originated from transitions of the terbium ion. Method peculiarities for deposition of compounds of dibasic acids H2Carb′ are established on example of terbium and europium terephtalates and europium 2,6-naphtalenedicarboxylate.
Spatial resolution in X-ray imaging with scintillating glass optical fiber plates
Pavan, P.; Zanella, G.; Zannoni, R.; Marigo, A.
1993-04-01
Some scintillating optical fiber plates, fabricated with terbium glasses are tested for their intrinsic spatial resolution under X-ray irradiation and the result is compared with a typical phosphor screen. The spatial resolution (CTF and MTF) is measured as a function of spatial frequency and the standard deviation of the corresponding Gaussian PSF is derived.
PROCESS FOR THE PREPARATION OF ALLOY NANOPARTICLES COMPRISING A NOBLE AND A NON-NOBLE METAL
DEFF Research Database (Denmark)
2017-01-01
The present invention concerns a chemical process for preparing nanoparticles of an alloy comprising both a noble metal, such as platinum, and a non-noble transition or lanthanide metal, such as yttrium, gadolinium or terbium. The process is carried out by reduction with hydrogen and removal...
Multiplet effects in the electronic structure of heavy rare-earth metals
Lebegue, S.; Svane, A.; Katsnelson, M.I.; Lichtenstein, A.I.; Eriksson, O.
2006-01-01
The spectroscopic properties of elemental terbium, dysprosium, holmium, and erbium are investigated using first-principles calculations taking into account intra-atomic correlation effects. In order to describe the strongly localized f electrons together with the conduction bands, we have used the
Performance of 20 Ci 137Cs γ-ray Compton spectrometer for the ...
Indian Academy of Sciences (India)
The in-house 137Cs spectrometer is very useful for the measurement of momentum densities of heavy materials. The performance of the machine is assessed using aluminum, terbium and mercury samples and the exper- imental data from comparable apparatus. Keywords. Compton scattering; electron momentum density; ...
African Journals Online (AJOL)
Pengkiliya, P. Vol 67 (2014) - Articles Interaction of 3-Hydroxypicolinamide with TbIII and its Sensitizing Effect on Terbium Luminescence as a Function of pH and Medium Abstract PDF. ISSN: 0379-4350. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...
African Journals Online (AJOL)
Devi, TP. Vol 67 (2014) - Articles Interaction of 3-Hydroxypicolinamide with TbIII and its Sensitizing Effect on Terbium Luminescence as a Function of pH and Medium Abstract PDF. ISSN: 0379-4350. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...
THz near-field Faraday imaging in hybrid metamaterials
Kumar, N.; Strikwerda, A.C.; Fan, K.; Zhang, X.; Averitt, R.D.; Planken, P.C.M.; Adam, A.J.L.
2012-01-01
We report on direct measurements of the magnetic near-field of metamaterial split ring resonators at terahertz frequencies using a magnetic field sensitive material. Specifically, planar split ring resonators are fabricated on a single magneto-optically active terbium gallium garnet crystal.
CSIR Research Space (South Africa)
Dejene, FB
2011-07-01
Full Text Available to Ca3Si2O7 as the terbium concentration increase. Broad band excitations peaking between 280 - 360 nm derived from excited states of Tb3+ ions were observed for all powders grown from various Tb compositions. The green emission peak at 545 nm due...
Scanning Electron Microscope-Cathodoluminescence Analysis of Rare-Earth Elements in Magnets.
Imashuku, Susumu; Wagatsuma, Kazuaki; Kawai, Jun
2016-02-01
Scanning electron microscope-cathodoluminescence (SEM-CL) analysis was performed for neodymium-iron-boron (NdFeB) and samarium-cobalt (Sm-Co) magnets to analyze the rare-earth elements present in the magnets. We examined the advantages of SEM-CL analysis over conventional analytical methods such as SEM-energy-dispersive X-ray (EDX) spectroscopy and SEM-wavelength-dispersive X-ray (WDX) spectroscopy for elemental analysis of rare-earth elements in NdFeB magnets. Luminescence spectra of chloride compounds of elements in the magnets were measured by the SEM-CL method. Chloride compounds were obtained by the dropwise addition of hydrochloric acid on the magnets followed by drying in vacuum. Neodymium, praseodymium, terbium, and dysprosium were separately detected in the NdFeB magnets, and samarium was detected in the Sm-Co magnet by the SEM-CL method. In contrast, it was difficult to distinguish terbium and dysprosium in the NdFeB magnet with a dysprosium concentration of 1.05 wt% by conventional SEM-EDX analysis. Terbium with a concentration of 0.02 wt% in an NdFeB magnet was detected by SEM-CL analysis, but not by conventional SEM-WDX analysis. SEM-CL analysis is advantageous over conventional SEM-EDX and SEM-WDX analyses for detecting trace rare-earth elements in NdFeB magnets, particularly dysprosium and terbium.
Performance of 20 Ci 137Cs γ-ray Compton spectrometer for the ...
Indian Academy of Sciences (India)
... than the conventional 241Am Compton spectrometers. The in-house 137Cs spectrometer is very useful for the measurement of momentum densities of heavy materials. The performance of the machine is assessed using aluminum, terbium and mercury samples and the experimental data from comparable apparatus.
Faraday isolator based on TSAG crystal for high power lasers.
Mironov, E A; Palashov, O V
2014-09-22
A Faraday isolator based on a new magneto-optical medium, TSAG (terbium scandium aluminum garnet) crystal, has been constructed and investigated experimentally. The device provides an isolation ratio of more than 30 dB at 500 W laser power. It is shown that this medium can be used in Faraday isolators for kilowatt-level laser powers.
1990-05-20
effects in fibers, and nonlinear phenomena in fibers. We also use NMR, ESR and Raman techniques to study incorporation of novel as well as...neodymium, erbium, holmium or terbium. These products can be vacuum dried at elevated temperature. The acac-compound is less expensive since the hfa
Time-gated FRET nanoassemblies for rapid and sensitive intra- and extracellular fluorescence imaging
Afsari, Hamid Samareh; Cardoso Dos Santos, Marcelina; Lindén, Stina; Chen, Ting; Qiu, Xue; van Bergen En Henegouwen, Paul M P|info:eu-repo/dai/nl/071919481; Jennings, Travis L; Susumu, Kimihiro; Medintz, Igor L; Hildebrandt, Niko; Miller, Lawrence W
Time-gated Förster resonance energy transfer (FRET) using the unique material combination of long-lifetime terbium complexes (Tb) and semiconductor quantum dots (QDs) provides many advantages for highly sensitive and multiplexed biosensing. Although time-gated detection can efficiently suppress
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science; Volume 39; Issue 7. Issue front cover thumbnail. Volume 39, Issue 7. December 2016, pages 1619-1889. pp 1619-1623. Luminescence properties of terbium-doped Li 3 PO 4 phosphor for radiation dosimetry · C B PALAN N S BAJAJ S K OMANWAR · More Details Abstract ...
Interaction of 3-Hydroxypicolinamide with Tb III and its Sensitizing ...
African Journals Online (AJOL)
Interaction of 3-Hydroxypicolinamide with Tb III and its Sensitizing Effect on Terbium Luminescence as a Function of pH and Medium. ... The complex formed exists asML2 species in which HPA behaves as anO,O,N,N-chelating ligand. The solid complex is isolated from aqueous medium and characterized employing ...
National Research Council Canada - National Science Library
Leif, Robert C; Becker, Margie C; Bromm Jr., Al; Chen, Nanguang; Cowan, Ann E; Vallarino, Lidia M; Yang, Sean; Zucker, Robert M
2004-01-01
.... Preliminary studies indicate that cells stained with the europium Quantum Dye can be observed both by conventional UV laser excitation and by infrared two-photon confocal microscopy. An enhancer has been found that enables the observation of simultaneous emissions from both the europium and terbium Quantum Dyes.
Kinetically inert lanthanide complexes as reporter groups for binding of potassium by 18-crown-6
DEFF Research Database (Denmark)
Junker, Anne Kathrine Ravnsborg; Tropiano, Manuel; Faulkner, Stephen
2016-01-01
in a copper(I)-catalyzed alkyne-azide cycloaddition (CuAAC) “click” reaction with azide-functionalized crown ethers. The resulting complexes were investigated using NMR and optical methods. Titrations with potassium chloride in methanol observing the sensititzed europium- and terbium-centered emissions were...
Hawthorne, P. J.
1976-01-01
Data obtained in wind tunnel tests are presented. The objectives of the tests were to: (1) obtain pressure distributions, forces and moments over the vehicle 5 Orbiter in the terminal area energy management (TAEM) and approach phases of flight; (2) obtain elevon and rudder hinge moments in the TAEM and approach phases of flight; (3) obtain body flap and elevon loads for verification of loads balancing with integrated pressure distributions; and (4) obtain pressure distributions near the short OMS pods in the high subsonic, transonic and low supersonic Mach number regimes. Testing was conducted over a Mach number range from 0.6 to 1.4 with Reynolds number variations from 4.57 million to 2.74 million per foot. Model angle-of-attack was varied from -4 to 16 degrees and angles of side slip ranged from -8 to 8 degrees.
de la Fuente-Gonzalo, Félix; Nieto, Jorge M; Velasco, Diego; Cela, Elena; Pérez, Germán; Fernández-Teijeiro, Ana; Escudero, Antonio; Villegas, Ana; González-Fernández, Fernando A; Ropero, Paloma
2016-04-01
Structural hemoglobinopathies do not usually have a clinical impact, but they can interfere with the analytical determination of some parameters, such as the glycated hemoglobin in diabetic patients. Thalassemias represent a serious health problem in areas where their incidence is high. The defects in the post-translational modifications produce hyper-unstable hemoglobin that is not detected by most of electrophoretic or chromatographic methods that are available so far. We studied seven patients who belong to six unrelated families. The first two families were studied because they had peak abnormal hemoglobin (Hb) during routine analytical assays. The other four families were studied because they had microcytosis and hypochromia with normal HbA2 and HbF without iron deficiency. HbA2 and F quantification and abnormal Hb separation were performed by chromatographic and electrophoretic methods. The molecular characterization was performed using specific sequencing. The Hb Puerta del Sol presents electrophoretic mobility and elution in HPLC that is different from HbA and similar to HbS. The electrophoretic and chromatographic profiles of the four other variants are normal and do not show any anomalies, and their identification was only possible with sequencing. Some variants, such as Hb Valdecilla, Hb Gran Vía, Hb Macarena and Hb El Retiro, have significant clinical impact when they are associated with other forms of α-thalassemia, which could lead to more serious forms of this group of pathologies as for HbH disease. Therefore, it is important to maintain an adequate program for screening these diseases in countries where the prevalence is high to prevent the occurrence of severe forms.
Energy Technology Data Exchange (ETDEWEB)
Means, Ken [National Energy Technology Lab. (NETL), Morgantown, WV (United States); Muring, Timothy M. [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); Sams, Neal W. [National Energy Technology Lab. (NETL), Morgantown, WV (United States); Oryshchyn, Danylo B. [National Energy Technology Lab. (NETL), Albany, OR (United States); Boswell, Ray [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); Keairns, Dale [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United States); Miller, III, Roy H. [National Energy Technology Lab. (NETL), Albany, OR (United States); Justman, Devn H. [National Energy Technology Lab. (NETL), Albany, OR (United States); Gemman, Randall S. [National Energy Technology Lab. (NETL), Morgantown, WV (United States); McKoy, Mark L. [National Energy Technology Lab. (NETL), Morgantown, WV (United States); Thewlis, Tracy A. [National Energy Technology Lab. (NETL), Morgantown, WV (United States); Boyle, Edward J. [National Energy Technology Lab. (NETL), Morgantown, WV (United States); Richards, George A. [National Energy Technology Lab. (NETL), Morgantown, WV (United States)
2017-08-01
NETL has reviewed available information and evaluated the deep geothermal and natural gas resources located beneath the Camp Dawson National Guard Training Center in West Virginia. This facility is located in the northeastern portion of the state in Preston County, near the town of Kingwood. This study reviews options for the onsite drilling of wells for the production of geothermal heat or natural gas, as well as the utilization of these resources for on-site power and heating needs. Resources of potential interest are at subsurface depths between 7,000 feet and 15,000 feet.
1976-04-01
assembly operations, bit may not extend to such specialized processes as diecasting , plastic molding, design, building, or debugging of specialized...following equipment categories: o Automatic screw machines o Punch presses o Other presses o Diecasting machines o Powder metal compaction presses o Cutoff...been grouped in this category, which includes machines to perform the following processes: o Broaching o Diecasting o Grinding o Injection molding o
Aksoy, Rahmi; Aksarı, Süleyman
2017-10-01
In their discussion on the Aksoy and Aksarı (2016) article, Alçiçek et al. (2017) claim that our stratigraphic interpretation, age assignment for the rock units and kinematic analysis depended on incorrect data. They also claim that there is no evidence for a NE-trending fault zone (Fethiye-Burdur Fault Zone) from Fethiye to Burdur with left-lateral strike-slip movement. Our opposing views on the above-mentioned issues are given below.
Palmer, William K G
2017-05-01
The research report concluded, "It appears that self-reported sleep reported of participants may be associated to the indirect effects of visual and attitudinal cue and concern about property devaluation rather than distance to the nearest WT's or noise as itself." Careful reading of the report shows that the conclusions presented are not supported by the data provided in the report. Copyright © 2016 Elsevier Inc. All rights reserved.
National Oceanic and Atmospheric Administration, Department of Commerce — Measurements in the data set are made with a Battelle Seaology pCO2 monitoring system (MApCO2), a Seabird SBE16plusV2 CTD, mounted on a surface buoy similar to the...
Energy Technology Data Exchange (ETDEWEB)
Esparza G, A.E.; Garcia, M.; Falcony, C.; Azorin N, J. [CICATA-IPN, Legaria 694, Col. Irrigacion, 11500 Mexico D.F. (Mexico)
2000-07-01
In this work the photo luminescent and cathode luminescent characteristics of aluminium oxide (Al{sub 2}O{sub 3}) powders impurified with terbium (Tb) were studied for their use in dosimetry. The optical, structural, morphological characteristics of the powders as function of variation in the impurity concentration and the annealing temperature will be presented. As regards the optical properties of powders (photoluminescence and cathode luminescence) it was observed a characteristic emission associated with radiative transitions between electron energy levels of terbium, the spectra associated with this emission consists of several peaks associated with such transitions. In the structural and morphological characterization (X-ray diffraction and scanning electron microscopy) it was appreciated that in accordance the annealing temperature of powders is augmented it is evident the apparition of certain crystalline phases. The results show that this is a promissory material for radiation dosimetry. (Author)
Plastic optical fibre sensor for in-vivo radiation monitoring during brachytherapy
Woulfe, P.; Sullivan, F. J.; Lewis, E.; O'Keeffe, S.
2015-09-01
An optical fibre sensor is presented for applications in real-time in-vivo monitoring of the radiation dose a cancer patient receives during seed implantation in Brachytherapy. The sensor is based on radioluminescence whereby radiation sensitive scintillation material is embedded in the core of a 1mm plastic optical fibre. Three scintillation materials are investigated: thallium-doped caesium iodide (CsI:Tl), terbium-doped gadolinium oxysulphide (Gd2O2S:Tb) and europium-doped lanthanum oxysulphide (La2O2S:Eu). Terbium-doped gadolinium oxysulphide was identified as being the most suitable scintillator and further testing demonstrates its measureable response to different activities of Iodine-125, the radio-active source commonly used in Brachytherapy for treating prostate cancer.
[Luminescent cytochemical methods of detecting microorganisms].
Ivanovskaia, N P; Osin, N S; Khramov, E N; Zlobin, V N
1999-01-01
The paper shows that the luminescence cytochemical technique can be used for identification of microorganisms and microbiological synthesis products. The method is based on the interaction of specific fluorescence probes (ANS, terbium ions, and beta-diketonate complexes of europium, as well as metal-containing porphyrines) with major microbial intracellular components and toxins. Unlike classical microbiological, immunochemical or biochemical methods of detection, the proposed method has a reasonable versatility, specificity, sensitivity, rapid action, and possible automation.
Radiotherapy dosimetry based on plastic optical fibre sensors
O'Keeffe, S.; Grattan, M.; Hounsell, A.; McCarthy, D.; Woulfe, P.; Cronin, J.; Lewis, E.
2013-05-01
The use of a PMMA based plastic optical fibre in radiotherapy dosimetry is presented. The optical fibre tip is coated with a scintillation material, terbium-doped gadolinium oxysulfide (Gd2O2S:Tb), which fluoresces under ionising radiation. The emitted signal penetrates the fibre and propagates along the fibre where it is remotely monitored using a fluorescence spectrometer. The results demonstrate good repeatability, with a maximum percentage error of 0.59% and the response is independent of dose rate.
Luminescent Lanthanide Metal Organic Frameworks for cis-Selective Isoprene Polymerization Catalysis
Samantha Russell; Thierry Loiseau; Christophe Volkringer; Marc Visseaux
2015-01-01
In this study, we are combining two areas of chemistry; solid-state coordination polymers (or Metal-Organic Framework—MOF) and polymerization catalysis. MOF compounds combining two sets of different lanthanide elements (Nd3+, Eu3+/Tb3+) were used for that purpose: the use of neodymium was required due to its well-known catalytic properties in dienes polymerization. A second lanthanide, europium or terbium, was included in the MOF structure with the aim to provide luminescent properties. Sev...
Energy Technology Data Exchange (ETDEWEB)
Hoffman, R. D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2013-09-06
We have developed a set of modeled nuclear reaction cross sections for use in radiochemical diagnostics. Systematics for the input parameters required by the Hauser-Feshbach statistical model were developed and used to calculate neutron induced nuclear reaction cross sections for targets ranging from Terbium (Z = 65) to Rhenium (Z = 75). Of particular interest are the cross sections on Tm, Lu, and Ta including reactions on isomeric targets.
Directory of Open Access Journals (Sweden)
M. S. Attia
2007-01-01
Full Text Available The efficiency of excited-states interactions between lanthanide ions Tb3+ and Eu3+ and some new cyclophanes (I, II, and III has been studied in different media. High luminescence quantum yield values for terbium and europium complexes in DMSO and PMMA were obtained. The photophysical properties of the green and red emissive Tb3+ and Eu3+ complexes have been elucidated, respectively.
Sojka, Bartlomiej; Liskova, Aurelia; Kuricova, Miroslava; Banski, Mateusz; Misiewicz, Jan; Dusinska, Maria; Horvathova, Mira; Ilavska, Silvia; Szabova, Michaela; Rollerova, Eva; Podhorodecki, Artur; Tulinska, Jana
2017-02-01
Sodium fluoride-based β-NaLnF4 nanoparticles (NPs) doped with lanthanide ions are promising materials for application as luminescent markers in bio-imaging. In this work, the effect of NPs doped with yttrium (Y), gadolinium (Gd), europium (Eu), thulium (Tm), ytterbium (Yb) and terbium (Tb) ions on phagocytic activity of monocytes and granulocytes and the respiratory burst was examined. The surface functionalization of leukocytes and respiratory burst of cells was observed for limited number of samples.
Cadman, Laura K; Mahon, Mary F; Burrows, Andrew D
2018-02-13
A series of lanthanide metal-organic frameworks (MOFs) of the general formula [Ln(Hodip)(H 2 O)]·nH 2 O (Sm, 1; Eu, 2; Gd, 3; Tb, 4; Dy, 5; Er, 6; H 4 odip = 5,5'-oxydiisophthalic acid) have been prepared and shown crystallographically to have isostructural three-dimensional frameworks. The fluorescence emission spectra of the europium compound 2, which is red, and the terbium compound 4, which is green, show characteristic peaks for transitions involving the metal centres, whereas that for the gadolinium compound 3 is dominated by transitions involving Hodip. Using a 1 : 1 : 1 mixture of europium, gadolinium and terbium nitrates in the synthesis resulted in the mixed-metal MOF [Gd 0.17 Tb 0.19 Eu 0.64 (Hodip)(H 2 O)]·nH 2 O 7, for which the ratio of the metal ions was determined using EDX spectroscopy. The fluorescence emission spectrum of 7 is dominated by europium emission bands reflecting the higher proportion of Eu 3+ centres and quenching of the terbium fluorescence by metal-to-metal energy transfer. A series of core-shell MOF materials based on the Ln(Hodip)(H 2 O) framework have been prepared in order to isolate the lanthanides in different domains within the crystals. The emission spectra for materials with Gd@Tb@Eu (8) and Tb@Eu@Gd (9) are dominated by terbium emissions, suggesting that physical separation from europium suppresses quenching. In contrast, the material with Eu@Gd@Tb (10) shows only broad ligand bands and europium emissions. This confirms that core-shell MOFs have different fluorescence properties to simple mixed-metal MOFs, demonstrating that the spatial distribution of the metals within a mixed-lanthanide MOF affects the fluorescence behaviour.
Synthesis and stimulated luminescence property of Zn(BO2)2:Tb(3).
Del Rosario, G Cedillo; Cruz-Zaragoza, E; Hipólito, M García; Marcazzó, J; Hernández A, J M; Murrieta S, H
2017-09-01
Zinc borate, Zn(BO2)2, doped with different concentrations of terbium (0.5-8mol%) was synthesized and polycrystalline samples were characterized by Scanning Electron Microscopy and X-Ray Diffraction. The Zn(BO2)2 was formed in the pure samples sintered at 750 and 800°C which has the body centered cubic structure, and a ZnB4O7 primitive orthorhombic phase was present. The thermoluminescent intensity was dependents on the thermal treatment (250-500°C) and also on the impurity concentration. The linear dose-response was obtained between 0.022-27.7Gy and 0.5-50Gy when the samples were exposed to beta and gamma radiation, respectively. The complex structure of the glow curves was analyzed by the Computerized Glow Curve Deconvolution method. The kinetics parameters were calculated assuming the general order kinetics model describing accurately the TL process. The glow curves of Tb(3+)-doped zinc borate phosphor were well deconvolved by six glow peaks. Zinc borate with 8mol% of impurity concentration exhibited an intense radioluminescent emission. The radioluminescent spectra show their maximum bands at 370, 490, 545 and 700nm related to the terbium ion in the zinc borate. These obtained results suggest that the terbium doped zinc borate is a promising phosphor for use in radiation dosimetry because of its high TL sensitivity to the ionizing radiation. Copyright © 2017 Elsevier Ltd. All rights reserved.
Effect of Ising-type Tb3+ ions on the low-temperature magnetism of La, Ca cobaltite.
Knížek, K; Jirák, Z; Hejtmánek, J; Veverka, M; Kaman, O; Maryško, M; Santavá, E; André, G
2014-03-19
Crystal and magnetic structures of the x = 0.2 member of the La0.8-xTbxCa0.2CoO3 perovskite series have been determined from powder neutron diffraction. Enhancement of the diffraction peaks due to ferromagnetic or cluster glass ordering is observed below TC = 55 K. The moments first evolve on Co sites, and ordering of Ising-type Tb(3+) moments is induced at lower temperatures by a molecular field due to Co ions. The final magnetic configuration is collinear Fx for the cobalt subsystem, while it is canted FxCy for terbium ions. The rare-earth moments align along local Ising axes within the ab-plane of the orthorhombic Pbnm structure. The behavior in external fields up to 70-90 kOe has been probed by magnetization and heat capacity measurements. The dilute terbium ions contribute to significant coercivity and remanence that both steeply increase with decreasing temperature. A remarkable manifestation of the Tb(3+) Ising character is the observation of a low-temperature region with an anomalously large linear term of heat capacity and its field dependence. Similar behaviors are detected also for other terbium dopings x = 0.1 and 0.3.
Luminescence enhancement by energy transfer in melamine-Y{sub 2}O{sub 3}:Tb{sup 3+} nanohybrids
Energy Technology Data Exchange (ETDEWEB)
Stagi, Luigi, E-mail: luigi.stagi@dsf.unica.it; Chiriu, Daniele; Carbonaro, Carlo M.; Ricci, Pier Carlo [Dipartimento di Fisica, Università degli Studi di Cagliari, S.P. Monserrato-Sestu Km 0,700, 09042 Monserrato (Italy); Ardu, Andrea; Cannas, Carla [Departimento di Scienze Chimiche e Geologiche and INSTM, Università d Cagliari, SS 554 bivio Sestu, I-09042 Monserrato (Italy)
2015-09-28
The phenomenon of luminescence enhancement was studied in melamine-Y{sub 2}O{sub 3}:Tb hybrids. Terbium doped Y{sub 2}O{sub 3} mesoporous nanowires were synthesized by hydrothermal method. X-ray diffraction patterns and Raman scattering spectra testified the realization of a cubic crystal phase. Organic-inorganic melamine-Y{sub 2}O{sub 3}:Tb{sup 3+} hybrid system was successfully obtained by vapour deposition method. Vibration Raman active modes of the organic counterpart were investigated in order to verify the achievement of hybrid system. Photoluminescence excitation and photoluminescence spectra, preformed in the region between 250 and 350 nm, suggest a strong interaction among melamine and Terbium ions. In particular, a remarkable improvement of {sup 5}D{sub 4}→ F{sub J} Rare Earth emission (at about 542 nm) of about 10{sup 2} fold was observed and attributed to an efficient organic-Tb energy transfer. The energy transfer mechanism was studied by the use of time resolved photoluminescence measurements. The melamine lifetime undergoes to a significant decrease when adsorbed to oxide surfaces and it was connected to a sensitization mechanism. The detailed analysis of time decay profile of Terbium radiative recombination shows a variation of double exponential law toward a single exponential one. Its correlation with surface defects and non-radiative recombination was thus discussed.
78 FR 56841 - Arbitrage Rebate Overpayments on Tax-Exempt Bonds
2013-09-16
.... Drafting Information The principal author of these regulations is Timothy Jones, Office of Associate Chief.... 1.148-0 Scope and table of contents. * * * * * (c) * * * Sec. 1.148-3 General arbitrage rebate rules...
Presence of virulent strains of amphizoic amoebae in swimming pools of the city of Szczecin
National Research Council Canada - National Science Library
Górnik, Katarzyna; Kuźna-Grygiel, Wanda
2004-01-01
.... No pathogenic strains were detected in the water sampled in the indoor swimming pools, and the virulent strains, AD 16, AD 148, AD 166, AM 17, and AM 148, were found only in the open-air swimming pools...
ORF Alignment: NC_005090 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... succinogenes] ... Length = 146 ... Query: 28 ... PEEQREALASLVRFIDNTKSDLDVAIYSFTNKEISKAIRKAAERGVKIRLIYDE...SANKGV 87 ... PEEQREALASLVRFIDNTKSDLDVAIYSFTNKEISKAIRKAAERGVKIRLIYDESANKGV... Sbjct: 1 ... PEEQREALASLVRFIDNTKSDLDVAIYSFTNKEISKAIRKAAERGVKIRLIYDESANKGV 60 ... Query: 148 YETLLITENLEWTQKAKRYF
ORF Alignment: NC_003228 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available VATFNIRYDNPGDSLNSWKYRKEKVCEFIREKHPDVLGMQEVLNHQLKDLLSGLPDYAY 60 ... Query: 148 DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAM...MTGDFNVSEEWEAYKT 207 ... DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAM...MTGDFNVSEEWEAYKT Sbjct: 121 DKTTGKEFLMLNTHFDHVGTEARRNSALLIIDKIKEIAGTHPAMMTGDFNVSEEWEAYKT 180 ... Query: 2
LLE Review 120 (July-September 2009)
Energy Technology Data Exchange (ETDEWEB)
Edgell, D.H., editor
2001-02-19
This issue has the following articles: (1) The Omega Laser Facility Users Group Workshop; (2) The Effect of Condensates and Inner Coatings on the Performance of Vacuum Hohlraum Targets; (3) Zirconia-Coated-Carbonyl-Iron-Particle-Based Magnetorheological Fluid for Polishing Optical Glasses and Ceramics; (4) All-Fiber Optical Magnetic Field Sensor Based on Faraday Rotation in Highly Terbium Doped Fiber; (5) Femtosecond Optical Pump-Probe Characterization of High-Pressure-Grown Al{sub 0.86}Ga{sub 0.14}N Single Crystals; (6) LLE's Summer High School Research Program; (7) Laser Facility Report; and (8) National Laser Users Facility and External Users Programs.
Reddy, D. Rajasekhar; Pedró Rosa, Laura E.; Miller, Lawrence W.
2011-01-01
Labeling proteins with long-lifetime emitting lanthanide (III) chelate reporters enables sensitive, time-resolved luminescence bioaffinity assays. Heterodimers of trimethoprim (TMP) covalently linked to various cs124-sensitized, polyaminocarboxylate chelates stably retain lanthanide ions and exhibit quantum yields of europium emission up to 20% in water. A time-resolved, luminescence resonance energy transfer (LRET) assay showed that TMP-polyaminocarboxylates bind to Escherichia coli dihydrofolate reductase (eDHFR) fusion proteins with nanomolar affinity in purified solutions and in bacterial lysates. The ability to selectively impart terbium or europium luminescence to fusion proteins in complex physiological mixtures bypasses the need for specific antibodies and simplifies sample preparation. PMID:21619068
Wang, QianMing
2009-09-01
The preparation of a novel type of low-molecular-weight amphiphilic organogelator bearing three long 14-alkyl chains and hydrophilic oligo(oxyethylene) groups was described. Ultra-violet absorption and fluorescence spectra give evidence of the energy transfer between organic ligands to lanthanide ions. Characteristic green, blue and red luminescence of the organogels were obtained and interesting emission properties of terbium, dysprosium and europium ions were unexpectedly observed at the first time during the order-disorder phase transition point (29 degrees C).
Giant onsite electronic entropy enhances the performance of ceria for water splitting
DEFF Research Database (Denmark)
Naghavi, S. Shahab; Emery, Antoine A.; Hansen, Heine Anton
2017-01-01
lanthanides, and reaches a maximum value of ≈4.7 kB per oxygen vacancy for Ce4+/Ce3+ reduction. This unique and large positive entropy source in ceria explains its excellent performance for high-temperature catalytic redox reactions such as water splitting. Our calculations also show that terbium dioxide has......Previous studies have shown that a large solid-state entropy of reduction increases the thermodynamic efficiency of metal oxides, such as ceria, for two-step thermochemical water splitting cycles. In this context, the configurational entropy arising from oxygen off-stoichiometry in the oxide, has...
Truman, Laura K; Bradberry, Samuel J; Comby, Steve; Kotova, Oxana; Gunnlaugsson, Thorfinnur
2017-07-05
The development of material-supported molecular logic gate mimics (MGLMs) for contained application and device fabrication has become of increasing interest. Herein, we present the formation of ≈5 nm gold nanoparticles (AuNPs) that have been surface-modified (via a thiol linkage) with heptadentate cyclen-based complexes of europium and terbium for sensing applications using delayed lanthanide luminescence and as integrated logic gate mimics within competitive media. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Ma Zhiya; Dosev, Dosi [Department of Mechanical and Aeronautical Engineering, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Nichkova, Mikaela [Department of Entomology, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Dumas, Randy K. [Department of Physics, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Gee, Shirley J.; Hammock, Bruce D. [Department of Entomology, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Liu Kai [Department of Physics, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States); Kennedy, Ian M. [Department of Mechanical and Aeronautical Engineering, University of California-Davis, One Shields Avenue, Davis CA 95616 (United States)], E-mail: imkennedy@ucdavis.edu
2009-05-15
Multifunctional core-shell nanocomposites with a magnetic core and a silica shell doped with lanthanide chelate have been prepared by a simple method. First, citric acid-modified magnetite nanoparticles were synthesized by a chemical coprecipitation method. Then the magnetite nanoparticles were coated with silica shells doped with terbium (Tb{sup 3+}) complex by a modified Stoeber method based on hydrolyzing and condensation of tetraethyl orthosilicate (TEOS) and a silane precursor. These multifunctional nanocomposites are potentially useful in a variety of biological areas such as bio-imaging, bio-labeling and bioassays because they can be simultaneously manipulated with an external magnetic field and exhibit unique phosphorescence properties.
Luminescent probing of the simplest chiral α-amino acid-alanine in an enantiopure and racemic state.
Tarasevych, Arkadii V; Kostyukov, Anton I; Baronskiy, Mark G; Rastorguev, Alexander A; Guillemin, Jean-Claude; Snytnikov, Valeriy N
2017-07-01
Luminescent spectroscopy combined with the technique of luminescent probing with rare earth ions (europium, gadolinium, terbium) and an actinide ion (uranyl) was used to differentiate enantiopure and racemic alanine, the simplest chiral proteinogenic amino acid. Using the achiral luminescent probes, small differences between pure L and DL alanine in the solid state were strongly amplified. Based on the observed electronic transitions of the probes, the position of the triplet level of the coordinated alanine was estimated. Formation of homo- and heterochiral complexes between enantiomers of alanine and the metal ions is discussed as a possible mechanism of chiral self-discrimination. © 2017 Wiley Periodicals, Inc.
DEFF Research Database (Denmark)
Lindgård, Per-Anker; Kowalska, A.; Laut, Peter
1967-01-01
-helical structure. A numerical calculation is performed for terbium on the basis of the Kaplan-Lyons Hamiltonian with added crystalline anisotropy. The non-istropic exchange part is shown to have a small effect on the dispersion curves, and it turns out that radical changes of the Ruderman-Kittel-type functions...... for the exchange interaction seem to be necessary for agreement with experimental dispersion curves be obtained. The effect of the anisotropy in the cross section is estimated and shown to be important for small magnon energies....
Directory of Open Access Journals (Sweden)
Camilo Méndez
2014-12-01
Full Text Available Rare (Earth Elements is a cycle of works for solo piano. The cycle was inspired by James Dillon’s Book of Elements (Vol. I-V. The complete cycle will consist of 14 pieces; one for each selected rare (earth element. The chosen elements are Neodymium, Erbium, Tellurium, Hafnium, Tantalum, Technetium, Indium, Dysprosium, Lanthanium, Cerium, Europium, Terbium, Yttrium and Darmstadtium. These elements were selected due to their special atomic properties that in many cases make them extremely valuable for the development of new technologies, and also because of their scarcity. To date, only 4 works have been completed Yttrium, Technetium, Indium and Tellurium.
Alaska's rare earth deposits and resource potential
Barker, James C.; Van Gosen, Bradley S.
2012-01-01
Alaska’s known mineral endowment includes some of the largest and highest grade deposits of various metals, including gold, copper and zinc. Recently, Alaska has also been active in the worldwide search for sources of rare earth elements (REE) to replace exports now being limitedby China. Driven by limited supply of the rare earths, combined with their increasing use in new ‘green’ energy, lighting, transportation, and many other technological applications, the rare earth metals neodymium, europium and, in particular, the heavy rare earth elements terbium, dysprosium and yttrium are forecast to soon be in critical short supply (U.S. Department of Energy, 2010).
Yu, Chufang; Zhang, Zhengyang; Fu, Meizhen; Gao, Jinwei; Zheng, Yuhui
2017-10-01
A group of silica gel electrolytes with lanthanide luminescent hybrid materials were assembled and investigated. Photophysical studies showed that terbium and europium hybrids displayed characteristic green and red emissions within the electrolytes. The influence of different concentration of the lanthanide hybrids on the electrochemical behavior of a gelled electrolyte valve-regulated lead-acid battery were studied through cyclic voltammograms, electrochemical impedance spectroscopy, water holding experiments and mobility tests. The morphology and particle size were analyzed by scanning electron microscopy. The results proved that lanthanide (Tb3+/Eu3+) luminescent materials are effective additives which will significantly improve the electrochemical properties of lead-acid batteries.
SPECTROSCOPIC PROPERTIES OF THE Ln-Ge COMPLEXES WITH DIETHYLENETRIAMINEPENTAACETIC ACID
Directory of Open Access Journals (Sweden)
Sergiy Smola
2007-06-01
Full Text Available Four new heteronuclear lanthanide complexes with general formula [Ge(OH(μ-HDTPALnGe(OH (μ-DTPA] (Ln = Sm – Dy were synthesized and subsequently characterized by different physico- chemical methods. The structures of new compounds have been proposed. In considered complexes the 4f-luminescence of three-charged ions of samarium, europium, terbium and dysprosium is realized at UV-excitation. It is noteworthy that it is the first observation of 4f-luminescence in water solutions of heteronuclear f-p-complexes. The comparison of luminescent characteristics of hetero- and homonuclear landthanide complexes is described and discussed as well.
Directory of Open Access Journals (Sweden)
Jin-Bei Shen
2011-09-01
Full Text Available In the centrosymmetric binuclear title complex, [Pr2(C9H9O36(C12H8N22], the two PrIII ions are linked by four 2-phenoxypropionate (L groups through their bi- and tridentate bridging modes. Each PrIII ion is nine-coordinated by one 1,10-phenanthroline molecule, one bidentate carboxylate group and four bridging carboxylate groups in a distorted PrN2O7 monocapped square-antiprismatic geometry. The title compound is isotypic with its terbium- and dysprosium-containing analogues.
Energy Technology Data Exchange (ETDEWEB)
Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State
2015-10-01
We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples
Faraday rotator based on TSAG crystal with orientation.
Yasuhara, Ryo; Snetkov, Ilya; Starobor, Aleksey; Mironov, Evgeniy; Palashov, Oleg
2016-07-11
A Faraday isolator (FI) for high-power lasers with kilowatt-level average power and 1-µm wavelength was demonstrated using a terbium scandium aluminum garnet (TSAG) with its crystal axis aligned in the direction. Furthermore, no compensation scheme for thermally induced depolarization in a magnetic field was used. An isolation ratio of 35.4 dB (depolarization ratio γ of 2.9 × 10-4) was experimentally observed at a maximum laser power of 1470 W. This result for room-temperature FIs is the best reported, and provides a simple, practical solution for achieving optical isolation in high-power laser systems.
ORF Alignment: NC_006513 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available th = 149 ... Query: 4 ... MAQLLSRSLTENIRLQTRLPPAPLHAFVAPHQLEXXXXXXXXXXRDAMPDGGSLMIAIG...E 63 ... MAQLLSRSLTENIRLQTRLPPAPLHAFVAPHQLE ... RDAMPDGGSLMIAIGE Sbjct: 1 ... MAQLLSRSLTENIRLQTRLP...PAPLHAFVAPHQLENALLNLALNARDAMPDGGSLMIAIGE 60 ... Query: 124 GFVRQSGGNIRIRSTPGSGTTVTFVLPR 151 ... GFVRQSGGNIRIRSTPGSGTTVTFVLPR Sbjct: 121 GFVRQSGGNIRIRSTPGSGTTVTFVLPR 148
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available idopsis thaliana] ... Length = 148 ... Query: 1 ... MSKDGLSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSII...TTENLS 60 ... MSKDGLSNDQVSSMKEAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSIITTENLS Sbjct: 1 ... MSKDGLSNDQVSSMK...EAFMLFDTDGDGKIAPSELGILMRSLGGNPTESQLKSIITTENLS 60 ... Query: 121 FDEWIKEVDVGSDGKIRYED
Gene : CBRC-OANA-01-1685 [SEVENS
Lifescience Database Archive (English)
Full Text Available | PREDICTED: similar to vomeronasal V1r-type receptor V1rg7 [Ornithorhynchus anatinus] 1e-148 100% gnl|UG|Oa...LSIFQAITISPSTSWWAGRKTKLPKCILPSFVIFWILNMLIDFHTLIVVTGPHNARIHQDMKYCSLGNASARATLIFSVVLSLRDLFFVGLMSVASVYMVFVLYSHHR
ORF Alignment: NC_006361 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... chain E [Nocardia farcinica IFM 10152] ... Length = 97 ... Query: 89 ... FYSMFRRTPTGDYHVGVCTNTLCA...VLGGDAILASLTEHLGIAAGETTADGAITVEHIECN 148 ... FYSMFRRTPTGDYHVGVCTNTLCAVLG...GDAILASLTEHLGIAAGETTADGAITVEHIECN Sbjct: 1 ... FYSMFRRTPTGDYHVGVCTNTLCAVLGGDAILASLTEHLGIAAGETTADGAITVEHIECN 60 ...
ORF Alignment: NC_003047 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available AEIARRSGLSAQTASVIMRSLEADGLLVRGAPVRGRVGQ 60 ... Query: 148 KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDR...WRDFDLQAAVASRIRHPVF 207 ... KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDRWRDFDLQAAVASRIRHP...VF Sbjct: 121 KLEGQLGPGERGRIAGVGIATPFELWNWSEEVGAPREEMDRWRDFDLQAAVASRIRHPVF 180 ... Query: 268 GKDGKSTQLLKIASVFV
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ADP1] ... Length = 154 ... Query: 13 ... LIIGIDPGSRLTGYGIIEKNGNELRFIDAGTIRTESQDMPERLKRIFAGVERIVKFHGPT 72 ... ... ... LIIGIDPGSRLTGYGIIEKNGNELRFIDAGTIRTESQDMPERLKRIFAGVERIVKFHGPT Sbjct: 1 ... ... LIIGIDPGSRLTGYGIIEKNGNELRFIDAGTIRTESQDMPERLKRIFAGVERIVKFHGPT 60 ... Query: 133 QMMVMRILNLTIKPQS 148 ... QMMVMRILNLTIKPQS Sbjct: 121 QMMVMRILNLTIKPQS 136
National Research Council Canada - National Science Library
Coté, Charlotte
2016-01-01
The food sovereignty movement initiated in 1996 by a transnational organization of peasants, La Via Campesina, representing 148 organizations from 69 countries, became central to self-determination...
Lifescience Database Archive (English)
Full Text Available D07465 Drug Arotinolol (INN) C15H21N3O2S3 371.0796 371.5411 D07465.gif Antiarrhythmic alpha1-adr...energic receptor antagonist [HSA:146 147 148] [KO:K04137 K04136 K04135]; beta1-adrenergic recep...tor antagonist [HSA:153] [KO:K04141]; beta2-adrenergic receptor antagonist [HSA:154] [KO:K04142]; beta3-adre...61(146+147+148+153+154) Adrenergic signaling in cardiomyocytes hsa04270(146+147+148) Vascular smooth muscle ...contraction hsa04970(146+147+148+153+154+155) Salivary secretion map07214 beta-Adr
Detection of bacterial spores with lanthanide-macrocycle binary complexes.
Cable, Morgan L; Kirby, James P; Levine, Dana J; Manary, Micah J; Gray, Harry B; Ponce, Adrian
2009-07-15
The detection of bacterial spores via dipicolinate-triggered lanthanide luminescence has been improved in terms of detection limit, stability, and susceptibility to interferents by use of lanthanide-macrocycle binary complexes. Specifically, we compared the effectiveness of Sm, Eu, Tb, and Dy complexes with the macrocycle 1,4,7,10-tetraazacyclododecane-1,7-diacetate (DO2A) to the corresponding lanthanide aquo ions. The Ln(DO2A)(+) binary complexes bind dipicolinic acid (DPA), a major constituent of bacterial spores, with greater affinity and demonstrate significant improvement in bacterial spore detection. Of the four luminescent lanthanides studied, the terbium complex exhibits the greatest dipicolinate binding affinity (100-fold greater than Tb(3+) alone, and 10-fold greater than other Ln(DO2A)(+) complexes) and highest quantum yield. Moreover, the inclusion of DO2A extends the pH range over which Tb-DPA coordination is stable, reduces the interference of calcium ions nearly 5-fold, and mitigates phosphate interference 1000-fold compared to free terbium alone. In addition, detection of Bacillus atrophaeus bacterial spores was improved by the use of Tb(DO2A)(+), yielding a 3-fold increase in the signal-to-noise ratio over Tb(3+). Out of the eight cases investigated, the Tb(DO2A)(+) binary complex is best for the detection of bacterial spores.
Dezi, Anna; Monachesi, Elenasophie; D’Ignazio, Michela; Scalise, Lorenzo; Montalto, Luigi; Paone, Nicola; Rinaldi, Daniele; Mengucci, Paolo; Loudos, George; Bakas, Athanasios; Michail, Christos; Valais, Ioannis; Fountzoula, Christine; Fountos, George; David, Stratos
2017-11-01
Rare earth activators are impurities added in the phosphor material to enhance probability of visible photon emission during the luminescence process. The main activators employed are rare earth trivalent ions such as Ce+3, Tb+3, Pr3+ and Eu+3. In this work, four terbium-activated Gd2O2S (GOS) powder screens with different thicknesses (1049 mg/cm2, 425.41 mg/cm2, 313 mg/cm2 and 187.36 mg/cm2) and one europium-activated GOS powder screen (232.18 mg/cm2) were studied to investigate possible applications for general radiology detectors. Results presented relevant differences in crystallinity between the GOS:Tb doped screens and GOS:Eu screens in respect to the dopant agent present. The AE (Absolute efficiency) was found to rise (i) with the increase of the X-ray tube voltage with the highest peaking at 110kVp and (ii) with the decrease of the thickness among the four GOS:Tb. Comparing similar thickness values, the europium-activated powder screen showed lower AE than the corresponding terbium-activated.
Energy Technology Data Exchange (ETDEWEB)
Kovacs, Thelma Antunes Rodrigues
2014-07-01
This work was synthesized and characterized ferrite magnetic nanoparticles manganese, using the chemical coprecipitation method. By varying the heating time under 98°C (0, 10,20,40,60 3 80 minutes), the molar percentage of doping (1, 3, 5, 7, and 10%), gadolinium, europium, terbium and holmium. Magnetic ferrite nanoparticles and manganese ferrite doped with manganese were synthesized by coprecipitation method starting with chloride solutions of metals (iron (III), manganese (II), europium (III), gadolinium (III), terbium (III) and holmium (III)) and NaOH 5mol.L{sup -1} as precipitating agent. The magnetic nanoparticles were characterized by scanning electron microscopy, infrared spectroscopy, X-ray diffraction, magnetization curves, and thermal analysis. Most of manganese ferrite particles showed superparamagnetic behavior. After the characterization it was found that the samples synthesized manganese ferrite with more than 40 minutes heating time, crystal structure showed the characteristic pattern of the inverted manganese ferrite spinel type. The stabilization of the samples in oleic acid nanoparticles produced with a hydrophobic outer layer and facilitated by coating chitosan biopolymer, since this has a positive charge. Among the doped samples there was no significant change in the magnetic behavior. Several techniques for characterizing these materials have been used such as X-ray diffraction spectrum in the infrared region, magnetization curves and thermal analysis. The resins were tested as magnetic material for the separation of biological materials. In this paper, are used as biological targets separation of bovine serum albumin. (author)
Cerium fluoride nanoparticles protect cells against oxidative stress
Energy Technology Data Exchange (ETDEWEB)
Shcherbakov, Alexander B.; Zholobak, Nadezhda M. [Zabolotny Institute of Microbiology and Virology, National Academy of Sciences of Ukraine, Kyiv D0368 (Ukraine); Baranchikov, Alexander E. [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); Ryabova, Anastasia V. [Prokhorov General Physics Institute of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Nuclear University MEPhI (Moscow Engineering Physics Institute), Moscow 115409 (Russian Federation); Ivanov, Vladimir K., E-mail: van@igic.ras.ru [Kurnakov Institute of General and Inorganic Chemistry of the Russian Academy of Sciences, Moscow 119991 (Russian Federation); National Research Tomsk State University, Tomsk 634050 (Russian Federation)
2015-05-01
A novel facile method of non-doped and fluorescent terbium-doped cerium fluoride stable aqueous sols synthesis is proposed. Intense green luminescence of CeF{sub 3}:Tb nanoparticles can be used to visualize these nanoparticles' accumulation in cells using confocal laser scanning microscopy. Cerium fluoride nanoparticles are shown for the first time to protect both organic molecules and living cells from the oxidative action of hydrogen peroxide. Both non-doped and terbium-doped CeF{sub 3} nanoparticles are shown to provide noteworthy protection to cells against the vesicular stomatitis virus. - Highlights: • Facile method of CeF{sub 3} and CeF{sub 3}:Tb stable aqueous sols synthesis is proposed. • Naked CeF{sub 3} nanoparticles are shown to be non-toxic and to protect cells from the action of H{sub 2}O{sub 2}. • CeF{sub 3} and CeF{sub 3}:Tb nanoparticles are shown to protect living cells against the vesicular stomatitis virus.
Energy Technology Data Exchange (ETDEWEB)
Paganini, Paula Pinheiro
2012-07-01
This work presents the synthesis, characterization and photo luminescent study of tin and titanium mixed oxide nanoparticles doped with europium, terbium and neodymium to be used with luminescent markers on biological systems. The syntheses were done by co-precipitation, protein sol-gel and Pechini methods and the nanoparticles were characterized by infrared spectroscopy, thermogravimetric analysis, scanning electron microscopy, X-ray diffraction and X-ray absorption spectroscopy. The photo luminescent properties studies were conducted for luminophores doped with europium, terbium and neodymium synthesized by coprecipitation method. For luminophore doped with europium it was possible to calculate the intensity parameters and quantum yield and it showed satisfactory results. In the case of biological system marking it was necessary the functionalization of these particles to allow them to bind to the biological part to be studied. So the nanoparticles were functionalized by microwave and Stoeber methods and characterized by infrared spectroscopy, scanning electron microscopy, energy dispersive X-ray spectroscopy and X-ray diffraction obtaining qualitative response of functionalization efficacy. The ninhydrin spectroscopic method was used for quantification of luminophores functionalization. The photo luminescent studies of functionalized particles demonstrate the potential applying of these luminophores as luminescent markers. (author)
Fabrication of Tb3Al5O12 transparent ceramics using co-precipitated nanopowders
Dai, Jiawei; Pan, Yubai; Wang, Wei; Luo, Wei; Xie, Tengfei; Kou, Huamin; Li, Jiang
2017-11-01
Terbium aluminum garnet (TAG) precursor was synthesized by a co-precipitation method from a mixed solution of terbium and aluminum nitrates using ammonium hydrogen carbonate (AHC) as the precipitant. The powders calcined at different temperatures were investigated by XRD, FTIR and FESEM in order to choose the optimal calcination temperature. Fine and low-agglomerated TAG powders with average particle size of 88 nm were obtained by calcining the precursor at 1100 °C for 4 h. Using this powder as starting material, TAG transparent ceramics were fabricated by vacuum sintering combined with hot isostatic pressing (HIP) sintering. For the sample pre-sintered at 1700 °C for 20 h with HIP post-treated at 1700 °C for 3 h, the average grain size is about 3.9 μm and the in-line transmittance is beyond 55% in the region of 500-1600 nm, reaching a maximum transmittance of 64.2% at the wavelength of 1450 nm. The Verdet constant at 633 nm is measured to be -178.9 rad T-1 m-1, which is 33% larger than that of the commercial TGG single crystal (-134 rad T-1 m-1).
Incorporation of Ln-Doped LaPO4 Nanocrystals as Luminescent Markers in Silica Nanoparticles.
van Hest, Jacobine J H A; Blab, Gerhard A; Gerritsen, Hans C; Donega, Celso de Mello; Meijerink, Andries
2016-12-01
Lanthanide ions are promising for the labeling of silica nanoparticles with a specific luminescent fingerprint due to their sharp line emission at characteristic wavelengths. With the increasing use of silica nanoparticles in consumer products, it is important to label silica nanoparticles in order to trace the biodistribution, both in the environment and living organisms.In this work, we synthesized LaPO4 nanocrystals (NCs) with sizes ranging from 4 to 8 nm doped with europium or cerium and terbium. After silica growth using an inverse micelle method, monodisperse silica spheres were obtained with a single LaPO4 NC in the center. We demonstrate that the size of the silica spheres can be tuned in the 25-55 nm range by addition of small volumes of methanol during the silica growth reaction. Both the LaPO4 core and silica nanocrystal showed sharp line emission characteristic for europium and terbium providing unique optical labels in silica nanoparticles of variable sizes.
Reehuis, M; Krimmel, A; Scheidt, E W; Stüsser, N; Loidl, A; Jeitschko, W
2003-01-01
The magnetic order of the orthorhombic aluminides TbFe sub 2 Al sub 1 sub 0 , HoFe sub 2 Al sub 1 sub 0 and ErFe sub 2 Al sub 1 sub 0 (space group Cmcm) has been studied by specific heat and magnetic measurements, as well as by neutron powder diffraction down to 100 mK and in external fields up to 5 T. Only the rare-earth ions carry a magnetic moment. At T = 1.5 K the terbium moments in TbFe sub 2 Al sub 1 sub 0 show a square-wave modulated magnetic order with wavevector k = (0, 0.7977, 0) and a moment direction parallel to the a-axis. At a critical field of H sub c sub 1 = 0.9 T one of ten spins is forced to flip, going into an intermediate ferrimagnetic phase that is stable up to the critical field H sub c sub 2 = 1.8 T. Above this field finally all the rest of the spins flip, resulting in a ferromagnetic order of the terbium moments. ErFe sub 2 Al sub 1 sub 0 orders antiferromagnetically below T sub N 1.77(7) K with a similar magnetic structure characterized by a wavevector k (0, approx 0.8, 0). In contras...
Deuteron induced Tb-155 production, a theranostic isotope for SPECT imaging and auger therapy.
Duchemin, C; Guertin, A; Haddad, F; Michel, N; Métivier, V
2016-12-01
Several terbium isotopes are suited for diagnosis or therapy in nuclear medicine. Tb-155 is of interest for SPECT imaging and/or Auger therapy. High radionuclide purity is mandatory for many applications in medicine. The quantification of the activity of the produced contaminants is therefore as important as that of the radionuclide of interest. The experiments performed at the ARRONAX cyclotron (Nantes, France), using the deuteron beam delivered up to 34MeV, provide an additional measurement of the excitation function of the Gd-nat(d,x)Tb-155 reaction and of the produced terbium and gadolinium contaminants. In this study, we investigate the achievable yield for each radionuclide produced in natural gadolinium as a function of the deuteron energy. Other reactions are discussed in order to define the production route that could provide Tb-155 with a high yield and a high radionuclide purity. This article aims to improve data for the Gd-nat(d,x) reaction and to optimize the irradiation conditions required to produce Tb-155. Copyright © 2016 Elsevier Ltd. All rights reserved.
Indian Academy of Sciences (India)
Navya
Reported frequencies of CDKN2A p.Ala148Thrand four non-synonymous MC1Rgenetic variants in melanoma populations of various geographical areas. Frequency (%) CDKN2A genetic variants. Country p.Ala148Thr. Reported study. Cyprus. 9.4. Current study. Brazil. 2.6. (Bakos et al. 2011). Iceland. 2.5. (Goldstein et al.
CDKN2A and MC1R variants found in Cypriot patients diagnosed ...
Indian Academy of Sciences (India)
Reported frequencies of CDKN2A p.Ala148Thr and four nonsynonymous MC1R genetic variants in melanoma populations of various geographical areas. Frequency (%) of CDKN2A genetic variants. Country p.Ala148Thr. Reported study. Cyprus. 9.4. Current study. Brazil. 2.6. Bakos et al. (2011). Iceland. 2.5. Goldstein et al.
Indian Academy of Sciences (India)
147b MI0005544. 125, >hsa-mir-148a MI0000253. 126, >hsa-mir-148b MI0000811. 127, >hsa-mir-149 MI0000478. 128, >hsa-mir-150 MI0000479. 129, >hsa-mir-151 MI0000809. 130, >hsa-mir-152 MI0000462. 131, >hsa-mir-153-1 MI0000463.
2013-09-09
... Foreign-Trade Zones Board Authority To Manufacture Carbon Fiber for the U.S. Market Not Approved; Foreign... manufacture carbon fiber under zone procedures for the U.S. market within Subzone 148C at the TTA facility in... authority to manufacture carbon fiber for the U.S. market under zone procedures within Subzone 148C at the...
US Fish and Wildlife Service, Department of the Interior — A total of 148 muskox in 7 groups were counted. A few muskox were probably missed during the census and the total of 148 muskox represents the minimum re-calving...
EST Table: AV400917 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available AV400917 br--1979 10/09/28 46 %/148 aa ref|XP_975194.1| PREDICTED: similar to something...|Amel|GB19080-PA 10/09/10 46 %/148 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 br-- ...
Page 1 oof van Buys hirurgie nde span lottige as klein rurgie in lewe ...
African Journals Online (AJOL)
Multimedia Book Department during December were: Medicinal Plants of South Africa by Ben-Erik van. Wyk, Bosch van Oudtshoorn and Nigel Gericke. R148. Briza. Publications, 1997. R148. ISBN 1-875093-09-5. Atlas of Minor Surgery by lan D Cracknell and Michael G Mead. R200. Churchill Uvingstone, 1997.
Directory of Open Access Journals (Sweden)
Hussein N. Yassine
2014-12-01
Full Text Available The oxidative modification of apolipoprotein A-I’s methionine148 (M148 is associated with defective HDL function in vitro. Multiple reaction monitoring (MRM is a mass spectrometric technique that can be used to quantitate post-translational modifications. In this study, we developed an MRM assay to monitor the abundance ratio of the peptide containing oxidized M148 to the native peptide in ApoA-I. Measurement of the oxidized-to-unoxidized-M148 ratio was reproducible (CV < 5%. The extent of methionine M148 oxidation in the HDL of healthy controls, and type 2 diabetic participants with and without prior cardiovascular events (CVD were then examined. The results suggest a significant increase in the relative ratio of the peptide containing oxidized M148 to the unmodified peptide in the HDL of participants with diabetes and CVD (p < 0.001, compared to participants without CVD. Monitoring the abundance ratio of the peptides containing oxidized and unoxidized M148 by MRM provides a means of examining the relationship between M148 oxidation and vascular complications in CVD.
Lifescience Database Archive (English)
Full Text Available OS=Clost... 37 1.5 tr|Q38L14|Q38L14_9VIRU Putative RNA dependent RNA polymerse OS=R... 36 1.9 tr|Q148R7|Q148...Putative RNA dependent RNA polymerse OS=Raphanus sativus cryptic virus 2 PE=4 SV=
Domain Modeling: NP_055198.1 [SAHG[Archive
Lifescience Database Archive (English)
Full Text Available NP_055198.1 chr19 Structure of an acetylated Rsc4 tandem bromodomain Histone Chimer...a p2r0sa_ chr19/NP_055198.1/NP_055198.1_apo_148-338.pdb p2r10a_ chr19/NP_055198.1/NP_055198.1_holo_148-338.p
Gclust Server: 152175 [Gclust Server
Lifescience Database Archive (English)
Full Text Available Sequences - 230 NP_085045.2 chromosome 6 open reading frame 148 ; no annotation 1 1.00e-99 0.0 0.0 0...Representative annotation NP_085045.2 chromosome 6 open reading frame 148 ; no annotation Number of Sequences 1
Annual Progress Report FY-92. Volume 1
1993-01-21
reported neuropsychiatric history on neuropsychological performance in HIV-infected military personnel. Fourth International Conference, Neuroscience of...Lip muscle EMG responses to mechanical stimulation Pr in a simple reaction time task. Society for Neuroscience , New Orleans, LA, November, 1991. [2506...148 hypersensitivity, 30 hyperthyroidism, 163, 168 hypnosis , 436 hypocalcemia, 474 hypocortisolemia, 148 hypogammaglobulinemia, I hypothyroidism, 168
hyperfibrinogenemia and ischemic stroke in young adul
African Journals Online (AJOL)
Imran Imran
2014-11-07
Nov 7, 2014 ... Abstract Background: Single nucleotide polymorphism (SNP) А148C/T which is located in b- fibrinogen gene (FGB) promoter has correlation with fibrinogen levels; however, the association of SNP А148C/T and ischemic stroke in young adult patients is contradictory. Aim: To determine the association of ...
Discriminating neutrino mass models using Type-II see-saw formula
Indian Academy of Sciences (India)
L Verde et al, Astrophys. J. Suppl. 148, 195 (2003). H V Peiris et al, Astrophys. J. Suppl. 148, 213 (2003). [12] S Hannestad, J. Cosmol. Astropart. Phys. 0305, 004 (2003). O Elgaroy and O Lahav, J. Cosmol. Astropart. Phys. 0304, 004 (2003). S Hannestad, Eur. Phys. J. C33, 5800 (2004), hep-ph/0310220. S Hannestad and ...
Corrigendum to ;Wounded quarks and diquarks in heavy ion collisions; [Phys. Lett. B 649 (2007) 263
Bialas, A.; Bzdak, A.
2017-10-01
Numerical result in Eq. (15), σqq /σNN = 1.147 - 1.148, as given in [Phys. Lett. B 649 (2007) 263] should be corrected to σqq /σNN = 0.147 - 0.148. The conclusions of the original paper remain unchanged. We thank Partha Pratim Bhaduri for pointing out this typo.