WorldWideScience

Sample records for terbium 141

  1. Elastic properties of terbium

    DEFF Research Database (Denmark)

    Spichkin, Y.I.; Bohr, Jakob; Tishin, A.M.

    1996-01-01

    The temperature dependence of the Young modulus along the crystallographic axes b and c (E(b) and E(c)), and the internal friction of a terbium single crystal have been measured. At 4.2 K, E(b) and E(c) are equal to 38 and 84.5 GPa, respectively. The lattice part of the Young modulus and the Debye...... temperature has been calculated. The origin of the Young modulus anomalies arising at the transition to the magnetically ordered state is discussed....

  2. Critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1968-01-01

    The inelasticity of the critical scattering of neutrons in terbium has been measured above the Neél temperature at the (0, 0, 2−Q) satellite position. The results show that dynamic slowing down of the fluctuations does occur in a second‐order phase transition in agreement with the general theory...

  3. Semiconductor composition containing iron, dysprosium, and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Pooser, Raphael C.; Lawrie, Benjamin J.; Baddorf, Arthur P.; Malasi, Abhinav; Taz, Humaira; Farah, Annettee E.; Kalyanaraman, Ramakrishnan; Duscher, Gerd Josef Mansfred; Patel, Maulik K.

    2017-09-26

    An amorphous semiconductor composition includes 1 to 70 atomic percent iron, 15 to 65 atomic percent dysprosium, 15 to 35 atomic percent terbium, balance X, wherein X is at least one of an oxidizing element and a reducing element. The composition has an essentially amorphous microstructure, an optical transmittance of at least 50% in at least the visible spectrum and semiconductor electrical properties.

  4. Raman spectroscopy study of the doping effect of the encapsulated terbium halogenides on single-walled carbon nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Kharlamova, M.V.; Kramberger, C.; Mittelberger, A. [University of Vienna, Faculty of Physics, Vienna (Austria)

    2017-04-15

    In the present work, the doping effect of terbium chloride, terbium bromide, and terbium iodide on single-walled carbon nanotubes (SWCNTs) was compared by Raman spectroscopy. A precise investigation of the doping-induced alterations of the Raman modes of the filled SWCNTs was conducted. The shifts of the components of the Raman modes and modification of their profiles allowed concluding that the inserted terbium halogenides have acceptor doping effect on the SWCNTs, and the doping efficiency increases in the line with terbium iodide, terbium bromide, and terbium chloride. (orig.)

  5. Magnetocaloric effect of thin Terbium films

    Science.gov (United States)

    Mello, V. D.; Anselmo, D. H. A. L.; Vasconcelos, M. S.; Almeida, N. S.

    2017-12-01

    We report a theoretical study of the magnetocaloric effect of Terbium (Tb) thin films due to finite size and surface effects in the helimagnetic phase, corresponding to a temperature range from TC=219 K to TN=231 K, for external fields of the order of kOe. For a Tb thin film of 6 monolayers submitted to an applied field (ΔH =30 kOe, ΔH =50 kOe and ΔH = 70 kOe) we report a significative change in adiabatic temperature, ΔT / ΔH , near the Néel temperature, of the order ten times higher than that observed for Tb bulk. On the other hand, for small values of the magnetic field, large thickness effects are found. For external field strength around few kOe, we have found that the thermal caloric efficiency increases remarkably for ultrathin films. For an ultrathin film with 6 monolayers, we have found ΔT / ΔH = 43 K/T while for thicker films, with 20 monolayers, ΔT / ΔH = 22 K/T. Our results suggest that thin films of Tb are a promising material for magnetocaloric effect devices for applications at intermediate temperatures.

  6. Femtosecond XUV spectroscopy of gadolinium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Carley, Robert; Frietsch, Bjoern; Doebrich, Kristian; Teichmann, Martin; Gahl, Cornelius; Noack, Frank [Max-Born-Institute, Berlin (Germany); Schwarzkopf, Olaf; Wernet, Philippe [Helmholtz-Zentrum fuer Materialien und Energie (BESSY II), Berlin (Germany); Weinelt, Martin [Max-Born-Institute, Berlin (Germany); Fachbereich Physik, Freie Universitaet, Berlin (Germany)

    2011-07-01

    We present recent results of time-resolved IR-pump-XUV-probe experiments on the ultrafast demagnetization of thin films of Gadolinium(0001) and Terbium(0001) on Tungsten(110). The experiments are the first to be done using a newly developed high-order harmonics (HHG) XUV beamline at the MBI. The beamline delivers monochromated XUV pulses of approximately 150 fs duration with a photon energy resolution of up to 150 meV. Following excitation by intense femtosecond infrared (IR) pulses, photoemission with 35 eV photons allows us to directly probe the 4f electrons and their interaction with the valence band, both in the bulk and at the surface, to follow the ultrafast magnetization dynamics in the Lanthanide metals. As signatures of ultrafast demagnetization of the metal by the IR pulse, we see for the first time, rapid strong reduction of the exchange splitting in the valence band. This is followed by a slower demagnetization due to the spin-lattice interaction.

  7. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    Glasses; terbium ion; oscillator strengths; fluorescence; lifetimes; fibre lasers. 1. Introduction. Today glasses are most favourable engineering materials for abundant applications due to the wide ability of property altering by compositional modifications. The considerable examination of glass science to achieve required ...

  8. Green fluorescence of terbium ions in lithium fluoroborate glasses ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 39; Issue 3. Green fluorescence of terbium ions in lithium fluoroborate glasses for fibre lasers and display devices. G R DILLIP C MADHUKAR REDDY M RAJESH SHIVANAND CHAURASIA B DEVA PRASAD RAJU S W JOO. Volume 39 Issue 3 June 2016 pp 711-717 ...

  9. Terahertz Cherenkov radiation from ultrafast magnetization in terbium gallium garnet

    Science.gov (United States)

    Gorelov, S. D.; Mashkovich, E. A.; Tsarev, M. V.; Bakunov, M. I.

    2013-12-01

    We report an experimental observation of terahertz Cherenkov radiation from a moving magnetic moment produced in terbium gallium garnet by a circularly polarized femtosecond laser pulse via the inverse Faraday effect. Contrary to some existing theoretical predictions, the polarity of the observed radiation unambiguously demonstrates the paramagnetic, rather than diamagnetic, nature of the ultrafast inverse Faraday effect. From measurements of the radiation field, the Verdet constant in the subpicosecond regime is ˜3-10 times smaller than its table quasistatic value.

  10. Terbium luminescence in alumina xerogel fabricated in porous anodic alumina matrix under various excitation conditions

    Energy Technology Data Exchange (ETDEWEB)

    Gaponenko, N. V., E-mail: nik@nano.bsuir.edu.by [Belarusian State University of Informatics and Radioelectronics (Belarus); Kortov, V. S. [Yeltsin Ural Federal University (Russian Federation); Orekhovskaya, T. I.; Nikolaenko, I. A. [Belarusian State University of Informatics and Radioelectronics (Belarus); Pustovarov, V. A.; Zvonarev, S. V.; Slesarev, A. I. [Yeltsin Ural Federal University (Russian Federation); Prislopski, S. Ya. [National Academy of Sciences of Belarus, Stepanov Institute of Physics (Belarus)

    2011-07-15

    Terbium-doped alumina xerogel layers are synthesized by the sol-gel method in pores of a porous anodic alumina film 1 {mu}m thick with a pore diameter of 150-180 nm; the film is grown on a silicon substrate. The fabricated structures exhibit terbium photoluminescence with bands typical of trivalent terbium terms. Terbium X-ray luminescence with the most intense band at 542 nm is observed for the first time for such a structure. Morphological analysis of the structure by scanning electron microscopy shows the presence of xerogel clusters in pore channels, while the main pore volume remains unfilled and pore mouths remain open. The data obtained confirm the promising applications of fabricated structures for developing matrix converters of X-rays and other ionizing radiations into visible light. The possibilities of increasing luminescence intensity in the matrix converter are discussed.

  11. Optical Properties of Lithium Terbium Fluoride and Implications for Performance in High Power Lasers (Postprint)

    Science.gov (United States)

    2016-02-01

    AFRL-RX-WP-JA-2016-0323 OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS... AMERICA (STINFO COPY) AIR FORCE RESEARCH LABORATORY MATERIALS AND MANUFACTURING DIRECTORATE WRIGHT-PATTERSON AIR FORCE BASE, OH 45433-7750 AIR...OPTICAL PROPERTIES OF LITHIUM TERBIUM FLUORIDE AND IMPLICATIONS FOR PERFORMANCE IN HIGH POWER LASERS (POSTPRINT) 5a. CONTRACT NUMBER IN-HOUSE 5b

  12. Detection of biothiols in cells by a terbium chelate-Hg (II) system

    Science.gov (United States)

    Tan, Hongliang; Chen, Yang

    2012-01-01

    Great efforts have been devoted to the development of sensitive and specific analysis methods for biothiols because of their important roles in biological systems. We present a new detection system for biothiols that is based on the reversible quenching and restoration of fluorescence of terbium chelate caused by Hg2+ and thiol species. In the presence of biothiols, a restoration of fluorescence of terbium chelate after quenching by Hg2+ was observed due to the interaction of Hg2+ with thiol groups, and the restored fluorescence increased with the concentration of biothiols. This method was sensitive and selective for biothiols. The detection limit was 80 nM for glutathione, 100 nM for Hcy, and 400 nM for Cysteine, respectively. The terbium chelate-Hg (II) system was successfully applied to determine the levels of biothiols in cancer cells and urine samples. Further, it was also shown to be comparable to Ellman's assay. Compared to other fluorescence methods, the terbium chelate probe is advantageous because interference from short-lived nonspecific fluorescence can be efficiently eliminated due to the long fluorescence lifetime of terbium chelate, which allows for detection by time-resolved fluorescence. The terbium chelate probe can serve as a diagnostic tool for the detection of abnormal levels of biothiols in disease.

  13. Cryogenic temperature characteristics of Verdet constant of terbium sesquioxide ceramics

    Science.gov (United States)

    Snetkov, I. L.; Palashov, O. V.

    2016-12-01

    The dependence of the Verdet constant on temperature in the (80-300 K) range for a promising magneto-active material terbium sesquioxide Tb2O3 at the wavelengths of 405-1064 nm is considered. For each of the studied wavelengths, the Verdet constant of the material cooled down to the liquid nitrogen temperature increased by more than a factor of 3.2 as compared to the room temperature value. Similarly to the other paramagnetics, the increase follows the law ∼1/T. Approximations for the temperature dependence of the Verdet constant have been obtained and the value of 1/V·(dV/dT) has been estimated. This information is needed to determine the angle of rotation as well as the variation of the extinction ratio of a Faraday isolator with temperature and extremely important at creation a cryogenic Faraday devices.

  14. Biogenic terbium oxide nanoparticles as the vanguard against osteosarcoma

    Science.gov (United States)

    Iram, Sana; Khan, Salman; Ansary, Abu Ayoobul; Arshad, Mohd; Siddiqui, Sahabjada; Ahmad, Ejaz; Khan, Rizwan H.; Khan, Mohd Sajid

    2016-11-01

    The synthesis of inner transition metal nanoparticles via an ecofriendly route is quite difficult. This study, for the first time, reports synthesis of terbium oxide nanoparticles using fungus, Fusarium oxysporum. The biocompatible terbium oxide nanoparticles (Tb2O3 NPs) were synthesized by incubating Tb4O7 with the biomass of fungus F. oxysporum. Multiple physical characterization techniques, such as UV-visible and photoluminescence spectroscopy, TEM, SAED, and zeta-potential were used to confirm the synthesis, purity, optical and surface characteristics, crystallinity, size, shape, distribution, and stability of the nanoemulsion of Tb2O3 NPs. The Tb2O3 NPs were found to inhibit the propagation of MG-63 and Saos-2 cell-lines (IC50 value of 0.102 μg/mL) and remained non-toxic up to a concentration of 0.373 μg/mL toward primary osteoblasts. Cell viability decreased in a concentration-dependent manner upon exposure to 10 nm Tb2O3 NPs in the concentration range 0.023-0.373 μg/mL. Cell toxicity was evaluated by observing changes in cell morphology, cell viability, oxidative stress parameters, and FACS analysis. Morphological examinations of cells revealed cell shrinkage, nuclear condensation, and formation of apoptotic bodies. The level of ROS within the cells-an indicator of oxidative stress was significantly increased. The induction of apoptosis at concentrations ≤ IC50 was corroborated by 4‧,6-diamidino-2-phenylindole dihydrochloride (DAPI) staining (DNA damage and nuclear fragmentation). Flow-cytometric studies indicated that the response was dose dependent with a threshold effect.

  15. Autofluorescence-free Live-cell Imaging Using Terbium Nanoparticles.

    Science.gov (United States)

    Cardoso Dos Santos, Marcelina; Goetz, Joan; Bartenlian, Hortense; Wong, Ka-Leung; Charbonniere, Loïc Joanny; Hildebrandt, Niko

    2018-02-20

    Fluorescent nanoparticles (NPs) have become irreplaceable tools for advanced cellular and sub-cellular imaging. While very bright NPs require excitation with UV or visible light, which can create strong autofluorescence of biological components, NIR-excitable NPs without autofluorescence issues exhibit much lower brightness. Here, we show the application of a new type of surface-photosensitized terbium NPs (Tb-NPs) for autofluorescence-free intracellular imaging in live HeLa cells. Combination of exceptionally high brightness, high photostability, and long photoluminecence (PL) lifetimes for highly efficient suppression of the short-lived autofluorescence, allowed for time-gated PL imaging of intracellular vesicles over 72 h without toxicity and at extremely low Tb-NP concentrations down to 12 pM. Detection of highly resolved long-lifetime (ms) PL decay curves from small (~10 µm2) areas within single cells within a few seconds emphasized the unprecedented photophysical properties of Tb-NPs for live-cell imaging that extend well beyond currently available nanometric imaging agents.

  16. Solar Thermochemical Hydrogen Production via Terbium Oxide Based Redox Reactions

    Directory of Open Access Journals (Sweden)

    Rahul Bhosale

    2016-01-01

    Full Text Available The computational thermodynamic modeling of the terbium oxide based two-step solar thermochemical water splitting (Tb-WS cycle is reported. The 1st step of the Tb-WS cycle involves thermal reduction of TbO2 into Tb and O2, whereas the 2nd step corresponds to the production of H2 through Tb oxidation by water splitting reaction. Equilibrium compositions associated with the thermal reduction and water splitting steps were determined via HSC simulations. Influence of oxygen partial pressure in the inert gas on thermal reduction of TbO2 and effect of water splitting temperature (TL on Gibbs free energy related to the H2 production step were examined in detail. The cycle (ηcycle and solar-to-fuel energy conversion (ηsolar-to-fuel efficiency of the Tb-WS cycle were determined by performing the second-law thermodynamic analysis. Results obtained indicate that ηcycle and ηsolar-to-fuel increase with the decrease in oxygen partial pressure in the inert flushing gas and thermal reduction temperature (TH. It was also realized that the recuperation of the heat released by the water splitting reactor and quench unit further enhances the solar reactor efficiency. At TH=2280 K, by applying 60% heat recuperation, maximum ηcycle of 39.0% and ηsolar-to-fuel of 47.1% for the Tb-WS cycle can be attained.

  17. Folate Receptor Targeted Alpha-Therapy Using Terbium-149

    CERN Document Server

    Müller, Cristina; Haller, Stephanie; Dorrer, Holger; Köster, Ulli; Johnston, Karl; Zhernosekov, Konstantin; Türler, Andreas; Schibli, Roger

    2014-01-01

    Terbium-149 is among the most interesting therapeutic nuclides for medical applications. It decays by emission of short-range α-particles (Eα = 3.967 MeV) with a half-life of 4.12 h. The goal of this study was to investigate the anticancer efficacy of a 149Tb-labeled DOTA-folate conjugate (cm09) using folate receptor (FR)-positive cancer cells in vitro and in tumor-bearing mice. 149Tb was produced at the ISOLDE facility at CERN. Radiolabeling of cm09 with purified 149Tb resulted in a specific activity of ~1.2 MBq/nmol. In vitro assays performed with 149Tb-cm09 revealed a reduced KB cell viability in a FR-specific and activity concentration-dependent manner. Tumor-bearing mice were injected with saline only (group A) or with 149Tb-cm09 (group B: 2.2 MBq; group C: 3.0 MBq). A significant tumor growth delay was found in treated animals resulting in an increased average survival time of mice which received 149Tb-cm09 (B: 30.5 d; C: 43 d) compared to untreated controls (A: 21 d). Analysis of blood parameters rev...

  18. Hardness and dielectric characteristics of flux grown terbium aluminate crystals

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, K.K.; Kotru, P.N. [Jammu Univ. (India). Dept. of Physics; Tandon, R.P. [National Physical Laboratory, New Delhi (India); Wanklyn, B.M. [Clarendon Laboratory, University of Oxford, Oxford (United Kingdom)

    1999-01-29

    Results of indentation induced Vickers hardness testing and dielectric studies conducted on flux-grown terbium aluminate crystals are presented. It is shown that the Vickers hardness value (H{sub v}) is independent of indentation time, but depends on the applied load. Applying the concept of Hays and Kendall, the load independent values are estimated for (110) and (001) planes. Differential behaviour in the crack formation of two different planes (110) and (001) is observed, while (001) plane develops Palmqvist cracks in the whole load range of 10-100 g, (110) plane shows a transition from Palmqvist to median cracks at 70 g. The fracture toughness, brittleness index and yield strength are determined for both the planes. The hardness anisotropy is reported. The dielectric constant, dielectric loss and conductivity are shown to be dependent on temperature and frequency of the applied a.c. field. The dielectric constant versus temperature shows a transition peak at 230 C, which remains independent of the frequency of the applied a.c. field in the range 1 kHz-13 MHz. (orig.) 36 refs.

  19. Thermoluminescence of cerium and terbium -doped calcium pyrophosphate

    Energy Technology Data Exchange (ETDEWEB)

    Roman L, J.; Cruz Z, E. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Lozano R, I. B.; Diaz G, J. A. I., E-mail: jesus.roman@nucleares.unam.mx [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Av. Legaria No. 694, 11500 Mexico D. F. (Mexico)

    2015-10-15

    The aim of this work is to report the thermoluminescence (Tl) response of Calcium Pyrophosphate phosphor doped with Cerium and Terbium impurities (Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+}). The phosphors were synthesized using the co-precipitation method and annealed at 900 degrees C by two hours for obtain the β phase. The intentional doping with Ce and Tb ions was 1 at.% and 0.1 at.%, whereas in the EDS results the concentration of impurities was 0.39 at.% and 0.05 at.%, respectively. The superficial morphology of phosphor is mainly composed by thin wafers of different size. All samples were exposed to gamma rays from {sup 60}Co in the Gammacell-200 irradiator. The Tl response of the phosphor was measured from Rt up to 350 degrees C and under nitrogen atmosphere in a Harshaw TLD 3500 reader. The glow curves of the Ca{sub 2}P{sub 2}O{sub 7}:Ce{sup 3+},Tb{sup 3+} powders showed a broad intense Tl peak centered at 165 degrees C and a shoulder at approximate 260 degrees C was observed. A linear Tl response in the range of absorbed dose of 0.2 to 10 Gy was obtained. Tl glow curves were analyzed using the initial rise (IR)and computerized glow curve deconvolution methods to evaluate the kinetics parameters such as activation energy (E), frequency factor (s) and kinetic order (b). (Author)

  20. Solvent polarity and oxygen sensitivity, rather than viscosity, determine lifetimes of biaryl-sensitised terbium luminescence.

    Science.gov (United States)

    Walter, Edward R H; Williams, J A Gareth; Parker, David

    2017-12-14

    In a macrocyclic terbium complex incorporating a biaryl sensitiser, the observed variation of emission lifetime is shown to be determined by the solubility of oxygen in the solvent system and the relative energy of the chromophore excited state, rather than any dependence on solvent viscosity.

  1. 14 CFR 141.39 - Aircraft.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft. 141.39 Section 141.39 Aeronautics... CERTIFICATED AGENCIES PILOT SCHOOLS Personnel, Aircraft, and Facilities Requirements § 141.39 Aircraft. (a... certificate or provisional pilot school certificate must show that each aircraft used by the school for flight...

  2. 40 CFR 141.33 - Record maintenance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Record maintenance. 141.33 Section 141.33 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Reporting and Recordkeeping § 141.33 Record maintenance. Any...

  3. 14 CFR 1264.141 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

  4. Nuclear Data Sheets for 141Eu

    Science.gov (United States)

    Tuli, J. K.

    1998-06-01

    Nuclear structure data pertaining to 141Eu have been compiled and evaluated, and incorporated into the ENSDF data file. This evaluation of 141Eu supersedes the previous publication by L. K. Peker Nuclear Data Sheets 63,573 (1991). Abs; 141Eu is updated. Mostly the new information is from ( 35Cl,2p2nγ) reaction.

  5. 47 CFR 101.141 - Microwave modulation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Microwave modulation. 101.141 Section 101.141... SERVICES Technical Standards § 101.141 Microwave modulation. (a) Microwave transmitters employing digital modulation techniques and operating below 25.25 GHz (except for MVDDS stations in the 12,200-12,700 MHz band...

  6. 47 CFR 87.141 - Modulation requirements.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Modulation requirements. 87.141 Section 87.141... Technical Requirements § 87.141 Modulation requirements. (a) When A3E emission is used, the modulation... modulation in excess of 100 percent. (c) If any licensed radiotelephone transmitter causes harmful...

  7. 40 CFR 141.91 - Recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... determinations, and any other information required by §§ 141.81 through 141.88. Each water system shall retain... requirements. Any system subject to the requirements of this subpart shall retain on its premises original... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recordkeeping requirements. 141.91...

  8. 17 CFR 141.5 - Hearing.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Hearing. 141.5 Section 141.5 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION SALARY OFFSET § 141.5 Hearing. (a) Request for hearing. (1) An employee must file a petition for a hearing in accordance with the...

  9. 22 CFR 141.5 - Compliance information.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be necessary...

  10. 40 CFR 141.703 - Sampling locations.

    Science.gov (United States)

    2010-07-01

    ... receive Cryptosporidium treatment credit for bank filtration under § 141.173(b) or § 141.552(a), as... treatment credit for the bank filtration under § 141.717(c). (e) Multiple sources. Systems with plants that... the analysis of the sample. (c) Systems that recycle filter backwash water must collect source water...

  11. 40 CFR 141.623 - Reduced monitoring.

    Science.gov (United States)

    2010-07-01

    ... influence of surface water, based on monitoring conducted under either § 141.132(b)(1)(iii) or § 141.132(d). Source water type Population size category Monitoringfrequency 1 Distribution system monitoring location... water under the direct influence of surface water, you must resume routine monitoring under § 141.621 or...

  12. 40 CFR 141.76 - Recycle provisions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recycle provisions. 141.76 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.76 Recycle provisions. (a... recycle spent filter backwash water, thickener supernatant, or liquids from dewatering processes must meet...

  13. 14 CFR 141.91 - Satellite bases.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...

  14. 25 CFR 141.28 - Gambling prohibited.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Gambling prohibited. 141.28 Section 141.28 Indians BUREAU..., HOPI AND ZUNI RESERVATIONS General Business Practices § 141.28 Gambling prohibited. No licensee may permit any person to gamble by dice, cards, or in any way whatever, including the use of any mechanical...

  15. 14 CFR 141.23 - Advertising limitations.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...

  16. [Phonomechanocardiography of 141 healthy patients].

    Science.gov (United States)

    Guadalajara, J F; Fishleder, B L; Cornó, A; Hladky, M; Araujo, J; Friedland, C

    1979-01-01

    When studying 141 normal persons of both sexes we checked acoustic phenomena and measured the sistolic intervals. We discuss here the presence of blowing anorganic phenomena and sounds III and IV among the general public. We develop equations of regression to correct the electromechanic sistole (QIIA) and the left ventricular ejection time (LVET) the registered values being different from those published by other researchers. Last of all we analyse semiology and the interpretation of the sistolic phases of the cardiac cycle using them in a routinary way and stressing its value and limitations, specially when used to get a better knowledge of the state of the myocardial functions.

  17. Arginine-responsive terbium luminescent hybrid sensors triggered by two crown ether carboxylic acids

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Lasheng [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Tang, Ke; Ding, Xiaoping [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Wang, Qianming, E-mail: qmwang@scnu.edu.cn [Key Laboratory of Theoretical Chemistry of Environment, Ministry of Education, School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China); Zhou, Zhan; Xiao, Rui [School of Chemistry and Environment, South China Normal University, Guangzhou 510006 (China)

    2013-12-01

    Crown ether carboxylic acids constitute main building blocks for the synthesis of terbium containing covalent cross-linked luminescent materials. Both the complexes and the hybrid nanomaterials could exhibit remarkable green emissions in pure water. More importantly, they were found to have a profound effect on the luminescence responses to arginine compared with glutamic acid, histidine, tryptophan, threonine, tyrosine and phenylalanine in aqueous environment. The present study provided the possibility of using a host–guest mechanism as a way of signal transduction based on lanthanide supramolecular hybrid materials. - Highlights: • Crown ether carboxylic acids were found to sensitize terbium ions among a group of ethers. • The complexes and silica hybrid materials were both prepared and characterized. • They could exhibit remarkable green emissions in pure water.

  18. Comparative analysis of conjugated alkynyl chromophore-triazacyclononane ligands for sensitized emission of europium and terbium.

    Science.gov (United States)

    Soulié, Marine; Latzko, Frédéric; Bourrier, Emmanuel; Placide, Virginie; Butler, Stephen J; Pal, Robert; Walton, James W; Baldeck, Patrice L; Le Guennic, Boris; Andraud, Chantal; Zwier, Jurriaan M; Lamarque, Laurent; Parker, David; Maury, Olivier

    2014-07-07

    A series of europium and terbium complexes based on a functionalized triazacyclononane carboxylate or phosphinate macrocyclic ligand is described. The influence of the anionic group, that is, carboxylate, methylphosphinate, or phenylphosphinate, on the photophysical properties was studied and rationalized on the basis of DFT calculated structures. The nature, number, and position of electron-donating or electron-withdrawing aryl substituents were varied systematically within the same phenylethynyl scaffold in order to optimize the brightness of the corresponding europium complexes and investigate their two-photon absorption properties. Finally, the europium complexes were examined in cell-imaging applications, and selected terbium complexes were studied as potential oxygen sensors. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe

    OpenAIRE

    Ramezani, Amir M.; Manzoori, Jamshid L.; Amjadi, Mohammad; Jouyban, Abolghasem

    2012-01-01

    A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb3+-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum resp...

  20. Dicty_cDB: SLB141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB141 (Link to dictyBase) - - - - SLB141Z (Link to Original site) - - SLB...141Z 728 - - - - Show SLB141 Library SL (Link to library) Clone ID SLB141 (Link to dictyBase) At...las ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB1-B/SLB...141Q.Seq.d/ Representative seq. ID SLB141Z (Link to Original site) R...epresentative DNA sequence >SLB141 (SLB141Q) /CSM/SL/SLB1-B/SLB141Q.Seq.d/ XXXXXXXXXXTCGATGCCATCGTCGAACCAAAA

  1. Genetically Encoded FRET-Sensor Based on Terbium Chelate and Red Fluorescent Protein for Detection of Caspase-3 Activity

    Directory of Open Access Journals (Sweden)

    Alexander S. Goryashchenko

    2015-07-01

    Full Text Available This article describes the genetically encoded caspase-3 FRET-sensor based on the terbium-binding peptide, cleavable linker with caspase-3 recognition site, and red fluorescent protein TagRFP. The engineered construction performs two induction-resonance energy transfer processes: from tryptophan of the terbium-binding peptide to Tb3+ and from sensitized Tb3+ to acceptor—the chromophore of TagRFP. Long-lived terbium-sensitized emission (microseconds, pulse excitation source, and time-resolved detection were utilized to eliminate directly excited TagRFP fluorescence and background cellular autofluorescence, which lasts a fraction of nanosecond, and thus to improve sensitivity of analyses. Furthermore the technique facilitates selective detection of fluorescence, induced by uncleaved acceptor emission. For the first time it was shown that fluorescence resonance energy transfer between sensitized terbium and TagRFP in the engineered construction can be studied via detection of microsecond TagRFP fluorescence intensities. The lifetime and distance distribution between donor and acceptor were calculated using molecular dynamics simulation. Using this data, quantum yield of terbium ions with binding peptide was estimated.

  2. 24 CFR 100.141 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... DISCRIMINATORY CONDUCT UNDER THE FAIR HOUSING ACT Discrimination in Residential Real Estate-Related Transactions... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Definitions. 100.141 Section 100.141 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF...

  3. 40 CFR 141.21 - Coliform sampling.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Coliform sampling. 141.21 Section 141... sampling. (a) Routine monitoring. (1) Public water systems must collect total coliform samples at sites... must collect at least one repeat sample from the sampling tap where the original total coliform...

  4. 21 CFR 14.1 - Scope.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Scope. 14.1 Section 14.1 Food and Drugs FOOD AND... performance standard for an electronic product by the Technical Electronic Product Radiation Safety Standards... basis. (iii) A group of experts who are employed by a private company or a trade association which has...

  5. 7 CFR 1955.141 - Transferring title.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Transferring title. 1955.141 Section 1955.141 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS... Transferring title. (a)-(c) [Reserved] (d) Rent increases for MFH property. After approval of a credit sale for...

  6. 36 CFR 223.141 - Suspension.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Suspension. 223.141 Section... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Suspension and Debarment of Timber Purchasers § 223.141 Suspension. (a) The suspending official may, in the public interest, suspend a purchaser on the basis of...

  7. 7 CFR 985.141 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 985.141 Section 985.141 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE MARKETING ORDER REGULATING THE HANDLING OF SPEARMINT OIL PRODUCED IN THE FA...

  8. 27 CFR 44.141 - Sign.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Sign. 44.141 Section 44... PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Operations by Export Warehouse Proprietors § 44.141 Sign. Every... is located, or at the entrance of his warehouse, where it can be plainly seen, a sign, in plain and...

  9. 40 CFR 141.6 - Effective dates.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Effective dates. 141.6 Section 141.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL... measuring dalapon, dinoseb, diquat, endothall, endrin, glyphosate, oxamyl, picloram, simazine, benzo(a...

  10. 40 CFR 141.700 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... system. (3) The requirements of this subpart for unfiltered systems apply only to unfiltered systems that... Cryptosporidium, if required, as described in § 141.711. All unfiltered systems must provide treatment for Cryptosporidium as described in § 141.712. Filtered and unfiltered systems must implement Cryptosporidium...

  11. 9 CFR 3.141 - Terminal facilities.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.141 Section 3... ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of... Mammals Transportation Standards § 3.141 Terminal facilities. Carriers and intermediate handlers shall not...

  12. 45 CFR 400.141 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Definitions. 400.141 Section 400.141 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Refugee Social...

  13. 19 CFR 191.141 - Drawback allowance.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Drawback allowance. 191.141 Section 191.141 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE... Drawback allowance. Section 313(h) of the Act, as amended (19 U.S.C. 1313(h)), provides for drawback on the...

  14. Green light emission in aluminum oxide powders doped with different terbium concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Mariscal B, L; Falcony, C. [IPN, Centro de Investigacion y de Estudios Avanzados, 07360 Ciudad de Mexico (Mexico); Carmona T, S.; Murrieta, H.; Sanchez A, M. A. [UNAM, Instituto de Fisica, 04510 Ciudad de Mexico (Mexico); Vazquez A, R. [IPN, Escuela Superior de Computo, 07738 Ciudad de Mexico (Mexico); Garcia R, C. M., E-mail: mariscal2005@gmail.com [UNAM, Facultad de Ciencias, 04510 Ciudad de Mexico (Mexico)

    2016-11-01

    Different emission intensities presented in aluminum oxide phosphors corresponding to different concentrations of doping performed with terbium are analyzed. The phosphors were synthesized by the evaporation technique and were characterized by photo and cathodoluminescence, X-ray diffraction and EDS techniques for different incorporation percentages of terbium as dopant; they show characteristic transitions in 494, 543, 587 and 622 nm, corresponding to {sup 5}D{sub 4} → {sup 7}F{sub 6}, {sup 5}D{sub 4} → {sup 7}F{sub 5}, {sup 5}D{sub 4} → {sup 7}F{sub 4} and {sup 5}D{sub 4} → {sup 7}F{sub 3}, respectively when they are excited with λ{sub exc} = 380 nm wavelength at room temperature. The results of X-ray diffraction show the presence of α-Al{sub 2}O{sub 3} phases with peaks located at 2θ = 25.78, 35.34, 37.96, 43.56, 45.8, 52.74, 57.7, 61.5, 66.74, 68.44, 77.12 and 80.94, and the δ-Al{sub 2}O-3 phase 2θ = 32.82, 45.8, 61.36 and 66.74. These compounds were heat treated for two hours at 1100 degrees Celsius. EDS analyzes indicate that these compounds have close to 60% oxygen around of 40% aluminum in the presence of terbium as dopant which indicates a stoichiometry close to the expected one for alumina. (Author)

  15. Graphene quantum dots-terbium ions as novel sensitive and selective time-resolved luminescent probes.

    Science.gov (United States)

    Llorent-Martínez, Eulogio J; Durán, Gema M; Ríos, Ángel; Ruiz-Medina, Antonio

    2018-01-01

    We propose an alternative approach for the development of analytical methods based on terbium-sensitized luminescence (TSL). TSL is based on the complexation between Tb(III) ions and fluorescent organic compounds that have appropriate functional groups to complex with Tb(III). We report the use of graphene quantum dot (GQDs) nanoparticles to improve the sensitivity and selectivity of TSL detection. GQDs can react with terbium ions through the carboxylic groups present in their structure. These Tb(III)-GQD complexes, formed in situ in aqueous solution, can be used as time-resolved luminescent probes. Ascorbic acid was selected as a target analyte to demonstrate the suitability of the proposed method. The selectivity of the TSL method was highly improved for most of the interferences tested. Under the optimum conditions [Tb(III) concentration 5 × 10-4 mol L-1, GQD concentration 4 mg L-1], a minimum 100% increase in selectivity was observed for several vitamins and common cations that may be present in the samples to be analyzed. In addition, the analytical signal showed a 30% enhancement with the use of GQDs compared with the use of merely Tb(III) ions, with a detection limit of 0.12 μg mL-1. The repeatability and intermediate precision were lower than 3% and 5%, respectively. From the results obtained, the implementation of GQDs in TSL can lead to the development of novel time-resolved luminescent probes with high analytical potential. Graphical abstract Quenching of Tb(III)-graphene quantum dot (GQD) luminescence by ascorbic acid (AA). TBL terbium-sensitized luminescence.

  16. Fluorescence study of some terbium-oligopeptide complexes in methanolic solution.

    Science.gov (United States)

    Rabouan, S; Delage, J; Durand, W; Prognon, P; Barthes, D

    2000-04-03

    This study concerned the use of lanthanide chelates to detect glycyl-leucyl-phenylalanine (GLF) and its homologues. Spectroscopic analysis of peptides without or with terbium complexation revealed the formation of (LF)(3)(Tb)(2), (GF)(3)(Tb)(2), (GLF)(3)(Tb)(2) and (FL)(4)Tb, (FG)(4)Tb complexes with high stability constants in methanolic solutions (pK(d)>13). Lanthanide chelate emission displayed a large Stokes shift (>270 nm), which allowed Tb chelates of GLF and its derivatives to be used for detection purposes. However, this preliminary study indicated some important limitations associated with lanthanide chelation, such as high methanolic content.

  17. Electromagnetic properties of terbium gallium garnet at millikelvin temperatures and low photon energy

    Science.gov (United States)

    Kostylev, Nikita; Goryachev, Maxim; Bushev, Pavel; Tobar, Michael E.

    2017-07-01

    Electromagnetic properties of single crystal terbium gallium garnet are characterised from room down to millikelvin temperatures using the whispering gallery mode method. Microwave spectroscopy is performed at low powers equivalent to a few photons in energy and conducted as functions of the magnetic field and temperature. A phase transition is detected close to the temperature of 3.5 K. This is observed for multiple whispering gallery modes causing an abrupt negative frequency shift and a change in transmission due to extra losses in the new phase caused by a change in complex magnetic susceptibility.

  18. Nuclear excitation functions from 40 to 200 MeV proton irradiation of terbium

    Energy Technology Data Exchange (ETDEWEB)

    Engle, Jonathan W., E-mail: jwengle@lanl.gov; Mashnik, Stepan G.; Parker, Lauren A.; Jackman, Kevin R.; Bitteker, Leo J.; Ullmann, John L.; Gulley, Mark S.; Pillai, Chandra; John, Kevin D.; Birnbaum, Eva R.; Nortier, Francois M.

    2016-01-01

    Nuclear formation cross sections are reported for 26 radionuclides, measured with 40–200 MeV proton irradiations of terbium foils. These data provide the basis for the production of medically relevant radionuclides (e.g., {sup 152}Tb, {sup 155}Tb, {sup 155}Eu, and {sup 156}Eu) and {sup 153}Gd, a potential source used in ongoing efforts to characterize stellar nucleosynthesis routes. Computational predictions from the ALICE2011, CEM03.03, Bertini, and INCL + ABLA codes are compared with newly measured data to contribute to the ongoing process of code development, and yields are calculated for selected radionuclides using measured data.

  19. Dicty_cDB: VHB141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB141 (Link to dictyBase) - - - Contig-U11418-1 | Contig-U13542-1 VHB...141P (Link to Original site) VHB141F 615 VHB141Z 765 VHB141P 1360 - - Show VHB141 Library VH (Link to library) Clone ID VHB...418-1 | Contig-U13542-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHB1-B/VHB...141Q.Seq.d/ Representative seq. ID VHB141P (Link to Original site) Representative DNA sequence >VHB141 (VHB...141Q) /CSM/VH/VHB1-B/VHB141Q.Seq.d/ AGATTAACAAGCACTTCACACCAAATCACCAATGATGACCATACAAAAGATATTCTCTTT

  20. Micelle-enhanced and terbium-sensitized spectrofluorimetric determination of gatifloxacin and its interaction mechanism

    Science.gov (United States)

    Guo, Changchuan; Wang, Lei; Hou, Zhun; Jiang, Wei; Sang, Lihong

    2009-05-01

    A terbium-sensitized spectrofluorimetric method using an anionic surfactant, sodium dodecyl benzene sulfonate (SDBS), was developed for the determination of gatifloxacin (GFLX). A coordination complex system of GFLX-Tb 3+-SDBS was studied. It was found that SDBS significantly enhanced the fluorescence intensity of the complex (about 11-fold). Optimal experimental conditions were determined as follows: excitation and emission wavelengths of 331 and 547 nm, pH 7.0, 2.0 × 10 -4 mol l -1 terbium (III), and 2.0 × 10 -4 mol l -1 SDBS. The enhanced fluorescence intensity of the system (Δ If) showed a good linear relationship with the concentration of GFLX over the range of 5.0 × 10 -10 to 5.0 × 10 -8 mol l -1 with a correlation coefficient of 0.9996. The detection limit (3 σ) was determined as 6.0 × 10 -11 mol l -1. This method has been successfully applied to the determination of GFLX in pharmaceuticals and human urine/serum samples. Compared with most of other methods reported, the rapid and simple procedure proposed in the text offers higher sensitivity, wider linear range, and better stability. The interaction mechanism of the system is also studied by the research of ultraviolet absorption spectra, surface tension, solution polarity and fluorescence polarization.

  1. Circularly Polarized Luminescence in Enantiopure Europium and Terbium Complexes with Modular, All-Oxygen Donor Ligands

    Science.gov (United States)

    Seitz, Michael; Do, King; Ingram, Andrew J.; Moore, Evan G.; Muller, Gilles; Raymond, Kenneth N.

    2009-01-01

    Abstract: Circulaly polarized luminescence from terbium(III) complexed and excited by chiral antenna ligands gives strong emission The modular synthesis of three new octadentate, enantiopure ligands are reported - one with the bidentate chelating unit 2-hydroxyisophthalamide (IAM) and two with 1-hydroxy-2-pyridinone (1,2-HOPO) units. A new design principle is introduced for the chiral, non-racemic hexamines which constitute the central backbones for the presented class of ligands. The terbium(III) complex of the IAM ligand, as well as the europium(III) complexes of the 1,2-HOPO ligands are synthesized and characterized by various techniques (NMR, UV, CD, luminescence spectroscopy). All species exhibit excellent stability and moderate to high luminescence efficiency (quantum yields ΦEu = 0.05–0.08 and ΦTb = 0.30–0.57) in aqueous solution at physiological pH. Special focus is put onto the properties of the complexes in regard to circularly polarized luminescence (CPL). The maximum luminescence dissymmetry factors (glum) in aqueous solution are high with |glum|max = 0.08 – 0.40. Together with the very favorable general properties (good stability, high quantum yields, long lifetimes), the presented lanthanide complexes can be considered as good candidates for analytical probes based on CPL in biologically relevant environments. PMID:19639983

  2. 19 CFR 141.66 - Bond for missing documents.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Bond for missing documents. 141.66 Section 141.66... TREASURY (CONTINUED) ENTRY OF MERCHANDISE Presentation of Entry Papers § 141.66 Bond for missing documents... of any required document which is not available at the time of entry. (See § 141.91 for the procedure...

  3. 25 CFR 141.48 - Translation of disclosure statements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Translation of disclosure statements. 141.48 Section 141.48 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Translation of disclosure statements. Disclosure required by §§ 141.46 and 141.47 shall be made in writing...

  4. 26 CFR 1.141-2 - Private activity bond tests.

    Science.gov (United States)

    2010-04-01

    ... test and private security or payment test of section 141(b) or the private loan financing test of section 141(c). The private business use and private security or payment tests are described in §§ 1.141-3... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Private activity bond tests. 1.141-2 Section 1...

  5. Luminescent method of determination of composition of europium and terbium complexes in solution by change of intensity ratio of luminescence bands

    Energy Technology Data Exchange (ETDEWEB)

    Bel' tyukova, S.V.; Nazarenko, N.A.; Poluehktov, N.S.

    1982-03-01

    The complexes of europium and terbium with phenanthroline, ethylenediaminetetraacetate, nitrilotriacetate, some acids-phenol derivatives and ..beta..-diketones series have been used as an example to demonstrate that the value of the ratio of intensities on the two bands of europium(terbium) luminescence spectra - the one corresponding to the hypersensitive'' transition and the other, to the magnetic dipole one - can be used for determination of the complexes composition in solutions.

  6. Dicty_cDB: VHH141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH141 (Link to dictyBase) - - - Contig-U12301-1 VHH141P (Link to Original site) VHH141F...(Link to library) Clone ID VHH141 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U12301-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHH1-B/VHH141Q.Seq.d/ Representative...Representative seq. ID VHH141P (Link to Original site) Representative DNA sequence >VHH141 (VHH141Q) /CSM/VH/VHH1-B/VHH141Q...d/ ATAAAAAACTTTTTATAAATAATATATACATACAATGGGTAACAGAGCATTCAAAGCACA CAACGGTCACTACTTAAGCGCTGAACACGATCACGT

  7. Dicty_cDB: SSD141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD141 (Link to dictyBase) - - - Contig-U13950-1 SSD141P (Link to Original site) SSD141F...(Link to library) Clone ID SSD141 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig...Contig-U13950-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSD1-B/SSD141Q.Seq.d/ Representative...Representative seq. ID SSD141P (Link to Original site) Representative DNA sequence >SSD141 (SSD141Q) /CSM/SS/SSD1-B/SSD141Q...Seq.d/ AATTGATACAGCCTATTTTACAGGTAATTATCCACCACATGCATCAATTGAAGCACTTTG TGATGATAGTGATCCAAATTTCAACACATTGAAA

  8. Thermo-transferred thermoluminescence (TTTl) in potassium-yttrium double fluoride doped with terbium

    Energy Technology Data Exchange (ETDEWEB)

    Gallegos, A.; Rivera, T.; Diaz G, J. A. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada, Legaria 694, Col. Irrigacion, 11500 Mexico D. F. (Mexico); Azorin, J. [Universidad Autonoma Metropolitana, Unidad Iztapalapa, San Rafael Atlixco No. 186, Col. Vicentina, 09340 Mexico D. F. (Mexico); Azorin, J. C. [Universidad de Guanajuato, Division de Ciencias e Ingenierias-Campus Leon, Lomas del Bosque No. 103, Col. Lomas del Campestre, 37000 Leon, Guanajuato (Mexico); Licona, R.; Rivas, F.; Hernandez C, G. [Benemerita Universidad Autonoma de Puebla, Facultad de Ciencias Quimicas, 14 Sur y San Claudio, Ciudad Universitaria, Puebla de Zaragoza, Puebla (Mexico); Khaidukov, N. [Institute of General and Inorganic Chemistry, Lenin SK 11 Prospect 31, Moscow 117907 (Russian Federation)

    2011-02-15

    This paper presents results of studying the thermo-transferred thermoluminescence (TTTl) phenomenon in potassium-yttrium double fluoride doped with terbium (K{sub 2}YF{sub 5:}Tb) at different impurity concentrations (0.8%, 0.95% and 0.99%). Previously to study the TTTl phenomenon, structural characterization and chemical composition of the materials were determined. The structural studies were conducted using a scanning electron microscope; meanwhile, chemical composition was analyzed using energy dispersive X-ray spectroscopy. Thermoluminescence kinetics was studied irradiating the samples with {sup 137}Cs gamma rays as well as with {sup 90}Sr/{sup 90}Y beta rays, analyzing the glow curves by the deconvolution method for obtaining the kinetic parameters. (Author)

  9. The influence of pressure on the photoluminescence properties of a terbium-adipate framework

    Science.gov (United States)

    Spencer, Elinor C.; Zhao, Jing; Ross, Nancy L.; Andrews, Michael B.; Surbella, Robert G.; Cahill, Christopher L.

    2013-06-01

    The influence of pressure (over the 0-4.7 GPa range) on the photoluminescence emissions and crystal structure of the known 3D terbium-adipate metal-organic framework material Tb-GWMOF6 has been evaluated by high-pressure single-crystal X-ray diffraction and spectroscopic techniques. The results from this study show that this complex lanthanide framework structure undergoes three phase transitions within the 0-4 GPa pressure range that involve alterations in the number of symmetry independent Tb3+ ion sites within the crystal lattice. These pressure induced modifications to the structure of Tb-GWMOF6 lead to pronounced changes in the profiles of the 5D4→7F5 emission spectra of this complex.

  10. Terbium Radionuclides for Theranostics Applications: A Focus On MEDICIS-PROMED

    Science.gov (United States)

    Cavaier, R. Formento; Haddad, F.; Sounalet, T.; Stora, T.; Zahi, I.

    A new facility, named CERN-MEDICIS, is under construction at CERN to produce radionuclides for medical applications. In parallel, the MEDICIS-PROMED, a Marie Sklodowska-Curie innovative training network of the Horizon 2020 European Commission's program, is being coordinated by CERN to train young scientists on the production and use of innovative radionuclides and develop a network of experts within Europe. One program within MEDICIS-PROMED is to determine the feasibility of producing innovative radioisotopes for theranostics using a commercial middle-sized high-current cyclotron and the mass separation technology developed at CERN-MEDICIS. This will allow the production of high specific activity radioisotopes not achievable with the common post-processing by chemical separation. Radioisotopes of scandium, copper, arsenic and terbium have been identified. Preliminary studies of activation yield and irradiation parameters optimization for the production of Tb-149 will be described.

  11. Dielectric and conducting behavior of gadolinium-terbium fumarate heptahydrate crystals

    Science.gov (United States)

    Shah, M. D.; Want, B.

    2015-07-01

    Gadolinium-terbium fumarate heptahydrate crystals were grown in silica gel by using single gel diffusion technique. The crystals were characterized by different physico-chemical techniques of characterization. Powder X-ray diffraction results showed that the grown material is purely crystalline in nature. Elemental analyses suggested the chemical formula of the compound to be Gd Tb (C4H2O4)3ṡ7H2O. Energy dispersive X-ray analysis confirmed the presence of Gd and Tb in the title compound. The dielectric and conductivity studies of the grown compound were carried as function of frequency of applied field and the temperature. The grown material showed a dielectric anomaly which was correlated with its thermal behavior. The ac conductivity of the material showed Jonscher's power law behavior: σ(ω)=σo+Aωs, with a temperature-dependent power exponent s(<1). The conductivity was found to be a function of temperature and frequency.

  12. Highly sensitive detection of dipicolinic acid with a water-dispersible terbium-metal organic framework.

    Science.gov (United States)

    Bhardwaj, Neha; Bhardwaj, Sanjeev; Mehta, Jyotsana; Kim, Ki-Hyun; Deep, Akash

    2016-12-15

    The sensitive detection of dipicolinic acid (DPA) is strongly associated with the sensing of bacterial organisms in food and many types of environmental samples. To date, the demand for a sensitive detection method for bacterial toxicity has increased remarkably. Herein, we investigated the DPA detection potential of a water-dispersible terbium-metal organic framework (Tb-MOF) based on the fluorescence quenching mechanism. The Tb-MOF showed a highly sensitive ability to detect DPA at a limit of detection of 0.04nM (linear range of detection: 1nM to 5µM) and also offered enhanced selectivity from other commonly associated organic molecules. The present study provides a basis for the application of Tb-MOF for direct, convenient, highly sensitive, and specific detection of DPA in the actual samples. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. A New Bis(phthalocyaninato) Terbium Single-Ion Magnet with an Overall Excellent Magnetic Performance.

    Science.gov (United States)

    Chen, Yuxiang; Ma, Fang; Chen, Xiaoxiang; Dong, Bowei; Wang, Kang; Jiang, Shangda; Wang, Chiming; Chen, Xin; Qi, Dongdong; Sun, Haoling; Wang, Bingwu; Gao, Song; Jiang, Jianzhuang

    2017-11-20

    Bulky and strong electron-donating dibutylamino groups were incorporated onto the peripheral positions of one of the two phthalocyanine ligands in the bis(phthalocyaninato) terbium complex, resulting in the isolation of heteroleptic double-decker (Pc)Tb{Pc[N(C4H9)2]8} {Pc = phthalocyaninate; Pc[N(C4H9)2]8 = 2,3,9,10,16,17,23,24-octakis(dibutylamino)phthalocyaninate} with the nature of an unsymmetrical molecular structure, a square-antiprismatic coordination geometry, an intensified coordination field strength, and the presence of organic radical-f interaction. As a total result of all these factors, this sandwich-type tetrapyrrole lanthanide single-ion magnet (SIM) exhibits an overall enhanced magnetic performance including a high blocking temperature (TB) of 30 K and large effective spin-reversal energy barrier of Ueff = 939 K, rendering it the best sandwich-type tetrapyrrole lanthanide SIM reported thus far.

  14. Ultralarge magneto-optic rotations and rotary dispersion in terbium gallium garnet single crystal.

    Science.gov (United States)

    Shaheen, Amrozia; Majeed, Hassaan; Anwar, Muhammad Sabieh

    2015-06-10

    We report systematically acquired data on the Verdet constant of terbium gallium garnet for wavelengths ranging from visible to near-infrared (405-830 nm) regime. Our experimental method of Stokes polarimetry is based on the Fourier decomposition of the received light intensity and allows unambiguous determination of both the Faraday rotation and the ellipticity of the emergent light. Temperature-dependent investigations in the range of 8-300 K extend earlier reports and verify the Verdet's constant direct dependence on the magnetization, whose first-order approximation is simply a manifestation of the Curie's law. Further, a least-squares fitting of the experimental data correlates well with theoretical predictions. At a wavelength of 405 nm and temperature of 8 K, the rotation is approximately 500°.

  15. Non-natives: 141 scientists object

    NARCIS (Netherlands)

    Simberloff, D.; Van der Putten, W.H.

    2011-01-01

    Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. dsimberloff@utk.edu Jake Alexander Institute of Integrative

  16. 40 CFR 141.803 - Coliform sampling.

    Science.gov (United States)

    2010-07-01

    ... maintenance plan in § 141.804. (1) Except as provided in paragraph (b)(2) of this section, the air carrier... water tap is located in the aircraft water system due to aircraft model type and construction, then a... three corrective actions and continue through with that action until a complete set of follow-up or...

  17. 40 CFR 141.809 - Supplemental treatment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Supplemental treatment. 141.809... treatment. (a) Any supplemental drinking water treatment units installed onboard existing or new aircraft... the manufacturer's plans and specifications and FAA requirements. (b) Water supplemental treatment and...

  18. 27 CFR 20.141 - General.

    Science.gov (United States)

    2010-04-01

    ...) completely denatured alcohol are not required to obtain a permit or file a bond under this part. (d) Any person recovering completely denatured alcohol for reuse shall obtain a permit under subpart D of this... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General. 20.141 Section 20...

  19. Terbium fluorescence as a sensitive, inexpensive probe for UV-induced damage in nucleic acids

    Energy Technology Data Exchange (ETDEWEB)

    El-Yazbi, Amira F.; Loppnow, Glen R., E-mail: glen.loppnow@ualberta.ca

    2013-07-05

    Graphical abstract: -- Highlights: •Simple, inexpensive, mix-and-read assay for positive detection of DNA damage. •Recognition of undamaged DNA via hybridization to a hairpin probe. •Terbium(III) fluorescence reports the amount of damage by binding to ssDNA. •Tb/hairpin is a highly selective and sensitive fluorescent probe for DNA damage. -- Abstract: Much effort has been focused on developing methods for detecting damaged nucleic acids. However, almost all of the proposed methods consist of multi-step procedures, are limited, require expensive instruments, or suffer from a high level of interferences. In this paper, we present a novel simple, inexpensive, mix-and-read assay that is generally applicable to nucleic acid damage and uses the enhanced luminescence due to energy transfer from nucleic acids to terbium(III) (Tb{sup 3+}). Single-stranded oligonucleotides greatly enhance the Tb{sup 3+} emission, but duplex DNA does not. With the use of a DNA hairpin probe complementary to the oligonucleotide of interest, the Tb{sup 3+}/hairpin probe is applied to detect ultraviolet (UV)-induced DNA damage. The hairpin probe hybridizes only with the undamaged DNA. However, the damaged DNA remains single-stranded and enhances the intrinsic fluorescence of Tb{sup 3+}, producing a detectable signal directly proportional to the amount of DNA damage. This allows the Tb{sup 3+}/hairpin probe to be used for sensitive quantification of UV-induced DNA damage. The Tb{sup 3+}/hairpin probe showed superior selectivity to DNA damage compared to conventional molecular beacons probes (MBs) and its sensitivity is more than 2.5 times higher than MBs with a limit of detection of 4.36 ± 1.2 nM. In addition, this probe is easier to synthesize and more than eight times cheaper than MBs, which makes its use recommended for high-throughput, quantitative analysis of DNA damage.

  20. Fine- and hyperfine structure investigations of even configuration system of atomic terbium

    Science.gov (United States)

    Stefanska, D.; Elantkowska, M.; Ruczkowski, J.; Furmann, B.

    2017-03-01

    In this work a parametric study of the fine structure (fs) and the hyperfine structure (hfs) for the even-parity configurations of atomic terbium (Tb I) is presented, based in considerable part on the new experimental results. Measurements on 134 spectral lines were performed by laser induced fluorescence (LIF) in a hollow cathode discharge lamp; on this basis, the hyperfine structure constants A and B were determined for 52 even-parity levels belonging to the configurations 4f85d6s2, 4f85d26s or 4f96s6p; in all the cases those levels were involved in the transitions investigated as the lower levels. For 40 levels the hfs was examined for the first time, and for the remaining 12 levels the new measurements supplement our earlier results. As a by-product, also preliminary values of the hfs constants for 84 odd-parity levels were determined (the investigations of the odd-parity levels system in the terbium atom are still in progress). This huge amount of new experimental data, supplemented by our earlier published results, were considered for the fine and hyperfine structure analysis. A multi-configuration fit of 7 configurations was performed, taking into account second-order of perturbation theory, including the effects of closed shell-open shell excitations. Predicted values of the level energies, as well as of magnetic dipole and electric quadrupole hyperfine structure constants A and B, are quoted in cases when no experimental values are available. By combining our experimental data with our own semi-empirical procedure it was possible to identify correctly the lower and upper level of the line 544.1440 nm measured by Childs with the use of the atomic-beam laser-rf double-resonance technique (Childs, J Opt Soc Am B 9;1992:191-6).

  1. Structural and optical characterization of terbium doped ZnGa2O4 thin films deposited by RF magnetron sputtering

    Science.gov (United States)

    Somasundaram, K.; Girija, K. G.; Sudarsan, V.; Selvin, P. Christopher; Vatsa, R. K.

    2016-05-01

    Tb3+ doped ZnGa2O4 nanophosphor (21 nm) has been synthesized via low temperature polyol route and subsequently thin films of the same were deposited on glass and ITO substrates by RF magnetron sputtering. The films were characterized by X-ray Diffraction and luminescence measurements. The XRD pattern showed that Tb3+ doped ZnGa2O4 nanophosphor has a cubic spinel phase. Luminescence behavior of the nanophosphor and as deposited sputtered film was investigated. The PL emission spectra of nanophosphor gave a broad ZnGa2O4 host emission band along with a strong terbium emission and the thin films showed only broad host emission band and there was no terbium ion emission.

  2. Determination of fluoxetine in pharmaceutical and biological samples based on the silver nanoparticle enhanced fluorescence of fluoxetine-terbium complex.

    Science.gov (United States)

    Lotfi, Ali; Manzoori, Jamshid L

    2016-11-01

    In this study, a simple and sensitive spectrofluorimetric method is presented for the determination of fluoxetine based on the enhancing effect of silver nanoparticles (AgNPs) on the terbium-fluoxetine fluorescence emission. The AgNPs were prepared by a simple reduction method and characterized by UV-Vis spectroscopy and transmission electron microscopy. It was indicated that these AgNPs have a remarkable amplifying effect on the terbium-sensitized fluorescence of fluoxetine. The effects of various parameters such as AgNP and Tb(3+) concentration and the pH of the media were investigated. Under obtained optimal conditions, the fluorescence intensity of the terbium-fluoxetine-AgNP system was enhanced linearly by increasing the concentration of fluoxetine in the range of 0.008 to 19 mg/L. The limit of detection (b + 3s) was 8.3 × 10(-4) mg/L. The interference effects of common species found in real samples were also studied. The method had good linearity, recovery, reproducibility and sensitivity, and was satisfactorily applied for the determination of fluoxetine in tablet formulations, human urine and plasma samples. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  3. Neutron Diffraction and Electrical Transport Studies on Magnetic Transition in Terbium at High Pressures and Low Temperatures

    Science.gov (United States)

    Thomas, Sarah; Montgomery, Jeffrey; Tsoi, Georgiy; Vohra, Yogesh; Weir, Samuel; Tulk, Christopher; Moreira Dos Santos, Antonio

    2013-06-01

    Neutron diffraction and electrical transport measurements have been carried out on the heavy rare earth metal terbium at high pressures and low temperatures in order to elucidate its transition from a helical antiferromagnetic to a ferromagnetic ordered phase as a function of pressure. The electrical resistance measurements using designer diamonds show a change in slope as the temperature is lowered through the ferromagnetic Curie temperature. The temperature of the ferromagnetic transition decreases at a rate of -16.7 K/GPa till 3.6 GPa, where terbium undergoes a structural transition from hexagonal close packed (hcp) to an α-Sm phase. Above this pressure, the electrical resistance measurements no longer exhibit a change in slope. In order to confirm the change in magnetic phase suggested by the electrical resistance measurements, neutron diffraction measurements were conducted at the SNAP beamline at the Oak Ridge National Laboratory. Measurements were made at pressures to 5.3 GPa and temperatures as low as 90 K. An abrupt increase in peak intensity in the neutron diffraction spectra signaled the onset of magnetic order below the Curie temperature. A magnetic phase diagram of rare earth metal terbium will be presented to 5.3 GPa and 90 K based on these studies.

  4. Non-natives: 141 scientists object

    OpenAIRE

    Simberloff, D.; Van der Putten, W.H.

    2011-01-01

    Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. Jake Alexander Institute of Integrative Biology, Zurich, Switzerland. Fred Allendorf University of Montana, Missoula, Montana, USA. James Aronson CEFE/CNRS, Montpellier, France. Pedro M. Antunes Algoma University, Sault Ste. Marie, Onta...

  5. 19 CFR 141.104 - Computation of duties.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computation of duties. 141.104 Section 141.104 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Deposit of Estimated Duties § 141.104 Computation of duties. In...

  6. 44 CFR 206.141 - Disaster unemployment assistance.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

  7. 14 CFR 141.83 - Quality of training.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Quality of training. 141.83 Section 141.83... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.83 Quality of training. (a) Each pilot... part. (b) The failure of a pilot school or provisional pilot school to maintain the quality of training...

  8. 14 CFR 141.11 - Pilot school ratings.

    Science.gov (United States)

    2010-01-01

    ...). (i) Recreational pilot course. (ii) Private pilot course. (iii) Commercial pilot course. (iv... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot school ratings. 141.11 Section 141.11... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.11 Pilot school ratings. (a) The ratings listed...

  9. 25 CFR 141.13 - Amusement company licenses.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Amusement company licenses. 141.13 Section 141.13 Indians... NAVAJO, HOPI AND ZUNI RESERVATIONS Licensing Requirements and Procedures § 141.13 Amusement company... companies where the contract between the tribe and the amusement company provides for the payment of a fee...

  10. 19 CFR 141.16 - Disposition of documents.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Disposition of documents. 141.16 Section 141.16... Disposition of documents. (a) Bill of lading or air waybill. When the return of the bill of lading or air... been made for the merchandise. (b) Other documents. When any of the other documents specified in § 141...

  11. 25 CFR 141.59 - Customer complaint procedures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Customer complaint procedures. 141.59 Section 141.59... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.59 Customer complaint procedures. (a) Any customer of a licensee may file a complaint with the Commissioner alleging...

  12. 25 CFR 141.29 - Political contributions restricted.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Political contributions restricted. 141.29 Section 141.29 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.29 Political contributions...

  13. 19 CFR 141.101 - Time of deposit.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Time of deposit. 141.101 Section 141.101 Customs... (CONTINUED) ENTRY OF MERCHANDISE Deposit of Estimated Duties § 141.101 Time of deposit. Estimated duties shall either be deposited with the Customs officer designated to receive the duties at the time of the...

  14. 40 CFR 141.101 - Use of bottled water.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Use of bottled water. 141.101 Section 141.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Use of Non-Centralized Treatment Devices § 141.101...

  15. 19 CFR 141.41 - Surety on Customs bonds.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Surety on Customs bonds. 141.41 Section 141.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.41 Surety on Customs bonds. Powers of...

  16. 25 CFR 141.17 - Health and sanitation requirements.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Health and sanitation requirements. 141.17 Section 141.17... THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.17 Health and sanitation... sale any goods that are banned for health or sanitation reasons from retail sale by any Federal agency...

  17. Study of Silver Nanoparticles Sensitized Fluorescence and Second-Order Scattering of Terbium(III-Pefloxacin Mesylate Complex and Determination of Pefloxacin Mesylate

    Directory of Open Access Journals (Sweden)

    Aiyun Li

    2014-01-01

    Full Text Available α-Keto acid of pefloxacin mesylate (PFLX can form the complex with Terbium(III. The intramolecular energy from PFLX to Terbium(III ion takes place when excited, and thus Terbium(III excited state is formed and then emits the characteristic fluorescence of Terbium(III, locating at 490, 545, 580, and 620 nm. The second-order scattering (SOS peak at 545 nm also appears for the complex with the exciting wavelength of 273 nm. When the silver nanoparticles are added to the system, the luminescence intensity at 545 nm greatly increased. So, with the adding of nanoparticles to the Terbium(III-PFLX complex, not only is the intramolecular energy promoted but also the SOS intensity is enhanced. The experimental results show that it is the silver nanoparticles with certain size and certain concentration which can greatly enhance the fluorescence-SOS intensity, and the relative intensity at 545 nm is proportional to the amount of PFLX. Based on this phenomenon, a novel method for the determination of PFLX has been developed and applied to the determination of PFLX in capsule and serum samples.

  18. Influence of crystalline structure on the luminescence properties of terbium orthotantalates

    Energy Technology Data Exchange (ETDEWEB)

    Siqueira, Kisla P.F. [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil); Carmo, Alexandre P. [Instituto Federal Fluminense, Campus Cabo Frio, RJ 28909-971 (Brazil); Bell, Maria J.V. [Departamento de Física, Universidade Federal de Juiz de Fora, Juiz de Fora 36036-330, MG (Brazil); Dias, Anderson, E-mail: anderson_dias@iceb.ufop.br [Departamento de Química, Universidade Federal de Ouro Preto, Campus Morro do Cruzeiro, ICEB II, Ouro Preto 35400-000, Minas Gerais (Brazil)

    2013-06-15

    Terbium orthotantalate powders were produced with M-fergusonite type (I2/a) and M′-fergusonite type (P2/a) structures. The samples were studied by X-ray diffraction, Raman scattering, and photoluminescence measurements (emission and decay curves). The results showed that crystalline materials were obtained with all the 18 Raman-active modes predicted by group theory calculations. Also, it was observed through photoluminescence decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. Photoluminescence emission curves exhibited some variation in spectral shape, peak position, and relative intensity as a consequence of their different crystalline arrangements. The dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549.2 nm (M-type) and 543.0 nm (M′-type). Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively. M′-type materials seems to be the most suitable for luminescent devices and could be a potential green luminescent material due to the strongest emission if compared with the M-fergusonite type. -- Highlights: ► Terbium orthotantalates were prepared in two different crystalline structures: I2/a and P2/a. ► XRD and Raman scattering showed that the different space groups obtained were exhibited all the 18 Raman-active modes. ► PL decay curves that the Tb{sup 3+} ions occupies only one-symmetry site in both crystallographic arrangements. ► Dominated emission of Tb{sup 3+} ({sup 5}D{sub 4}→{sup 7}F{sub 5}) is centered with a maximum intensity at 549 nm (M-type) and 543 nm (M′-type). ► Fluorescence lifetimes for M-TbTaO{sub 4} and M′-TbTaO{sub 4} were determined as 33.4 μs and 1.25 ms, respectively.

  19. Laser control and temperature switching of luminescence intensity in photostable transparent film based on terbium(III) β-diketonate complex

    Science.gov (United States)

    Lapaev, Dmitry V.; Nikiforov, Victor G.; Safiullin, Georgy M.; Lobkov, Vladimir S.; Salikhov, Kev M.; Knyazev, Andrey A.; Galyametdinov, Yury G.

    2014-11-01

    The study of the terbium(III) and gadolinium(III) β-diketonate complexes by photoluminescence spectroscopy reveals considerable changes of the photophysical properties of the complexes under the UV laser irradiation. The measurements show the enhancement of the luminescence intensities in the vitrified transparent film of the terbium(III) complex as well as the gadolinium(III) complex under the 337 nm laser irradiation at room temperature. The irradiated film of the terbium(III) complex restores the initial photophysical properties after heating close to the melting temperature (∼353 K) and cooling. We observe no change of the luminescent properties of the irradiated film for months. These features can be used for the design of new lanthanide-based photostable systems with laser control of the luminescence intensity.

  20. Eclipse program C-141A aircraft

    Science.gov (United States)

    1997-01-01

    This photograph shows the Air Force C-141A that was used in the Eclipse project as a tow vehicle. In 1997 and 1998, the Dryden Flight Research Center at Edwards, California, supported and hosted a Kelly Space & Technology, Inc. project called Eclipse, which sought to demonstrate the feasibility of a reusable tow-launch vehicle concept. The project goal was to successfully tow, inflight, a modified QF-106 delta-wing aircraft with an Air Force C-141A transport aircraft. This would demonstrate the possibility of towing and launching an actual launch vehicle from behind a tow plane. Dryden was the responsible test organization and had flight safety responsibility for the Eclipse project. Dryden provided engineering, instrumentation, simulation, modification, maintenance, range support, and research pilots for the test program. The Air Force Flight Test Center (AFFTC), Edwards, California, supplied the C-141A transport aircraft and crew and configured the aircraft as needed for the tests. The AFFTC also provided the concept and detail design and analysis as well as hardware for the tow system and QF-106 modifications. Dryden performed the modifications to convert the QF-106 drone into the piloted EXD-01 (Eclipse eXperimental Demonstrator-01) experimental aircraft. Kelly Space & Technology hoped to use the results gleaned from the tow test in developing a series of low-cost, reusable launch vehicles. These tests demonstrated the validity of towing a delta-wing aircraft having high wind loading, validated the tow simulation model, and demonstrated various operational procedures, such as ground processing of in-flight maneuvers and emergency abort scenarios.

  1. Development of functionalized terbium fluorescent nanoparticles for antibody labeling and time-resolved fluoroimmunoassay application.

    Science.gov (United States)

    Ye, Zhiqiang; Tan, Mingqian; Wang, Guilan; Yuan, Jingli

    2005-01-15

    Silica-based functionalized terbium fluorescent nanoparticles were prepared, characterized and developed as a fluorescence probe for antibody labeling and time-resolved fluoroimmunoassay. The nanoparticles were prepared in a water-in-oil (W/O) microemulsion containing a strongly fluorescent Tb(3+) chelate, N,N,N(1),N(1)-[2,6-bis(3'-aminomethyl-1'-pyrazolyl)phenylpyridine] tetrakis(acetate)-Tb(3+) (BPTA-Tb(3+)), Triton X-100, octanol, and cyclohexane by controlling copolymerization of tetraethyl orthosilicate (TEOS) and 3-[2-(2-aminoethylamino)ethylamino]propyl-trimethoxysilane (AEPS) with ammonia water. The characterizations by transmission electron microscopy and fluorometric methods show that the nanoparticles are spherical and uniform in size, 45 +/- 3nm in diameter, strongly fluorescent with fluorescence quantum yield of 10% and a long fluorescence lifetime of 2.0ms. The amino groups directly introduced to the nanoparticle's surface by using AEPS in the preparation made the surface modification and bioconjugation of the nanoparticles easier. The nanoparticle-labeled anti-human alpha-fetoprotein antibody was prepared and used for time-resolved fluoroimmunoassay of alpha-fetoprotein (AFP) in human serum samples. The assay response is linear from 0.10ngml(-1) to about 100ngml(-1) with the detection limit of 0.10ngml(-1). The coefficient variations (CVs) of the method are less than 9.0%, and the recoveries are in the range of 84-98% for human serum sample measurements.

  2. Highly efficient precipitation of phosphoproteins using trivalent europium, terbium, and erbium ions

    Energy Technology Data Exchange (ETDEWEB)

    Guezel, Yueksel; Rainer, Matthias; Mirza, Munazza Raza; Bonn, Guenther K. [Leopold-Franzens University, Institute of Analytical Chemistry and Radiochemistry, Innsbruck (Austria)

    2012-05-15

    This study describes a highly efficient method for the selective precipitation of phosphoproteins by trivalent europium, terbium, and erbium metal ions. These metal cations belong to the group of lanthanides and are known to be hard acceptors with an overwhelming preference for oxygen-containing anions such as phosphates to which they form very tight ionic bonds. The method could be successfully applied to specifically precipitate phosphoproteins from complex samples including milk and egg white by forming solid metal-protein complexes. Owing to the low solubility product of the investigated lanthanide salts, the produced metal-protein complexes showed high stability. The protein pellets were extensively washed to remove nonphosphorylated proteins and contaminants. For the analysis of proteins the pellets were first dissolved in 30 % formic acid and subjected to matrix-assisted laser desorption/ionization-time of flight (MALDI-TOF) MS. For peptide mass-fingerprint analysis the precipitated phosphoproteins were enzymatically digested using microwave-assisted digestion. The method was found to be highly specific for the isolation and purification of phosphoproteins. Protein quantification was performed by colorimetric detection of total precipitated phosphoproteins and revealed more than 95 % protein recovery for each lanthanide salt. (orig.)

  3. A Terbium Sensitized Luminescence Method for the Assay of Flubiprofen in Pharmaceutical Formulations

    Directory of Open Access Journals (Sweden)

    Salma M.Z. Al-Kindy

    2014-12-01

    Full Text Available A sensitive time-resolved luminescence method for the determination of flubiprofen (FLP in methanol and in aqueous solution is described. The method is based on the luminescence sensitization of terbium (Tb3+ by the formation of a ternary complex with FLP in the presence of 4,7 diphenyl 1,10 phenanthroline (DPP as co-ligand, and Tween-20 as surfactant. The signal for Tb-FLP-DPP was monitored at λex  = 285 nm and λem  = 552 nm. Optimum conditions for the formation of the complex in an aqueous system were TRIS buffer, pH 8.0, DPP (2.5Å~10−7  M, Tween-20 (0.30% and 4Å~10-5  mol L-1  of Tb3+  which allowed the determination of 20–1000 ng mL-1  of FLP with a limit of detection (LOD of 10 ng mL-1 . The relative standard deviations of the method ranged between 0.6 and 1.4% indicating excellent reproducibility of the method. The proposed method was successfully applied for the assays of FLP in pharmaceutical formulations and spiked tap water samples with average recoveries of 87% – 95%.

  4. Sensitization effects of supramolecular assemblies on the luminescence of terbium-ion prulifloxacin complexes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Hong; Yi Chongyue; Li Xue; Fang Fang [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China); Yang Yajiang, E-mail: yjyang@mail.hust.edu.c [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2011-04-15

    Luminescence enhancement of terbium-ion prulifloxacin complexes (Tb(III)-PUFX) in supramolecular hydrogels formed by assembly of 1,3:2,4-di-O-benzylidene-D-sorbitol (DBS) was investigated by steady-state fluorescence, varying temperature fluorescence and time-resolved fluorescence. The luminescence images show that Tb(III)-PUFX were dispersed in the DBS gels. The luminescence intensity of Tb(III)-PUFX in the DBS gels was significantly increased in comparison with that in corresponding aqueous solutions. The varying temperature fluorescent spectra show that the luminescence intensity of Tb(III)-PUFX decreased with an increase in the temperature. This implies that the luminescence enhancement of Tb(III)-PUFX is related to the dissociation and the formation of the DBS assemblies. Time-resolved fluorescence measurements show slower rotational motion in DBS gels in comparison with that in the corresponding aqueous solutions. This may be ascribed to a unique microstructure of three-dimensional network formed by DBC aggregates, resulting in deactivation of the nonradiative relaxation. The images of field emission scanning electron microscopy and polarized optical microscopy indicate that the morphology of the DBS assemblies was not influenced upon addition of Tb(III)-PUFX to the DBS gels.

  5. A Nanoscale Multiresponsive Luminescent Sensor Based on a Terbium(III) Metal-Organic Framework.

    Science.gov (United States)

    Dang, Song; Wang, Ting; Yi, Feiyan; Liu, Qinghui; Yang, Weiting; Sun, Zhong-Ming

    2015-08-01

    A nanoscale terbium-containing metal-organic framework (nTbL), with a layer-like structure and [H2 NMe2 ](+) cations located in the framework channels, was synthesized under hydrothermal conditions. The structure of the as-prepared sample was systematically confirmed by powder XRD and elemental analysis; the morphology was characterized by field-emission SEM and TEM. The photoluminescence studies revealed that rod-like nTbL exhibited bright-green emission, corresponding to (5)D4 →(7)FJ (J=6-3) transitions of the Tb(3+) ion under excitation. Further sensing measurements revealed that as-prepared nTbL could be utilized as a multiresponsive luminescent sensor, which showed significant and exclusive detection ability for Fe(3+) ions and phenylmethanol. These results highlight the practical applications of lanthanide-containing metal-organic frameworks as fluorescent probes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Terbium-Doped VO2 Thin Films: Reduced Phase Transition Temperature and Largely Enhanced Luminous Transmittance.

    Science.gov (United States)

    Wang, Ning; Duchamp, Martial; Dunin-Borkowski, Rafal E; Liu, Shiyu; Zeng, XianTing; Cao, Xun; Long, Yi

    2016-01-26

    Vanadium dioxide (VO2) is a well-known thermochromic material with large IR modulating ability, promising for energy-saving smart windows. The main drawbacks of VO2 are its high phase transition temperature (τ(c) = 68°C), low luminous transmission (T(lum)), and weak solar modulating ability (ΔT(sol)). In this paper, the terbium cation (Tb(3+)) doping was first reported to reduce τ(c) and increase T(lum) of VO2 thin films. Compared with pristine VO2, 2 at. % doping level gives both enhanced T(lum) and ΔT(sol) from 45.8% to 54.0% and 7.7% to 8.3%, respectively. The T(lum) increases with continuous Tb(3+) doping and reaches 79.4% at 6 at. % doping level, representing ∼73.4% relative increment compared with pure VO2. This has surpassed the best reported doped VO2 thin films. The enhanced thermochromic properties is meaningful for smart window applications of VO2 materials.

  7. Luminescent investigations of terbium(III) biosorption as a surrogate for heavy metals and radionuclides.

    Science.gov (United States)

    Achyuthan, Komandoor E; Arango, Dulce C; Carles, Elizabeth L; Cutler, Christopher E; Meyer, Lauren A; Brozik, Susan M

    2009-07-01

    We describe a metal transport system for investigating the interfacial interactions between the anionic surface charge of a gram-negative bacterium (Escherichia coli) and a trivalent cationic metal, Tb3+. We believe this is the first description of the uptake kinetics, sub- and intracellular distribution, and temporal fate of Tb3+ ion in E. coli. We used the luminescence of the terbium-dipicolinic acid chelate to study metal ion transport. The bacteria had a high tolerance for the metal (IC(50) = 4 mM Tb3+). Metal ion transport was passive and metabolism independent. The uptake kinetics rapidly reached a maximum within 15 min, followed by a stasis for 60 min, and declining thereafter between 120 and 240 min, resulting in a biphasic curve. During this period, greater than one-third of the metal ion was sequestered within the cell. Our choice of a safe Biosafety Level I E. coli bacteria and the relatively non-toxic Tb3+ metal represents a model system for luminescent investigations of biosorption, for studying bacterial-water interfacial chemistry and for the bioremediation of heavy metals and radionuclides.

  8. Construction of the energy matrix for complex atoms. Part VIII: Hyperfine structure HPC calculations for terbium atom

    Science.gov (United States)

    Elantkowska, Magdalena; Ruczkowski, Jarosław; Sikorski, Andrzej; Dembczyński, Jerzy

    2017-11-01

    A parametric analysis of the hyperfine structure (hfs) for the even parity configurations of atomic terbium (Tb I) is presented in this work. We introduce the complete set of 4fN-core states in our high-performance computing (HPC) calculations. For calculations of the huge hyperfine structure matrix, requiring approximately 5000 hours when run on a single CPU, we propose the methods utilizing a personal computer cluster or, alternatively a cluster of Microsoft Azure virtual machines (VM). These methods give a factor 12 performance boost, enabling the calculations to complete in an acceptable time.

  9. Spectrofluorimetric determination of human serum albumin using terbium-danofloxacin probe.

    Science.gov (United States)

    Ramezani, Amir M; Manzoori, Jamshid L; Amjadi, Mohammad; Jouyban, Abolghasem

    2012-01-01

    A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA) and bovine serum albumin (BSA) using terbium-danofloxacin (Tb(3+)-Dano) as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb(3+)-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb(3+)-Dano is proportional to the concentration of proteins (HSA and BSA). Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH = 7.8, [Tb(3+)] = 8.5 × 10(-5) mol L(-1), [Dano] = 1.5 × 10(-4) mol L(-1). The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2 × 10(-6) - 1.3 × 10(-6) mol L(-1), 0.2 × 10(-6) - 1.4 × 10(-6) mol L(-1), and 0.2 × 10(-6) - 1 × 10(-6) mol L(-1), respectively. The detection limits (S/N = 3) for BSA, HSA, and plasma sample of HSA were 8.7 × 10(-8) mol L(-1), 6.2 × 10(-8) mol L(-1), and 8.1 × 10(-8) mol L(-1), respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.

  10. Spectrofluorimetric Determination of Human Serum Albumin Using Terbium-Danofloxacin Probe

    Directory of Open Access Journals (Sweden)

    Amir M. Ramezani

    2012-01-01

    Full Text Available A spectrofluorimetric method is proposed for the determination of human serum albumin (HSA and bovine serum albumin (BSA using terbium-danofloxacin (Tb3+-Dano as a fluorescent probe. These proteins remarkably enhance the fluorescence intensity of the Tb3+-Dano complex at 545 nm, and the enhanced fluorescence intensity of Tb3+-Dano is proportional to the concentration of proteins (HSA and BSA. Optimum conditions for the determination of HSA were investigated and found that the maximum response was observed at: pH=7.8, [Tb3+] =8.5×10−5 mol L−1, [Dano] =1.5×10−4 mol L−1. The calibration graphs for standard solutions of BSA, HSA, and plasma samples of HSA were linear in the range of 0.2×10−6−1.3×10−6 mol L−1, 0.2×10−6−1.4×10−6 mol L−1, and 0.2×10−6−1×10−6 mol L−1, respectively. The detection limits (S/N = 3 for BSA, HSA, and plasma sample of HSA were 8.7×10−8 mol L−1, 6.2×10−8 mol L−1, and 8.1×10−8 mol L−1, respectively. The applicability of the method was checked using a number of real biological plasma samples and was compared with the UV spectrometric reference method. The results was showed that the method could be regarded as a simple, practical, and sensitive alternative method for determination of albumin in biological samples.

  11. Determination of flavonoids in pharmaceutical preparations using Terbium sensitized fluorescence method

    Directory of Open Access Journals (Sweden)

    M Shaghaghi

    2009-12-01

    Full Text Available "nBackground and the Purpose of the Study: The aim of this study was development and validation of a simple, rapid and sensitive spectrofluorimetric method for determination of total flavonoids in two topical formulations of Calendula officinalis, Ziziphus Spina-christi and an oral drop of Hypiran perforatum L. The proposed method is based on the formation of terbium (Tb3+ "n-flavonoids (quercetin as a reference standard complex at pH 7.0, which has fluorescence intensely with maximum emission at 545 nm when excited at 310 nm. "nMethod "n: For ointments masses of topical formulations were weighed and added to ethanol-aqueous buffer (pH 10.0 and the resulting mixtures were shaken and then two phases were separated by centrifugation. Aqueous phases were filtered and then diluted with water. For Hypiran drops an appropriate portion was diluted with ethanol and then aliquots of sample or standard solutions were determined according to the experimental procedure. "nResults "n: Under the optimum conditions, total concentrations of flavonoids (as quercetin equivalent in three tested formulations were found to be 0.204 mg/g (for Dermatin cream, 0.476 mg/g (for Calendula ointment and 13.50 μg/ml (for Hypiran drops. Analytical recoveries from samples spiked with different amounts of quercetin were 96.1-104.0 % with RSD % of less than 3.5. Conclusion : The proposed method which requires a simple dissolution step without any matrix interferences provided high sensitivity and selectivity and was easily applied to determine total flavonoids in real samples of three investigated formulations with excellent reproducibility.

  12. TOF SIMS analysis and generation of white photoluminescence from strontium silicate codoped with europium and terbium

    Energy Technology Data Exchange (ETDEWEB)

    Tshabalala, Modiehi A.; Swart, Hendrik C.; Ntwaeaborwa, Odireleng M., E-mail: ntwaeab@ufs.ac.za [Department of Physics, University of the Free State, P.O Box 339, Bloemfontein 9300 South Africa (South Africa)

    2014-03-15

    White light emitting terbium (Tb{sup 3+}) and europium (Eu{sup 3+}) codoped strontium silicate (Sr{sub 2}SiO{sub 4}) phosphors were prepared by a solid state reaction process. The structure, particle morphology, chemical composition, ion distribution, photoluminescence (PL), and decay characteristics of the phosphors were analyzed by x-ray diffraction (XRD), scanning electron microscopy (SEM), time-of-flight secondary ion mass spectrometry (TOF-SIMS), and PL spectroscopy, respectively. The XRD data showed that our Sr{sub 2}SiO{sub 4} composed of two phases, namely, β-Sr{sub 2}SiO{sub 4} and α′-Sr{sub 2}SiO{sub 4}, and the α′-Sr{sub 2}SiO{sub 4} phase was more prominent than the β-Sr{sub 2}SiO{sub 4} phase. The SEM micrographs showed that the particles were agglomerated together and they did not have definite shapes. All ions (i.e., negative and positive) present in our materials were identified by TOF-SIMS. In addition, the chemical imaging performed with the TOF-SIMS demonstrated how the individual ions including the dopants (Eu{sup 3+} and Tb{sup 3+}) were distributed in the host lattice. White photoluminescence was observed when the Sr{sub 2}SiO{sub 4}:Tb{sup 3+}, Eu{sup 3+} phosphor was excited at 239 nm using a monochromatized xenon lamp as the excitation source. The phosphor exhibited fast decay lifetimes implying that it is not a good candidate for long afterglow applications.

  13. Synthesis, crystal structure and photophysical properties of europium(III) and terbium(III) complexes with pyridine-2,6-dicarboxamide

    NARCIS (Netherlands)

    Tanase, S.; Gallego, P.M.; Gelder, R. de; Fu, W.T.

    2007-01-01

    The reactions of pyridine-2,6-dicarboxamide with europium(III) and terbium(III) triflates led to the formation of mononuclear complexes of formula [Ln(pcam)(3)](CF3SO3)(3) (Ln = Eu 1, Tb 2; pcam stands for pyridine-2,6-dicarboxamide). From single-crystal X-ray diffraction analysis, the complexes

  14. Zinc sulfide and terbium-doped zinc sulfide films grown by traveling wave reactor atomic layer epitaxy

    CERN Document Server

    Yun, S J; Nam, K S

    1998-01-01

    Zinc sulfide (ZnS) and terbium-doped ZnS (ZnS:Tb) thin films were grown by traveling wave reactor atomic layer epitaxy (ALE). In the present work, ZnCl sub 2 , H sub 2 S, and tris (2,2,6,6-tetramethyl-3,5-heptandionato) terbium (Tb(tmhd) sub 3) were used as the precursors. The dependence of crystallinity and Cl content of ZnS films was investigated on the growth temperature. ZnS and ZnS:Tb films grown at temperatures ranging from 400 to 500 .deg. C showed a hexagonal-2H crystalline structure. The crystallinity of ZnS film was greatly enhanced as the temperature increased. At growth temperatures higher than 450.deg.C, the films showed preferred orientation with mainly (002) diffraction peak. The Cl content decreased from approximately 9 to 1 at.% with the increase in growth temperature from 400 to 500 .deg. C. The segregation of Cl near the surface region and the incorporation of O from Tb(tmhd) sub 3 during ALE process were also observed using Auger electron spectroscopy. The ALE-grown ZnS and ZnS:Tb films re...

  15. Commercializing potassium terbium fluoride, KTF (KTb3F10) faraday crystals for high laser power optical isolator applications

    Science.gov (United States)

    Schlichting, Wolfgang; Stevens, Kevin; Foundos, Greg; Payne, Alexis

    2017-10-01

    Many scientific lasers and increasingly industrial laser systems operate in power regime, require high-performance optical isolators to prevent disruptive light feedback into the laser cavity. The optically active Faraday material is the key optical element inside the isolator. SYNOPTICS has been supplying the laser market with Terbium Gallium Garnet (TGG - Tb3Ga5O12) for many years. It is the most commonly used material for the 650-1100nm range and the key advantages for TGG include its cubic crystal structure for alignment free processing, little to no intrinsic birefringence, and ease of manufacture. However, for high-power laser applications TGG is limited by its absorption at 1064nm and its thermo-optic coefficient, dn/dT. Specifically, thermal lensing and depolarization effects become a limiting factor at high laser powers. While TGG absorption has improved significantly over the past few years, there is an intrinsic limit. Now, SYNOPTICS is commercializing the enhanced new crystal Potassium Terbium Fluoride KTF (KTb3F10) that exhibits much smaller nonlinear refractive index and thermo-optic coefficients, and still exhibits a Verdet constant near that of TGG. This cubic crystal has relatively low absorption and thermo-optic coefficients. It is now fully characterized and available for select production orders. At OPTIFAB in October 2017 we present recent results comparing the performance of KTF to TGG in optical isolators and show SYNOPTICS advances in large volume crystal growth and the production ramp up.

  16. Preparation and photoluminescence enhancement in terbium(III ternary complexes with β-diketone and monodentate auxiliary ligands

    Directory of Open Access Journals (Sweden)

    Devender Singh

    2016-12-01

    Full Text Available A series of new solid ternary complexes of terbium(III ion based on β-diketone ligand acetylacetone (acac and monodentate auxiliary ligands (aqua/urea/triphenylphosphineoxide/pyridine-N-oxide had been prepared. The structural characterizations of synthesized ternary compounds were studied by means of elemental analysis, infrared (IR, and proton nuclear magnetic resonance (NMR spectral techniques. The optical characteristics were investigated with absorption as well as photoluminescence spectroscopy. Thermal behavior of compounds was examined by TGA/DTA analysis and all metal complexes were found to have good thermal stability. The luminescence decay time of complexes were also calculated by monitoring at emission wavelength corresponding to 5D4 → 7F5 transition. A comparative inspection of the luminescent behavior of prepared ternary compounds was performed in order to determine the function of auxiliary ligands in the enhancement of luminescence intensity produced by central terbium(III ion. The color coordinates values suggested that compounds showed bright green emission in visible region in electromagnetic spectrum. Complexes producing green light could play a significant role in the fabrication of efficient light conversion molecular devices for display purposes and lightning systems.

  17. 27 CFR 479.141 - Stolen or lost firearms.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 3 2010-04-01 2010-04-01 false Stolen or lost firearms. 479.141 Section 479.141 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO, FIREARMS, AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...

  18. 40 CFR 141.41 - Special monitoring for sodium.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for sodium. 141.41... and Prohibition on Lead Use § 141.41 Special monitoring for sodium. (a) Suppliers of water for... distribution system for the determination of sodium concentration levels; samples must be collected and...

  19. 28 CFR 0.141 - Audit and ledger accounts.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Audit and ledger accounts. 0.141 Section... Authorizations With Respect to Personnel and Certain Administrative Matters § 0.141 Audit and ledger accounts... Justice Assistance, Research and Statistics are, as to their respective jurisdictions, authorized to audit...

  20. 40 CFR 1.41 - Office of Air and Radiation.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Office of Air and Radiation. 1.41 Section 1.41 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL STATEMENT OF ORGANIZATION... of technological developments into improved control program procedures. (c) Office of Radiation...

  1. 40 CFR 141.42 - Special monitoring for corrosivity characteristics.

    Science.gov (United States)

    2010-07-01

    ... to the drinking water, such as: Vinyl lined asbestos cement pipe. Coal tar lined pipes and tanks. ... characteristics. 141.42 Section 141.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Special Regulations, Including Monitoring...

  2. 40 CFR 141.716 - Source toolbox components.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Source toolbox components. 141.716... for Microbial Toolbox Components § 141.716 Source toolbox components. (a) Watershed control program... documents must be in a plain language style and include criteria by which to evaluate the success of the...

  3. 37 CFR 1.41 - Applicant for patent.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Applicant for patent. 1.41 Section 1.41 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Who May Apply for A...

  4. 40 CFR 141.174 - Filtration sampling requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Filtration sampling requirements. 141... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.174 Filtration sampling requirements. (a) Monitoring...

  5. 40 CFR 141.171 - Criteria for avoiding filtration.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.171 Criteria for avoiding filtration. In addition to the...

  6. 40 CFR 141.65 - Maximum residual disinfectant levels.

    Science.gov (United States)

    2010-07-01

    ... following as the best technology, treatment techniques, or other means available for achieving compliance... treatment processes to reduce disinfectant demand and control of disinfection treatment processes to reduce.... 141.65 Section 141.65 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

  7. 40 CFR 141.27 - Alternate analytical techniques.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Alternate analytical techniques. 141... § 141.27 Alternate analytical techniques. (a) With the written permission of the State, concurred in by the Administrator of the U.S. EPA, an alternate analytical technique may be employed. An alternate...

  8. 9 CFR 319.141 - Fresh pork sausage.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Fresh pork sausage. 319.141 Section 319.141 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... INSPECTION AND CERTIFICATION DEFINITIONS AND STANDARDS OF IDENTITY OR COMPOSITION Sausage Generally: Fresh...

  9. 26 CFR 1.141-5 - Private loan financing test.

    Science.gov (United States)

    2010-04-01

    ... be private activity bonds under the private business use and the private security or payment tests... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Private loan financing test. 1.141-5 Section 1... (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-5 Private...

  10. 40 CFR 141.712 - Unfiltered system Cryptosporidium treatment requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Unfiltered system Cryptosporidium... Cryptosporidium Treatment Technique Requirements § 141.712 Unfiltered system Cryptosporidium treatment... water monitoring required under § 141.701(a), unfiltered systems must calculate the arithmetic mean of...

  11. 40 CFR 141.706 - Reporting source water monitoring results.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Reporting source water monitoring... Cryptosporidium Source Water Monitoring Requirements § 141.706 Reporting source water monitoring results. (a) Systems must report results from the source water monitoring required under § 141.701 no later than 10...

  12. 40 CFR 141.25 - Analytical methods for radioactivity.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods for radioactivity... § 141.25 Analytical methods for radioactivity. (a) Analysis for the following contaminants shall be conducted to determine compliance with § 141.66 (radioactivity) in accordance with the methods in the...

  13. 21 CFR 150.141 - Artificially sweetened fruit jelly.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit jelly. 150.141 Section 150.141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES...) A vinegar, lemon juice, lime juice, citric acid, lactic acid, malic acid, tartaric acid, fumaric...

  14. 5 CFR 185.141 - Stay pending appeal.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stay pending appeal. 185.141 Section 185.141 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD... disposition of a motion for reconsideration or of an appeal to the authority head. (b) No administrative stay...

  15. 33 CFR 141.25 - Evidence of citizenship.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Evidence of citizenship. 141.25...) OUTER CONTINENTAL SHELF ACTIVITIES PERSONNEL Restrictions on Employment § 141.25 Evidence of citizenship... District of Columbia. (3) A United States passport. (4) A Certificate of Citizenship issued by the...

  16. 14 CFR 121.141 - Airplane flight manual.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

  17. Synthesis and luminescent study of Ce{sup 3+}-doped terbium-yttrium aluminum garnet

    Energy Technology Data Exchange (ETDEWEB)

    Dotsenko, V.P., E-mail: ssclab@ukr.net [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Berezovskaya, I.V.; Zubar, E.V.; Efryushina, N.P. [A.V. Bogatsky Physico-Chemical Institute, National Academy of Sciences of Ukraine, Lustdorfskaya doroga 86, 65080 Odessa (Ukraine); Poletaev, N.I.; Doroshenko, Yu.A. [Institute of Combustion and Advanced Technologies, Mechnikov Odessa National University, Dvoryanskaya 2, 65082 Odessa (Ukraine); Stryganyuk, G.B. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine); HASYLAB at DESY, Notkestrasse 85, 22607 Hamburg (Germany); Voloshinovskii, A.S. [Ivan Franko National University of Lviv, Kirilo i Mefodii 8, 79005 Lviv (Ukraine)

    2013-02-15

    Highlights: Black-Right-Pointing-Pointer Ce{sup 3+}-doped garnets (TYAG) were prepared using nanostructured reagents. Black-Right-Pointing-Pointer The Ce{sup 3+} ions cause a very efficient yellow emission of the samples. Black-Right-Pointing-Pointer The reasons for the long wavelength position of this emission are discussed. Black-Right-Pointing-Pointer Contribution from Al atoms to the conduction band of TYAG is quite essential. - Abstract: Terbium-yttrium aluminum garnets (TYAG) doped with Ce{sup 3+} ions have been prepared by solid state reactions between nanostructured oxides of aluminum and rare earths. The luminescent properties of Ce{sup 3+} ions in (Tb{sub 0.8}Y{sub 0.2}){sub 3(1-x)}Ce{sub 3x}Al{sub 5}O{sub 12} (x = 0.03) have been studied upon excitation in the 2-20 eV region. The substitution of Tb{sup 3+} for Y{sup 3+} in the garnet structure results in broadening the emission band and shifting its maximum towards the longer wavelengths. It was found that in addition to the 4f{sup n} {yields} 4f{sup n-1}5d excitation bands of Ce{sup 3+} and Tb{sup 3+} ions, the excitation spectra for the Ce{sup 3+} emission contain broad bands at 6.73 and {approx}9.5 eV. These bands are attributed to the Ce{sup 3+}-bound exciton formation and O 2p {yields} Al 3s, 3p transitions, respectively. In contrast to the predictions based on the results of electronic structure calculations on Y{sub 3}Al{sub 5}O{sub 12} and Tb{sub 4}Al{sub 2}O{sub 9}, the threshold of interband transitions in TYAG is at high energies ( Greater-Than-Or-Slanted-Equal-To 7.3 eV), and contributions from Al{sub tetr} and Al{sub oct} atoms to the conduction-band density of states are evaluated as quite essential.

  18. Structural variations in terbium(III) complexes with 1,3-adamantanedicarboxylate and diverse co-ligands

    Energy Technology Data Exchange (ETDEWEB)

    Thuéry, Pierre, E-mail: pierre.thuery@cea.fr

    2015-07-15

    Terbium nitrate was reacted with 1,3-adamantanedicarboxylic acid (LH{sub 2}) under solvo-hydrothermal conditions with either N,N-dimethylformamide (DMF) or N,N-dimethylacetamide (DMA) as organic solvents. Hydrolysation of the latter co-solvents resulted in the formation of formate or acetate ions, which are present as co-ligands in the 1D coordination polymer [Tb(L)(HCOO)(H{sub 2}O){sub 2}] (1) and the 2D assembly [Tb(L)(CH{sub 3}COO)(H{sub 2}O)] (2). The increase in dimensionality in the latter arises from the higher connectivity provided by acetate versus formate, the L{sup 2−} ligand being bis-chelating in both cases. The complex [Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 5}][Tb{sub 2}(L){sub 3}(H{sub 2}O){sub 4}]·3H{sub 2}O (3), another 1D species, crystallizes alongside crystals of 2. Further addition of cucurbit[6]uril (CB6), with DMF as co-solvent, gave the two complexes [Tb{sub 2}(L){sub 2}(CB6)(H{sub 2}O){sub 6}](NO{sub 3}){sub 2}·6H{sub 2}O (4) and [H{sub 2}NMe{sub 2}]{sub 2}[Tb(L)(HCOO){sub 2}]{sub 2}·CB6·3H{sub 2}O (5). Complex 4 crystallizes as a 3D framework in which Tb(L){sup +} chains are connected by tetradentate CB6 molecules, while 5 unites a carboxylate-bridged anionic 2D planar assembly and layers of CB6 molecules with counter-cations held at both portals. - Graphical abstract: One- to three-dimensional assemblies are formed in terbium(III) complexes with 1,3-adamantanedicarboxylate obtained under solvo-hydrothermal conditions, these species including formate or acetate co-ligands formed in situ, or additional cucurbit[6]uril molecules. - Highlights: • We report structures of terbium(III) complexes with 1,3-adamantanedicarboxylate. • Solvents able to generate co-ligands or counter-ions in situ have been used. • A 3D species including additional cucurbituril molecules is decribed. • One species displays an alternation of metal–organic and organic sheets.

  19. Complete Stokes polarimetry of magneto-optical Faraday effect in a terbium gallium garnet crystal at cryogenic temperatures.

    Science.gov (United States)

    Majeed, Hassaan; Shaheen, Amrozia; Anwar, Muhammad Sabieh

    2013-10-21

    We report the complete determination of the polarization changes caused in linearly polarized incident light due to propagation in a magneto-optically active terbium gallium garnet (TGG) single crystal, at temperatures ranging from 6.3 to 300 K. A 28-fold increase in the Verdet constant of the TGG crystal is seen as its temperature decreases to 6.3 K. In contrast with polarimetry of light emerging from a Faraday material at room temperature, polarimetry at cryogenic temperatures cannot be carried out using the conventional fixed polarizer-analyzer technique because the assumption that ellipticity is negligible becomes increasingly invalid as temperature is lowered. It is shown that complete determination of light polarization in such a case requires the determination of its Stokes parameters, otherwise inaccurate measurements will result with negative implications for practical devices.

  20. Development of Optical Isolators for Visible Light Using Terbium Aluminum Garnet (Tb3Al5O12) Single Crystals

    Science.gov (United States)

    Geho, Mikio; Takagi, Takashi; Chiku, Shinichiro; Fujii, Takashi

    2005-07-01

    We have recently reported the successful growth of incongruently melting terbium aluminum garnet (Tb3Al5O12; TAG) single crystals by the hybrid laser FZ (floating zone) method. Optical property evaluations confirmed a high transmittance and a larger Verdet constant than conventional Tb3Ga5O12 (TGG) crystals and/or Faraday glasses. In this study, we attempted to design, fabricate, and evaluate optical isolators in visible light through near-infrared (NIR) regions using TAG crystals. A finite element method (FEM) simulation of possible models led us to the preferable one based on a radially magnetized magnet. To realize this, we employed a pseudo-radially magnetized magnet. The target wavelengths of the prototype device were 408, 808, and 1064 nm. The typical extinction ratio was more than 30 dB and the insertion loss was less than 0.3 dB for AR-coated devices.

  1. Chronic urticaria. Clinical and pathogenetic studies in 141 patients

    NARCIS (Netherlands)

    Doeglas, Hendrik Maarten George

    1975-01-01

    This study describes a combined clinical, laboratory and experimental approach of the problems of 141 patients with chronic urticaria, collected over a three-year period in a Dermatology department. ... Zie: Summary

  2. 27 CFR 44.141a - Use of premises.

    Science.gov (United States)

    2010-04-01

    ..., WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Operations by Export Warehouse Proprietors § 44.141a Use of premises. Export warehouse premises may only be used for the storage of tobacco products and...

  3. Schostakowitsch: Sinfonie N15, Op. 141 / Hanspeter Krellmann

    Index Scriptorium Estoniae

    Krellmann, Hanspeter

    1990-01-01

    Uuest heliplaadist "Schostakowitsch: Sinfonie N15, Op. 141, Oktober, Op. 131, Ouvertüre über russische und kirgisische Volksthemen, Op. 115. Göteborger Sinfonie-Orchester, Neeme Järvi". DG CD 427 616-2

  4. A hydrometallurgical process for the recovery of terbium from fluorescent lamps: Experimental design, optimization of acid leaching process and process analysis.

    Science.gov (United States)

    Innocenzi, Valentina; Ippolito, Nicolò Maria; De Michelis, Ida; Medici, Franco; Vegliò, Francesco

    2016-12-15

    Terbium and rare earths recovery from fluorescent powders of exhausted lamps by acid leaching with hydrochloric acid was the objective of this study. In order to investigate the factors affecting leaching a series of experiments was performed in according to a full factorial plan with four variables and two levels (4 2 ). The factors studied were temperature, concentration of acid, pulp density and leaching time. Experimental conditions of terbium dissolution were optimized by statistical analysis. The results showed that temperature and pulp density were significant with a positive and negative effect, respectively. The empirical mathematical model deducted by experimental data demonstrated that terbium content was completely dissolved under the following conditions: 90 °C, 2 M hydrochloric acid and 5% of pulp density; while when the pulp density was 15% an extraction of 83% could be obtained at 90 °C and 5 M hydrochloric acid. Finally a flow sheet for the recovery of rare earth elements was proposed. The process was tested and simulated by commercial software for the chemical processes. The mass balance of the process was calculated: from 1 ton of initial powder it was possible to obtain around 160 kg of a concentrate of rare earths having a purity of 99%. The main rare earths elements in the final product was yttrium oxide (86.43%) following by cerium oxide (4.11%), lanthanum oxide (3.18%), europium oxide (3.08%) and terbium oxide (2.20%). The estimated total recovery of the rare earths elements was around 70% for yttrium and europium and 80% for the other rare earths. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Investigation of the luminescent properties of terbium-anthranilate complexes and application to the determination of anthranilic acid derivatives in aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Arnaud, N.; Georges, J

    2003-01-10

    The luminescent properties of terbium complexes with furosemide (FR), flufenamic (FF) acid, tolfenamic (TF) acid and mefenamic (MF) acid have been investigated in aqueous solutions. For all four compounds, complexation occurs when the carboxylic acid of the aminobenzoic group is dissociated and is greatly favoured in the presence of trioctylphosphine oxide as co-ligand and Triton X-100 as surfactant. Under optimum conditions, luminescence of the lanthanide ion is efficiently sensitised and the lifetime of the {sup 5}D{sub 4} resonance level of terbium in the complex is ranging between 1 and 1.9 ms, against 0.4 ms for the aqua ion. The sensitivity of the method for the determination of anthranilic acid derivatives is improved by one to two orders of magnitude with respect to that achieved using native fluorescence or terbium-sensitised luminescence in methanol. The limits of detection are 2x10{sup -10}, 5x10{sup -10} and 2x10{sup -9} mol l{sup -1} for flufenamic acid, furosemide and tolfenamic acid, and mefenamic acid, respectively, with within-run RSD values of less than 1%. The method has been applied to the determination of flufenamic acid in spiked calf sera with and without sample pretreatment. Depending on the method and the analyte concentration, the recovery was ranging between 83 and 113% and the lowest concentration attainable in serum samples was close to 1x10{sup -7} mol l{sup -1}.

  6. 40 CFR 141.540 - Who has to develop a disinfection benchmark?

    Science.gov (United States)

    2010-07-01

    ... benchmark? 141.540 Section 141.540 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Disinfection-Systems Serving Fewer Than 10,000 People Disinfection Benchmark § 141.540 Who has to develop a disinfection benchmark? If you are a subpart H system required to develop a disinfection profile under §§ 141...

  7. 26 CFR 1.141-14 - Anti-abuse rules.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-14 Anti-abuse rules... of the local market conditions, it is reasonably expected that the fair rental value of the... state and local bonds. In cases where this method is used in a manner inconsistent with the purposes of...

  8. 26 CFR 1.141-12 - Remedial actions.

    Science.gov (United States)

    2010-04-01

    ...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-12 Remedial actions... of the sale to P is $6 million. Because the transfer was for less than fair market value, the bonds... bonds and if all of the requirements in paragraphs (a) (1) through (5) of this section are met. (1...

  9. 40 CFR 141.83 - Source water treatment requirements.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Source water treatment requirements... water treatment requirements. Systems shall complete the applicable source water monitoring and....86, and 141.88) by the following deadlines. (a) Deadlines for completing source water treatment steps...

  10. 27 CFR 24.141 - Bonded wine warehouse.

    Science.gov (United States)

    2010-04-01

    ... § 24.141 Bonded wine warehouse. Where all operations at a bonded wine warehouse are to be permanently... operations of the bonded wine warehouse will be discontinued. (Sec. 201, Pub. L. 85-859, 72 Stat. 1379, as... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bonded wine warehouse. 24...

  11. 40 CFR 141.172 - Disinfection profiling and benchmarking.

    Science.gov (United States)

    2010-07-01

    ... Disinfection-Systems Serving 10,000 or More People § 141.172 Disinfection profiling and benchmarking. (a... profile of its disinfection practice for a period of up to three years. (2) The system must monitor daily... decides to make a significant change to its disinfection practice must consult with the State prior to...

  12. 40 CFR 80.141 - Interim detergent gasoline program.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Interim detergent gasoline program. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.141 Interim detergent gasoline... apply to: (i) All gasoline sold or transferred to a party who sells or transfers gasoline to the...

  13. 40 CFR 141.155 - Report delivery and recordkeeping.

    Science.gov (United States)

    2010-07-01

    ...) The system must make a good faith effort to reach consumers who do not get water bills, using means... consumers who are served by the system but are not bill-paying customers, such as renters or workers. A good... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Report delivery and recordkeeping. 141...

  14. 27 CFR 25.141 - Barrels and kegs.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY LIQUORS BEER Marks, Brands, and Labels § 25.141 Barrels and kegs. (a) General requirements. The brewer's name or trade name and the place of production (city and, if necessary for identification, State) shall be permanently marked on each barrel or keg. If the place of production is clearly...

  15. 40 CFR 141.84 - Lead service line replacement requirements.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper § 141.84 Lead... portion would be precluded by State, local or common law. A water system that does not replace the entire...-replaced lead service line that is representative of the water in the service line for analysis of lead...

  16. 40 CFR 141.701 - Source water monitoring.

    Science.gov (United States)

    2010-07-01

    ... least monthly for 24 months. (2) Unfiltered systems serving at least 10,000 people must sample their... the Bin 1 Cryptosporidium level in § 141.710. (6) Unfiltered systems serving fewer than 10,000 people... Applies to filtered systems that meet the conditions of paragraph (a)(4) of this section and unfiltered...

  17. propanediol by isolated Klebsiella pneumoniae 141B stain

    African Journals Online (AJOL)

    In this study, 1,3-propanediol (1,3-PDO) production by Klebsiella pneumoniae 141B strain using raw glycerol as substrate was investigated. Taguchi L18 orthogonal array (OA) was adopted to optimize nutritional (raw glycerol, yeast extract and calcium carbonate), physiological (incubation temperature and medium pH) and ...

  18. 41 CFR 105-71.141 - Financial reporting.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Financial reporting. 105... GOVERNMENTS 71.14-Post-Award Requirements/Reports, Records, Retention, and Enforcement § 105-71.141 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this section, grantees will...

  19. Structural investigation and photoluminescent properties of gadolinium(III), europium(III) and terbium(III) 3-mercaptopropionate complexes.

    Science.gov (United States)

    Souza, E R; Mazali, I O; Sigoli, F A

    2014-01-01

    This work reports on the synthesis, crystallographic determination and spectroscopic characterization of gadolinium(III), terbium(III) and europium(III) 3-mercaptopropionate complexes, aqua-tris(3-mercaptopropionate)lanthanide(III)--[Ln(mpa)3(H2O)]. The Judd-Ofelt intensity parameters were experimentally determined from emission spectrum of the [Eu(mpa)3(H2O)]complex and they were also calculated from crystallographic data. The complexes are coordination polymers, where the units of each complex are linked together by carboxylate groups leading to an unidimensional and parallel chains that by chemical interactions form a tridimensional framework. The emission spectrum profile of the [Eu(mpa)3(H2O)] complex is discussed based on point symmetry of the europium(III) ion, that explains the bands splitting observed in its emission spectrum. Photoluminescent analysis of the [Gd(mpa)3(H2O)] complex show no efficient ligand excitation but an intense charge transfer band. The excitation spectra of the [Eu(mpa)3(H2O)] and [Tb(mpa)3(H2O)] complexes do not show evidence of energy transfer from the ligand to the excited levels of these trivalent ions. Therefore the emission bands are originated only by direct f-f intraconfigurational excitation of the lantanide(III) ions.

  20. Fluorometric determination of proteins using the terbium (III)-2-thenoyltrifluoroacetone-sodium dodecyl benzene sulfonate-protein system

    Energy Technology Data Exchange (ETDEWEB)

    Jia Zhen [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Department of Chemistry, Dezhou University, Dezhou 253023 (China); Yang Jinghe [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)]. E-mail: yjh@sdu.edu.cn; Wu Xia [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Wang Fei [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Guo Changying [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China); Liu Shufang [Key Laboratory of Colloid and Interface Chemistry of Education Ministry, School of Chemistry and Chemical Engineering, Shandong University, Jinan 250100 (China)

    2006-12-15

    It is found that in hexamethylene tetramine (HMTA)-HCl buffer of pH=8.00, proteins can enhance the fluorescence of terbium (III) (Tb{sup 3+})-2-thenoyltrifluoroacetone (TTA)-sodium dodecyl benzene sulfonate (SDBS) system. Based on this, a sensitive method for the determination of proteins is proposed. The experiments indicate that under the optimum conditions, the enhanced fluorescence intensity is in proportion to the concentration of proteins in the range of 4.0x10{sup -9}-7.5x10{sup -6}g/mL for bovine serum albumin (BSA), 5.0x10{sup -9}-1.5x10{sup -5}g/mL for human serum albumin (HSA), 1.0x10{sup -8}-7.5x10{sup -6}g/mL for egg albumin (EA). Their detection limits (S/N=3) are 0.5, 0.8 and 2.0ng/mL, respectively. The interaction mechanism is also studied.

  1. Terbium to Quantum Dot FRET Bioconjugates for Clinical Diagnostics: Influence of Human Plasma on Optical and Assembly Properties

    Directory of Open Access Journals (Sweden)

    Niko Hildebrandt

    2011-10-01

    Full Text Available Förster resonance energy transfer (FRET from luminescent terbium complexes (LTC as donors to semiconductor quantum dots (QDs as acceptors allows extraordinary large FRET efficiencies due to the long Förster distances afforded. Moreover, time-gated detection permits an efficient suppression of autofluorescent background leading to sub-picomolar detection limits even within multiplexed detection formats. These characteristics make FRET-systems with LTC and QDs excellent candidates for clinical diagnostics. So far, such proofs of principle for highly sensitive multiplexed biosensing have only been performed under optimized buffer conditions and interactions between real-life clinical media such as human serum or plasma and LTC-QD-FRET-systems have not yet been taken into account. Here we present an extensive spectroscopic analysis of absorption, excitation and emission spectra along with the luminescence decay times of both the single components as well as the assembled FRET-systems in TRIS-buffer, TRIS-buffer with 2% bovine serum albumin, and fresh human plasma. Moreover, we evaluated homogeneous LTC-QD FRET assays in QD conjugates assembled with either the well-known, specific biotin-streptavidin biological interaction or, alternatively, the metal-affinity coordination of histidine to zinc. In the case of conjugates assembled with biotin-streptavidin no significant interference with the optical and binding properties occurs whereas the histidine-zinc system appears to be affected by human plasma.

  2. Evidence of mass exchange between inside and outside of sonoluminescing bubble in aqueous solution of terbium chloride

    Energy Technology Data Exchange (ETDEWEB)

    Liang, Jinfu, E-mail: liang.shi2007@163.com [School of Physics and Electronic Science, Guizhou Normal University, Guiyang 550001 (China); Chen, Weizhong, E-mail: wzchen@nju.edu.cn [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China); Wang, Xun; Yang, Jing; Chen, Zhan [The Key Laboratory of Modern Acoustics, Ministry of Education, Institution of Acoustics, Nanjing University, Nanjing 210093 (China)

    2016-12-16

    Highlights: • Time-resolved spectra of SBSL were obtained for Tb{sup 3+} ions emission lines. • Mass exchange between inside and outside of SL bubble was probed via Tb{sup 3+} ions lines. • The argon rectification hypothesis was tested by time-resolved spectra of SBSL. • The rate of mass exchange inside an SBSL bubble increases with increasing sound pressure. - Abstract: Spectra of single-bubble sonoluminescence (SBSL) were obtained for Tb{sup 3+} ions emission lines from bubbles in an aqueous solution of terbium chloride (TbCl{sub 3}). The spectra provide experimental evidence to prove that an air bubble driven by strong ultrasound will not eventually become a rectified pure argon bubble, which is not as predicted by the argon rectification hypothesis. The time-resolved spectra of SBSL show a mass exchange of material such as Tb{sup 3+} ions between the inside and outside of the bubble. With increasing sound pressure, the rate of mass exchange and the SBSL intensity increases.

  3. Optical properties and electrical transport of thin films of terbium(III bis(phthalocyanine on cobalt

    Directory of Open Access Journals (Sweden)

    Peter Robaschik

    2014-11-01

    Full Text Available The optical and electrical properties of terbium(III bis(phthalocyanine (TbPc2 films on cobalt substrates were studied using variable angle spectroscopic ellipsometry (VASE and current sensing atomic force microscopy (cs-AFM. Thin films of TbPc2 with a thickness between 18 nm and 87 nm were prepared by organic molecular beam deposition onto a cobalt layer grown by electron beam evaporation. The molecular orientation of the molecules on the metallic film was estimated from the analysis of the spectroscopic ellipsometry data. A detailed analysis of the AFM topography shows that the TbPc2 films consist of islands which increase in size with the thickness of the organic film. Furthermore, the cs-AFM technique allows local variations of the organic film topography to be correlated with electrical transport properties. Local current mapping as well as local I–V spectroscopy shows that despite the granular structure of the films, the electrical transport is uniform through the organic films on the microscale. The AFM-based electrical measurements allow the local charge carrier mobility of the TbPc2 thin films to be quantified with nanoscale resolution.

  4. Highly luminescent charge-neutral europium(iii) and terbium(iii) complexes with tridentate nitrogen ligands.

    Science.gov (United States)

    Senthil Kumar, Kuppusamy; Schäfer, Bernhard; Lebedkin, Sergei; Karmazin, Lydia; Kappes, Manfred M; Ruben, Mario

    2015-09-21

    We report on the synthesis of tridentate-nitrogen pyrazole-pyridine-tetrazole (L(1)H) and pyrazole-pyridine-triazole (L(2)H) ligands and their complexation with lanthanides (Ln = Gd(iii), Eu(iii) and Tb(iii)) resulting in stable, charge-neutral complexes Ln(L(1))3 and Ln(L(2))3, respectively. X-ray crystallographic analysis of the complexes with L(1) ligands revealed tricapped trigonal coordination geometry around the lanthanide ions. All complexes show bright photoluminescence (PL) in the solid state, indicating efficient sensitization of the lanthanide emission via the triplet states of the ligands. In particular, the terbium complexes show high PL quantum yields of 65 and 59% for L(1) and L(2), respectively. Lower PL efficiencies of the europium complexes (7.5 and 9%, respectively) are attributed to large energy gaps between the triplet states of the ligands and accepting levels of Eu(iii). The triplet state energy can be reduced by introducing an electron withdrawing (EW) group at the 4 position of the pyridine ring. Such substitution of L(1)H with a carboxylic ester (COOMe) EW group leads to a europium complex with increased PL quantum yield of 31%. A comparatively efficient PL of the complexes dissolved in ethanol indicates that the lanthanide ions are shielded against nonradiative deactivation via solvent molecules.

  5. Micelle enhanced and terbium sensitized spectrofluorimetric determination of danofloxacin in milk using molecularly imprinted solid phase extraction

    Science.gov (United States)

    Kaur, Kuldeep; Saini, Shivender Singh; Malik, Ashok Kumar; Singh, Baldev

    2012-10-01

    An efficient molecularly imprinted solid phase extraction (MISPE)-spectrofluorimetric method was developed to sensitively determine danofloxacin (DAN) in milk samples. Solid phase extraction procedure using MISPE cartridges was first performed on milk samples and then spectrofluorimetric determination was done at 546 nm using an excitation wavelength of 285 nm in presence of terbium and sodium dodecyl benzene sulfonate (SDBS). It was found that SDBS significantly enhanced the fluorescence intensity of the DAN-Tb3+ complex. Various factors affecting the fluorescence intensity of DAN-Tb3+-SDBS system were studied and conditions were optimized. The enhanced fluorescence intensity of the system (ΔF) showed a good linear relationship with the concentration of DAN over the range of 8.4 × 10-9-3.4 × 10-7 mol L-1 with a correlation coefficient of 0.9996. The detection limit was determined as 2.0 × 10-9 mol L-1 and the limit of quantification was determined as 6.5 × 10-9 mol L-1. The MISPE-spectrofluorimetric procedure was successfully applied to the determination of DAN in milk samples. The method is simple, rapid, sensitive and allows interference free determination of DAN in complex fluorescent matrices like milk. The method can be used to determine whether the DAN residues in milk exceed MRLs or not.

  6. Study of quantum dot based on tin/yttrium mixed oxide doped with terbium to be used as biomarker

    Energy Technology Data Exchange (ETDEWEB)

    Paganini, Paula P.; Felinto, Maria Claudia F.C.; Kodaira, Claudia A., E-mail: paulapaganini@usp.b, E-mail: mfelinto@ipen.b, E-mail: claudiakodaira@yahoo.co [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Brito, Hermi F., E-mail: hefbrito@iq.usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Quimica. Lab. de Elementos do Bloco f; Nunes, Luiz Antonio O., E-mail: luizant@ifsc.usp.b [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Fisica. Dept. de Fisica e Informatica

    2009-07-01

    Quantum dots (semiconductors nanocrystals) have brought a promising field to develop a new generation of luminescent biomarkers. The use of lanthanides ions as luminescent markers has many advantages, for example a security method, low cost, high specificity and also the luminescence can be promptly measured with high sensibility and accuracy. These luminescent dots are functionalized with biomolecules. For the luminophore particle to be connect with biologicals molecules (for example covalent antibody) is necessary a previous chemical treatment to modify luminophore particle surface and this process is called functionalization. A prior chemical treatment with changes on the surface luminophore particle is necessary to couple the luminophore to biological molecules. This process can be used as coating which can protect these particles from being dissolved by acid as well as provide functional groups for biological conjugation. This work presents a photoluminescence study of nanoparticles based on tin/yttrium mixed oxides doped with terbium (SnO{sub 2}/Y{sub 2}O{sub 3}:Tb{sup 3+}), synthesized by coprecipitation method. The nanoparticles were submitted to thermal treatment and characterized by X-Ray Powder Diffraction (XRD) that showed cassiterite phase formation and the influence of thermal treatment on nanoparticles structures. These nanoparticles going to be functionalized with a natural polysaccharide (chitosan) in order to form microspheres. These microspheres going to be irradiated with gamma radiation to sterilization and it can be evaluated if the nanoparticles are resistant to irradiation and they do not lose functionality with this process. (author)

  7. Terbium-doped gadolinium oxysulfide (Gd2O2S:Tb) scintillation-based polymer optical fibre sensor for real time monitoring of radiation dose in oncology

    Science.gov (United States)

    Lewis, E.; O'Keeffe, S.; Grattan, M.; Hounsell, A.; McCarthy, D.; Woulfe, P.; Cronin, J.; Mihai, L.; Sporea, D.; Santhanam, A.; Agazaryan, N.

    2014-05-01

    A PMMA based plastic optical fibre sensor for use in real time radiotherapy dosimetry is presented. The optical fibre tip is coated with a scintillation material, terbium-doped gadolinium oxysulfide (Gd2O2S:Tb), which fluoresces when exposed to ionising radiation (X-Ray). The emitted visible light signal penetrates the sensor optical fibre and propagates along the transmitting fibre at the end of which it is remotely monitored using a fluorescence spectrometer. The results demonstrate good repeatability, with a maximum percentage error of 0.5% and the response is independent of dose rate.

  8. 40 CFR 141.708 - Requirements when making a significant change in disinfection practice.

    Science.gov (United States)

    2010-07-01

    ... calculate disinfection benchmarks for Giardia lamblia and viruses as described in § 141.709. Prior to... disinfection benchmark for Giardia lamblia and viruses as described in § 141.709. (2) A description of the...

  9. Investigation of lifetimes in dipole bands of {sup 141}Eu

    Energy Technology Data Exchange (ETDEWEB)

    Podsvirova, E.O.; Pasternak, A.A. [Institut fuer Kernphysik, Forschungszentrum Juelich, D-52425, Juelich (Germany); A.F. Ioffe Physical Technical Institute RAS, RU-194021, St. Petersburg (Russian Federation); Lieder, R.M.; Gast, W.; Jaeger, H.M.; Mihailescu, L. [Institut fuer Kernphysik, Forschungszentrum Juelich, D-52425, Juelich (Germany); Chmel, S. [Institut fuer Strahlen- und Kernphysik, University of Bonn, D-53115, Bonn (Germany); Venkova, T. [Institut fuer Kernphysik, Forschungszentrum Juelich, D-52425, Juelich (Germany); Institute of Nuclear Research and Nuclear Energy, Bulgarian Academy of Sciences, BG-1784, Sofia (Bulgaria); Angelis, G. de; Napoli, D.R.; Gadea, A. [Istituto Nazionale di Fisica Nucleare, Laboratori Nazionali di Legnaro, I-35020, Legnaro (Italy); Bazzacco, D.; Menegazzo, R.; Lunardi, S. [Dipartimento di Fisica dell' Universita and Istituto Nazionale di Fisica Nucleare, Sezione di Padova, I-35131, Padova (Italy); Urban, W.; Droste, C.; Morek, T.; Rzaca-Urban, T. [Institute of Experimental Physics, University of Warsaw, PL-00-681, Warszawa (Poland); Duchene, G. [Institut de Recherches Subatomique IReS, F-67037, Strasbourg (France)

    2004-07-01

    Lifetimes have been measured for dipole bands in {sup 141}Eu using DSAM. The deduced B(M1) and B(E2) values as well as B(M1)/B(E2) ratios are compared with calculations in the framework of the TAC (Tilted Axis Cranking) and SPAC (Shears mechanism with Principal Axis Cranking) models. The dipole bands can be interpreted as magnetic rotational bands. (orig.)

  10. Magnetic rotation in the nucleus 141Eu

    Energy Technology Data Exchange (ETDEWEB)

    Marcinkowska, Z.; Rzaca-Urban, T.; Droste, C.; Morek, T.; Czajkowska, B.; Urban, W.; Marcinkowski, R.; Olbratowski, P.; Lieder, R. M.; Brans, H.; Gast, W.; Jager, H. M.; Mihailescu, L.; Bazzacco, D.; Falconi, G.; Menegazzo, R.; Lunardi, S.; Rossi-Alvarez, C.; De Angelis, G.; Farnea, E.; Gadea, A.; Napoli, D. R.; Podolyak, Z.

    2003-04-01

    The previously known level scheme of 141 Eu nucleus was revised and substantially extended. Three dipole cascades, characterized by large B(M1)/B(E2) ratios, have been found. Spin and parity assignments were based on the angular distribution ratios and linear polarizations of γ-rays. The experimental results have been compared with the calculations of Tilted Axis Cranking (TAC) model.

  11. 49 CFR 40.141 - How does the MRO obtain information for the verification decision?

    Science.gov (United States)

    2010-10-01

    ... Verification Process § 40.141 How does the MRO obtain information for the verification decision? As the MRO... 49 Transportation 1 2010-10-01 2010-10-01 false How does the MRO obtain information for the verification decision? 40.141 Section 40.141 Transportation Office of the Secretary of Transportation...

  12. 40 CFR 141.11 - Maximum contaminant levels for inorganic chemicals.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for inorganic chemicals. 141.11 Section 141.11 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.11 Maximum contaminant levels for inorganic chemicals. (a) The maximum contaminant level for...

  13. 40 CFR 141.804 - Aircraft water system operations and maintenance plan.

    Science.gov (United States)

    2010-07-01

    ... maintenance plan. 141.804 Section 141.804 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... § 141.804 Aircraft water system operations and maintenance plan. (a) Each air carrier must develop and implement an aircraft water system operations and maintenance plan for each aircraft water system that it...

  14. 19 CFR 141.113 - Recall of merchandise released from Customs and Border Protection custody.

    Science.gov (United States)

    2010-04-01

    ... Border Protection custody. 141.113 Section 141.113 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION... Merchandise § 141.113 Recall of merchandise released from Customs and Border Protection custody. (a)(1... be not legally marked, the port director may demand its return to CBP custody for the purpose of...

  15. 40 CFR 141.88 - Monitoring requirements for lead and copper in source water.

    Science.gov (United States)

    2010-07-01

    ... copper in source water. 141.88 Section 141.88 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.88 Monitoring requirements for lead and copper in source water. (a) Sample location, collection... make another sampling point more representative of each source or treatment plant. (ii) Surface water...

  16. 10 CFR 60.141 - Confirmation of geotechnical and design parameters.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Confirmation of geotechnical and design parameters. 60.141 Section 60.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN GEOLOGIC REPOSITORIES Performance Confirmation Program § 60.141 Confirmation of geotechnical and design parameters. (a) During repository...

  17. Compact all-fiber optical Faraday components using 65-wt%-terbium-doped fiber with a record Verdet constant of -32 rad/(Tm).

    Science.gov (United States)

    Sun, L; Jiang, S; Marciante, J R

    2010-06-07

    A compact all-fiber Faraday isolator and a Faraday mirror are demonstrated. At the core of each of these components is an all-fiber Faraday rotator made of a 4-cm-long, 65-wt%-terbium-doped silicate fiber. The effective Verdet constant of the terbium-doped fiber is measured to be -32 rad/(Tm), which is 27 x larger than that of silica fiber. This effective Verdet constant is the largest value measured to date in any fiber and is 83% of the Verdet constant of commercially available crystal used in bulk optics-based isolators. Combining the all-fiber Faraday rotator with fiber polarizers results in a fully fusion spliced all-fiber isolator whose isolation is measured to be 19 dB. Combining the all-fiber Faraday rotator with a fiber Bragg grating results in an all-fiber Faraday mirror that rotates the polarization state of the reflected light by 88 +/- 4 degrees .

  18. Picomolar Traces of Americium(III) Introduce Drastic Changes in the Structural Chemistry of Terbium(III): A Break in the "Gadolinium Break".

    Science.gov (United States)

    Welch, Jan M; Müller, Danny; Knoll, Christian; Wilkovitsch, Martin; Giester, Gerald; Ofner, Johannes; Lendl, Bernhard; Weinberger, Peter; Steinhauser, Georg

    2017-10-16

    The crystallization of terbium 5,5'-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H 2 O) 7 ZT] 2 ZT⋅10 H 2 O is isostructural to light lanthanide (Ce-Gd) 5,5'-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5'-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H 2 O) 8 ] 2 ZT 3 ⋅6 H 2 O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10 8 -fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microcopy. In addition, the inclusion properties of terbium 5,5'-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. First allowed bandcrossing in neutron deficient nucleus {sup 141}Tb

    Energy Technology Data Exchange (ETDEWEB)

    Medina, N.H.; Oliveira, J.R.B.; Cybulska, E.W.; Rao, M.N.; Ribas, R.V.; Rizzutto, M.A.; Seale, W.A. [Sao Paulo Univ., SP (Brazil). Inst. de Fisica; Espinoza-Quinones, F.R. [Universidade Estadual do Oeste do Parana, Toledo, PR (Brazil). Centro de Engenharia e Ciencias Exatas; Bazzacco, D.; Brandolini, F.; Lunardi, S.; Petrache, C.M.; Podolyak, Zs.; Rossi-Alvarez, C.; Soramel, F.; Ur, C.A. [Istituto Nazionale di Fisica Nucleare, Padova (Italy); Cardona, M.A.; Angelis, G. de; Napoli, D.R.; Spolaore, P.; Gadea, A.; Acua, D. de; Poli, M. de; Farnea, E.; Foltescu, D.; Ionescu-Bujor, M.; Iordachescu, A. [Istituto Nazionale di Fisica Nucleare, Legnaro (Italy). Laboratori Nazionali

    2004-09-15

    The neutron deficient {sup 141}Tb nucleus has been studied with the {sup 92}Mo ({sup 54}Fe, {alpha}-) reaction at 240-MeV incident energy and the multidetector array GASP. For the yrast {pi}h{sub 11/2} decoupled band, excited states up to 6.7 MeV and spin up to 47=2{sup -} have been observed. This band presents an upbend at rotational frequency of Plank constant{omega}=0:38 MeV due to the alignment of h{sub 11}/{sub 2} protons. The results are discussed in terms of the Cranking model. (author)

  20. Crystal structures of two mononuclear complexes of terbium(III) nitrate with the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane.

    Science.gov (United States)

    Gregório, Thaiane; Giese, Siddhartha O K; Nunes, Giovana G; Soares, Jaísa F; Hughes, David L

    2017-02-01

    Two new mononuclear cationic complexes in which the TbIII ion is bis-chelated by the tripodal alcohol 1,1,1-tris-(hy-droxy-meth-yl)propane (H3LEt, C6H14O3) were prepared from Tb(NO3)3·5H2O and had their crystal and mol-ecular structures solved by single-crystal X-ray diffraction analysis after data collection at 100 K. Both products were isolated in reasonable yields from the same reaction mixture by using different crystallization conditions. The higher-symmetry complex dinitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) nitrate di-meth-oxy-ethane hemisolvate, [Tb(NO3)2(H3LEt)2]NO3·0.5C4H10O2, 1, in which the lanthanide ion is 10-coordinate and adopts an s-bicapped square-anti-prismatic coordination geometry, contains two bidentate nitrate ions bound to the metal atom; another nitrate ion functions as a counter-ion and a half-mol-ecule of di-meth-oxy-ethane (completed by a crystallographic twofold rotation axis) is also present. In product aqua-nitratobis[1,1,1-tris-(hy-droxy-meth-yl)propane]-terbium(III) dinitrate, [Tb(NO3)(H3LEt)2(H2O)](NO3)2, 2, one bidentate nitrate ion and one water mol-ecule are bound to the nine-coordinate terbium(III) centre, while two free nitrate ions contribute to charge balance outside the tricapped trigonal-prismatic coordination polyhedron. No free water mol-ecule was found in either of the crystal structures and, only in the case of 1, di-meth-oxy-ethane acts as a crystallizing solvent. In both mol-ecular structures, the two tripodal ligands are bent to one side of the coordination sphere, leaving room for the anionic and water ligands. In complex 2, the methyl group of one of the H3LEt ligands is disordered over two alternative orientations. Strong hydrogen bonds, both intra- and inter-molecular, are found in the crystal structures due to the number of different donor and acceptor groups present.

  1. Closure report for underground storage tank 141-R3U1 and its associated underground piping

    Energy Technology Data Exchange (ETDEWEB)

    Mallon, B.J.; Blake, R.G.

    1994-03-01

    Underground storage tank UST 141-R3U1 at Lawrence Livermore National Laboratory (LLNL), was registered with the State Water Resources Control Board on June 27, 1984. This tank system consisted of a concrete tank, lined with polyvinyl chloride, and approximately 100 feet of PVC underground piping. UST 141-R3U1 had a capacity of 450 gallons. The underground piping connected three floor drains and one sink inside Building 141 to UST 141-R3U1. The wastewater collected in UST 141-R3U1 contained organic solvents, metals, and inorganic acids. On November 30, 1987, the 141-R3U1 tank system failed a precision tank test. The 141-R3U1 tank system was subsequently emptied and removed from service pending further precision tests to determine the location of the leak within the tank system. A precision tank test on February 5, 1988, was performed to confirm the November 30, 1987 test. Four additional precision tests were performed on this tank system between February 25, 1988, and March 6, 1988. The leak was located where the inlet piping from Building 141 penetrates the concrete side of UST 141-R3U1. The volume of wastewater that entered the backfill and soil around and/or beneath UST 141-R3U1 is unknown. On December 13, 1989, the LLNL Environmental Restoration Division submitted a plan to close UST 141-R3U1 and its associated piping to the Alameda County Department of Environmental Health. UST 141-R3U1 was closed as an UST, and shall be used instead as additional secondary containment for two aboveground storage tanks.

  2. The response behavior of PPy-DB18C6 electrode to terbium(III in acetonitrile and its thermodynamic application

    Directory of Open Access Journals (Sweden)

    Mohammad Hossein Arbab Zavar

    2016-11-01

    Full Text Available Polypyrrole modified electrode prepared by electropolymerization of pyrrole in the presence of a complexing ligand, dibenzo-18-crown-6(DB18C6, was prepared and investigated as a Tb3+-selective electrode in acetonitrile. The potentiometric response of the electrode was linear within the Tb3+ concentration range 1 × 10−5–1 × 10−2 M with a Nernstian slope of 20.9 mVdecade−1 in AN. The electrode was applied to study the complexation of the terbium(III ion in acetonitrile with such other basic aprotic solvent molecules (D as dimethyl sulfoxide, N,N-dimethyl formamide, propylene carbonate and pyridine. The successive complex formation constant (βi and Gibbs energies of transfer (ΔGtr of Tb3+ in AN in relation to such D were obtained.

  3. Luminescence and Magnetic Properties of Two Three-Dimensional Terbium and Dysprosium MOFs Based on Azobenzene-4,4′-Dicarboxylic Linker

    Directory of Open Access Journals (Sweden)

    Belén Fernández

    2016-02-01

    Full Text Available We report the in situ formation of two novel metal-organic frameworks based on terbium and dysprosium ions using azobenzene-4,4′-dicarboxylic acid (H2abd as ligand, synthesized by soft hydrothermal routes. Both materials show isostructural three-dimensional networks with channels along a axis and display intense photoluminescence properties in the solid state at room temperature. Textural properties of the metal-organic frameworks (MOFs have been fully characterized although no appreciable porosity was obtained. Magnetic properties of these materials were studied, highlighting the dysprosium material displays slightly frequency-dependent out of phase signals when measured under zero external field and under an applied field of 1000 Oe.

  4. Polymorphisms at Amino Acid Residues 141 and 154 Influence Conformational Variation in Ovine PrP

    Directory of Open Access Journals (Sweden)

    Sujeong Yang

    2014-01-01

    Full Text Available Polymorphisms in ovine PrP at amino acid residues 141 and 154 are associated with susceptibility to ovine prion disease: Leu141Arg154 with classical scrapie and Phe141Arg154 and Leu141His154 with atypical scrapie. Classical scrapie is naturally transmissible between sheep, whereas this may not be the case with atypical scrapie. Critical amino acid residues will determine the range or stability of structural changes within the ovine prion protein or its functional interaction with potential cofactors, during conversion of PrPC to PrPSc in these different forms of scrapie disease. Here we computationally identified that regions of ovine PrP, including those near amino acid residues 141 and 154, displayed more conservation than expected based on local structural environment. Molecular dynamics simulations showed these conserved regions of ovine PrP displayed genotypic differences in conformational repertoire and amino acid side-chain interactions. Significantly, Leu141Arg154 PrP adopted an extended beta sheet arrangement in the N-terminal palindromic region more frequently than the Phe141Arg154 and Leu141His154 variants. We supported these computational observations experimentally using circular dichroism spectroscopy and immunobiochemical studies on ovine recombinant PrP. Collectively, our observations show amino acid residues 141 and 154 influence secondary structure and conformational change in ovine PrP that may correlate with different forms of scrapie.

  5. Shape evolution and magnetic rotation in {sup 141}Nd

    Energy Technology Data Exchange (ETDEWEB)

    Zerrouki, T.; Petrache, C.M.; Leguillon, R.; Hauschild, K.; Korichi, A.; Lopez-Martens, A. [Universite Paris-Sud and CNRS/IN2P3, Centre de Spectrometrie Nucleaire et de Spectrometrie de Masse, Orsay (France); Frauendorf, S. [University of Notre Dame, Department of Physics, Notre Dame, IN (United States); Ragnarsson, I. [Lund University, Division of Mathematical Physics, LTH, P.O. Box 118, Lund (Sweden); Huebel, H.; Neusser-Neffgen, A.; Al-Khatib, A.; Bringel, P.; Buerger, A.; Nenoff, N.; Schoenwasser, G.; Singh, A.K. [Universitaet Bonn, Helmholtz-Institut fuer Strahlen- und Kernphysik, Bonn (Germany); Curien, D. [DRS-IPHC, Departement de Recherches Subatomiques, Institut Pluridisciplinaire Hubert Curien, 23 rue du Loess, BP 28, Strasbourg (France); Hagemann, G.B.; Herskind, B.; Sletten, G. [Niels Bohr Institute, Copenhagen (Denmark); Fallon, P. [Lawrence Berkeley National Laboratory, Nuclear Science Division, Berkeley, CA (United States); Goergen, A. [University of Oslo, Departement de Physics, Oslo (Norway); Bednarczyk, P. [Polish Academy of Sciences, The Niewodniczanski Institute of Nuclear Physics, Krakow (Poland)

    2015-04-01

    The high-spin states in {sup 141}Nd were investigated using the {sup 96}Zr({sup 48}Ca, 3n) reaction and the EUROBALL array. The level scheme has been extended up to an excitation energy of around 16MeV and spin 81/2. Two new bands of dipole transitions and three bands presumably of quadrupole transitions were identified and their connections to low-lying states were established. Cranked Nilsson-Strutinsky and tilted axis cranking calculations are combined in the interpretation of the observed dipole bands. The high-spin bands with assigned quadrupole transitions are interpreted as triaxial bands, while the dipole bands appear in the calculations to exhibit a shape evolution from low-deformation triaxial to spherical shape. They can be classified as magnetic rotation, with transition probabilities that show the characteristic decrease with angular momentum caused by the shears mechanism. (orig.)

  6. Luminescent europium and terbium complexes of dipyridoquinoxaline and dipyridophenazine ligands as photosensitizing antennae: structures and biological perspectives.

    Science.gov (United States)

    Dasari, Srikanth; Patra, Ashis K

    2015-12-14

    The europium(III) and terbium(III) complexes, namely [Eu(dpq)(DMF)2(NO3)3] (1), [Eu(dppz)2(NO3)3] (2), [Tb(dpq)(DMF)2Cl3] (3), and [Tb(dppz)(DMF)2Cl3] (4), where dipyrido[3,2-d:2',3'-f]quinoxaline (dpq in 1 and 3), dipyrido[3,2-a:2',3'-c]phenazine (dppz in 2 and 4) and N,N'-dimethylformamide (DMF) have been isolated, characterized from their physicochemical data, luminescence studies and their interaction with DNA, serum albumin protein and photo-induced DNA cleavage activity are studied. The X-ray crystal structures of complexes 1-4 show discrete mononuclear Ln(3+)-based structures. The Eu(3+) in [Eu(dpq)(DMF)2(NO3)3] (1) and [Eu(dppz)2(NO3)3] (2) as [Eu(dppz)2(NO3)3]·dppz (2a) adopts a ten-coordinated bicapped dodecahedron structure with a bidentate N,N-donor dpq ligand, two DMF and three NO3(-) anions in 1 and two bidentate N,N-donor dppz ligands and three NO3(-) anions in 2. Complexes 3 and 4 show a seven-coordinated mono-capped octahedron structure where Tb(3+) contains bidentate dpq/dppz ligands, two DMF and three Cl(-) anions. The complexes are highly luminescent in nature indicating efficient photo-excited energy transfer from the dpq/dppz antenna to Ln(3+) to generate long-lived emissive excited states for characteristic f → f transitions. The time-resolved luminescence spectra of complexes 1-4 show typical narrow emission bands attributed to the (5)D0 → (7)F(J) and (5)D4 → (7)F(J) f-f transitions of Eu(3+) and Tb(3+) ions respectively. The number of inner-sphere water molecules (q) was determined from luminescence lifetime measurements in H2O and D2O confirming ligand-exchange reactions with water in solution. The complexes display significant binding propensity to the CT-DNA giving binding constant values in the range of 1.0 × 10(4)-6.1 × 10(4) M(-1) in the order 2, 4 (dppz) > 1, 3 (dpq). DNA binding data suggest DNA groove binding with the partial intercalation nature of the complexes. All the complexes also show binding propensity (K(BSA)

  7. Aberrant Reduction of MiR-141 Increased CD47/CUL3 in Hirschsprung's Disease

    Directory of Open Access Journals (Sweden)

    Weibing Tang

    2013-12-01

    Full Text Available Background: MiR-141 has been confirmed to be associated with various human diseases. However, whether miR-141 is involved in the pathogenesis of Hirschsprung's disease (HSCR remains unknown. Here, we design the experiment to reveal the relationship between miR-141 and HSCR. Methods: Quantitative real-time PCR and Western blot were used to detect the expression levels of miR-141 and its potential genes in 70 tissues of HSCR compared with 60 controls. Bisulfite sequencing PCR (BSP assay was applied to explain the possible mechanism of the aberrant expression level of miR-141. We employed a dual-luciferase reporter assay to validate the regulation relation between miR-141 and CD47/CUL3. Cell migration, proliferation, apoptosis, and cell cycle progression were examined by transwell assay, MTT assay, and flow cytometry, respectively. Results: MiR-141 was down-regulated whereas CD47 and CUL3 expression was increased in colon tissues from patients with HSCR compared with control group, The increased level of CD47 and CUL3 induced by miR-141 reduced proliferation and migration of 293T and SH-SY5Y cells. Furthermore, this suppression was reversed by reducing of CD47 and CUL3. Hypermethylation of a CpG Island in the promoter region of miR-141 gene was confirmed in HSCR tissues. Conclusion: Aberrant reduction of miR-141 may play an important role in the pathogenesis of HSCR with the inhibiting affection on cell migration and proliferation abilities. The present study demonstrates for the first time the role of miR-141 and its target genes in the occurrence of HSCR, and provides us a new direction for the study of the pathogenesis of Hirschsprung's disease.

  8. 37 CFR 2.141 - Ex parte appeals from action of trademark examining attorney.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Ex parte appeals from action of trademark examining attorney. 2.141 Section 2.141 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Appeals...

  9. 14 CFR 141.41 - Flight simulators, flight training devices, and training aids.

    Science.gov (United States)

    2010-01-01

    ..., and training aids. 141.41 Section 141.41 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... aids. An applicant for a pilot school certificate or a provisional pilot school certificate must show that its flight simulators, flight training devices, training aids, and equipment meet the following...

  10. 9 CFR 354.141 - Issuance and disposition of rabbits inspection certificates.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Issuance and disposition of rabbits inspection certificates. 354.141 Section 354.141 Animals and Animal Products FOOD SAFETY AND INSPECTION... certificates. (a) Upon the request of an interested party, any inspector is authorized to issue a rabbit...

  11. 40 CFR 141.51 - Maximum contaminant level goals for inorganic contaminants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for inorganic contaminants. 141.51 Section 141.51 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... inorganic contaminants. (a) (b) MCLGs for the following contaminants are as indicated: Contaminant MCLG (mg...

  12. 33 CFR 141.30 - Evidence of status as a resident alien.

    Science.gov (United States)

    2010-07-01

    ... alien. 141.30 Section 141.30 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Evidence of status as a resident alien. For the purposes of this part, the employer may accept as sufficient evidence that a person is a resident alien any one of the following documents and no others: (a) A...

  13. 25 CFR 141.36 - Maximum finance charges on pawn transactions.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Maximum finance charges on pawn transactions. 141.36... PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS Pawnbroker Practices § 141.36 Maximum finance charges on pawn transactions. No pawnbroker may impose an annual finance charge greater than twenty-four percent...

  14. 40 CFR 141.86 - Monitoring requirements for lead and copper in tap water.

    Science.gov (United States)

    2010-07-01

    ... line materials when reading water meters or performing maintenance activities): (i) All plumbing codes... copper in tap water. 141.86 Section 141.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper...

  15. 40 CFR 141.711 - Filtered system additional Cryptosporidium treatment requirements.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced... dioxide, membranes, ozone, or UV, as described in §§ 141.716 through 141.720. (c) Failure by a system in... survey or an equivalent source water assessment that after a system completed the monitoring conducted...

  16. 19 CFR 141.84 - Photocopies of invoice for separate entries of same shipment.

    Science.gov (United States)

    2010-04-01

    ... same shipment. 141.84 Section 141.84 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... Photocopies of invoice for separate entries of same shipment. (a) Entries at one port. If by reason of... at the same port of a portion of any merchandise covered by such invoice, if a pro forma invoice is...

  17. 14 CFR Appendix A to Part 141 - Recreational Pilot Certification Course

    Science.gov (United States)

    2010-01-01

    ... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. A Appendix A to Part 141... recognition and avoidance of wake turbulence; (g) Effects of density altitude on takeoff and climb performance... the aircraft category and class for which the course applies, in preparation for the practical test...

  18. 40 CFR 141.50 - Maximum contaminant level goals for organic contaminants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant level goals for organic contaminants. 141.50 Section 141.50 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... (27) Glyphosate .7 (28) Hexachlorocyclopentadiene .05 (29) Oxamyl (Vydate) .2 (30) Picloram .5 (31...

  19. 10 CFR 52.141 - Referral to the Advisory Committee on Reactor Safeguards (ACRS).

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Referral to the Advisory Committee on Reactor Safeguards (ACRS). 52.141 Section 52.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) LICENSES, CERTIFICATIONS... Committee on Reactor Safeguards (ACRS). The Commission shall refer a copy of the application to the ACRS...

  20. 42 CFR 480.141 - Disclosure of QIO interpretations on the quality of health care.

    Science.gov (United States)

    2010-10-01

    ... health care. 480.141 Section 480.141 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT... QIO interpretations on the quality of health care. Subject to the procedures for disclosure and notice... interpretations and generalizations on the quality of health care that identify a particular institution. ...

  1. 33 CFR 209.141 - Coordination of hydroelectric power operations with power marketing agencies.

    Science.gov (United States)

    2010-07-01

    ... power operations with power marketing agencies. 209.141 Section 209.141 Navigation and Navigable Waters... Coordination of hydroelectric power operations with power marketing agencies. (a) Purpose. This regulation... generating facilities with the power marketing agencies. (b) Applicability. This regulation applies to all...

  2. 18 CFR 141.14 - Form No. 80, Licensed Hydropower Development Recreation Report.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Form No. 80, Licensed Hydropower Development Recreation Report. 141.14 Section 141.14 Conservation of Power and Water Resources... Hydropower Development Recreation Report. The form of the report, Licensed Hydropower Development Recreation...

  3. Engineering assessment and certification of integrity of the 141-R1U1 tank system

    Energy Technology Data Exchange (ETDEWEB)

    Graser, D.A. (Science Applications International Corp. (USA))

    1990-09-01

    This Engineering Assessment and Certification of Integrity of retention tank 141-R1U1 is in response to the requirements of 40 CFR 265.191 for an existing tank system that stores hazardous waste and does not have secondary containment. This technical assessment has been reviewed by an independent, qualified, California registered professional engineer, who has certified the tank system to be adequately designed and compatible with the stored waste so that it will not collapse rupture, or fail. This document will be kept on file at the facility. Onground retention tanks 141-R1O1 and 141-R1O2, which are also part of the 141-R1 retention tank system, do not have secondary containment; consequently, certification documentation for these tanks is not included in this assessment. A discussion of the onground tanks, however, is included in this report to provide a complete description of the 141-R1 retention tank system. 8 refs., 7 figs.

  4. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden

    1975-01-01

    The selection rules for the linear couplings between magnons and phonons propagating in the c direction of a simple basal-plane hcp ferromagnet are determined by general symmetry considerations. The acoustic-optical magnon-phonon interactions observed in the heavy-rare-earth metals have been expl...... by Liu. The coupled magnon—transverse-phonon system for the c direction of Tb is analyzed in detail, and the strengths of the couplings are deduced as a function of wave vector by combining the experimental studies with the theory....

  5. Spin Waves in Terbium

    DEFF Research Database (Denmark)

    Jensen, J.; Houmann, Jens Christian Gylden; Bjerrum Møller, Hans

    1975-01-01

    The energies of spin waves propagating in the c direction of Tb have been studied by inelastic neutron scattering, as a function of a magnetic field applied along the easy and hard directions in the basal plane, and as a function of temperature. From a general spin Hamiltonian, consistent...... with the symmetry, we deduce the dispersion relation for the spin waves in a basal-plane ferromagnet. This phenomenological spin-wave theory accounts for the observed behavior of the magnon energies in Tb. The two q⃗-dependent Bogoliubov components of the magnon energies are derived from the experimental results...

  6. Synthesis and crystal structure of terbium(III) meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}); Synthese und Kristallstruktur von Terbium(III)-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6})

    Energy Technology Data Exchange (ETDEWEB)

    Nikelski, Tanja; Schleid, Thomas [Institut fuer Anorganische Chemie der Universitaet Stuttgart (Germany)

    2003-06-01

    The terbium meta-oxoborate Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) is obtained as single crystals by the reaction of terbium, Tb{sub 4}O{sub 7} and TbCl{sub 3} with an excess of B{sub 2}O{sub 3} in gastight sealed platinum ampoules at 950 C after three weeks. The compound appears to be air- and water-resistant and crystallizes as long, thin, colourless needles which tend to growth-twinning due to their marked fibrous habit. The crystal structure of Tb(BO{sub 2}){sub 3} (orthorhombic, Pnma; a = 1598.97(9), b = 741.39(4), c = 1229.58(7) pm; Z = 16) contains strongly corrugated oxoborate layers {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} built of vertex-linked [BO{sub 4}]{sup 5-} tetrahedra (d(B-O) = 143 - 154 pm, and angsph;(O-B-O) = 102-115 ) which spread out parallel (100). The four crystallographically different Tb{sup 3+} cations all exhibit coordination numbers of eight towards the oxygen atoms (d(Tb-O) = 228-287 pm). The corresponding metal cation polyhedra [TbO{sub 8}]{sup 13+} too convene to layers (composition: {sub {infinity}}{sup 2}{l_brace}(Tb{sub 2}O{sub 11}){sup 16-}{r_brace}) which are likewise oriented parallel to the (100) plane. (Abstract Copyright [2003], Wiley Periodicals, Inc.) [German] Das Terbium-meta-Oxoborat Tb(BO{sub 2}){sub 3} ({identical_to} TbB{sub 3}O{sub 6}) entsteht einkristallin bei der Reaktion von Terbium, Tb{sub 4}O{sub 7} und TbCl{sub 3} mit einem Ueberschuss von B{sub 2}O{sub 3} in gasdicht verschlossenen Platinampullen nach drei Wochen bei 950 C. Die Verbindung ist luft- und wasserstabil und faellt in langen, duennen, farblosen Nadeln an, die aufgrund ihres ausgepraegt faserigen Habitus zur Wachstumsverzwillingung neigen. Die Kristallstruktur von Tb(BO{sub 2}){sub 3} (orthorhombisch, Pnma; a = 1598, 97(9), b = 741, 39(4), c = 1229, 58(7) pm; Z = 16) enthaelt parallel (100) verlaufende, stark gewellte Oxoborat-Schichten {sub {infinity}}{sup 2}{l_brace}(BO{sub 2}){sup -}{r_brace} aus

  7. 14 CFR 141.18 - Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances. 141.18 Section 141.18 Aeronautics and Space FEDERAL AVIATION... General § 141.18 Carriage of narcotic drugs, marijuana, and depressant or stimulant drugs or substances...

  8. 18 CFR 141.51 - FERC Form No. 714, Annual Electric Balancing Authority Area and Planning Area Report.

    Science.gov (United States)

    2010-04-01

    ..., Annual Electric Balancing Authority Area and Planning Area Report. 141.51 Section 141.51 Conservation of...) § 141.51 FERC Form No. 714, Annual Electric Balancing Authority Area and Planning Area Report. (a) Who... Policies Act, 16 U.S.C. 2602, operating a balancing authority area, and any group of electric utilities...

  9. 14 CFR Appendix J to Part 141 - Aircraft Type Rating Course, For Other Than an Airline Transport Pilot Certificate

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft Type Rating Course, For Other Than an Airline Transport Pilot Certificate J Appendix J to Part 141 Aeronautics and Space FEDERAL... PILOT SCHOOLS Pt. 141, App. J Appendix J to Part 141—Aircraft Type Rating Course, For Other Than an...

  10. 40 CFR 141.521 - What updated watershed control requirements must my unfiltered system implement to continue to...

    Science.gov (United States)

    2010-07-01

    ... requirements must my unfiltered system implement to continue to avoid filtration? 141.521 Section 141.521... People Additional Watershed Control Requirements for Unfiltered Systems § 141.521 What updated watershed control requirements must my unfiltered system implement to continue to avoid filtration? Your system must...

  11. Codon 141 polymorphisms of the ovine prion protein gene affect the phenotype of classical scrapie transmitted from goats to sheep.

    Science.gov (United States)

    Konold, Timm; Phelan, Laura J; Donnachie, Ben R; Chaplin, Melanie J; Cawthraw, Saira; González, Lorenzo

    2017-05-04

    A study to investigate transmission of classical scrapie via goat milk was carried out in sheep: firstly, lambs were challenged orally with goat scrapie brain homogenate to confirm transmission of scrapie from goats to sheep. In the second study phase, milk from scrapie-infected goats was fed to lambs. Lambs were selected according to their prion protein gene (PRNP) genotype, which was either VRQ/VRQ or ARQ/ARQ, with or without additional polymorphisms at codon 141 (FF141, LF141 or LL141) of the ovine PRNP. This report describes the clinical, pathological and molecular phenotype of goat scrapie in those sheep that progressed to clinical end-stage. Ten sheep (six VRQ/VRQ and four ARQ/ARQ, of which three FF141 and one LL141) challenged with one of two scrapie brain homogenates, and six pairs of sheep (ARQ, of which five LL141 and seven LF141) fed milk from six different goats, developed clinical disease, which was characterised by a pruritic (all VRQ/VRQ and LL141 sheep) or a non-pruritic form (all LF141 and FF141 sheep). Immunohistochemical (IHC) examination revealed that the pattern of intra- and extracellular accumulation of disease-associated prion protein in the brain was also dependent on PRNP polymorphisms at codon 141, which was similar in VRQ and LL141 sheep but different from LF141 and FF141 sheep. The influence of codon 141 was also seen in discriminatory Western blot (WB), with LF141 and FF141 sheep showing a bovine spongiform encephalopathy-like profile (diminished reactivity with P4 antibody) on brain tissue. However, discriminatory WB in lymphoid tissues, and IHC pattern and profile both in lymphoid and brain tissue was consistent with classical scrapie in all sheep. This study provided further evidence that the clinical presentation and the pathological and molecular phenotypes of scrapie in sheep are influenced by PRNP polymorphisms, particularly at codon 141. Differences in the truncation of disease-associated prion protein between LL141 sheep and

  12. An integrated logic system for time-resolved fluorescent "turn-on" detection of cysteine and histidine base on terbium (III) coordination polymer-copper (II) ensemble.

    Science.gov (United States)

    Xue, Shi-Fan; Lu, Ling-Fei; Wang, Qi-Xian; Zhang, Shengqiang; Zhang, Min; Shi, Guoyue

    2016-09-01

    Cysteine (Cys) and histidine (His) both play indispensable roles in many important biological activities. An enhanced Cys level can result in Alzheimer's and cardiovascular diseases. Likewise, His plays a significant role in the growth and repair of tissues as well as in controlling the transmission of metal elements in biological bases. Therefore, it is meaningful to detect Cys and His simultaneously. In this work, a novel terbium (III) coordination polymer-Cu (II) ensemble (Tb(3+)/GMP-Cu(2+)) was proposed. Guanosine monophosphate (GMP) can self-assemble with Tb(3+) to form a supramolecular Tb(3+) coordination polymer (Tb(3+)/GMP), which can be suited as a time-resolved probe. The fluorescence of Tb(3+)/GMP would be quenched upon the addition of Cu(2+), and then the fluorescence of the as-prepared Tb(3+)/GMP-Cu(2+) ensemble would be restored again in the presence of Cys or His. By incorporating N-Ethylmaleimide and Ni(2+) as masking agents, Tb(3+)/GMP-Cu(2+) was further exploited as an integrated logic system and a specific time-resolved fluorescent "turn-on" assay for simultaneously sensing His and Cys was designed. Meanwhile it can also be used in plasma samples, showing great potential to meet the need of practical application. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Synthesis and photoluminescence properties of cerium-doped terbium-yttrium aluminum garnet phosphor for white light-emitting diodes applications

    Science.gov (United States)

    Wang, Jun; Han, Tao; Lang, Tianchun; Tu, Mingjing; Peng, Lingling

    2015-11-01

    Cerium-doped terbium-yttrium aluminum garnet phosphors were synthesized using the solid-state reaction method. The crystalline phase, morphology, and photoluminescence properties were characterized by x-ray diffraction (XRD), scanning electron microscope (SEM), and fluorescence spectrophotometer, respectively. The XRD results indicate that with an increase of the amount of x (Tb3+), all of the samples have a pure garnet crystal structure without secondary phases. The SEM images reveal that the samples are composed of sphere-like crystallites, which exhibit different degrees of agglomeration. The luminescent properties of Ce ions in )Al5O12∶Ce0.1 have been studied, and it was found that the emission band shifted toward a longer wavelength. The redshift is attributed to the lowering of the 5d energy level centroid of Ce, which can be explained by the nephelauxetic effect and compression effect. These phosphors were coated on blue light-emitting diode (LED) chips to fabricate white light-emitting diodes (WLEDs), and their color-rendering indices, color temperatures, and luminous efficiencies were measured. As a consequence of the addition of Tb, the blue LED pumped )Al5O12∶Ce0.1 phosphors WLEDs showed good optical properties.

  14. Study on the fluorescent enhancement effect in terbium-gadolinium-protein-sodium dodecyl benzene sulfonate system and its application on sensitive detection of protein at nanogram level.

    Science.gov (United States)

    Sun, Changxia; Yang, Jinghe; Wu, Xia; Liu, Shufang; Su, Benyu

    2004-08-01

    The co-luminescence effect in a terbium-gadolinium-protein-sodium dodecyl benzene sulfonate (SDBS) system is reported here. Based on it, the sensitive quantitative analysis of protein at nanogram levels is established. The co-luminescence mechanism is studied using fluorescence, resonance light scattering (RLS), absorption spectroscopy and NMR measurement. It is considered that protein could be unfolded by SDBS, then a efficacious intramolecular fluorescent energy transfer occurs from unfolded protein to rare earth ions through SDBS acting as a "transfer bridge" to enhance the emission fluorescence of Tb3+ in this ternary complex of Tb-SDBS-BSA, where energy transfer from protein to SDBS by aromatic ring stacking is the most important step. Cooperating with the intramolecular energy transfer above is the intermolecular energy transfer between the simultaneous existing complexes of both Tb3+ and Gd3+. The fluorescence quantum yield is increased by an energy-insulating sheath, which is considered to be another reason for the resulting enhancement of the fluorescence. Förster theory is used to calculate the distribution of enhancing factors and has led to a greater understanding of the mechanisms of energy transfer.

  15. [Studies on luminescence properties of seven ternary complexes of terbium with 1,10-phenanthroline and benzoic acid and its derivatives].

    Science.gov (United States)

    Gao, Zhi-hua; Wang, Shu-ping; Liu, Cui-ge; Ma, Rui-xia; Wang, Rui-fen

    2006-04-01

    Seven ternary complexes of Tb(III) were synthesized with benzoic acid (BA), o-, m-, p-methylbenzoic acid (o-MBA, m-MBA, p-MBA), and o-, m-, p-methoxybenzoic acid (o-MOBA, m-MOBA, p-MOBA) as the first ligand, and 1,10-phenanthroline (phen) as the second ligand. The content of C, H and N were measured by using a Flash-EA model 1112 elemental analyzer. Excitation and luminescence spectra of the title solid complexes were recorded by using a Hitachi F-4500 fluorescence spectrophotometer at room temperature. The effects of different varieties and different positions of replacing benzoic acid as the first ligand on fluorescence properties of the ternary complexes of terbium were discussed. The results indicated that the intensity of 5D4-->7F6 (489 nm) and 5D4-->7F5 (545 nm) of substituting benzoic acid complexes was stronger than benzoic acid. Three ternary complexes of Tb(III) with o-, m-, p-methylbenzoic acid showed emission intensity in the consecution: Tb(o-MBA)3 phenMOBA)3phen x H2O>Tb(m-MOBA)3phen x H2O>Tb(p-MOBA)3 phen.

  16. 26 CFR 31.3401(a)(14)-1 - Group-term life insurance.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Group-term life insurance. 31.3401(a)(14)-1... SOURCE Collection of Income Tax at Source § 31.3401(a)(14)-1 Group-term life insurance. (a) The cost of group-term life insurance on the life of an employee is excepted from wages, and hence is not subject to...

  17. 40 CFR 141.61 - Maximum contaminant levels for organic contaminants.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for organic contaminants. 141.61 Section 141.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...-7 Diquat 0.02 (25) 145-73-3 Endothall 0.1 (26) 72-20-8 Endrin 0.002 (27) 1071-53-6 Glyphosate 0.7...

  18. Contrasting roles of the ABCG2 Q141K variant in prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Sobek, Kathryn M. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Cummings, Jessica L. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Critical Care Medicine, University of Pittsburgh, Pittsburgh, PA (United States); Bacich, Dean J. [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States); O’Keefe, Denise S., E-mail: OKeefeD@uthscsa.edu [Department of Urology, University of Pittsburgh School of Medicine, Pittsburgh, PA (United States); Department of Urology, University of Texas Health Science Center, San Antonio, TX (United States)

    2017-05-01

    ABCG2 is a membrane transport protein that effluxes growth-promoting molecules, such as folates and dihydrotestosterone, as well as chemotherapeutic agents. Therefore it is important to determine how variants of ABCG2 affect the transporter function in order to determine whether modified treatment regimens may be necessary for patients harboring ABCG2 variants. Previous studies have demonstrated an association between the ABCG2 Q141K variant and overall survival after a prostate cancer diagnosis. We report here that in patients with recurrent prostate cancer, those who carry the ABCG2 Q141K variant had a significantly shorter time to PSA recurrence post-prostatectomy than patients homozygous for wild-type ABCG2 (P=0.01). Transport studies showed that wild-type ABCG2 was able to efflux more folic acid than the Q141K variant (P<0.002), suggesting that retained tumoral folate contributes to the decreased time to PSA recurrence in the Q141K variant patients. In a seemingly conflicting study, it was previously reported that docetaxel-treated Q141K variant prostate cancer patients have a longer survival time. We found this may be due to less efficient docetaxel efflux in cells with the Q141K variant versus wild-type ABCG2. In human prostate cancer tissues, confocal microscopy revealed that all genotypes had a mixture of cytoplasmic and plasma membrane staining, with noticeably less staining in the two homozygous KK patients. In conclusion, the Q141K variant plays contrasting roles in prostate cancer: 1) by decreasing folate efflux, increased intracellular folate levels result in enhanced tumor cell proliferation and therefore time to recurrence decreases; and 2) in patients treated with docetaxel, by decreasing its efflux, intratumoral docetaxel levels and tumor cell drug sensitivity increase and therefore patient survival time increases. Taken together, these data suggest that a patient's ABCG2 genotype may be important when determining a personalized treatment

  19. Contrasting roles of the ABCG2 Q141K variant in prostate cancer.

    Science.gov (United States)

    Sobek, Kathryn M; Cummings, Jessica L; Bacich, Dean J; O'Keefe, Denise S

    2017-05-01

    ABCG2 is a membrane transport protein that effluxes growth-promoting molecules, such as folates and dihydrotestosterone, as well as chemotherapeutic agents. Therefore it is important to determine how variants of ABCG2 affect the transporter function in order to determine whether modified treatment regimens may be necessary for patients harboring ABCG2 variants. Previous studies have demonstrated an association between the ABCG2 Q141K variant and overall survival after a prostate cancer diagnosis. We report here that in patients with recurrent prostate cancer, those who carry the ABCG2 Q141K variant had a significantly shorter time to PSA recurrence post-prostatectomy than patients homozygous for wild-type ABCG2 (P=0.01). Transport studies showed that wild-type ABCG2 was able to efflux more folic acid than the Q141K variant (Ptime to PSA recurrence in the Q141K variant patients. In a seemingly conflicting study, it was previously reported that docetaxel-treated Q141K variant prostate cancer patients have a longer survival time. We found this may be due to less efficient docetaxel efflux in cells with the Q141K variant versus wild-type ABCG2. In human prostate cancer tissues, confocal microscopy revealed that all genotypes had a mixture of cytoplasmic and plasma membrane staining, with noticeably less staining in the two homozygous KK patients. In conclusion, the Q141K variant plays contrasting roles in prostate cancer: 1) by decreasing folate efflux, increased intracellular folate levels result in enhanced tumor cell proliferation and therefore time to recurrence decreases; and 2) in patients treated with docetaxel, by decreasing its efflux, intratumoral docetaxel levels and tumor cell drug sensitivity increase and therefore patient survival time increases. Taken together, these data suggest that a patient's ABCG2 genotype may be important when determining a personalized treatment plan. Copyright © 2017 Elsevier Inc. All rights reserved.

  20. Involvement of glycine 141 in substrate activation by enoyl-CoA hydratase.

    Science.gov (United States)

    Bell, A F; Wu, J; Feng, Y; Tonge, P J

    2001-02-13

    Raman spectroscopy has been used to investigate the structure of a substrate analogue, hexadienoyl-CoA (HD-CoA), bound to wild-type enoyl-CoA hydratase and G141P, a mutant in which a hydrogen bond to the substrate carbonyl has been removed. Raman spectra of isotopically labeled HD-CoAs, together with normal mode calculations, confirm the selective ground-state polarization of the enone fragment previously suggested to occur on binding to the wild-type enzyme [Tonge, P. J., Anderson, V. E., Fausto, R., Kim, M., Pusztai-Carey, M., and Carey, P. R. (1995) Biospectroscopy 1, 387-394]. In addition, Raman spectra of HD-CoA bound to the G141P mutant enzyme demonstrate that the hydrogen bond between the G141 amide NH group and the substrate carbonyl is critical for polarization and activity. Replacement of G141 with proline results in an approximately 10(6)-fold decrease in k(cat) and eliminates the ability of the enzyme to polarize the substrate analogue. As G141 is part of a consensus sequence in the enoyl-CoA hydratase superfamily, the results presented here provide direct evidence for the importance of the oxyanion hole in the reactions catalyzed by other family members.

  1. Self-diffusion coefficients of the trivalent f-element ion series in dilute and moderately dilute aqueous solutions: A comparative study between europium, gadolinium, terbium and berkelium

    Science.gov (United States)

    Rafik, Besbes; Noureddine, Ouerfelli; Abderabbou, Abdelmanef; Habib, Latrous

    2010-03-01

    We have continued the studies on the trivalent ions of the 4f and 5f elements. In this paper, we compare the transport properties (self-diffusion coefficient) of the trivalent aquo ions over two ranges of concentrations (0 — 2×10-3M) and (2×10-3 — 1.5M). Self-diffusion coefficients, D, of the trivalent f-element aquo ion series have been determined in aqueous background electrolytes of Gd(NO3)3 and Nd(ClO4)3, at pH=2.5 (HNO3, HClO4) and at 25°C using the open-end capillary method (O.E.C.M.). This method measures the transportation time of ions across a fixed distance. In this paper, we complete a measurement of self-diffusion coefficient for terbium. We optimized the pH to avoid hydrolysis, ion-pairing and complexation of the trivalent 4f and 5f ions. The variation of D versus √C is not linear for dilute solutions (0 — 2×10-3M) and quasi-linear in moderate concentrations (C<=1.5 M). Similar behavior was observed for Tb, as compared with those for Bk, Eu and Gd. We complete the comparison variation of D/D° versus √C for all studied 4f and 5f elements from concentration 0 to 1.5M and we obtained the same variation with √C for all studied elements. All 4f and 5f elements studied follow the Nernst-Hartley expression.

  2. Terbium-based time-gated Förster resonance energy transfer imaging for evaluating protein-protein interactions on cell membranes.

    Science.gov (United States)

    Lindén, Stina; Singh, Manish Kumar; Wegner, K David; Regairaz, Marie; Dautry, François; Treussart, François; Hildebrandt, Niko

    2015-03-21

    Fluorescence imaging of cells and subcellular compartments is an essential tool to investigate biological processes and to evaluate the development and progression of diseases. In particular, protein-protein interactions can be monitored by Förster resonance energy transfer (FRET) between two proximal fluorophores that are attached to specific recognition biomolecules such as antibodies. We investigated the membrane expression of E- and N-cadherins in three different cell lines used as model systems to study epithelial to mesenchymal transition (EMT) and a possible detection of circulating tumour cells (CTCs). EMT is a key process in cancer metastasis, during which epithelial markers (such as E-cadherin) are down-regulated in the primary tumour whereas mesenchymal markers (such as N-cadherin) are up-regulated, leading to enhanced cell motility, intravasation, and appearance of CTCs. Various FRET donor-acceptor pairs and protein recognition strategies were utilized, in which Lumi4-Tb terbium complexes (Tb) and different organic dyes were conjugated to several distinct E- and N-cadherin-specific antibodies. Pulsed excitation of Tb at low repetition rates (100 Hz) and time-gated (TG) imaging of both the Tb-donor and the dye-acceptor photoluminescence (PL) allowed efficient detection of the EMT markers as well as FRET in the case of sufficient donor-acceptor proximity. Efficient FRET was observed only between two E-cadherin-specific antibodies and further experiments indicated that these antibodies recognized the same E-cadherin molecule, suggesting a limited accessibility of cadherins when they are clustered at adherens junctions. The investigated Tb-to-dye FRET systems provided reduced photobleaching compared to the AlexaFluor 488-568 donor-acceptor pair. Our results demonstrate the applicability and advantages of Tb-based TG FRET for efficient and stable imaging of antibody-antibody interactions on different cell lines. They also reveal the limitations of

  3. A broad G protein-coupled receptor internalization assay that combines SNAP-tag labeling, diffusion-enhanced resonance energy transfer, and a highly emissive terbium cryptate acceptor

    Directory of Open Access Journals (Sweden)

    Angélique eLEVOYE

    2015-11-01

    Full Text Available Although G protein-coupled receptor (GPCR internalization has long been considered a major aspect of the desensitization process that tunes ligand responsiveness, internalization is also involved in receptor resensitization and signaling, as well as the ligand scavenging function of some atypical receptors. Internalization thus contributes to the diversity of GPCR-dependent signaling, and its dynamics and quantification in living cells has generated considerable interest. We developed a robust and sensitive assay to follow and quantify ligand-induced and constitutive GPCR internalization but also receptor recycling in living cells. This assay is based on diffusion-enhanced resonance energy transfer (DERET between cell surface GPCRs labeled with a luminescent terbium cryptate donor and a fluorescein acceptor present in the culture medium. GPCR internalization results in a quantifiable reduction of energy transfer. This method yields a high signal-to-noise ratio due to time-resolved measurements. For various GPCRs belonging to different classes, we demonstrated that constitutive and ligand-induced internalization could be monitored as a function of time and ligand concentration, thus allowing accurate quantitative determination of kinetics of receptor internalization but also half-maximal effective or inhibitory concentrations of compounds. In addition to its selectivity and sensitivity, we provided evidence that DERET-based internalization assay is particularly suitable for characterizing biased ligands. Furthermore, the determination of a Z’-factor value of 0.45 indicates the quality and suitability of DERET-based internalization assay for high-throughput screening (HTS of compounds that may modulate GPCRs internalization.

  4. Crystal structure of an eight-coordinate terbium(III ion chelated by N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (bbpen2− and nitrate

    Directory of Open Access Journals (Sweden)

    Thaiane Gregório

    2015-01-01

    Full Text Available The reaction of terbium(III nitrate pentahydrate in acetonitrile with N,N′-bis(2-hydroxybenzyl-N,N′-bis(pyridin-2-ylmethylethylenediamine (H2bbpen, previously deprotonated with triethylamine, produced the mononuclear compound [N,N′-bis(2-oxidobenzyl-κO-N,N′-bis(pyridin-2-ylmethyl-κNethylenediamine-κ2N,N′](nitrato-κ2O,O′terbium(III, [Tb(C28H28N4O2(NO3]. The molecule lies on a twofold rotation axis and the TbIII ion is eight-coordinate with a slightly distorted dodecahedral coordination geometry. In the symmetry-unique part of the molecule, the pyridine and benzene rings are both essentially planar and form a dihedral angle of 61.42 (7°. In the molecular structure, the N4O4 coordination environment is defined by the hexadentate bbpen ligand and the bidentate nitrate anion. In the crystal, a weak C—H...O hydrogen bond links molecules into a two-dimensional network parallel to (001.

  5. An IR-Selected Galaxy Cluster at z = 1.41

    OpenAIRE

    Stanford, S. A.; Eisenhardt, Peter R.; Brodwin, Mark; Gonzalez, Anthony H.; Stern, Daniel; Jannuzi, Buell; Dey, Arjun; Brown, Michael J. I.; McKenzie, Eric; Elston, Richard

    2005-01-01

    We report the discovery of a galaxy cluster at z = 1.41. ISCS J143809+341419 was found in the Spitzer/IRAC Shallow Survey of the Bootes field in the NOAO Deep Wide-Field Survey carried out by IRAC. The cluster candidate was initially identified as a high density region of objects with photometric redshifts in the range 1.3 < z < 1.5. Optical spectroscopy of a limited number of objects in the region shows that 5 galaxies within a ~120 arcsec diameter region lie at z = 1.41 +/- 0.01. Most of th...

  6. 26 CFR 1.141-3 - Definition of private business use.

    Science.gov (United States)

    2010-04-01

    ... TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141... other arrangement that conveys special legal entitlements for beneficial use of bond proceeds or of... under the arrangement is redetermined at generally applicable, fair market value rates that are in...

  7. 29 CFR 780.141 - Practices must relate to farming operations on the particular farm.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Practices must relate to farming operations on the... UNDER THE FAIR LABOR STANDARDS ACT General Scope of Agriculture âsuch Farming Operationsâ-on the Farm § 780.141 Practices must relate to farming operations on the particular farm. “Practices * * * performed...

  8. Cdc42 inhibitor ML141 enhances G-CSF-induced hematopoietic stem and progenitor cell mobilization.

    Science.gov (United States)

    Chen, Chong; Song, Xuguang; Ma, Sha; Wang, Xue; Xu, Jie; Zhang, Huanxin; Wu, Qingyun; Zhao, Kai; Cao, Jiang; Qiao, Jianlin; Sun, Xiaoshen; Li, Depeng; Zeng, Lingyu; Li, Zhengyu; Xu, Kailin

    2015-01-01

    G-CSF is the most often used agent in clinical hematopoietic stem and progenitor cell (HSPC) mobilization. However, in about 10 % of patients, G-CSF does not efficiently mobilize HSPC in clinically sufficient amounts. Cdc42 activity is involved in HSPC mobilization. In the present study, we explore the impact of Cdc42 inhibitor ML141 on G-CSF-mediated HSPC mobilization in mice. We found that the use of ML141 alone only triggered modest HSPC mobilization effect in mice. However, combination of G-CSF and ML141 significantly promoted HPSC counts and colony forming units in peripheral blood, as compared to mice treated with G-CSF alone. ML141 did not significantly alter the levels of SDF-1 and MMP-9 in the bone marrow, when used alone or in combination with G-CSF. We also found that G-CSF administration significantly increases the level of GTP-bound Cdc42, but does not alter the expression of Cdc42 in the bone marrow. Our data indicate that the Cdc42 signal is a negative regulator in G-CSF-mediated HSPC mobilization, and that inhibition of the Cdc42 signal efficiently improves mobilization efficiency. These findings may provide a new strategy for efficient HSPC mobilization, especially in patients with poor G-CSF response.

  9. 19 CFR 141.102 - When deposit of estimated duties, estimated taxes, or both not required.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false When deposit of estimated duties, estimated taxes... Estimated Duties § 141.102 When deposit of estimated duties, estimated taxes, or both not required. Entry or... duties, or estimated taxes, or both, as specifically noted: (a) Cigars and cigarettes. A qualified dealer...

  10. 40 CFR 141.87 - Monitoring requirements for water quality parameters.

    Science.gov (United States)

    2010-07-01

    ... § 141.87 Monitoring requirements for water quality parameters. All large water systems, and all small- and medium-size systems that exceed the lead or copper action level shall monitor water quality... methods. (i) Tap samples shall be representative of water quality throughout the distribution system...

  11. 37 CFR 1.141 - Different inventions in one national application.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Different inventions in one... Provisions Joinder of Inventions in One Application; Restriction § 1.141 Different inventions in one national application. (a) Two or more independent and distinct inventions may not be claimed in one national...

  12. 40 CFR 141.204 - Tier 3 Public Notice-Form, manner, and frequency of notice.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Tier 3 Public Notice-Form, manner, and... Drinking Water Violations § 141.204 Tier 3 Public Notice—Form, manner, and frequency of notice. (a) Which violations or situations require a Tier 3 public notice? Table 1 of this section lists the violation...

  13. 40 CFR 141.717 - Pre-filtration treatment toolbox components.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Pre-filtration treatment toolbox... Cryptosporidium Requirements for Microbial Toolbox Components § 141.717 Pre-filtration treatment toolbox... softening stages prior to filtration. Both softening stages must treat the entire plant flow taken from a...

  14. 40 CFR 141.715 - Microbial toolbox options for meeting Cryptosporidium treatment requirements.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced... source water monitoring must sample the well to determine bin classification and are not eligible for... 0.5-log factor of safety. Specific criteria are in § 141.719(a). (11) Membrane filtration Log credit...

  15. 42 CFR 410.141 - Outpatient diabetes self-management training.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Outpatient diabetes self-management training. 410...-Management Training and Diabetes Outcome Measurements § 410.141 Outpatient diabetes self-management training... Part B covers outpatient diabetes self-management training for a beneficiary who has been diagnosed...

  16. miR-141-3p inhibits human stromal (mesenchymal) stem cell proliferation and differentiation

    DEFF Research Database (Denmark)

    Qiu, Weimin; Kassem, Moustapha

    2014-01-01

    Wnt signaling determines human stromal (mesenchymal) stem cell (hMSC) differentiation fate into the osteoblast or adipocyte lineage. microRNAs (miRNAs) are small RNA molecules of 21-25 nucleotides that regulate many aspects of osteoblast biology. Thus, we examined miRNAs regulated by Wnt signaling...... activity, gene expression and in vitro mineralized matrix formation. Bioinformatic studies, Western blot analysis and 3'UTR reporter assay demonstrated that cell division cycle 25A (CDC25A) is a direct target of miR-141-3p. siRNA-mediated knock-down of CDC25A inhibited hMSC proliferation and osteoblast...... in hMSC. We identified miRNA (miR)-141-3p as a Wnt target which in turn inhibited Wnt signaling. Moreover, miR-141-3p inhibited hMSC proliferation by arresting cells at the G1 phase of the cell cycle. miR-141-3p inhibited osteoblast differentiation of hMSC as evidenced by reduced alkaline phosphatase...

  17. 30 CFR 14.1 - Purpose, effective date for approval holders.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Purpose, effective date for approval holders... TESTING, EVALUATION, AND APPROVAL OF MINING PRODUCTS REQUIREMENTS FOR THE APPROVAL OF FLAME-RESISTANT CONVEYOR BELTS General Provisions § 14.1 Purpose, effective date for approval holders. This Part...

  18. 26 CFR 1.141-9 - Unrelated or disproportionate use test.

    Science.gov (United States)

    2010-04-01

    ... 141(b)(3) (the unrelated or disproportionate use test), an issue meets the private business tests if the amount of private business use and private security or payments attributable to unrelated or disproportionate private business use exceeds 5 percent of the proceeds of the issue. For this purpose, the private...

  19. 34 CFR 403.141 - What are the application requirements for the State Assistance for Vocational Education Support...

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false What are the application requirements for the State Assistance for Vocational Education Support Programs by Community-Based Organizations? 403.141 Section 403... Education Support Programs by Community-Based Organizations § 403.141 What are the application requirements...

  20. 40 CFR 142.64 - Variances and exemptions from the requirements of part 141, subpart H-Filtration and Disinfection.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Variances and exemptions from the requirements of part 141, subpart H-Filtration and Disinfection. 142.64 Section 142.64 Protection of...—Filtration and Disinfection. (a) No variances from the requirements in part 141, subpart H are permitted. (b...

  1. 18 CFR 141.400 - FERC Form No. 3-Q, Quarterly financial report of electric utilities, licensees, and natural gas...

    Science.gov (United States)

    2010-04-01

    ..., Quarterly financial report of electric utilities, licensees, and natural gas companies. 141.400 Section 141..., licensees, and natural gas companies. (a) Prescription. The quarterly report of electric utilities, licensees, and natural gas companies, designated as FERC Form No. 3-Q, is prescribed for the reporting...

  2. 19 CFR 141.56 - Single entry summary for multiple transportation entries consigned to the same consignee.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Single entry summary for multiple transportation entries consigned to the same consignee. 141.56 Section 141.56 Customs Duties U.S. CUSTOMS AND BORDER... transportation entries consigned to the same consignee. (a) Requirement. Port directors may accept one entry...

  3. 26 CFR 31.3121(b)(14)-1 - Services in delivery or distribution of newspapers, shopping news, or magazines.

    Science.gov (United States)

    2010-04-01

    ... newspapers, shopping news, or magazines. 31.3121(b)(14)-1 Section 31.3121(b)(14)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) EMPLOYMENT TAXES AND COLLECTION OF INCOME TAX AT... distribution of newspapers, shopping news, or magazines. (a) Services of individuals under age 18. Services...

  4. Genomics and genetics of Sulfolobus islandicus LAL14/1, a model hyperthermophilic archaeon

    DEFF Research Database (Denmark)

    Jaubert, Carole; Danioux, Chloë; Oberto, Jacques

    2013-01-01

    The 2 465 177 bp genome of Sulfolobus islandicus LAL14/1, host of the model rudivirus SIRV2, was sequenced. Exhaustive comparative genomic analysis of S. islandicus LAL14/1 and the nine other completely sequenced S. islandicus strains isolated from Iceland, Russia and USA revealed a highly synten...

  5. Gene-Targeted Mice with the Human Troponin T R141W Mutation Develop Dilated Cardiomyopathy with Calcium Desensitization.

    Directory of Open Access Journals (Sweden)

    Mohun Ramratnam

    Full Text Available Most studies of the mechanisms leading to hereditary dilated cardiomyopathy (DCM have been performed in reconstituted in vitro systems. Genetically engineered murine models offer the opportunity to dissect these mechanisms in vivo. We generated a gene-targeted knock-in murine model of the autosomal dominant Arg141Trp (R141W mutation in Tnnt2, which was first described in a human family with DCM. Mice heterozygous for the mutation (Tnnt2R141W/+ recapitulated the human phenotype, developing left ventricular dilation and reduced contractility. There was a gene dosage effect, so that the phenotype in Tnnt2R141W/+mice was attenuated by transgenic overexpression of wildtype Tnnt2 mRNA transcript. Male mice exhibited poorer survival than females. Biomechanical studies on skinned fibers from Tnnt2R141W/+ hearts showed a significant decrease in pCa50 (-log[Ca2+] required for generation of 50% of maximal force relative to wildtype hearts, indicating Ca2+ desensitization. Optical mapping studies of Langendorff-perfused Tnnt2R141W/+ hearts showed marked increases in diastolic and peak systolic intracellular Ca2+ ([Ca2+]i, and prolonged systolic rise and diastolic fall of [Ca2+]i. Perfused Tnnt2R141W/+ hearts had slower intrinsic rates in sinus rhythm and reduced peak heart rates in response to isoproterenol. Tnnt2R141W/+ hearts exhibited a reduction in phosphorylated phospholamban relative to wildtype mice. However, crossing Tnnt2R141W/+ mice with phospholamban knockout (Pln-/- mice, which exhibit increased Ca2+ transients and contractility, had no effect on the DCM phenotype. We conclude that the Tnnt2 R141W mutation causes a Ca2+ desensitization and mice adapt by increasing Ca2+-transient amplitudes, which impairs Ca2+ handling dynamics, metabolism and responses to β-adrenergic activation.

  6. MIR141 expression differentiates Hashimoto Thyroiditis from PTC and benign thyrocytes in Irish archival thyroid tissues

    Directory of Open Access Journals (Sweden)

    Emma R Dorris

    2012-09-01

    Full Text Available MicroRNAs (miRNAs are small non-coding RNAs approximately 22 nucleotides in length that function as regulators of gene expression. Dysregulation of miRNAs has been associated with initiation and progression of oncogenesis in humans. Our group has previously described a unique miRNA expression signature, including the MIR200 family member MIR141, which can differentiate papillary thyroid cancer (PTC cell lines from a control thyroid cell line. An investigation into the expression of MIR141 in a series of archival thyroid malignancies (n=140; classic PTC, follicular variant PTC, follicular thyroid carcinoma (FTC, Hashimoto thyroiditis (HT, or control thyrocytes was performed. Each cohort had a minimum of 20 validated samples surgically excised within the period 1980 - 2009. A subset of the HT and cPTC cohorts (n=3 were also analysed for expression of TGFβR1, a key member of the TGFβ pathway and known target of MIR141. Laser capture microdissection was used to specifically dissect target cells from formalin-fixed paraffin-embedded archival tissue. Thyrocyte- and lymphocyte-specific markers (TSHR and LSP1 respectively confirmed the integrity of cell populations in the HT cohort. RNA was extracted and quantitative RT-PCR was performed using comparative CT (ΔΔCT analysis. Statistically significant (p<0.05 differential expression profiles of MIR141 were found between tissue types. HT samples displayed significant downregulation of MIR141 compared to both classic PTC and control thyrocytes. Furthermore, TGFβR1 expression was detected in cPTC samples but not in HT thyrocytes. It is postulated that the down-regulation of this miRNA is due, at least in part, to its involvement in regulating the TGFβ pathway. This pathway is exquisitely involved in T-cell autoimmunity and has previously been linked with HT. In conclusion, HT epithelium can be distinguished from cPTC epithelium and control epithelium based on the relative expression of MIR141.

  7. Selective Sensing of Fe(3+) and Al(3+) Ions and Detection of 2,4,6-Trinitrophenol by a Water-Stable Terbium-Based Metal-Organic Framework.

    Science.gov (United States)

    Cao, Li-Hui; Shi, Fang; Zhang, Wen-Min; Zang, Shuang-Quan; Mak, Thomas C W

    2015-10-26

    A water-stable luminescent terbium-based metal-organic framework (MOF), {[Tb(L1 )1.5 (H2 O)]⋅3 H2 O}n (Tb-MOF), with rod-shaped secondary building units (SBUs) and honeycomb-type tubular channels has been synthesized and structurally characterized by single-crystal X-ray diffraction. The high green emission intensity and the microporous nature of the Tb-MOF indicate that it can potentially be used as a luminescent sensor. In this work, we show that Tb-MOF can selectively sense Fe(3+) and Al(3+) ions from mixed metal ions in water through different detection mechanisms. In addition, it also exhibits high sensitivity for 2,4,6-trinitrophenol (TNP) in the presence of other nitro aromatic compounds in aqueous solution by luminescence quenching experiments. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Picomolar traces of americium(III) introduce drastic changes in the structural chemistry of terbium(III). A break in the ''gadolinium break''

    Energy Technology Data Exchange (ETDEWEB)

    Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)

    2017-10-16

    The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Observation of high-spin oblate band structures in Pm141

    Science.gov (United States)

    Gu, L.; Zhu, S. J.; Wang, J. G.; Yeoh, E. Y.; Xiao, Z. G.; Zhang, S. Q.; Meng, J.; Zhang, M.; Liu, Y.; Ding, H. B.; Xu, Q.; Zhu, L. H.; Wu, X. G.; He, C. Y.; Li, G. S.; Wang, L. L.; Zheng, Y.; Zhang, B.

    2011-06-01

    The high-spin states of Pm141 have been investigated through the reaction Te126(F19,4n) at a beam energy of 90 MeV. A previous level scheme has been updated with spins up to 49/2ℏ. Six collective bands at high spins are newly observed. Based on the systematic comparison, one band is proposed as a decoupled band; two bands with strong ΔI=1 M1 transitions inside the bands are suggested as the oblate bands with γ ~-60°; three other bands with large signature splitting have been proposed with the oblate-triaxial deformation with γ~ -90°. The triaxial n-particle-n-hole particle rotor model calculations for one of the oblate bands in Pm141 are in good agreement with the experimental data. The other characteristics for these bands have been discussed.

  10. DEGB LOCA ECS power limit recommendation for the K-14.1 subcycle. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Smith, F.G. III; Aleman, S.E.

    1991-04-01

    This report documents assembly deposited power limits and the corresponding effluent temperature limits recommended for operating the K-14.1 subcycle to ensure sufficient cooling of reactor assemblies during the ECS phase of a Double Ended Guillotine Break (DEGSS) Loss of Coolant Accident (LOCA). The ECS LOCA effluent temperature limits are computed for each flowzone of the K-14.1 charge. The recommended overall DEGB LOCA ECS power limit is 1515 MW or about 63.1% of the historical full reactor power limit (assumed to be 2400-MW) for Mark 22 assemblies. The design basis accident is a break in the plenum inlet line where the AC pump motors not tripped.

  11. A new probe for tracking the presence of E141i food colorant

    OpenAIRE

    Pérez Gálvez, Antonio; Ríos, José Julián; Roca, María

    2015-01-01

    © 2014 Elsevier Ltd. HPLC/APCI-MS was applied to the characterization of copper pyropheophytin a, the main chlorophyllic derivative present in E141i, a marketed copper chlorophyll mixture used legally for addition of green hues in food products. Exceptionally, its use is banned in Europe and America for fats and oils and consequently, the characterization of copper pyropheophytin a by HPLC/MS is critical for olive oil control adulteration and also essential for the detection of this colorant ...

  12. The structure of cytomegalovirus immune modulator UL141 highlights structural Ig-fold versatility for receptor binding

    Energy Technology Data Exchange (ETDEWEB)

    Nemčovičová, Ivana [La Jolla Institute for Allergy and Immunology, 9420 Athena Circle, La Jolla, CA 92037 (United States); Slovak Academy of Sciences, Dúbravská cesta 9, SK 84505 Bratislava (Slovakia); Zajonc, Dirk M., E-mail: dzajonc@liai.org [La Jolla Institute for Allergy and Immunology, 9420 Athena Circle, La Jolla, CA 92037 (United States)

    2014-03-01

    The crystal structure of Human cytomegalovirus immune modulator UL141 was solved at 3.25 Å resolution. Here, a detailed analysis of its intimate dimerization interface and the biophysical properties of its receptor (TRAIL-R2 and CD155) binding interactions are presented. Natural killer (NK) cells are critical components of the innate immune system as they rapidly detect and destroy infected cells. To avoid immune recognition and to allow long-term persistence in the host, Human cytomegalovirus (HCMV) has evolved a number of genes to evade or inhibit immune effector pathways. In particular, UL141 can inhibit cell-surface expression of both the NK cell-activating ligand CD155 as well as the TRAIL death receptors (TRAIL-R1 and TRAIL-R2). The crystal structure of unliganded HCMV UL141 refined to 3.25 Å resolution allowed analysis of its head-to-tail dimerization interface. A ‘dimerization-deficient’ mutant of UL141 (ddUL141) was further designed, which retained the ability to bind to TRAIL-R2 or CD155 while losing the ability to cross-link two receptor monomers. Structural comparison of unliganded UL141 with UL141 bound to TRAIL-R2 further identified a mobile loop that makes intimate contacts with TRAIL-R2 upon receptor engagement. Superposition of the Ig-like domain of UL141 on the CD155 ligand T-cell immunoreceptor with Ig and ITIM domains (TIGIT) revealed that UL141 can potentially engage CD155 similar to TIGIT by using the C′C′′ and GF loops. Further mutations in the TIGIT binding site of CD155 (Q63R and F128R) abrogated UL141 binding, suggesting that the Ig-like domain of UL141 is a viral mimic of TIGIT, as it targets the same binding site on CD155 using similar ‘lock-and-key’ interactions. Sequence alignment of the UL141 gene and its orthologues also showed conservation in this highly hydrophobic (L/A)X{sub 6}G ‘lock’ motif for CD155 binding as well as conservation of the TRAIL-R2 binding patches, suggesting that these host

  13. How angry was the ancient Greek god Poseidon in 141/142 A.D.?

    Science.gov (United States)

    Şahin, Murat; Elitez, İrem; Yaltırak, Cenk

    2017-04-01

    Poseidon, also known as "God of Sea" or "Earth-Shaker", was one of the Olympian's Gods in the Greek mythology. It was a common belief that Poseidon shows his rage by tsunamis and earthquakes. So, the how angry Poseidon in 141/142 A.D.? According to the historical records, the whole area including Lycian cities and Rhodes was affected by a destructive earthquake and a following tsunami in 141/142. After these events the emperor of Greeks made donations to the Lycian cities and Rhodes for their recovery with relative to the damage and importance of the city. 141/142 earthquake had a considerable amount of damage on 28 ancient cities. With respect to the historical catalogues, this earthquake had at least 9-10 intensity and caused a tsunami in Rhodes and harbour of the ancient city of Patara. In this study, we try to restrict the magnitude of the event by using PGA (peak ground acceleration), MMI (Modified Mercalli Intensity), tsunami modelling and amount of aids. Our preliminary results suggest that this event has to be bigger or equal magnitude 8.

  14. Freon R141b flow boiling in silicon microchannel heat sinks: experimental investigation

    Science.gov (United States)

    Dong, Tao; Yang, Zhaochu; Bi, Qincheng; Zhang, Yulong

    2008-01-01

    This paper presents experimental investigations on Freon R141b flow boiling in rectangular microchannel heat sinks. The main aim is to provide an appropriate working fluid for microchannel flow boiling to meet the cooling demand of high power electronic devices. The microchannel heat sink used in this work contains 50 parallel channels, with a 60 × 200 ( W × H) μm cross-section. The flow boiling heat transfer experiments are performed with R141b over mass velocities ranging from 400 to 980 kg/(m2 s) and heat flux from 40 to 700 kW/m2, and the outlet pressure satisfying the atmospheric condition. The fluid flow-rate, fluid inlet/outlet temperature, wall temperature, and pressure drop are measured. The results indicate that the mean heat transfer coefficient of R141b flow boiling in present microchannel heat sinks depends heavily on mass velocity and heat flux and can be predicted by Kandlikar’s correlation (Heat Transf Eng 25(3):86 93, 2004). The two-phase pressure drop keeps increasing as mass velocity and exit vapor quality rise.

  15. A141

    Directory of Open Access Journals (Sweden)

    H. Davtyan

    2015-11-01

    Full Text Available The aim of this study was to investigate the quantitative changes in the phospholipid (PL content of peripheral blood mononuclear cells (MNC, plasma membrane (PM, fraction in breast (BC and cervical cancers (CC compared to normal levels. Eight PL fractions were identified by TLC method in the PM of MNC, namely: lysophosphatidylcholines (LPC, sphingomyelins (SPM, phosphatidylcholines (PC, phosphatidylinositols (PI, phosphatidylserines (PS, phosphatidylethanolamines (PE, phosphatidic acids (PA and diphosphatidylglycerols (DPG. Data obtained indicate that all PLs, quantified in this study, were significantly altered in blood MNC of cancer patients compared to healthy individuals. It was shown that compared to norm levels of LPC, PC, PE fractions were reliable increased in BC and CC, when PI, PS, PA – decreased. Notably, regular disturbances reveled in BC and CC were identical with those observed earlier in chronic lymphocytic leukemia and also distinctly individual for each patient. We conclude that alterations in PLs content of crude MNC PMs have been associated with disease pathology and similarly involved in the onset and evolution of diverse forms of cancer. These data can be useful for prospective biomarkers selection and cancer definition as well as for discovery of new personalized treatment modes.

  16. MicroRNA-141 is downregulated in human renal cell carcinoma and regulates cell survival by targeting CDC25B

    Directory of Open Access Journals (Sweden)

    Yu XY

    2013-04-01

    Full Text Available Xiu-yue Yu, Zhe Zhang, Jiao Liu, Bo Zhan, Chui-ze Kong Department of Urology, the First Hospital of China Medical University, Shenyang, People’s Republic of China Background/objective: MicroRNAs (miRNAs are small noncoding RNAs (ribonucleic acids, approximately 22 nucleotides in length, that function as regulators of gene expression. Dysregulation of miRNAs has been associated with the initiation and progression of oncogenesis in humans. The cell division cycle (CDC25 phosphatases are important regulators of the cell cycle. Their abnormal expression detected in a number of tumors implies that their dysregulation is involved in malignant transformation. Methods: Using miRNA target prediction software, we found that miR-141 could target the 3´ untranslated region (3´UTR sequence of CDC25B. To shed light on the role of miR-141 in renal cell carcinogenesis, the expression of miR-141 was examined by real-time polymerase chain reaction (RT-PCR in renal cell carcinoma and normal tissues. The impact of miR-141 re-expression on 769-P cells was analyzed using 3-(4,5-Dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT and colony-forming assay. A luciferase reporter assay was applied to prove the functionality of the miR-141 binding site. Results: miR-141 is significantly downregulated in renal cell carcinoma. miR-141 re-expression suppressed cell growth in 769-P cells. Luciferase expression from a reporter vector containing the CDC25B-3'UTR was decreased when this construct was transfected with miR-141 in 769-P cells. The overexpression of miR-141 suppressed the endogenous CDC25B protein level in 769-P cells. Conclusion: For the first time, we demonstrated that CDC25B is a direct target of miR-141 in renal cell carcinoma. The transcriptional loss of miR-141 and the resultant increase in CDC25B expression facilitates increased genomic instability at an early stage of renal cell carcinoma development. Keywords: carcinogenesis, 769-P, target, Micro

  17. Invasion and metastasis ability of renal cancer cell strains 786-0: under the influence of miR-141.

    Science.gov (United States)

    Xu, Y; Lv, L N; Guo, Z Y; Zhang, W

    2016-01-01

    This study aimed to explore the invasion and metastasis ability of miR-141 in 786-0 renal cancer tissue cells, as well as identify the key function of endogenous miR-141 in adjustment and control of malignant activities of renal cancer. The renal cancer cell strain with overexpression of miR-141 and its control renal cancer cell line were constructed; methyl thiazolyl tetrazolium (MTT) assay was adopted to measure proliferation of renal cancer cells; Transwell assay was performed to measure the invasion and metastasis ability of cells; MTT assay and fluorescence activated cell sorting (FACS) were used for measurement of cell apoptosis and drug susceptibility. Results indicated that the expression of miR-141 in 786-0 cells could be significantly increased 400-fold by slow viruses that contained miR-141; moreover, c omprehensive functions showed that miR-141 inhibited the invasion and metastasis ability of renal cancer cells to a great extent (p less than 0.001), partially inhibited cell growth (p less than 0.05) and also induced cell cycle to be arrested in G0/G1 as well as reducing the number of cells in S phase (DNA replicative phase). Moreover, miR-141 could not induce morphologic changes of renal cancer cells, had no direct stimulating effect on cell apoptosis and could not improve the drug susceptibility of renal cancer cells to drugs such as cis-Dichlorodiamineplatinum (DDP), 5-fluorouracil (5-FU) and tumor-related apoptosis-inducing ligand (TRAIL). In conclusion, miR-141 can be considered an important cancer suppressor gene of renal cancer by inhibiting proliferation and metastasis of renal cancer cells.

  18. Sodium terbium(III polyphosphate

    Directory of Open Access Journals (Sweden)

    Abdelghani Oudahmane

    2010-04-01

    Full Text Available Single crystals of the title compound, NaTb(PO34, were obtained by solid-state reaction. This compound belongs to type II of long-chain polyphosphates with the general formula AIBIII(PO34. It is isotypic with the NaNd(PO34 and NaEr(PO34 homologues. The crystal structure is built up of infinite crenelated chains of corner-sharing PO4 tetrahedra with a repeating unit of four tetrahedra. These chains, extending parallel to [100], are linked by isolated TbO8 square antiprisms, forming a three-dimensional framework. The Na+ ions are located in channels running along [010] and are surrounded by six oxygen atoms in a distorted octahedral environment within a cut-off distance <2.9 Å.

  19. Eclipse project QF-106 and C-141A takeoff on first tethered flight December 20, 1997

    Science.gov (United States)

    1997-01-01

    TOW ROPE TAKEOFF - The Kelly Space & Technology (KST)/USAF Eclipse project's modified QF-106 and a USAF C-141A takeoff for the project's first tethered flight on December 20, 1997. The successful 18-minute-long flight reached an altitude of 10,000 feet. NASA's Dryden Flight Research Center, Edwards, California, hosted the project, providing engineering and facility support as well as the project pilot. In 1997 and 1998, the Dryden Flight Research Center at Edwards, California, supported and hosted a Kelly Space & Technology, Inc. project called Eclipse, which sought to demonstrate the feasibility of a reusable tow-launch vehicle concept. The project goal was to successfully tow, inflight, a modified QF-106 delta-wing aircraft with an Air Force C-141A transport aircraft. This would demonstrate the possibility of towing and launching an actual launch vehicle from behind a tow plane. Dryden was the responsible test organization and had flight safety responsibility for the Eclipse project. Dryden provided engineering, instrumentation, simulation, modification, maintenance, range support, and research pilots for the test program. The Air Force Flight Test Center (AFFTC), Edwards, California, supplied the C-141A transport aircraft and crew and configured the aircraft as needed for the tests. The AFFTC also provided the concept and detail design and analysis as well as hardware for the tow system and QF-106 modifications. Dryden performed the modifications to convert the QF-106 drone into the piloted EXD-01 (Eclipse eXperimental Demonstrator-01) experimental aircraft. Kelly Space & Technology hoped to use the results gleaned from the tow test in developing a series of low-cost, reusable launch vehicles. These tests demonstrated the validity of towing a delta-wing aircraft having high wing loading, validated the tow simulation model, and demonstrated various operational procedures, such as ground processing of in-flight maneuvers and emergency abort scenarios.

  20. Purification and characterization of extracellular laccase secreted by Pleurotus sajor-caju MTCC 141.

    Science.gov (United States)

    Sahay, R; Yadav, R S S; Yadav, K D S

    2008-12-01

    The effect of lignin containing natural substrates corn-cob, coir-dust, saw-dust, wheat straw and bagasse particles on the extracellular secretion of laccase in the liquid culture growth medium of Pleurotus sajor-caju MTCC 141 has been studied. The culture conditions for maximum secretion of laccase by Pleurotus sajor-caju MTCC 141 have been optimized. Homogeneous preparation of laccase from the culture filtrate of the fungus has been achieved using ammonium sulphate precipitation, anion exchange chromatography on DEAE and gel filtration chromatography on Sephadex G-100. The purified enzyme preparation gave a single protein band in SDS-PAGE analysis indicating a molecular weight of 90 kD. The enzymatic characteristics Km, k(cat), pH and temperature optima of the purified laccase have been determined using 2, 6-dimethoxyphenol as the substrate and have been found to be 35 micromol/L, 0.30 min(-1), 4.5 and 37 degrees C respectively. The Km values for the other substrate like catechol, m-cresol, pyrogallol and syringaldazine have also been determined which were found to be 216 micromol/L, 380 micromol/L, 370 micromol/L and 260 micromol/L respectively.

  1. PHIP - a novel candidate breast cancer susceptibility locus on 6q14.1.

    Science.gov (United States)

    Jiao, Xiang; Aravidis, Christos; Marikkannu, Rajeshwari; Rantala, Johanna; Picelli, Simone; Adamovic, Tatjana; Liu, Tao; Maguire, Paula; Kremeyer, Barbara; Luo, Liping; von Holst, Susanna; Kontham, Vinaykumar; Thutkawkorapin, Jessada; Margolin, Sara; Du, Quan; Lundin, Johanna; Michailidou, Kyriaki; Bolla, Manjeet K; Wang, Qin; Dennis, Joe; Lush, Michael; Ambrosone, Christine B; Andrulis, Irene L; Anton-Culver, Hoda; Antonenkova, Natalia N; Arndt, Volker; Beckmann, Matthias W; Blomqvist, Carl; Blot, William; Boeckx, Bram; Bojesen, Stig E; Bonanni, Bernardo; Brand, Judith S; Brauch, Hiltrud; Brenner, Hermann; Broeks, Annegien; Brüning, Thomas; Burwinkel, Barbara; Cai, Qiuyin; Chang-Claude, Jenny; Couch, Fergus J; Cox, Angela; Cross, Simon S; Deming-Halverson, Sandra L; Devilee, Peter; Dos-Santos-Silva, Isabel; Dörk, Thilo; Eriksson, Mikael; Fasching, Peter A; Figueroa, Jonine; Flesch-Janys, Dieter; Flyger, Henrik; Gabrielson, Marike; García-Closas, Montserrat; Giles, Graham G; González-Neira, Anna; Guénel, Pascal; Guo, Qi; Gündert, Melanie; Haiman, Christopher A; Hallberg, Emily; Hamann, Ute; Harrington, Patricia; Hooning, Maartje J; Hopper, John L; Huang, Guanmengqian; Jakubowska, Anna; Jones, Michael E; Kerin, Michael J; Kosma, Veli-Matti; Kristensen, Vessela N; Lambrechts, Diether; Le Marchand, Loic; Lubinski, Jan; Mannermaa, Arto; Martens, John W M; Meindl, Alfons; Milne, Roger L; Mulligan, Anna Marie; Neuhausen, Susan L; Nevanlinna, Heli; Peto, Julian; Pylkäs, Katri; Radice, Paolo; Rhenius, Valerie; Sawyer, Elinor J; Schmidt, Marjanka K; Schmutzler, Rita K; Seynaeve, Caroline; Shah, Mitul; Simard, Jacques; Southey, Melissa C; Swerdlow, Anthony J; Truong, Thérèse; Wendt, Camilla; Winqvist, Robert; Zheng, Wei; Benitez, Javier; Dunning, Alison M; Pharoah, Paul D P; Easton, Douglas F; Czene, Kamila; Hall, Per; Lindblom, Annika

    2017-11-28

    Most non-BRCA1/2 breast cancer families have no identified genetic cause. We used linkage and haplotype analyses in familial and sporadic breast cancer cases to identify a susceptibility locus on chromosome 6q. Two independent genome-wide linkage analysis studies suggested a 3 Mb locus on chromosome 6q and two unrelated Swedish families with a LOD >2 together seemed to share a haplotype in 6q14.1. We hypothesized that this region harbored a rare high-risk founder allele contributing to breast cancer in these two families. Sequencing of DNA and RNA from the two families did not detect any pathogenic mutations. Finally, 29 SNPs in the region were analyzed in 44,214 cases and 43,532 controls from BCAC, and the original haplotypes in the two families were suggested as low-risk alleles for European and Swedish women specifically. There was also some support for one additional independent moderate-risk allele in Swedish familial samples. The results were consistent with our previous findings in familial breast cancer and supported a breast cancer susceptibility locus at 6q14.1 around the PHIP gene.

  2. The Pitx2:miR-200c/141:noggin pathway regulates Bmp signaling and ameloblast differentiation.

    Science.gov (United States)

    Cao, Huojun; Jheon, Andrew; Li, Xiao; Sun, Zhao; Wang, Jianbo; Florez, Sergio; Zhang, Zichao; McManus, Michael T; Klein, Ophir D; Amendt, Brad A

    2013-08-01

    The mouse incisor is a remarkable tooth that grows throughout the animal's lifetime. This continuous renewal is fueled by adult epithelial stem cells that give rise to ameloblasts, which generate enamel, and little is known about the function of microRNAs in this process. Here, we describe the role of a novel Pitx2:miR-200c/141:noggin regulatory pathway in dental epithelial cell differentiation. miR-200c repressed noggin, an antagonist of Bmp signaling. Pitx2 expression caused an upregulation of miR-200c and chromatin immunoprecipitation assays revealed endogenous Pitx2 binding to the miR-200c/141 promoter. A positive-feedback loop was discovered between miR-200c and Bmp signaling. miR-200c/141 induced expression of E-cadherin and the dental epithelial cell differentiation marker amelogenin. In addition, miR-203 expression was activated by endogenous Pitx2 and targeted the Bmp antagonist Bmper to further regulate Bmp signaling. miR-200c/141 knockout mice showed defects in enamel formation, with decreased E-cadherin and amelogenin expression and increased noggin expression. Our in vivo and in vitro studies reveal a multistep transcriptional program involving the Pitx2:miR-200c/141:noggin regulatory pathway that is important in epithelial cell differentiation and tooth development.

  3. Experimental study on a prototype solar water heater using refrigerant R141b as a transfer fluid

    Science.gov (United States)

    Ambarita, Himsar; Sitepu, Tekad

    2017-09-01

    A prototype of a heat pipe type solar water heater by using refrigerant as a heat transfer fluid is investigated experimentally. The objective is to explore the performance and characteristics of the prototype when it is filled with R141b. A prototype of the solar water heater with flat plate collector is designed and fabricated. In the experiments, two different refrigerants, R141b and R718, are employed, respectively. The initial pressure of transfer fluid is varied from 10 psi to 55 psi. The prototype is exposed to solar irradiation in a location in Medan city. Solar collector temperatures, solar irradiation, water temperature, and ambient temperature are measured. The efficiency of the system is analyzed. The results show that at the same initial pressure, the solar water heater filled with R141b is better than R718. The optimum initial pressure of the solar water heater filled with R141b is 30 psi. Thermal efficiency of the solar water heater at pressure 30 psi can be up to 34%. The main conclusion can be drawn here is that the solar water heater using refrigerant R141b as a transfer fluid results in a better performance in comparison with conventional water heater.

  4. Roles of L5-7 loop in the structure and chaperone function of SsHSP14.1.

    Science.gov (United States)

    Wen, Zhen-Zhen; Wang, Yong-Hua; Yang, Bo; Xie, Ming-Quan; Chou, Kuo-Chen

    2011-03-01

    The small heat shock protein SsHSP14.1 from the hyper-thermophilic archeaon, Sulfolobus solfataricus (S. solfataricus) was able to protect proteins from thermal aggregation and prevent enzymes from heat induced inactivation. According to the 3D (dimensional) structural model of SsHSP14.1 developed by us before, the region L5-7 (β5-β7, 68-82 residues) plays an important role for the oligomerization of SsHSP14.1 and its chaperone function. Here, to validate the findings, an in-depth investigation was conducted of both the wild type SsHSP14.1 and its deletion mutant DEL75-79. With E. coli proteins and bromelain as substrate, the deletion mutant DEL75-79 can protect them from thermo-aggregating as effective as the wild protein. Interestingly, unlike the wild protein, DEL75-79 was unable to prevent bromelain and EcoRI from thermo-inactivating. Results of size exclusion HPLC showed that the oligomerization state was changed in mutant protein. This was in accordance with the changed structure and lower hydrophobicity of DEL75-79. These outcomes proved that the L5-7 loop did play a role for the oligomerizing SsHSP14.1, and that the residues 75-79 were indispensable for its function of prevent enzymes from thermo-inactivating.

  5. Propofol Inhibits Neurogenesis of Rat Neural Stem Cells by Upregulating MicroRNA-141-3p.

    Science.gov (United States)

    Jiang, Qiliang; Wang, Yingwei; Shi, Xueyin

    2017-02-01

    Prolonged or high-dose exposure to anesthetics, such as propofol, can cause brain cell degeneration and subsequent long-term learning or memory deficits, particularly in the developing brain. However, the cellular and molecular mechanisms underlying the deleterious effects of propofol at certain stages of development remain unclear. In this study we found that propofol inhibited the proliferation, neuronal differentiation, and migration of neural stem cells (NSCs) while upregulating miR-141-3p. Silencing of miR-141-3p abrogated the effects of propofol on NSC neurogenesis. Propofol treatment downregulated IGF2BP2, a direct target of miR-141-3p, whereas overexpression of IGF2BP2 attenuated the effects of propofol and miR-141-3p on NSC neurogenesis. In short, propofol inhibits NSC neurogenesis through a mechanism involving the miR-141-3p/IGF2BP2 axis. Our results may provide a potential approach for preventing the neurodegenerative effects of propofol in the developing brain.

  6. Flexible and wearable 3D graphene sensor with 141 KHz frequency signal response capability

    Science.gov (United States)

    Xu, R.; Zhang, H.; Cai, Y.; Ruan, J.; Qu, K.; Liu, E.; Ni, X.; Lu, M.; Dong, X.

    2017-09-01

    We developed a flexible force sensor consisting of 3D graphene foam (GF) encapsulated in flexible polydimethylsiloxane (PDMS). Because the 3D GF/PDMS sensor is based on the transformation of an electronic band structure aroused by static mechanical strain or KHz vibration, it can detect frequency signals by both tuning fork tests and piezoelectric ceramic transducer tests, which showed a clear linear response from audio frequencies, including frequencies up to 141 KHz in the ultrasound range. Because of their excellent response with a wide bandwidth, the 3D GF/PDMS sensors are attractive for interactive wearable devices or artificial prosthetics capable of perceiving seismic waves, ultrasonic waves, shock waves, and transient pressures.

  7. Potentially acceptable substitutes for the chlorofluorocarbons: properties and performance features of HFC-134a, HCFC-123, and HCFC-141b

    Science.gov (United States)

    Sukornick, B.

    1989-05-01

    Potentially acceptable substitutes are known for CFC-11 and CFC-12-the most important Chlorofluorocarbons. HFC-134a could replace CFC-12 in airconditioning and refrigeration and both HCFC-123 and HCFC-141b show promise as CFC-11 substitutes. The replacement molecules all have significantly reduced greenhouse and ozone depletion potentials compared to their fully halogenated counterparts. HCFC-123 is theoretically a less efficient blowing agent than CFC-11, but 141b is more efficient. Results from experimental foaming tests confirm these relationships and show that initial insulating values are slightly lower for 141b and 123 than 11. Both substitutes are nonflammable liquids. Based on its physical properties, HFC-134a is an excellent replacement candidate for CFC-12. In addition, it is more thermally stable than CFC-12. A new family of HFC-134a compatible lubricant oils will be required. The estimated coefficient of performance (COP) of 134a is 96 98% that of CFC-12. Subacute toxicity tests show HFC-134a to have a low order of toxicity. HCFC-123 reveals no serious side effects at a concentration of 0.1% in subchronic tests and the inhalation toxicity of 141b is lower than that of CFC-11 based on a 6-h exposure. Chronic tests on all the new candidates will have to be completed for large-scale commercial use. Allied-Signal is conducting process development at a highly accelerated pace, and we plan to begin commercialization of substitutes within 5 years.

  8. Onderzoek naar de analyse en het voorkomen van Ugilec 141 (dichloorbenzyldichloortoluenen) in afvalolie. Methodiekontwikkeling en onderzoek van Nederlandse afvalolie

    NARCIS (Netherlands)

    Velde EG van der; Linders SHMA; Wammes JIJ; Meiring HD; Liem AKD; LOC

    1994-01-01

    In the seventies and eighties, the environmental and health risks of the application of polychlorinated biphenyls (PCBs) have been discerned, resulting in a restriction of the use of PCBs in most western countries. Several PCB substitutes, such as Ugilec 141 - a technical mixture

  9. Meta-analysis of 28,141 individuals identifies common variants within five new loci that influence uric acid concentrations

    NARCIS (Netherlands)

    M. Kolz (Melanie); T. Johnson (Toby); S. Sanna (Serena); A. Teumer (Alexander); V. Vitart (Veronique); M. Perola (Markus); M. Mangino (Massimo); E. Albrecht (Eva); C. Wallace (Chris); M. Farrall (Martin); A. Johansson (Åsa); A.S. Dimas (Antigone); Y.S. Aulchenko (Yurii); J.S. Beckmann (Jacques); S.M. Bergmann (Sven); M. Bochud (Murielle); M.J. Brown (Morris); H. Campbell (Harry); J. Connell (John); A. Dominiczak (Anna); G. Homuth (Georg); C. Lamina (Claudia); M.I. McCarthy (Mark); T. Meitinger (Thomas); V. Mooser (Vincent); P. Munroe (Patricia); M. Nauck (Matthias); J. Peden (John); H. Prokisch (Holger); P. Salo (Perttu); V. Salomaa (Veikko); N.J. Samani (Nilesh); D. Schlessinger (David); M. Uda (Manuela); G. Waeber (Gérard); D. Waterworth (Dawn); R. Wang-Sattler (Rui); A.F. Wright (Alan); J. Adamski (Jerzy); J.B. Whitfield (John); U. Gyllensten (Ulf); J.F. Wilson (James); I. Rudan (Igor); P.P. Pramstaller (Peter Paul); H. Watkins (Hugh); A. Doering (Angela); H.E. Wichmann (Erich); T.D. Spector (Tim); L. Peltonen (Leena Johanna); H. Völzke (Henry); R. Nagaraja (Ramaiah); P. Vollenweider (Peter); M. Caulfield (Mark); T. Illig (Thomas); C. Gieger (Christian); U. Völker (Uwe)

    2009-01-01

    textabstractElevated serum uric acid levels cause gout and are a risk factor for cardiovascular disease and diabetes. To investigate the polygenetic basis of serum uric acid levels, we conducted a meta-analysis of genome-wide association scans from 14 studies totalling 28,141 participants of

  10. Workshop Design Guidelines for Inland Waterways – Best Practice Approach – using existing examples (PIANC-INCOM WG 141)

    NARCIS (Netherlands)

    Koedijk, O.C.

    2013-01-01

    The Pianc Working group 141 is in progress to develop design guidelines for Inland Waterways. In advance of publication of the final report, this paper consists of paragraph 6.2 of the report to come. The possibility exists that the content of this paper needs to be revised to suit with the other

  11. 40 CFR 141.544 - What if my system uses chloramines, ozone, or chlorine dioxide for primary disinfection?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What if my system uses chloramines... Benchmark § 141.544 What if my system uses chloramines, ozone, or chlorine dioxide for primary disinfection? If your system uses chloramines, ozone or chlorine dioxide for primary disinfection your system must...

  12. 40 CFR 141.535 - What if my system uses chloramines, ozone, or chlorine dioxide for primary disinfection?

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false What if my system uses chloramines... § 141.535 What if my system uses chloramines, ozone, or chlorine dioxide for primary disinfection? If your system uses chloramines, ozone, or chlorine dioxide for primary disinfection, you must also...

  13. 7 CFR 42.141 - Obtaining Operating Characteristic (OC) curve information for skip lot sampling and inspection.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Obtaining Operating Characteristic (OC) curve... FOOD CONTAINERS Miscellaneous § 42.141 Obtaining Operating Characteristic (OC) curve information for skip lot sampling and inspection. The Operating Characteristic (OC) curve information (probability of...

  14. Level structure of 141Ba and 139Xe and the level systematics of N=85 even-odd isotones

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Y.X.; Rasmussen, J.O.; Hamilton, J.H.; Ramayya, A.V.; Hwang, J.K.; Beyer, C.J.; Zhu, S.J.; Kormicki, J.; Zhang, X.Q.; Jones, E.F.; Gore, P.M.; Ginter, T.N.; Gregorich, K.E.; Lee, I-Yang; Macchiavelli, A.O.; Zielinski, P.; Folden III, C.M.; Fallon, P.; Ter-Akopian, G.M.; Oganessian, Yu.Ts.; Daniel, A.V.; Stoyer, M.A.; Cole, J.D.; Donangelo, R.; Wu, S.C.; Asztalos, S.J.

    2002-01-31

    New level schemes of {sup 141}Ba and {sup 139}Xe are proposed from the analyses of spontaneous-fission gamma data from our {sup 252}Cf spontaneous fission Gammasphere runs of 1995 and 2000. By analogy with the N = 85 even-odd isotones {sup 149}Gd, {sup 147}Sm, and {sup 145}Nd, spins and parities were assigned to the observed excited states in {sup 141}Ba and {sup 139}Xe. It appears that spherical shell model neutron excitations plus octupolephonons are an appropriate basis at the lower end of the bands. Going to higher spins it is clear that the soft rotor involving valence protons as well as neutrons becomes increasingly important in the configurations. Level systematics in the N = 85 even-odd isotones from Gd(Z=64) through Te(Z=52), are discussed. The excitation systematics and smooth trends of the analogous levels support the spin and parity assignment for excited levels observed in {sup 141}Ba and {sup 139}Xe. The level systematics and the comparison with neighboring even-even isotopes indicate that quadrupole and octupole collectivity play roles in {sup 141}Ba and {sup 139}$Xe. From Gd(Z=64) through Te(Z=52), increasing excitation energies of the 13/2{sup +} states and lowering relative intensities of the positive parity bands in the N = 85 even-odd isotones may indicate that the octupole strength is becoming weaker for the isotones when approaching the Z = 50 closed shell.

  15. 40 CFR 141.211 - Special notice for repeated failure to conduct monitoring of the source water for Cryptosporidium...

    Science.gov (United States)

    2010-07-01

    ... conduct monitoring of the source water for Cryptosporidium and for failure to determine bin classification... of the source water for Cryptosporidium and for failure to determine bin classification or mean... operator of a community or non-community water system that is required to monitor source water under § 141...

  16. Preparation of Na{sub 4}UO{sub 2}(CO{sub 3}){sub 3} in presence of Ce-141. I, Influence of the post-reaction time in the concentration of anion species of Ce-141; Preparacion del Na{sub 4}UO{sub 2}(CO{sub 3}){sub 3} en presencia de Ce-141. I, Influencia del tiempo de post-reaccion en la concentracion de especies anionicas de Ce-141

    Energy Technology Data Exchange (ETDEWEB)

    Lopez M, B.E.; Rodriguez S, A.; Iturbe G, J.L

    1991-10-15

    An effective condition to minimize the presence of Ce-141, in the final product of recovery like hexa hydrated uranyl nitrate has been obtained. It is considered to this condition like a pre purification stage in the recovery process of the non-fissioned residual uranium in the fission production of Mo-99. (Author)

  17. Delineation of the 3p14.1p13 microdeletion associated with syndromic distal limb contractures

    DEFF Research Database (Denmark)

    Thevenon, Julien; Monnier, Nicole; Callier, Patrick

    2014-01-01

    named hs1149. Sanger sequencing and locus quantification of hs1149, EIF4E3, and FOXP1 in a cohort of 11 French patients affected by DLC appeared normal. In conclusion, we delineate a new microdeletion syndrome involving the 3p14.1p13 locus and associated with DLC and severe developmental delay....

  18. 41 CFR 302-9.141 - What is the “authorized point of origin” when I transport a POV to my post of duty?

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What is the âauthorized point of originâ when I transport a POV to my post of duty? 302-9.141 Section 302-9.141 Public Contracts and Property Management Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND...

  19. Pro-arrhythmogenic Effects of the V141M KCNQ1 Mutation in Short QT Syndrome and Its Potential Therapeutic Targets: Insights from Modeling.

    Science.gov (United States)

    Lee, Hsiang-Chun; Rudy, Yoram; Liang, Hongwu; Chen, Chih-Chieh; Luo, Ching-Hsing; Sheu, Sheng-Hsiung; Cui, Jianmin

    2017-10-01

    Gain-of-function mutations in the pore-forming subunit of I Ks channels, KCNQ1, lead to short QT syndrome (SQTS) and lethal arrhythmias. However, how mutant I Ks channels cause SQTS and the possibility of I Ks -specific pharmacological treatment remain unclear. V141M KCNQ1 is a SQTS associated mutation. We studied its effect on I Ks gating properties and changes in the action potentials (AP) of human ventricular myocytes. Xenopus oocytes were used to study the gating mechanisms of expressed V141M KCNQ1/KCNE1 channels. Computational models were used to simulate human APs in endocardial, mid-myocardial, and epicardial ventricular myocytes with and without β-adrenergic stimulation. V141M KCNQ1 caused a gain-of-function in I Ks characterized by increased current density, faster activation, and slower deactivation leading to I Ks accumulation. V141M KCNQ1 also caused a leftward shift of the conductance-voltage curve compared to wild type (WT) I Ks (V 1/2 = 33.6 ± 4.0 mV for WT, and 24.0 ± 1.3 mV for heterozygous V141M). A Markov model of heterozygous V141M mutant I Ks was developed and incorporated into the O'Hara-Rudy model. Compared to the WT, AP simulations demonstrated marked rate-dependent shortening of AP duration (APD) for V141M, predicting a SQTS phenotype. Transmural electrical heterogeneity was enhanced in heterozygous V141M AP simulations, especially under β-adrenergic stimulation. Computational simulations identified specific I K1 blockade as a beneficial pharmacologic target for reducing the transmural APD heterogeneity associated with V141M KCNQ1 mutation. V141M KCNQ1 mutation shortens ventricular APs and enhances transmural APD heterogeneity under β-adrenergic stimulation. Computational simulations identified I K1 blockers as a potential antiarrhythmic drug of choice for SQTS.

  20. A europium- and terbium-coated magnetic nanocomposite as sorbent in dispersive solid phase extraction coupled with ultra-high performance liquid chromatography for antibiotic determination in meat samples.

    Science.gov (United States)

    Castillo-García, M L; Aguilar-Caballos, M P; Gómez-Hens, A

    2015-12-18

    A new magnetic dispersive solid-phase extraction approach based on Eu- and Tb-coated magnetic nanocomposites, combined with ultra-high performance liquid chromatography with fluorometric detection, is reported for the extraction and simultaneous determination of veterinary antibiotics. The method is aimed at monitoring of potential residues of three tetracyclines, namely oxytetracycline, tetracycline, chlortetracycline and three acidic quinolones, such as oxolinic acid, nalidixic acid and flumequine, chosen as model analytes, in animal muscle samples. The nanocomposites were obtained by synthesizing magnetic nanoparticles by a co-precipitation method and their coating with terbium and europium ions. The limits of detection obtained using standard solutions were: 1.0, 1.5, 3.8, 0.25, 0.7 and 1.2ngmL(-1), which corresponds to 3.3, 5.0, 12.7, 0.8, 2.3 and 4.0μgkg(-1) for oxytetracycline, tetracycline, chlortetracycline, oxolinic acid, nalidixic acid and flumequine, respectively, in meat samples. The precision values, obtained in the presence of the sample matrix, were in the ranges 0.12-2.0% and 2.6-15.4% for retention times and areas, respectively. The selectivity of the method was checked by assaying different veterinary drugs, finding that most of them did not interfere at the same concentration levels as that of analytes. A recovery study was performed in the presence of chicken and pork muscle samples, which provided values in the range of 61.5-102.6%. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. Completion summary for boreholes USGS 140 and USGS 141 near the Advanced Test Reactor Complex, Idaho National Laboratory, Idaho

    Science.gov (United States)

    Twining, Brian V.; Bartholomay, Roy C.; Hodges, Mary K.V.

    2014-01-01

    In 2013, the U.S. Geological Survey, in cooperation with the U.S. Department of Energy, drilled and constructed boreholes USGS 140 and USGS 141 for stratigraphic framework analyses and long-term groundwater monitoring of the eastern Snake River Plain aquifer at the Idaho National Laboratory in southeast Idaho. Borehole USGS 140 initially was cored to collect continuous geologic data, and then re-drilled to complete construction as a monitor well. Borehole USGS 141 was drilled and constructed as a monitor well without coring. Boreholes USGS 140 and USGS 141 are separated by about 375 feet (ft) and have similar geologic layers and hydrologic characteristics based on geophysical and aquifer test data collected. The final construction for boreholes USGS 140 and USGS 141 required 6-inch (in.) diameter carbon-steel well casing and 5-in. diameter stainless-steel well screen; the screened monitoring interval was completed about 50 ft into the eastern Snake River Plain aquifer, between 496 and 546 ft below land surface (BLS) at both sites. Following construction and data collection, dedicated pumps and water-level access lines were placed to allow for aquifer testing, for collecting periodic water samples, and for measuring water levels. Borehole USGS 140 was cored continuously, starting from land surface to a depth of 543 ft BLS. Excluding surface sediment, recovery of basalt and sediment core at borehole USGS 140 was about 98 and 65 percent, respectively. Based on visual inspection of core and geophysical data, about 32 basalt flows and 4 sediment layers were collected from borehole USGS 140 between 34 and 543 ft BLS. Basalt texture for borehole USGS 140 generally was described as aphanitic, phaneritic, and porphyritic; rubble zones and flow mold structure also were described in recovered core material. Sediment layers, starting near 163 ft BLS, generally were composed of fine-grained sand and silt with a lesser amount of clay; however, between 223 and 228 ft BLS, silt

  2. Comparison of the design criteria of 141 onsite wastewater treatment systems available on the French market.

    Science.gov (United States)

    Dubois, V; Boutin, C

    2017-08-01

    New EC standards published in 2009 led to a surge in onsite wastewater treatment systems reaching the European market. Here we summarize their technical aspects and compare them to known values used in centralized wastewater treatment. The paper deals with two types of processes: attached-growth systems (AGS) on fine media and suspended-growth systems (SGS). Covering 141 technical approvals and 36 manufacturers, we compare onsite design criteria against the centralized wastewater design criteria for each process. The systems use a wide range of materials for bacterial growth, from soil, sand or gravel to zeolite, coconut shavings or rockwool cubes, with a huge range of variation in useful surface, from 0.26 m 2 /PE for one rockwool cube filter to 5 m 2 /PE for a (traditional system) vertical sand filter. Some rockwool can handle applied daily surface load of 160 g BOD 5 /m 2 . SGS design parameters range from 0.025 to 0.34 kg BOD 5 per kg MLVSS/d with hydraulic retention times of 0.28-3.7 d. For clarifier design, water velocity ranges from 0.15 to 1.47 m/h. In the sludge line, sludge storage volume ranges from 0.125 down to just 0.56 m 3 /PE. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. XMM - Newton observations of the Seyfert 1 galaxy ESO 141-G55

    Energy Technology Data Exchange (ETDEWEB)

    Gondoin, P

    2004-06-01

    We report on an observation of the Seyfert 1 galaxy ESO 141-G55 performed in October 2001 with the EPIC MOS cameras and Reflection Grating Spectrometers (RGS) on board the XMM - Newton observatory. We find the hard (3-10 keV) continuum slope, including reflection, to be somewhat flatter ({gamma}=1.72{+-}0.06) than that of a typical broad-line Seyfert 1 galaxy. The spectrum shows a weak emission line at 6.45 {+-} 0.04 keV with a measured equivalent width of {approx} 40 eV. A broad spectral feature is observed around 7 keV that can be fitted by an absorption edge at 7.6 {+-} 0.1 keV. The extrapolation of the primary power law continuum to energies lower than 2 keV indicates the presence of a soft excess component contributing 45{+-} 3% of the overall flux in the 0.3-2.0 keV energy range. This soft-excess cannot be explained solely by enhanced reflection from a highly ionized disk.

  4. Ceramic coatings of LA141 alloy formed by plasma electrolytic oxidation for corrosion protection.

    Science.gov (United States)

    Li, Zhijun; Yuan, Yi; Sun, Pengpeng; Jing, Xiaoyan

    2011-09-01

    Superlight Mg-Li alloy is a promising structural materials in aerospace, automobile, and electronics because of its excellent properties such as low density, high ductility, superior strength-to-weight ratio, and good damping ability. The fabrication of compact plasma electrolytic oxidation coatings with excellent corrosion resistance is valuable for the widespread application of Mg-Li alloy. Here we present a ceramic coating on the surface of Mg-14Li-1Al (LA141) alloy for corrosion protection via plasma electrolytic oxidation (PEO) in an alkaline silicate electrolyte with tungstate as an additive. X-ray photoelectron spectroscopy and thin film-X-ray diffraction analysis of coatings show that the surface coating is mainly comprised of Mg(2)SiO(4), MgO and WO(3). Scanning electron microscopy observations have revealed that the dense and compact coating formed in the presence of tungstate has less structural imperfections in comparison to the control one fabricated without use of tungstate. The effect of oxidation time on the morphology and phase composition of coatings is also examined in detail.

  5. Rorschach Comprehensive System data for a sample of 141 adult nonpatients from Denmark.

    Science.gov (United States)

    Ivanouw, Jan

    2007-01-01

    A sample (n = 141) of Danish nonpatients 25-50 years of age, never hospitalized with a psychiatric diagnosis and currently employed, was demographically representative of two geographical areas of Copenhagen with different social strain. The sample, as well as 45 persons not currently employed, was tested with the Rorschach (Exner, 1995), MMPI-2 (Butcher, Dahlstrom, Graham, Tellegen, & Kaemmer, 1989), Word Association Test (Ivanouw, 1999b), WAIS Comprehension subtest (Hess, 1974), and SCL-90-R (Olsen, Mortenson, & Bech, 2006). Half of the persons contacted volunteered for the study. There was no difference in rate of volunteering between a standard no-feedback condition and a feedback condition; the latter, however, tended to attract more psychologically resourceful persons. The employed persons tended to appear healthier than the not employed. Response style of the subjects, quality of the Rorschach protocols, reliability of scoring, and the effect of the data being grouped on geographical area and examiner were examined. Form level, color, texture, cooperative movement, and EA were lower than in the Comprehensive System (CS; n = 450) sample, but higher than in nine international nonpatient Rorschach studies. Unique for the Danish sample was a low number of animal movement answers. The Rorschach data showed women to be healthier than men. Differences in Rorschach variables based on educational level were small.

  6. Role for DNA methylation in the regulation of miR-200c and miR-141 expression in normal and cancer cells

    Energy Technology Data Exchange (ETDEWEB)

    Vrba, Lukas; Jensen, Taylor J.; Garbe, James C.; Heimark, Ronald L.; Cress, Anne E.; Dickinson, Sally; Stampfer, Martha R.; Futscher, Bernard W.

    2009-12-23

    BACKGROUND: The microRNA-200 family participates in the maintenance of an epithelial phenotype and loss of its expression can result in epithelial to mesenchymal transition (EMT). Furthermore, the loss of expression of miR-200 family members is linked to an aggressive cancer phenotype. Regulation of the miR-200 family expression in normal and cancer cells is not fully understood. METHODOLOGY/ PRINCIPAL FINDINGS: Epigenetic mechanisms participate in the control of miR-200c and miR-141 expression in both normal and cancer cells. A CpG island near the predicted mir-200c/mir-141 transcription start site shows a striking correlation between miR-200c and miR-141 expression and DNA methylation in both normal and cancer cells, as determined by MassARRAY technology. The CpG island is unmethylated in human miR-200/miR-141 expressing epithelial cells and in miR-200c/miR-141 positive tumor cells. The CpG island is heavily methylated in human miR-200c/miR-141 negative fibroblasts and miR-200c/miR-141 negative tumor cells. Mouse cells show a similar inverse correlation between DNA methylation and miR-200c expression. Enrichment of permissive histone modifications, H3 acetylation and H3K4 trimethylation, is seen in normal miR-200c/miR-141-positive epithelial cells, as determined by chromatin immunoprecipitation coupled to real-time PCR. In contrast, repressive H3K9 dimethylation marks are present in normal miR-200c/miR-141-negative fibroblasts and miR-200c/miR-141 negative cancer cells and the permissive histone modifications are absent. The epigenetic modifier drug, 5-aza-2'-deoxycytidine, reactivates miR-200c/miR-141 expression showing that epigenetic mechanisms play a functional role in their transcriptional control. CONCLUSIONS/ SIGNIFICANCE: We report that DNA methylation plays a role in the normal cell type-specific expression of miR-200c and miR-141 and this role appears evolutionarily conserved, since similar results were obtained in mouse. Aberrant DNA methylation

  7. Accumulative dose response of CdZnTe detectors to 14.1 MeV neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Xiang, E-mail: chenxiang@nint.ac.cn; Han, He-tong; Li, Gang; Lu, Yi

    2017-03-01

    The accumulative dose response of CdZnTe (CZT) detectors to 14.1 MeV neutrons is discussed experimentally in this paper. The Cockcroft–Walton Accelerator is used to obtain a steady neutron beam of 14.1 MeV neutrons. A pulsed X-ray source is used to test the response parameters of the neutron-exposed CZT detectors under the pulse mode. The irradiation time (hours) is shorter relative to the time scales (years) where annealing effects occur. Time and linearity response is analyzed to evaluate the maximum dose rate of the CZT detectors and the pulse shape. The result shows that the experimental CZT detectors maintain stable response behaviors, while the maximum dose rate and the total accumulative dose are less than 10{sup 6} neutrons/(cm{sup 2}·s) and 10{sup 10} neutrons/cm{sup 2}, respectively.

  8. Measurement of 14.1 MeV neutrons with a Th-scintillator optical fibre detector

    Science.gov (United States)

    Yamane, Y.; Lindén, P.; Karlsson, J. K.-H.; Pázsit, I.

    The flux of 14.1 MeV neutrons was measured with high spatial resolution in the vicinity of the target of a D-T neutron generator. The measurements were made by a thin optical fibre detector with a ZnS(Ag) scintillation tip mixed with a 232Th neutron converter. The detector concept was originally developed at Nagoya University. The flux of 14.1 MeV neutrons could be measured with a spatial resolution of about 1 mm. The position of the impact area of the deuterium beam on the target surface was determined by the method as an application. A simple model for the calculation of the space dependence of the flux was developed, and it was shown to agree very well with the measurements. With the help of the model, both the vertical and horizontal position of the beam impact area centre can be determined from one single measurement through parameter fitting.

  9. G141.2+5.0, A NEW PULSAR WIND NEBULA DISCOVERED IN THE CYGNUS ARM OF THE MILKY WAY

    Energy Technology Data Exchange (ETDEWEB)

    Kothes, R.; Foster, T. J. [National Research Council Herzberg, Dominion Radio Astrophysical Observatory, P.O. Box 248, Penticton, British Columbia, V2A 6J9 (Canada); Sun, X. H. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Reich, W., E-mail: roland.kothes@nrc-cnrc.gc.ca [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany)

    2014-04-01

    We report the discovery of the new pulsar wind nebula (PWN) G141.2+5.0 in data observed with the Dominion Radio Astrophysical Observatory's Synthesis Telescope at 1420 MHz. The new PWN has a diameter of about 3.'5, which translates to a spatial extent of about 4 pc at a distance of 4.0 kpc. It displays a radio spectral index of α ≈ –0.7, similar to the PWN G76.9+1.1. G141.2+5.0 is highly polarized up to 40% with an average of 15% in the 1420 MHz data. It is located in the center of a small spherical H I bubble, which is expanding at a velocity of 6 km s{sup –1} at a systemic velocity of v {sub LSR} = –53 km s{sup –1}. The bubble could be the result of the progenitor star's mass loss or the shell-type supernova remnant (SNR) created by the same supernova explosion in a highly advanced stage. The systemic LSR velocity of the bubble shares the velocity of H I associated with the Cygnus spiral arm, which is seen across the second and third quadrants and an active star-forming arm immediately beyond the Perseus arm. A kinematical distance of 4 ± 0.5 kpc is found for G141.2+5.0, similar to the optical distance of the Cygnus arm (3.8 ± 1.1 kpc). G141.2+5.0 represents the first radio PWN discovered in 17 years and the first SNR discovered in the Cygnus spiral arm, which is in stark contrast with the Perseus arm's overwhelming population of shell-type remnants.

  10. Decay Data Evaluation Project (DDEP): Updated evaluation of the 133Ba, 140Ba, 140La and 141Ce decay characteristics

    Science.gov (United States)

    Chechev, Valerii P.; Kuzmenko, Nikolai K.

    2017-09-01

    Within the Decay Data Evaluation Project (DDEP) an updated comprehensive assessment has been made of the decay characteristics of 133Ba, 140Ba, 140La, and 141Ce. Experimental data published up to 2016 along with other information (new compilations, analyses and corrections) were taken into account. Newly evaluated values of the half-lives and a number of other key decay characteristics are presented in this paper for all four radionuclides.

  11. Cooperation of p300 and PCAF in the control of microRNA 200c/141 transcription and epithelial characteristics.

    Directory of Open Access Journals (Sweden)

    Yoshiaki Mizuguchi

    Full Text Available Epithelial to mesenchymal transition (EMT not only occurs during embryonic development and in response to injury, but is an important element in cancer progression. EMT and its reverse process, mesenchymal to epithelial transition (MET is controlled by a network of transcriptional regulators and can be influenced by posttranscriptional and posttranslational modifications. EMT/MET involves many effectors that can activate and repress these transitions, often yielding a spectrum of cell phenotypes. Recent studies have shown that the miR-200 family and the transcriptional suppressor ZEB1 are important contributors to EMT. Our previous data showed that forced expression of SPRR2a was a powerful inducer of EMT and supports the findings by others that SPRR gene members are highly upregulated during epithelial remodeling in a variety of organs. Here, using SPRR2a cells, we characterize the role of acetyltransferases on the microRNA-200c/141 promoter and their effect on the epithelial/mesenchymal status of the cells. We show that the deacetylase inhibitor TSA as well as P300 and PCAF can cause a shift towards epithelial characteristics in HUCCT-1-SPRR2a cells. We demonstrate that both P300 and PCAF act as cofactors for ZEB1, forming a P300/PCAF/ZEB1 complex on the miR200c/141 promoter. This binding results in lysine acetylation of ZEB1 and a release of ZEB1 suppression on miR-200c/141 transcription. Furthermore, disruption of P300 and PCAF interactions dramatically down regulates miR-200c/141 promoter activity, indicating a PCAF/P300 cooperative function in regulating the transcriptional suppressor/activator role of ZEB1. These data demonstrate a novel mechanism of miRNA regulation in mediating cell phenotype.

  12. The PLAU P141L single nucleotide polymorphism is associated with collateral circulation in patients with coronary artery disease.

    Science.gov (United States)

    Duran, Joan; Sánchez-Olavarría, Pilar; Mola, Marina; Götzens, Víctor; Carballo, Julio; Martín-Pelegrina, Eva; Petit, Màrius; García Del Blanco, Bruno; García-Dorado, David; de Anta, Josep M

    2014-07-01

    Urokinase-type plasminogen activator, which is encoded by the PLAU gene, plays a prominent role during collateral arterial growth. We investigated whether the PLAU P141L (C > T) polymorphism, which causes a mutation in the kringle domain of the protein, is associated with coronary collateral circulation in a cohort of 676 patients with coronary artery disease. The polymorphism was genotyped in blood samples using a TaqMan-based genotyping assay, and collateral circulation was assessed by the Rentrop method. Multivariate logistic regression models adjusted by clinically relevant variables to estimate odds ratios were used to examine associations of PLAU P141L allelic variants and genotypes with collateral circulation. Patients with poor collateral circulation (Rentrop 0-1; n = 547) showed a higher frequency of the TT genotype than those with good collateral circulation (Rentrop 2-3; n = 129; P = .020). The T allele variant was also more common in patients with poor collateral circulation (P = .006). The odds ratio of having poorly developed collaterals in patients bearing the T allele (adjusted for clinically relevant variables) was statistically significant under the dominant model (odds ratio = 1.83 [95% confidence interval, 1.16-2.90]; P = .010) and the additive model (odds ratio = 1.73 [95% confidence interval, 1.14-2.62]; P = .009). An association was found between coronary collateral circulation and the PLAU P141L polymorphism. Patients with the 141L variant are at greater risk of developing poor coronary collateral circulation. Copyright © 2013 Sociedad Española de Cardiología. Published by Elsevier Espana. All rights reserved.

  13. Endovascular management of dural carotid-cavernous sinus fistulas in 141 patients

    Energy Technology Data Exchange (ETDEWEB)

    Kirsch, M. [Alfried Krupp Krankenhaus, Klinik fuer Radiologie und Neuroradiologie, Essen (Germany); Universitaetsklinikum Greifswald, Institut fuer Diagnostische Radiologie und Neuroradiologie, Greifswald (Germany); Henkes, H.; Liebig, T.; Weber, W.; Golik, S.; Kuehne, D. [Alfried Krupp Krankenhaus, Klinik fuer Radiologie und Neuroradiologie, Essen (Germany); Esser, J. [Universitaetsklinikum Essen, Zentrum fuer Augenheilkunde, Essen (Germany)

    2006-07-15

    Introduction: The purpose of this study was to evaluate the single-centre experience with transvenous coil treatment of dural carotid-cavernous sinus fistulas. Methods: Between November 1991 and December 2005, a total of 141 patients (112 female) with dural carotid-cavernous sinus fistula underwent 161 transvenous treatment sessions. The patient files and angiograms were analysed retrospectively. Clinical signs and symptoms included chemosis (94%), exophthalmos (87%), cranial nerve palsy (54%), increased intraocular pressure (60%), diplopia (51%), and impaired vision (28%). Angiography revealed in addition cortical drainage in 34% of the patients. Partial arterial embolization was carried out in 23% of the patients. Transvenous treatment comprised in by far the majority of patients complete filling of the cavernous sinus and the adjacent segment of the superior and inferior ophthalmic vein with detachable coils. Complete interruption of the arteriovenous shunt was achieved in 81% of the patients. A minor residual shunt (without cortical or ocular drainage) remained in 13%, a significant residual shunt (with cortical or ocular drainage) remained in 4%, and the attempted treatment failed in 2%. There was a tendency for ocular pressure-related symptoms to resolve rapidly, while cranial nerve palsy and diplopia improved slowly (65%) or did not change (11%). The 39 patients with visual impairment recovered within the first 2 weeks after endovascular treatment. After complete interruption of the arteriovenous shunt, no recurrence was observed. The transvenous coil occlusion of the superior and inferior ophthalmic veins and the cavernous sinus of the symptomatic eye is a highly efficient and safe treatment in dural carotid-cavernous sinus fistulas. In the majority of patients a significant and permanent improvement in clinical signs and symptoms can be achieved. (orig.)

  14. A dataset comprising 141 magnetic resonance imaging scans of 98 extant sea urchin species.

    Science.gov (United States)

    Ziegler, Alexander; Faber, Cornelius; Mueller, Susanne; Nagelmann, Nina; Schröder, Leif

    2014-01-01

    Apart from its application in human diagnostics, magnetic resonance imaging (MRI) can also be used to study the internal anatomy of zoological specimens. As a non-invasive imaging technique, MRI has several advantages, such as rapid data acquisition, output of true three-dimensional imagery, and provision of digital data right from the onset of a study. Of particular importance for comparative zoological studies is the capacity of MRI to conduct high-throughput analyses of multiple specimens. In this study, MRI was applied to systematically document the internal anatomy of 98 representative species of sea urchins (Echinodermata: Echinoidea). The dataset includes raw and derived image data from 141 MRI scans. Most of the whole sea urchin specimens analyzed were obtained from museum collections. The attained scan resolutions permit differentiation of various internal organs, including the digestive tract, reproductive system, coelomic compartments, and lantern musculature. All data deposited in the GigaDB repository can be accessed using open source software. Potential uses of the dataset include interactive exploration of sea urchin anatomy, morphometric and volumetric analyses of internal organs observed in their natural context, as well as correlation of hard and soft tissue structures. The dataset covers a broad taxonomical and morphological spectrum of the Echinoidea, focusing on 'regular' sea urchin taxa. The deposited files significantly expand the amount of morphological data on echinoids that are electronically available. The approach chosen here can be extended to various other vertebrate and invertebrate taxa. We argue that publicly available digital anatomical and morphological data gathered during experiments involving non-invasive imaging techniques constitute one of the prerequisites for future large-scale genotype-phenotype correlations.

  15. TANGRA - an experimental setup for basic and applied nuclear research by means of 14.1 MeV neutrons

    Science.gov (United States)

    Ruskov, Ivan; Kopatch, Yury; Bystritsky, Vyacheslav; Skoy, Vadim; Shvetsov, Valery; Hambsch, Franz-Josef; Oberstedt, Stephan; Noy, Roberto Capote; Grozdanov, Dimitar; Zontikov, Artem; Rogov, Yury; Zamyatin, Nikolay; Sapozhnikov, Mikhail; Slepnev, Vyacheslav; Bogolyubov, Evgeny; Sadovsky, Andrey; Barmakov, Yury; Ryzhkov, Valentin; Yurkov, Dimitry; Valković, Vladivoj; Obhođaš, Jasmina; Aliyev, Fuad

    2017-09-01

    For investigation of the basic characteristics of 14.1 MeV neutron induced nuclear reactions on a number of important isotopes for nuclear science and engineering, a new experimental setup TANGRA has been constructed at the Frank Laboratory of Neutron Physics of the Joint Institute for Nuclear Research in Dubna. For testing its performance, the angular distribution of γ-rays (and neutrons) from the inelastic scattering of 14.1 MeV neutrons on high-purity carbon was measured and the angular anisotropy of γ-rays from the reaction 12C(n, n'γ)12C was determined. This reaction is important from fundamental (differential cross-sections) and practical (non-destructive elemental analysis of materials containing carbon) point of view. The preliminary results for the anisotropy of the γ-ray emission from the inelastic scattering of 14.1- MeV neutrons on carbon are compared with already published literature data. A detailed data analysis for determining the correlations between inelastic scattered neutron and γ-ray emission will be published elsewhere.

  16. A Novel 141Ce-Based Flood Field Phantom: Assessment of Suitability for Daily Uniformity Testing in a Clinical Nuclear Medicine Department.

    Science.gov (United States)

    Jha, Ashish Kumar; Mithun, Sneha; Chauhan, Manoj H; Purandare, Nilendu; Shah, Sneha; Agrawal, Archi; Saxena, Sanjay Kumar; Dash, Ashutosh; Rangarajan, Venkatesh

    2017-09-01

    Daily quality control testing of a γ-camera is of the utmost importance in assessing whether the camera is suitable for clinical use. The aim of our study was to assess the suitability of a fillable 141Ce-based flood field phantom developed in-house for daily quality control testing of γ-cameras. Methods: Daily uniformity testing was performed for 113 d using the fillable 141Ce phantom and a commercially available sheet-type 57Co phantom, and the results were compared. Results: The average integral uniformity obtained by the 141Ce and 57Co phantoms was 3.24% and 2.72%, respectively, for detector 1 and 3.31% and 2.78%, respectively, for detector 2. Conclusion: The 141Ce phantom we developed is a suitable alternative to the commercially available 57Co phantom. © 2017 by the Society of Nuclear Medicine and Molecular Imaging.

  17. MicroRNA-141 enhances anoikis resistance in metastatic progression of ovarian cancer through targeting KLF12/Sp1/survivin axis.

    Science.gov (United States)

    Mak, Celia S L; Yung, Mingo M H; Hui, Lynn M N; Leung, Leanne L; Liang, Rui; Chen, Kangmei; Liu, Stephanie S; Qin, Yiming; Leung, Thomas H Y; Lee, Kai-Fai; Chan, Karen K L; Ngan, Hextan Y S; Chan, David W

    2017-01-17

    Cancer metastasis is determined by the formation of the metastatic niche and the ability of cancer cells to adapt to microenvironmental stresses. Anoikis resistance is a fundamental feature of metastatic cancer cell survival during metastatic cancer progression. However, the mechanisms underlying anoikis resistance in ovarian cancer are still unclear. Expressions of miRNA-141 and its downstream targets were evaluated by qPCR, Western blotting, Immunohistochemical (IHC) and in situ hybridization (ISH) assays. The luciferase assays were used to prove KLF12 as the downstream target of miR-141. The cDNA microarray and apoptotic protein arrays were used to identify the targets of miR-141 and KLF12. The competition of KLF12 and Sp1 on survivin promoter was examined by ChIP assay. IHC analysis on ovarian cancer tissue array was used to evaluate the expressions of KLF12 and miR-141 and to show the clinical relevance. The functional studies were performed by in vitro and in vivo tumorigenic assays. Enforced expression of miR-141 promotes, while knockdown of miR-141 expression inhibits, cell proliferation, anchorage-independent capacity, anoikis resistance, tumor growth and peritoneal metastases of ovarian cancer cells. Bioinformatics and functional analysis identified that Kruppel-related zinc finger protein AP-2rep (KLF12) is directly targeted by miR-141. Consistent with this finding, knockdown of KLF12 phenocopied the effects of miR-141 overexpression in ovarian cancer cells. In contrast, restoration of KLF12 in miR-141-expressing cells significantly attenuated anoikis resistance in ovarian cancer cells via interfering with Sp1-mediated survivin transcription, which inhibits the intrinsic apoptotic pathway and is crucial for ovarian cancer cell survival, anoikis resistance and peritoneal metastases. Immunohistochemical (IHC) and in situ hybridization (ISH) assays confirmed that miRNA-141 expression is inversely correlated with KLF12 expression and significantly associated

  18. Association between the DRD2-141C Insertion/Deletion polymorphism and schizophrenia Associação entre o polimorfismo -141C Ins/Del do gene do DRD2 e esquizofrenia

    Directory of Open Access Journals (Sweden)

    Quirino Cordeiro

    2009-06-01

    Full Text Available Epidemiological studies have demonstrated that the genetic component is an important risk factor for the development of schizophrenia. The genes that codify the different compounds of the dopaminergic system have created interest for molecular investigations in patients with schizophrenia because the antipsychotic drugs, especially those of first generation, act on this cerebral system. Thus the aim of the present study was to investigate the possible association between the -141 Ins/Del (rs1799732 polymorphism of the dopamine receptor type 2 (DRD2 and schizophrenia. The distribution of the alleles and genotypes of the studied polymorphism was investigated in a sample of 229 patients and 733 controls. There were statistical differences in the allelic (χ2=9.78; p=0.001 and genotypic genotypic (χ2=12.74; p=0.001 distributions between patients and controls. Thus the -141C Ins/Del polymorphism of the DRD2 gene (allele Ins was associated to the SCZ phenotype in the investigated sample.Estudos epidemiológicos têm demonstrado que o componente genético é um importante fator de risco para o desenvolvimento de esquizofrenia. Os genes que codificam os diferentes componentes do sistema dopaminérgico passaram a despertar interesse para os estudos moleculares em pacientes com esquizofrenia, devido ao fato dos antipsicóticos, em especial os de primeira geração, exercerem sua ação nesse sistema. Assim, o objetivo do presente estudo foi investigar a possível associação entre polimorfismo -141C Ins/Del (rs1799732 do gene do receptor dopaminérgico tipo 2 (DRD2 e esquizofrenia. Um total de 229 pacientes e 733 controles pareados para sexo e idade foi selecionado com o objetivo de investigar a distribuição dos alelos e genótipos do polimorfismo investigado entre os grupos de pacientes e controles. Houve diferença estatisticamente significante nas distribuições alélica (χ2=9,78; p=0,001 e genotípica (χ2=12,74; p=0,001 entre pacientes e

  19. Eclipse project QF-106 and C-141A climbs out under tow on first tethered flight December 20, 1997

    Science.gov (United States)

    1997-01-01

    TOW LAUNCH DEMONSTRATION - The Kelly Space & Technology (KST)/USAF/NASA Eclipse project's modified QF-106 climbs out under tow by a USAF C-141A on the project's first tethered flight on December 20, 1997. The successful 18-minute-long flight reached an altitude of 10,000 feet. NASA's Dryden Flight Research Center, Edwards, California, hosted the project, providing engineering and facility support as well as the project pilot. In 1997 and 1998, the Dryden Flight Research Center at Edwards, California, supported and hosted a Kelly Space & Technology, Inc. project called Eclipse, which sought to demonstrate the feasibility of a reusable tow-launch vehicle concept. The project goal was to successfully tow, inflight, a modified QF-106 delta-wing aircraft with an Air Force C-141A transport aircraft. This would demonstrate the possibility of towing and launching an actual launch vehicle from behind a tow plane. Dryden was the responsible test organization and had flight safety responsibility for the Eclipse project. Dryden provided engineering, instrumentation, simulation, modification, maintenance, range support, and research pilots for the test program. The Air Force Flight Test Center (AFFTC), Edwards, California, supplied the C-141A transport aircraft and crew and configured the aircraft as needed for the tests. The AFFTC also provided the concept and detail design and analysis as well as hardware for the tow system and QF-106 modifications. Dryden performed the modifications to convert the QF-106 drone into the piloted EXD-01 (Eclipse eXperimental Demonstrator-01) experimental aircraft. Kelly Space & Technology hoped to use the results gleaned from the tow test in developing a series of low-cost, reusable launch vehicles. These tests demonstrated the validity of towing a delta-wing aircraft having high wing loading, validated the tow simulation model, and demonstrated various operational procedures, such as ground processing of in-flight maneuvers and emergency abort

  20. An experimental investigation of flow boiling heat transfer of R-141b and R-1234yf in microchannels

    Directory of Open Access Journals (Sweden)

    Shamirzaev Alisher

    2017-01-01

    Full Text Available This study presents experimental results of flow boiling heat transfer of refrigerants R-141b and R-1234yf in a horizontal microchannel heat sink. The copper microchannel heat sink contains 21 microchannels with 335×930 μm cross-section. Distribution of local heat transfer coefficients along the length and width of the microchannel plate were measured in the range of external heat fluxes from 50 to 550 kW/m2. Finally, comparisons with predictions according to the model of flow boiling heat transfer are reported for the data sets.

  1. HA14-1 selectively induces apoptosis in Bcl-2-overexpressing leukemia/lymphoma cells, and enhances cytarabine-induced cell death.

    Science.gov (United States)

    Lickliter, J D; Wood, N J; Johnson, L; McHugh, G; Tan, J; Wood, F; Cox, J; Wickham, N W

    2003-11-01

    The Bcl-2 oncoprotein is commonly overexpressed in hematological malignancy, where it promotes the survival of neoplastic cells. Recently, a small molecule (HA14-1) was reported to bind the surface pocket of Bcl-2 that mediates antiapoptotic interactions, triggering apoptosis in a Bcl-2-transfected cell line. We investigated the activity of this compound in a panel of malignant hematopoietic cell lines. Consistent with its proposed role as a Bcl-2 inhibitor, HA14-1 was most cytotoxic in lines expressing high levels of Bcl-2. In addition, at lower concentrations (5-12.5 muM), the compound predominantly triggered apoptosis. However, at concentrations two-fold higher than this and above, increasing primary necrosis was observed, suggesting the onset of interactions supplementary to Bcl-2 inhibition. In experiments on primary cells, 25 muM HA14-1 induced extensive apoptosis in acute leukemic blasts, but also suppressed normal hematopoietic colony formation to <50% of baseline. Importantly, low-concentration HA14-1 (5 muM) was nontoxic to normal colony-forming cells, whereas it enhanced the cytotoxicity of the antileukemia drug cytarabine in Bcl-2-positive lymphoblastic leukemia cells. In conclusion, our results indicate that HA14-1 at low concentration selectively triggers apoptosis in malignant hematopoietic cells that overexpress Bcl-2. Agents of this class may have particular utility in combination with cytotoxic chemotherapy drugs.

  2. Paeonol Suppresses Chondrosarcoma Metastasis through Up-Regulation of miR-141 by Modulating PKCδ and c-Src Signaling Pathway

    Science.gov (United States)

    Horng, Chi-Ting; Shieh, Po-Chuen; Tan, Tzu-Wei; Yang, Wei-Hung; Tang, Chih-Hsin

    2014-01-01

    Chondrosarcoma, a primary malignant bone cancer, has potential for local invasion and distant metastasis, especially to the lungs. Patients diagnosed with it show poor prognosis. Paeonol (2'-hydroxy-4'-methoxyacetophenone), the main active compound of traditional Chinese remedy Paeonia lactiflora Pallas, exhibits anti-inflammatory and anti-tumor activity; whether paeonol regulates metastatic chondrosarcoma is largely unknown. Here, we find paeonol do not increase apoptosis. By contrast, at non-cytotoxic concentrations, paeonol suppresses migration and invasion of chondrosarcoma cells. We also demonstrate paeonol enhancing miR-141 expression and miR-141 inhibitor reversing paeonol-inhibited cell motility; paeonol also reduces protein kinase C (PKC)δ and c-Src kinase activity. Since paeonol inhibits migration and invasion of human chondrosarcoma via up-regulation of miR-141 via PKCδ and c-Src pathways, it thus might be a novel anti-metastasis agent for treatment of metastatic chondrosarcoma. PMID:24992595

  3. Paeonol Suppresses Chondrosarcoma Metastasis through Up-Regulation of miR-141 by Modulating PKCδ and c-Src Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Chi-Ting Horng

    2014-07-01

    Full Text Available Chondrosarcoma, a primary malignant bone cancer, has potential for local invasion and distant metastasis, especially to the lungs. Patients diagnosed with it show poor prognosis. Paeonol (2'-hydroxy-4'-methoxyacetophenone, the main active compound of traditional Chinese remedy Paeonia lactiflora Pallas, exhibits anti-inflammatory and anti-tumor activity; whether paeonol regulates metastatic chondrosarcoma is largely unknown. Here, we find paeonol do not increase apoptosis. By contrast, at non-cytotoxic concentrations, paeonol suppresses migration and invasion of chondrosarcoma cells. We also demonstrate paeonol enhancing miR-141 expression and miR-141 inhibitor reversing paeonol-inhibited cell motility; paeonol also reduces protein kinase C (PKCd and c-Src kinase activity. Since paeonol inhibits migration and invasion of human chondrosarcoma via up-regulation of miR-141 via PKCd and c-Src pathways, it thus might be a novel anti-metastasis agent for treatment of metastatic chondrosarcoma.

  4. EpiNet : Revue électronique de l'EPI, Année 2012, n° 141-150

    OpenAIRE

    Archambault, Jean-Pierre

    2012-01-01

    Accès aux articles et documents dans le fichier attaché index.html. EPI, Archambault, J.-P. (2012). Éditorial : Une commission de l'Académie des Sciences sur l'enseignement de l'informatique. EpiNet : Revue électronique de l'EPI (Enseignement Public & Informatique), jan. 2012, (141). a1201a Archambault, J.-P. (2012). Au bout de dix ans de pratique du B2i, nous constatons un échec. EpiNet : Revue électronique de l'EPI (Enseignement Public & Informatique), jan. 2012, (141). a1201b Karsenti, ...

  5. Remaining Sites Verification Package for the 100-B-14:1 Process Sewer, Waste Site Reclassification Form 2004-005

    Energy Technology Data Exchange (ETDEWEB)

    L. M. Dittmer

    2007-02-22

    The 100-B-14:1 subsite encompasses the former process sewer main associated with the 105-B Reactor Building, 108-B Chemical Pumphouse and Tritium Separation Facility, 184-B Boiler House and the 100-B water treatment facilities, as well as the feeder lines associated with the 108-B facility, formerly discharging to the 116-B-7 Outfall Structure. The subsite has been remediated to achieve the remedial action objectives specified in the Remaining Sites ROD. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.

  6. Spectroscopic analysis of lithium terbium tetrafluoride

    DEFF Research Database (Denmark)

    Christensen, H.P.

    1978-01-01

    . The rare-earth site in LiTbF4 possesses S4 symmetry, which allows six crystal-field parameters. ζ and the six Bim were varied to obtain the best agreement with the experimentally observed levels. Keeping F2=434 cm-1 fixed, a fit with a standard deviation of 12 cm-1 was obtained at 10 K with the following...... were calculated by diagonalizing an effective spin-orbit and crystal-field Hamiltonian in an LS basis. H=Σλi(L→·S→)i+ΣαiΣBimOim, where the parameters λi are functions of the spin-orbit parameter ζ and the Slater parameter F2. The Oim and αi are Racah operators and reduced matrix elements, respectively...

  7. Inelastic critical scattering of neutrons from terbium

    DEFF Research Database (Denmark)

    Als-Nielsen, Jens Aage; Dietrich, O.W.; Marshall, W.

    1967-01-01

    We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition.......We have measured the inelasticity of the critical neutron scattering in Tb above the Néel temperature. The results show that dynamical slowing down of fluctuations does occur at a second order phase transition....

  8. -141C Ins/Del polymorphism of the dopamine D2 receptor gene is associated with schizophrenia in a Spanish population.

    Science.gov (United States)

    Lafuente, Amalia; Bernardo, Miquel; Mas, Sergi; Crescenti, Anna; Aparici, Monica; Gassó, Patricia; Goti, Javier; Sanchez, Vanessa; Catalan, Rosa; Carne, Xavier

    2008-06-01

    In this study we examined the relationship between dopamine D2 receptor (DRD2) polymorphisms (TaqIA, TaqIB, -141C Ins/Del) and dopamine D3 receptor (DRD3) Ser9Gly polymorphism and the risk of schizophrenia in a Spanish population. Two hundred and forty-three schizophrenia patients and 291 healthy controls from the general population participated in a case-control study. No significant differences were observed in the allele or genotype frequencies of TaqIA, TaqIB or Ser9Gly polymorphisms between the schizophrenia patients and the healthy controls. The frequency of the -141C Del allele was significantly lower in the former group (odds ratio=0.4, P=0.01). The -141C Del allele, which produces lower expression of DRD2, may protect against dopaminergic hyperactivity in schizophrenia. This study is one of the few studies of Caucasian participants that supports the results obtained in the original Japanese study, in which the -141C Ins/Del polymorphism was first described. Furthermore, our findings reinforce the hypothesis that excess dopaminergic activity leads to schizophrenia.

  9. Simplified Description of Adsorption Breakthrough Curves of 1,1-Dichloro-1-fluoroethane (HCFC-141b) on Activated Carbon with Temperature Effect.

    Science.gov (United States)

    Tsai; Chang; Ho; Chen

    1999-06-15

    Recovery of HCFC-141b, used as a major alternative solvent and foam-blowing agent for CFCs in industrial applications, has received great attention due to its gradual phase out. This paper describes an investigation of the adsorption breakthrough of HCFC-141b vapor on a commercial activated carbon. A simple theoretical model developed by Yoon and Nelson was applied to investigate the breakthrough behavior of HCFC-141b on an activated carbon column. The values of parameters k' (a rate constant) and tau (the time required for 50% adsorbate breakthrough) in the Yoon and Nelson model were determined at four different concentration levels (i.e., 399, 734, 1139, and 1954 ppmv) and five temperature ranges (i.e., 283, 293, 298, 303, and 313 K), respectively. These values were used to calculate the entire (0-100%) breakthrough curve (plot of percentage breakthrough versus time) regarding the adsorption of HCFC-141b on activated carbon columns. It was found that the calculated theoretical breakthrough curves are in high agreement with the corresponding experimental data. Also, the rate constant k' can be reasonably represented by the empirical Arrhenius equation. The results obtained are applicable for the scale-up design of adsorption columns in the HCFC adsorption on activated carbon adsorbent. Copyright 1999 Academic Press.

  10. 10 CFR Appendix A to Subpart A of... - Selected Provisions of the Atomic Energy Act of 1954, as Amended, Sec. 141 (42 U.S.C. 2161), Sec...

    Science.gov (United States)

    2010-01-01

    ... Amended, Sec. 141 (42 U.S.C. 2161), Sec. 145 (42 U.S.C. 2165), Sec. 161 (42 U.S.C. 2201) A Appendix A to Subpart A of Part 710 Energy DEPARTMENT OF ENERGY CRITERIA AND PROCEDURES FOR DETERMINING ELIGIBILITY FOR... Eligibility for Access to Classified Matter or Special Nuclear Material Pt. 710, Subpt. A, App. A Appendix A...

  11. Human CD141+ Dendritic Cell and CD1c+ Dendritic Cell Undergo Concordant Early Genetic Programming after Activation in Humanized Mice In Vivo.

    Science.gov (United States)

    Minoda, Yoshihito; Virshup, Isaac; Leal Rojas, Ingrid; Haigh, Oscar; Wong, Yide; Miles, John J; Wells, Christine A; Radford, Kristen J

    2017-01-01

    Human immune cell subsets develop in immunodeficient mice following reconstitution with human CD34+ hematopoietic stem cells. These "humanized" mice are useful models to study human immunology and human-tropic infections, autoimmunity, and cancer. However, some human immune cell subsets are unable to fully develop or acquire full functional capacity due to a lack of cross-reactivity of many growth factors and cytokines between species. Conventional dendritic cells (cDCs) in mice are categorized into cDC1, which mediate T helper (Th)1 and CD8+ T cell responses, and cDC2, which mediate Th2 and Th17 responses. The likely human equivalents are CD141+ DC and CD1c+ DC subsets for mouse cDC1 and cDC2, respectively, but the extent of any interspecies differences is poorly characterized. Here, we exploit the fact that human CD141+ DC and CD1c+ DC develop in humanized mice, to further explore their equivalency in vivo. Global transcriptome analysis of CD141+ DC and CD1c+ DC isolated from humanized mice demonstrated that they closely resemble those in human blood. Activation of DC subsets in vivo, with the TLR3 ligand poly I:C, and the TLR7/8 ligand R848 revealed that a core panel of genes consistent with DC maturation status were upregulated by both subsets. R848 specifically upregulated genes associated with Th17 responses by CD1c+ DC, while poly I:C upregulated IFN-λ genes specifically by CD141+ DC. MYCL expression, known to be essential for CD8+ T cell priming by mouse DC, was specifically induced in CD141+ DC after activation. Concomitantly, CD141+ DC were superior to CD1c+ DC in their ability to prime naïve antigen-specific CD8+ T cells. Thus, CD141+ DC and CD1c+ DC share a similar activation profiles in vivo but also have induce unique signatures that support specialized roles in CD8+ T cell priming and Th17 responses, respectively. In combination, these data demonstrate that humanized mice provide an attractive and tractable model to study human DC in vitro and in

  12. The role of classification and reference vessels in the design of inland fairways for commercial vessels – contribution to the Workshop of WG 141 Design Guidelines for Inland Waterways

    NARCIS (Netherlands)

    Koedijk, O.C.

    2015-01-01

    The Pianc WG 141 is proceeding in the conception of Design Guidelines for Inland Waterways. WG 141 aims to produce its first draft in the end of 2015. Part of the forseen content are classification of waterways and the object of reference vessels. The role of those subjects will be presented and

  13. Expression of wild-type PtrIAA14.1, a poplar Aux/IAA gene causes morphological changes in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Shanda eLiu

    2015-06-01

    Full Text Available Aux/IAA proteins are transcriptional repressors that control auxin signaling by interacting with Auxin Response Factors (ARFs. So far all of the identified Aux/IAA mutants with auxin-related phenotypes in Arabidopsis and rice (Oryza sativa are dominant gain-of-function mutants, with mutantions in Domain II that affected stability of the corresponding Aux/IAA proteins. On the other hand, morphological changes were observed in knock-down mutants of Aux/IAA genes in tomato (Solanum lycopersicum, suggesting that functions of Aux/IAA proteins may be specific for certain plant species. We report here the characterization of PtrIAA14.1, a poplar (Populus trichocarpa homologue of IAA7. Bioinformatics analysis showed that PtrIAA14.1 is a classic Aux/IAA protein. It contains four conserved domains with the repressor motif in Domain I, the degron in Domain II, and the conserved amino acid signatures for protein-protein interactions in Domain III and Domain IV. Protoplast transfection assays showed that PtrIAA14.1 is localized in nucleus. It is unable in the presence of auxin, and it represses auxin response reporter gene expression. Expression of wild type PtrIAA14.1 in Arabidopsis resulted in auxin-related phenotypes including down-curling leaves, semi-draft with increased number of branches, and greatly reduced fertility, but expression of the Arabidopsis Aux/IAA genes tested remain largely unchanged in the transgenic plants. Protein-protein interaction assays in yeast and protoplasts showed that PtrIAA14.1 interacted with ARF5, but not other ARFs. Consistent with this observation, vascular patterning was altered in the transgenic plants, and the expression of AtHB8 (Arabidopsis thaliana Homeobox Gene 8 was reduced in transgenic plants.

  14. Genome-wide Scan of 29,141 African Americans Finds No Evidence of Directional Selection since Admixture

    Science.gov (United States)

    Bhatia, Gaurav; Tandon, Arti; Patterson, Nick; Aldrich, Melinda C.; Ambrosone, Christine B.; Amos, Christopher; Bandera, Elisa V.; Berndt, Sonja I.; Bernstein, Leslie; Blot, William J.; Bock, Cathryn H.; Caporaso, Neil; Casey, Graham; Deming, Sandra L.; Diver, W. Ryan; Gapstur, Susan M.; Gillanders, Elizabeth M.; Harris, Curtis C.; Henderson, Brian E.; Ingles, Sue A.; Isaacs, William; De Jager, Phillip L.; John, Esther M.; Kittles, Rick A.; Larkin, Emma; McNeill, Lorna H.; Millikan, Robert C.; Murphy, Adam; Neslund-Dudas, Christine; Nyante, Sarah; Press, Michael F.; Rodriguez-Gil, Jorge L.; Rybicki, Benjamin A.; Schwartz, Ann G.; Signorello, Lisa B.; Spitz, Margaret; Strom, Sara S.; Tucker, Margaret A.; Wiencke, John K.; Witte, John S.; Wu, Xifeng; Yamamura, Yuko; Zanetti, Krista A.; Zheng, Wei; Ziegler, Regina G.; Chanock, Stephen J.; Haiman, Christopher A.; Reich, David; Price, Alkes L.

    2014-01-01

    The extent of recent selection in admixed populations is currently an unresolved question. We scanned the genomes of 29,141 African Americans and failed to find any genome-wide-significant deviations in local ancestry, indicating no evidence of selection influencing ancestry after admixture. A recent analysis of data from 1,890 African Americans reported that there was evidence of selection in African Americans after their ancestors left Africa, both before and after admixture. Selection after admixture was reported on the basis of deviations in local ancestry, and selection before admixture was reported on the basis of allele-frequency differences between African Americans and African populations. The local-ancestry deviations reported by the previous study did not replicate in our very large sample, and we show that such deviations were expected purely by chance, given the number of hypotheses tested. We further show that the previous study’s conclusion of selection in African Americans before admixture is also subject to doubt. This is because the FST statistics they used were inflated and because true signals of unusual allele-frequency differences between African Americans and African populations would be best explained by selection that occurred in Africa prior to migration to the Americas. PMID:25242497

  15. Genome-wide scan of 29,141 African Americans finds no evidence of directional selection since admixture.

    Science.gov (United States)

    Bhatia, Gaurav; Tandon, Arti; Patterson, Nick; Aldrich, Melinda C; Ambrosone, Christine B; Amos, Christopher; Bandera, Elisa V; Berndt, Sonja I; Bernstein, Leslie; Blot, William J; Bock, Cathryn H; Caporaso, Neil; Casey, Graham; Deming, Sandra L; Diver, W Ryan; Gapstur, Susan M; Gillanders, Elizabeth M; Harris, Curtis C; Henderson, Brian E; Ingles, Sue A; Isaacs, William; De Jager, Phillip L; John, Esther M; Kittles, Rick A; Larkin, Emma; McNeill, Lorna H; Millikan, Robert C; Murphy, Adam; Neslund-Dudas, Christine; Nyante, Sarah; Press, Michael F; Rodriguez-Gil, Jorge L; Rybicki, Benjamin A; Schwartz, Ann G; Signorello, Lisa B; Spitz, Margaret; Strom, Sara S; Tucker, Margaret A; Wiencke, John K; Witte, John S; Wu, Xifeng; Yamamura, Yuko; Zanetti, Krista A; Zheng, Wei; Ziegler, Regina G; Chanock, Stephen J; Haiman, Christopher A; Reich, David; Price, Alkes L

    2014-10-02

    The extent of recent selection in admixed populations is currently an unresolved question. We scanned the genomes of 29,141 African Americans and failed to find any genome-wide-significant deviations in local ancestry, indicating no evidence of selection influencing ancestry after admixture. A recent analysis of data from 1,890 African Americans reported that there was evidence of selection in African Americans after their ancestors left Africa, both before and after admixture. Selection after admixture was reported on the basis of deviations in local ancestry, and selection before admixture was reported on the basis of allele-frequency differences between African Americans and African populations. The local-ancestry deviations reported by the previous study did not replicate in our very large sample, and we show that such deviations were expected purely by chance, given the number of hypotheses tested. We further show that the previous study's conclusion of selection in African Americans before admixture is also subject to doubt. This is because the FST statistics they used were inflated and because true signals of unusual allele-frequency differences between African Americans and African populations would be best explained by selection that occurred in Africa prior to migration to the Americas. Copyright © 2014 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  16. Influence of cooling rate on structural and magnetic properties of (Fe78Nb8B141-xTbx alloys

    Directory of Open Access Journals (Sweden)

    G. Ziółkowski

    2017-05-01

    Full Text Available In the presented work we are focused on the influence of cooling rate on structural and magnetic properties of (Fe78Nb8B141-xTbx (x = 0.08, 0.1, 0.12 nanocrystalline bulk alloys. The samples were fabricated using the vacuum suction technique with different cooling rates controlled by different sample diameters (from 0.5 to 1.5 mm. The increased Nb content leads to the formation of specific microstructure and allows obtaining ultra-high coercive alloys just after casting without any additional treatment. The coercivity exceeds 8.6 T at the room temperature in case of optimal chemical and preparation conditions (x = 0.12, d = 0.5 mm and 5.6 T for x = 0.1. The impact of Tb content as well as the cooling rate on magnetic and structural (XRD, SEM, MFM properties is widely discussed in the context of reduction of rare earths in the RE-based permanent magnets.

  17. An integrated YAC clone contig for the WAGR region on human chromosome 11p13-p14.1

    Energy Technology Data Exchange (ETDEWEB)

    Gawin, B.; Klamt, B.; Koenig, A.; Thaete, C. [Biozentrum der Universitaet Wuerzburg (Germany)] [and others

    1995-11-01

    The WAGR syndrome (Wilms tumor, aniridia, genito-urinary anomalies, and mental retardation) deletion region on chromosome 11p13 has been extensively characterized by deletion analysis and long-range restriction mapping. A dense probe set is available for this genomic region, which harbors a number of disease gene loci, some of which still are not cloned. The identification of candidates for these genes would be greatly facilitated by a complete gene map for this chromosomal segment. As an initial step toward this goal, we have isolated the entire region in 58 overlapping YAC clones. The contig spanning 8 Mb from RAG1 to KCNA4 has been assembled by STS and probe content mapping for 76 loci with an average spacing of about 100 kb. A subset of clones has been analyzed by PFG analysis to position these within the known physical map. Common microsatellite markers permit an alignment of the YAC contig with the genetic and radiation hybrid maps of chromosome 11. Ten known genes, some with much more refined map positions, are placed in the contig. The severalfold coverage of 11p13-p14.1 provides a reliable resource for the future development of a complete gene map of this region. 34 refs., 1 fig., 2 tabs.

  18. La tésera celtibérica de Sasamón (K.14.1

    Directory of Open Access Journals (Sweden)

    Francisco J. Rubio Orecilla

    2004-06-01

    Full Text Available In this paper the Celtiberian tessera K.14.1 from Sasamon is analyzed. The inscription is a twofold hospitium document between IroreKiios, qualificated of monituuKoos, and Nemaios. Likely monituuKoos, which we find as a derivation basis of the epitheton of the Matres Monitucinae, is an ethnic adjective; nevertheless it could also be explained as an appelative containing *moni- ‘legal protection’ and *tuk(o- ‘descendance, sons’. On the other side of the inscription the word aleTuures should be a nominative plural, agreeing both IroreKiios and Nemaios; but there are so many formal problems concerning such a stem *aleTur-, that we must seek for another solution. AleTuures could also be a nominative singular, agreeing with Nemaios; but its identification as an ethnic designation (*alleto-rēgs = allot-rīg-es? would be very problematic. Finally, it could be a personal name (allthough without parallels in the hispanoceltic onomastics, and then the pact would have two participants, the surprisingly unidentified individual aleTuures on one side, and on the other IroreKiios the *Monitucean and Nemaios, whose mutual relation would thereupon be misterious. Etymologies for the toponyms Munébrega and Monesma (both from *mono- ‘mountain’, ethnic names as autrigones, allotriges or Celtiberian words as sToTeroi are here propossed or discussed.

  19. Critical Role for CD103(+)/CD141(+) Dendritic Cells Bearing CCR7 for Tumor Antigen Trafficking and Priming of T Cell Immunity in Melanoma.

    Science.gov (United States)

    Roberts, Edward W; Broz, Miranda L; Binnewies, Mikhail; Headley, Mark B; Nelson, Amanda E; Wolf, Denise M; Kaisho, Tsuneyasu; Bogunovic, Dusan; Bhardwaj, Nina; Krummel, Matthew F

    2016-08-08

    Intratumoral dendritic cells (DC) bearing CD103 in mice or CD141 in humans drive intratumoral CD8(+) T cell activation. Using multiple strategies, we identified a critical role for these DC in trafficking tumor antigen to lymph nodes (LN), resulting in both direct CD8(+) T cell stimulation and antigen hand-off to resident myeloid cells. These effects all required CCR7. Live imaging demonstrated direct presentation to T cells in LN, and CCR7 loss specifically in these cells resulted in defective LN T cell priming and increased tumor outgrowth. CCR7 expression levels in human tumors correlate with signatures of CD141(+) DC, intratumoral T cells, and better clinical outcomes. This work identifies an ongoing pathway to T cell priming, which should be harnessed for tumor therapies. Copyright © 2016 Elsevier Inc. All rights reserved.

  20. p16INK4Ainduces senescence and inhibits EMT through microRNA-141/microRNA-146b-5p-dependent repression of AUF1.

    Science.gov (United States)

    Al-Khalaf, Huda H; Aboussekhra, Abdelilah

    2017-03-01

    Senescence and epithelial-to-mesenchymal transition (EMT) processes are under the control of common tumor suppressor proteins, EMT transcription factors, and microRNAs. However, the molecular mechanisms that coordinate the functional link between senescence and EMT are still elusive. We have shown here that p16 INK4A -related induction of senescence is mediated through miR-141 and miR-146b-5p. These two microRNAs are up-regulated in aging human fibroblast and epithelial cells. Furthermore, miR-141 and miR146b-5p trigger cell cycle arrest at G1 phase and induce senescence in primary human fibroblasts and breast cancer cells in the presence and absence of p16 INK4A . Like p16 INK4A -induced senescence, miR-141/miR146b-5p-related senescence is not associated with secretory phenotype, and is mediated through the RNA binding protein AUF1. We have further demonstrated that p16 INK4A and its downstream miRNA targets inhibit EMT through suppressing the EMT inducer ZEB1 in an AUF1-dependent manner. Indeed, AUF1 binds the mRNA of this gene leading to increase in its level. These results indicate that p16 INK4A controls both senescence and EMT through repressing EMT-related transcription factor via miR-141/miR146b-5p and their target AUF1. This sheds more light on the molecular basis of the tumor suppressive functions of p16 INK4A , which represses both the proliferative and the migratory/invasive capacities of cells. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  1. European emissions of HFC-365mfc, a chlorine-free substitute for the foam blowing agents HCFC-141b and CFC-11.

    Science.gov (United States)

    Stemmler, Konrad; Folini, Doris; Ubl, Sandy; Vollmer, Martin K; Reimann, Stefan; O'Doherty, Simon; Greally, Brian R; Simmonds, Peter G; Manning, Alistair J

    2007-02-15

    HFC-365mfc (1,1,1,3,3-pentafluorobutane) is an industrial chemical used for polyurethane foam blowing. From early 2003, HFC-365mfc has been commercially produced as a substitute for HCFC-141b, whose use in Europe has been banned since January 2004. We describe the first detection of HFC-365mfc in the atmosphere and report on a 2 year long record at the high Alpine station of Jungfraujoch (Switzerland) and the Atlantic coast station of Mace Head (Ireland). The measurements at Jungfraujoch are used to estimate the central European emissions of HFC-365mfc, HCFC-141b, and CFC-11. For HFC-365mfc, we estimate the central European emissions (Germany, France, Italy, Switzerland, The Netherlands, Belgium, and Luxembourg) in 2003 and 2004 as 400-500 tonnes year(-1). These emissions are about one-third lower on a per capita basis than what we estimate from the Mace Head measurements for the total of Europe. The estimated emissions of HCFC-141b for central Europe are higher (i.e., 7.2-3.5 ktonnes year(-1)) with a decreasing trend in the period from 2000 to 2004. Residual emissions of CFC-11 are estimated at 2.4-4.7 ktonnes year(-1) in the same time period. The Po Valley (northern Italy) appears to be a main source region for HFC-365mfc and for the former blowing agents HCFC-141b and CFC-11. In 2004, the emissions of HFC-365mfc arose from a wider region of Europe, which we attribute to an increased penetration of HFC-365mfc into the European market.

  2. Validation of a SPE HPLC-UV method for the quantification of a new ER-specific photosensitizer OR-141 in blood serum using total error concept.

    Science.gov (United States)

    Bony, Emilie; Mace, Yohan; Pinto, Adán; Delvaux, David; Kiss, Robert; Riant, Olivier; Feron, Olivier; Quetin-Leclercq, Joëlle

    2017-07-15

    The aim of this work is to develop the first validated HPLC-UV method quantification in blood serum for a new endoplasmic reticulum (ER)-specific benzophenazine photosensitizer (OR-141). A fast solid phase extraction (SPE) cleaning sample procedure was achieved on C18 encapped (ec) SPE cartridges and the separation was performed on a RP-18e column (5μM) using an isocratic elution with methanol. The method has been fully validated according to accuracy profiles based on total error and tolerance intervals. Calibration was performed in the matrix and trueness (<4.25% relative bias), repeatability (<4.75% relative standard deviation (RSD)), intermediate precision (<5.37% RSD), selectivity, response function, linearity, and dilution effect were evaluated for both OR-141 regio-isomers. Afterwards the developed method was successfully applied to perform the quantitative determination of OR-141 in mouse blood serum samples in a preliminary pharmacokinetic study. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. In Vitro Effect of the Synthetic cal14.1a Conotoxin, Derived from Conus californicus, on the Human Parasite Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Marco A. De León-Nava

    2016-04-01

    Full Text Available Toxins that are secreted by cone snails are small peptides that are used to treat several diseases. However, their effects on parasites with human and veterinary significance are unknown. Toxoplasma gondii is an opportunistic parasite that affects approximately 30% of the world’s population and can be lethal in immunologically compromised individuals. The conventional treatment for this parasitic infection has remained the same since the 1950s, and its efficacy is limited to the acute phase of infection. These findings have necessitated the search for new drugs that specifically target T. gondii. We examined the effects of the synthetic toxin cal14.1a (s-cal14.1a from C. californicus on the tachyzoite form of T. gondii. Our results indicate that, at micromolar concentrations, s-cal14.1a lowers viability and inhibits host cell invasion (by 50% and 61%, respectively on exposure to extracellular parasites. Further, intracellular replication decreased significantly while viability of the host cell was unaffected. Our study is the first report on the antiparasitic activity of a synthetic toxin of C. californicus.

  4. Thermal-neutron cross sections and resonance integrals of {sup 138}Ba and {sup 141}Pr using Am-Be neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Panikkath, Priyada; Mohanakrishnan, P. [Manipal University, Manipal Centre for Natural Sciences, Karnataka (India)

    2016-09-15

    The thermal-neutron capture cross sections and resonance integrals of {sup 138}Ba(n, γ){sup 139}Ba and {sup 141}Pr(n, γ){sup 142}Pr were measured by activation method using an isotopic Am-Be neutron source. The estimations were with respect to that of {sup 55}Mn(n, γ){sup 56}Mn and {sup 197}Au(n, γ){sup 198}Au reference monitors. The measured thermal-capture cross section of {sup 138}Ba with respect to {sup 55}Mn is 0.410±0.023 b and with respect to {sup 197}Au is 0.386±0.019 b. The measured thermal-capture cross section of {sup 141}Pr with respect to {sup 55}Mn is 11.36±1.29 b and with respect to {sup 197}Au is 10.43±1.14 b. The resonance integrals for {sup 138}Ba are 0.380±0.033 b ({sup 55}Mn) and 0.364±0.027 b ({sup 197}Au) and for {sup 141}Pr are 21.05±2.88 b ({sup 55}Mn) and 15.27±1.87 b ({sup 197}Au). The comparison between the present measurements and various reported values are discussed. The cross sections corresponding to the selected isotopes are measured using an Am-Be source facility for the first time. (orig.)

  5. Preparation of Na{sub 4}UO{sub 2}(CO{sub 3}){sub 3} in presence of Ce-141. II, Treatment of uranium decontamination; Preparacion del Na{sub 4}UO{sub 2}(CO{sub 3}){sub 3} en presencia de Ce-141. II, Tratamiento de descontaminacion de uranio

    Energy Technology Data Exchange (ETDEWEB)

    Lopez M, B.E.; Rodriguez S, A

    1992-02-15

    It was settled down that the coexistence of chemical species structurally different of cerium, is a consequence of the preparation time; whose practical application, for the purification of the uranium, it can constitute the technological aspect but important in the ion exchange process, to separate the Ce-141 from the uranium. (Author)

  6. Immediate haemodynamic effects of a novel partial agonist, beta 1-adrenoceptor blocking drug ICI 141,292 after intravenous administration to healthy young volunteers and patients with ischaemic heart disease

    DEFF Research Database (Denmark)

    Bonde, J; Svendsen, T L; Lyngborg, K

    1987-01-01

    ICI 141,292 is a new beta 1-adrenoceptor blocking drug. The beta 1-adrenoceptor antagonistic effect of ICI 141,292 was examined in a double-blind, randomised crossover study in eight healthy young volunteers and compared with atenolol. Three doses of ICI 141,292 (1, 2 and 4 mg) and atenolol 5 mg....... No significant changes were observed in mean arterial blood pressure, stroke volume or total peripheral resistance whereas an increase in supine resting mean pulmonary arterial pressure of 3.4 mm Hg (P less than 0.05) could be demonstrated. ICI 141,292 seems to be a potent (at least five times as potent...

  7. Walraven VBLUW photometry in Basel halo fields. II. Metallicity distribution of F- and G-stars in the direction of SA 141 (South Galactic Pole).

    Science.gov (United States)

    Trefzger, Ch. F.; Pel, J. W.; Gabi, S.

    1995-12-01

    In an earlier paper (Pel et al. 1988, Paper I) photoelectric photometry in the Walraven VBLUW system was presented for magnitude limited samples of F-G stars in three high latitude fields of the Basel halo survey. The stars were selected from the photographic RGU survey using the color criterion (G-R)Basel halo survey contains mostly intermediate population stars. Up to z=900pc a rather steep mean metallicity gradient in the z direction is found: -0.55+/-0.1dex/kpc. This tends to flatten out to -0.18dex/kpc at z=1-2kpc. Including 160 additional fainter stars from the Basel survey for which (less accurate) [Fe/H] values can be estimated from the photographic RGU photometry, we determine an overall mean [Fe/H]-gradient for z=-0.6 and σ[Fe/H]=0.3dex. No attempt is made yet to determine a "best solution" for the three-component fit to the SA 141 data; this will be done in combination with the data for two additional Basel fields, SA 94 and SA 107. The results for SA 141 are consistent with Sandage (1987) who proposed a local density normalization of 10% and a vertical scale height of 1kpc for the thick disk. The observed stellar number-distance distribution for SA 141 is in excellent agreement with the prediction by the three-component model. This is an important independent check on the reliability of our absolute magnitudes and photospheric parameters.

  8. Natural human apoA-I mutations L141RPisa and L159RFIN alter HDL structure and functionality and promote atherosclerosis development in mice.

    Science.gov (United States)

    Tiniakou, Ioanna; Kanaki, Zoi; Georgopoulos, Spiros; Chroni, Angeliki; Van Eck, Miranda; Fotakis, Panagiotis; Zannis, Vassilis I; Kardassis, Dimitris

    2015-11-01

    Mutations in human apolipoprotein A-I (apoA-I) are associated with low high-density lipoprotein (HDL) cholesterol levels and pathological conditions such as premature atherosclerosis and amyloidosis. In this study we functionally characterized two natural human apoA-I mutations, L141RPisa and L159RFIN, in vivo. We generated transgenic mice expressing either wild-type (WT) or the two mutant forms of human apoA-I on a mouse apoA-I(-/-) background and analyzed for abnormalities in their lipid and lipoprotein profiles. HDL structure and functionality, as well as atherosclerosis development following a 14-week high-fat diet were assessed in these mice. The expression of either apoA-I mutant was associated with markedly reduced serum apoA-I (<10% of WT apoA-I), total and HDL-cholesterol levels (∼20% and ∼7% of WT apoA-I, respectively) and the formation of few small size HDL particles with preβ2 and α3, α4 electrophoretic mobility. HDL particles containing either of the two apoA-I mutants exhibited attenuated anti-oxidative properties as indicated by their inability to prevent low-density lipoprotein oxidation, and by decreased activities of paraoxonase-1 and platelet-activating factor acetylhydrolase. However, the apoA-I(L141R)Pisa or apoA-I(L159R)FIN-containing HDL particles demonstrated increased capacity to promote ATP-Binding Cassette Transporter A1-mediated cholesterol efflux from macrophages. Expression of apoA-I(L141R)Pisa or apoA-I(L159R)FIN mutations in mice was associated with increased diet-induced atherosclerosis compared to either WT apoA-I transgenic or apoA-I(-/-) mice. These findings suggest that natural apoA-I mutations L141RPisa and L159RFIN affect the biogenesis and the functionality of HDL in vivo and predispose to diet-induced atherosclerosis in the absence of any other genetic defect. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  9. De novo microdeletions of chromosome 6q14.1-q14.3 and 6q12.1-q14.1 in two patients with intellectual disability - further delineation of the 6q14 microdeletion syndrome and review of the literature

    DEFF Research Database (Denmark)

    Becker, Kerstin; Di Donato, Nataliya; Holder-Espinasse, Muriel

    2012-01-01

    .3 and a de novo 11.3 Mb deletion at 6q12.1-6q14.1, respectively. We provide a review of the clinical features of twelve other patients with 6q14 deletions detected by array CGH analysis. By assessing all reported data we could not identify a single common region of deletion. Possible candidate genes in 6q14...

  10. The synthetic heat shock protein 90 (Hsp90) inhibitor EC141 induces degradation of Bcr-Abl p190 protein and apoptosis of Ph-positive acute lymphoblastic leukemia cells.

    Science.gov (United States)

    Tong, Wei-Gang; Estrov, Zeev; Wang, Yongtao; O'Brien, Susan; Faderl, Stefan; Harris, David M; Van Pham, Quin; Hazan-Halevy, Inbal; Liu, Zhiming; Koch, Patricia; Kantarjian, Hagop; Keating, Michael J; Ferrajoli, Alessandra

    2011-12-01

    The prognosis of patients with Philadelphia chromosome-positive (Ph+) acute lymphoblastic leukemia (ALL) is poor. Chemotherapy is rarely curative and tyrosine kinase inhibitors (TKIs) induce only transient responses. Heat shock protein 90 (Hsp90) is a chaperone protein that is important in signal transduction, cell cycle control, and transcription regulation in both normal and leukemia cells. In the current study, we tested the growth inhibitory and apoptotic effects of a novel Hsp90 inhibitor, EC141 on the Ph+ ALL lines Z-119, Z-181, and Z-33, as well as primary bone marrow-derived blasts from patients with newly diagnosed Ph+ ALL. We found that EC141 inhibited the growth of Ph+ ALL cells in a concentration-dependent manner with IC(50) ranged from 1 to 10 nM. EC141 also inhibited the proliferation of primary bone marrow-derived blasts using the ALL blast colony assay. EC141 down-regulated Hsp90 and up-regulated Hsp70 protein levels, inhibited CrkL phosphorylation, and induced degradation of Bcr-Abl p190 protein through ubiquitin-dependent proteasomal pathway. Furthermore, exposure of Ph+ ALL cells to EC141 resulted in activation of caspase-3, cleavage of poly (ADP-ribose) polymerase (PARP), and induction of apoptosis. In conclusion, our data suggest that EC141 is a potent Hsp90 inhibitor with activity against Ph+ ALL. Further studies to investigate the anticancer effect of EC141 either as a single agent, or in combination in Ph+ ALL and other hematological malignancies are warranted.

  11. Experimental investigation of the Cu/R141b nanofluids on the evaporation/boiling heat transfer characteristics for surface with capillary micro-channels

    Science.gov (United States)

    Diao, Yanhua; Liu, Yan; Wang, Rui; Zhao, Yaohua; Guo, Lei

    2014-09-01

    An experimental study was conducted to investigate the heat transfer characteristic of a vertical copper plate with rectangular micro-channels. In this research, Cu/R141b nanofluids were used as the working fluid. Three different volume concentrations—0.001, 0.01, and 0.1 %—of Cu nanoparticles with an average diameter of 20 nm dispersed in R141b were prepared. Experiments were performed to measure thermal resistance of the microchannel surface under a steady operating pressure range of 0.86 × 105 Pa to 2 × 105 Pa. Thermal resistance weakened with addition of nanoparticles into the base fluid. The maximum reduction effect of the thermal resistance was 50 %, which corresponds to 0.01 % volume concentration of nanofluid at low operating pressure. The operating pressure significantly affects thermal performance of the microchannel surface. This paper also studied heat transfer characteristics for a Cu nanoparticle-coated surface with rectangular microchannels, which were produced by heating in different volume concentrations from 0.001 to 0.1 %. Nanoparticle layer on the micro-channel surface is responsible for enhanced heat transfer of nanofluids with 0.001 and 0.01 % volume concentrations.

  12. Experimental measurements and nuclear model calculations on the excitation functions of $^{nat}Ce(^{3}He, xn)$ and $^{141}$therapeutic radionuclide $^{140}$Nd

    CERN Document Server

    Hilgers, K; Coenen, H H; Qaim, S M

    2005-01-01

    For production of the therapy related Auger electron emitting neutron deficient nuclide /sup 140/Nd (T/sub fraction 1/2/=3.37d) two routes were investigated: the nuclear reaction range from 15 to 36 MeV and the reaction /sup 141/Pr(p,2n)/sup 140isotopes, namely /sup 139/Nd and /sup 141/Nd, as well as to cerium(IV)-oxide and praseodymium (III)-oxide were obtained by sedimentation and the conventional stacked-foil technique was used for cross section measurements. All the experimental data obtained in this work were compared with the results of theoretical calculations using the exciton model code ALICE-IPPE as well as with literature experimental data, if available. In general, good agreement between experimental and theoretical results was found. The theoretical thick target yields of all the product nuclides were calculated from the measured excitation functions. The theoretical thick target yield of amounts to 12 MBq/mu Acenterdoth and over the energy range E/sub p/=30rightward arrow15 Me V to 210 MBq/mu; A...

  13. Expression patterns of miR-34b, miR-34c, and miR-141 during aging and mechanical force application in periodontal ligament cells

    Directory of Open Access Journals (Sweden)

    Sulakshana Koliyath

    2016-01-01

    Full Text Available Background and Objective: Age changes as well as mechanotransduction events in periodontal ligament (PDL cells influence the outcome of mechanical forces as well as physiologic homeostasis in a larger way. Numerous studies have reported changes in inflammatory marker levels as well as cellular density as age advances with PDL fibroblasts as model. MicroRNAs (miRNAs regulate messenger RNAs in either up regulating or down regulating protein synthesis and forms the determinant of cellular function as well as maintenance of tissue homeostasis. No studies till now have utilized in vivo PDL cell model for assessing miRNA levels as age advances and to study their response to mechanical force application. This study forms the first of its kind and evaluated the expression pattern of three miRNAs - miR-34b, miR-34c, and miR-141 - in aging PDL cells as well as with orthodontic force application. Materials and Methods: Twelve subjects were recruited and divided into three groups and subjected to mechanical force application. First premolar teeth designated for extraction were selected as specimens from the first three groups (Groups A-C. Mechanical force was applied to first premolar teeth designated for therapeutic extraction as part of orthodontic treatment for 21 days in the fourth group (Group D. All teeth were carefully extracted, and PDL from middle third of the root was scraped with a scalpel. Cells isolated from aged as well as mechanical force applied human premolar teeth were subjected to reverse transcriptase polymerase chain reaction, miRNA analysis, and quantification with ImageJ software. Results: Age-dependent changes in miRNA - looking at the expression bands, miR-141 showed significant change in the Group C specimens when compared to other two groups. The expression of miR-34b and miR-34c showed a steady increase as age advanced with Group C values being significantly different statistically from Groups A and B. Mechanical force

  14. Rate constant for the reaction of OH with CH3CCl2F (HCFC-141b) determined by relative rate measurements with CH4 and CH3CCl3

    Science.gov (United States)

    Huder, Karin; Demore, William B.

    1993-01-01

    Determination of accurate rate constants for OH abstraction is of great importance for the calculation of lifetimes for HCFCs and their impact on the atmosphere. For HCFC-141b there has been some disagreement in the literature for absolute measurements of this rate constant. In the present work rate constant ratios for HCFC-141b were measured at atmospheric pressure in the temperature range of 298-358 K, with CH4 and CH3CCl3 as reference gases. Ozone was photolyzed at 254 nm in the presence of water vapor to produce OH radicals. Relative depletions of 141b and the reference gases were measured by FTIR. Arrhenius expressions for 141b were derived from each reference gas and found to be in good agreement with each other. The combined expression for HCFC-141b which we recommend is 1.4 x 10 exp -12 exp(-1630/T) with k at 298 K being 5.9 x 10 exp -15 cu cm/molec-s. This value is in excellent agreement with the JPL 92-20 recommendation.

  15. Immediate haemodynamic effects of a novel partial agonist, beta 1-adrenoceptor blocking drug ICI 141,292 after intravenous administration to healthy young volunteers and patients with ischaemic heart disease

    DEFF Research Database (Denmark)

    Bonde, J; Svendsen, T L; Lyngborg, K

    1987-01-01

    decreased approximately 8% following all three doses of ICI 141,292 and 14.9% after atenolol 5 mg. No changes in blood pressure were observed under resting conditions after any of the drugs. In six patients with ischaemic heart disease the intrinsic sympathomimetic activity following intravenous...... were administered intravenously. The attenuation in exercise induced tachycardia varied between 16.0 and 21.2% (P less than 0.01). A significant reduction in blood pressure could be demonstrated following all three doses of ICI 141,292 and atenolol during exercise. At rest in the sitting position HR....... No significant changes were observed in mean arterial blood pressure, stroke volume or total peripheral resistance whereas an increase in supine resting mean pulmonary arterial pressure of 3.4 mm Hg (P less than 0.05) could be demonstrated. ICI 141,292 seems to be a potent (at least five times as potent...

  16. Chemical characterization of a prominent phosphomonoester resonance from mammalian brain. 31P and 1H NMR analysis at 4.7 and 14.1 tesla

    Science.gov (United States)

    Pettegrew, J. W.; Kopp, S. J.; Dadok, J.; Minshew, N. J.; Feliksik, J. M.; Glonek, T.; Cohen, M. M.

    A prominent 31P NMR resonance at 3.84 ppm in mammalian brain has been identified as ethanolamine phosphate. The identification was based on 1H and 31P NMR findings (including pH titrations) at 4.7 and 14.1 T, as well as thin-layer chromatography studies. We previously incorrectly assigned the 3.84 ppm resonance to ribose-5-phosphate. The incorrect assignment occurred because the two compounds have very similar 31P chemical shifts, and because we did not carefully consider the effects of counter ions and ionic strengths when interpreting the 31P chemical shifts. In separate preliminary studies we have demonstrated ethanolamine phosphate to be high in immature developing brain and in the degenerating brain of Alzheimer's and Huntington's disease patients. Ethanolamine phosphate may therefore serve as a sensitive marker of membrane phospholipid turnover for both in vitro and in vivo31P NMR studies.

  17. Determination of neutron capture cross sections of 232Th at 14.1 MeV and 14.8 MeV using the neutron activation method

    Science.gov (United States)

    Lan, Chang-Lin; Zhang, Yi; Lv, Tao; Xie, Bao-Lin; Peng, Meng; Yao, Ze-En; Chen, Jin-Gen; Kong, Xiang-Zhong

    2017-04-01

    The 232Th(n, γ)233Th neutron capture reaction cross sections were measured at average neutron energies of 14.1 MeV and 14.8 MeV using the activation method. The neutron flux was determined using the monitor reaction 27Al(n,α)24Na. The induced gamma-ray activities were measured using a low background gamma ray spectrometer equipped with a high resolution HPGe detector. The experimentally determined cross sections were compared with the data in the literature, and the evaluated data of ENDF/B-VII.1, JENDL-4.0u+, and CENDL-3.1. The excitation functions of the 232Th(n,γ)233Th reaction were also calculated theoretically using the TALYS1.6 computer code. Supported by Chinese TMSR Strategic Pioneer Science and Technology Project-The Th-U Fuel Physics Term (XDA02010100) and National Natural Science Foundation of China (11205076, 21327801)

  18. De fines y elecciones pirrónicos. Un análisis comparativo de DL 9.107-8 y M 11.141-67

    Directory of Open Access Journals (Sweden)

    Alfonso Correa Motta

    2015-01-01

    Full Text Available El artículo presenta un análisis comparativo de los últimos parágrafos de la Vida de Pirrón de Diógenes Laercio (9.107-8 y de un capítulo del Adversus ethicos de Sexto Empírico (M 11.[5].141-67. Los resultados de este análisis harán plausible la hipótesis de una fuente común, reproducida parcialmente en DL, pero elaborada y refinada en Sexto. En ambos textos son centrales las nociones de fin y de elección. Se presentan las diferencias entre ambos textos entorno a la primera, y las tensiones internas comunes que implica el tratamiento de la segunda.

  19. The broad-band X-ray spectra of Mrk 926, 4U 1344-60 and ESO 141-G055

    Science.gov (United States)

    Lohfink, Anne; Fabian, Andrew C.; Buisson, Douglas; Kara, Erin; Reynolds, Christopher S.

    2017-08-01

    Mrk 926, 4U 1344-60 and ESO 141-G055 are bright Seyfert 1 galaxies that contrary to many of the Seyfert 1s studied in-depth with NuSTAR do not show signs of relativistic reflection. We present results from the spectroscopic analyses of simultaneous Swift-NuSTAR or in case of Mrk 926 XMM-NuSTAR observations of these three AGN. The broad-band spectral coverage and the simplicity of the spectra allows us to measure the primary emission with great accuracy. We use the results from our spectral studies and others in the literature to explore whether the differences in reflection-strength in bright Seyfert 1s coincide with any differences in the Comptonization parameters. This allows us to test the hypothesis that the detection of a relativistic reflection component is geometry-driven.

  20. Label-free and reagentless electrochemical detection of microRNAs using a conducting polymer nanostructured by carbon nanotubes: application to prostate cancer biomarker miR-141.

    Science.gov (United States)

    Tran, H V; Piro, B; Reisberg, S; Tran, L D; Duc, H T; Pham, M C

    2013-11-15

    In this paper, a label-free and reagentless microRNA sensor based on an interpenetrated network of carbon nanotubes and electroactive polymer is described. The nanostructured polymer film presents very well-defined electroactivity in neutral aqueous medium in the cathodic potential domain from the quinone group embedded in the polymer backbone. Addition of microRNA miR-141 target (prostate cancer biomarker) gives a "signal-on" response, i.e. a current increase due to enhancement of the polymer electroactivity. On the contrary, non-complementary miRNAs such as miR-103 and miR-29b-1 do not lead to any significant current change. A very low detection limit of ca. 8 fM is achieved with this sensor. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Fast neutrons from thick deuterium target irradiated by 15.8 MeV protons and 14.1 MeV deuterons

    CERN Document Server

    Bem, P; Cvachovec, F; Götz, M; Kroha, V; Nikolskii, E Y; Simeckova, E; Vincour, J

    1999-01-01

    The energy spectra of neutrons emitted by a thick deuterium target at 0 deg. angle, irradiated by a beam of 15.8 MeV protons and 14.1 MeV deuterons were measured in an open geometry with a stilbene scintillator and with a two-dimensional n-gamma discrimination technique. The evaluated spectral yields were compared with those of p+Be and d+Be reactions at relevant energies. This comparison shows that the D-target spectra are substantially harder having small relative contribution of low-energy neutrons, which makes these reactions useful as intense neutron sources for biomedical and analytical purposes. The total neutron yield from the d+D reaction is in good agreement with values calculated from published differential cross-section data. The p+D reaction seems to be the most effective fast neutron source, based on low-energy (E<40 MeV) cyclotrons.

  2. Association between Virulence Factors and TRAF1/4-1BB/Bcl-xL Expression in Gastric Mucosa Infected with Helicobacter pylori

    Directory of Open Access Journals (Sweden)

    Fen Wang

    2015-01-01

    Full Text Available Objective. CagA+/vacAs1+/vacAm1+ Helicobacter pylori upregulates the expression of tumor necrosis factor receptor–associated factor 1 (TRAF1, tumor necrosis factor receptor superfamily member 9 (4-1BB, and B-cell lymphoma-extra large (Bcl-xL in human gastric epithelial cells. We investigated the correlation between cagA/vacAs1/vacAm1 and TRAF1/4-1BB/Bcl-xL expression in gastric mucosal tissue of patients with gastric disorders. Methods. We collected gastric mucosa samples from 35 chronic, nonatrophic gastritis (CG patients, 41 atrophic gastritis patients, 44 intestinal metaplasia with atypical hyperplasia (IM patients, and 28 gastric carcinoma (Ca patients. The expression of  TRAF1, 4-1BB, and Bcl-xL was determined using western blotting. The expression of cagA, vacAs1, and vacAm1 in H. pylori was examined with polymerase chain reaction. Results. The expression of TRAF1, 4-1BB, and Bcl-xL was significantly upregulated in IM and Ca patients (P<0.05 compared with CG. There were more cases of cagA+/vacAs1+/vacAm1+ H. pylori infection in samples with elevated TRAF1, 4-1BB, or Bcl-xL expression (P<0.05. Additionally, there were a remarkably large number of samples with upregulated TRAF1/4-1BB/Bcl-xL expression in cases of cagA+/vacAs1+/vacAm1+ H. pylori infection (44 cases, 67.7%; P<0.05. Conclusions. The pathogenesis of IM and Ca may be promoted by cagA+/vacAs1+/vacAm1+ H. pylori, possibly via upregulated TRAF1, 4-1BB, and Bcl-xL in gastric mucosal tissue.

  3. Study of Polymorphism of the DRD2 Gene (-141C Ins/Del, rs1799732 with Attention Deficit Hyperactivity Disorder a Population Sample of Children in Iranian-Azeri

    Directory of Open Access Journals (Sweden)

    Leila Mehdizadeh Fanid

    2017-03-01

    Full Text Available BackgroundAttention deficit hyperactivity disorder (ADHD, is a multifactorial disorder and converging evidence has implicated abnormalities of dopamine neurotransmission. The aim of this study was to examine the association of -141 polymorphisms in DRD2 gene with ADHA among Iranian-Azeri population.Materials and Methods A case–control association study included 153 patients with attention deficit hyper activity disorder (case group, and 133 healthy subjects (control group. Genomic DNA was extracted peripheral blood samples by salting-out method. Single nucleotide polymorphism (SNP genotyping was performed by Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP technique. The data analysis was performed through Chi-square, with a significance level of 0.05.Results: There was not significant difference in the allele and genotype frequencies between ADHD and -141C Ins/Del polymorphism in cases and controls (P>0.05. Ins/Ins homozygous dominants were more frequent in control group than the case group, but there was not significant difference observed (P>0.05. Del/Del homozygous dominants were not observed. No significant difference was detected in the allele and genotype frequencies between ADHD and -141 Insertion/Deletion polymorphism in cases and control groups (P>0.05.ConclusionOur results do not detected association between the -141C Ins/Del, rs1799732, polymorphism and ADHD disorder in population of Children in Iranian-Azeri.

  4. High prevalence of Arginine to Glutamine Substitution at 98, 141 and 162 positions in Troponin I (TNNI3 associated with hypertrophic cardiomyopathy among Indians

    Directory of Open Access Journals (Sweden)

    Rani Deepa

    2012-08-01

    Full Text Available Abstract Background Troponin I (TNNI3 is the inhibitory subunit of the thin filament regulatory complex Troponin, which confers calcium-sensitivity to striated muscle actomyosin ATPase activity. Mutations (2-7% in this gene had been reported in hypertrophic cardiomyopathy patients (HCM. However, the frequencies of mutations and associated clinical presentation have not been established in cardiomyopathy patients of Indian origin, hence we have undertaken this study. Methods We have sequenced all the exons, including the exon-intron boundaries of TNNI3 gene in 101 hypertrophic cardiomyopathy patients (HCM, along with 160 healthy controls, inhabited in the same geographical region of southern India. Results Our study revealed a total of 16 mutations. Interestingly, we have observed Arginine to Glutamine (R to Q mutation at 3 positions 98, 141 and 162, exclusively in HCM patients with family history of sudden cardiac death. The novel R98Q was observed in a severe hypertrophic obstructive cardiomyopathy patient (HOCM. The R141Q mutation was observed in two familial cases of severe asymmetric septal hypertrophy (ASH++. The R162Q mutation was observed in a ASH++ patient with mean septal thickness of 29 mm, and have also consists of allelic heterogeneity by means of having one more synonymous (E179E mutation at g.4797: G → A: in the same exon 7, which replaces a very frequent codon (GAG: 85% with a rare codon (GAA: 14%. Screening for R162Q mutation in all the available family members revealed its presence in 9 individuals, including 7 with allelic heterogeneity (R162Q and E179E of which 4 were severely affected. We also found 2 novel SNPs, (g.2653; G → A and g.4003 C → T exclusively in HCM, and in silico analysis of these SNPs have predicted to cause defect in recognition/binding sites for proteins responsible for proper splicing. Conclusion Our study has provided valuable information regarding the prevalence of TNNI3 mutations in

  5. The sex-linked region in Populus tremuloides Turesson 141 corresponds to a pericentromeric region of about two million base pairs on P. trichocarpa chromosome 19.

    Science.gov (United States)

    Kersten, B; Pakull, B; Groppe, K; Lueneburg, J; Fladung, M

    2014-03-01

    In the dioecious genus Populus, sex determination has been located to chromosome 19. However, despite a high degree of genome collinearity, various Populus species seem to differ with regard to the location of the sex-determining region on the respective chromosome and the apparent heterogametic sex. In this study, the boundaries of the recombination-suppressed, sex-linked region of the male P. tremuloides clone Turesson 141 were localised by genetic mapping using new SNP and InDel markers. The respective region seems to be located in a pericentromeric position. The corresponding P. trichocarpa genome region spans about two million bp and comprises 65 gene loci, which were bioinformatically evaluated for their potential as candidate genes for sex determination. Three putative transcription factor genes and four genes that are potentially involved in flower development processes, e.g. meristem transition from the vegetative to the reproductive phase, were identified. Populus tremuloides sequence data of the sex-linked region is required for a final search for candidate genes. © 2013 German Botanical Society and The Royal Botanical Society of the Netherlands.

  6. Magnetic-crystallographic p,T-phase diagram of Fe{sub 1.141}Te: A high-pressure neutron diffraction study

    Energy Technology Data Exchange (ETDEWEB)

    Joergensen, Jens-Erik [Department of Chemistry, Aarhus University (Denmark); Hansen, Thomas Christian [Institute Max von Laue-Paul Langevin, Grenoble (France)

    2016-11-15

    The crystal and magnetic structures of Fe{sub 1.141}Te have been studied by neutron powder diffraction in the temperature range from 5 to 106 K and pressures in the range from ambient to ∼2.7 GPa. The p,T-phase diagram contains three phases with monoclinic, orthorhombic, and tetragonal symmetry. The monoclinic phase was found to be stable for T 2.16 GPa. The monoclinic phase shows commensurate bicollinear antiferromagnetic order with propagation vector k = (1/2 0 1/2), while the orthorhombic phase is incommensurately antiferromagnetically ordered with propagation vector k = (1/2-δ 0 1/2). The δ-parameter increases linearly with the pressure for 0.4 or similar 2.1 GPa and temperatures less than ∝68 K, depending on the pressure. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  7. Two apolipoprotein E mimetic peptides, ApoE(130-149) and ApoE(141-155)2, bind to LRP1.

    Science.gov (United States)

    Croy, Johnny E; Brandon, Theodore; Komives, Elizabeth A

    2004-06-15

    LRP1 is a cell surface receptor responsible for clearing some 30 known ligands. We have previously shown that each of the three complete LDL receptor-homology domains of the LRP1 extracellular domain (sLRPs) binds apoE-enriched beta-VLDL particles. Here we show that two peptides from the N-terminal receptor binding domain of apoE, which are known to elicit a number of different cellular responses, bind to LRP1. Solution binding assays show that the two peptides, apoE(130-149) and apoE(141-155)(2), interact with each of the sLRPs (2, 3, and 4). Each peptide was found to exhibit the same solution binding characteristics as apoE-enriched beta-VLDL particles. Surface plasmon resonance analyses of the sLRP-apoE peptide interaction show that both peptides bind the sLRPs with K(D) values in the 100 nM range, a value similar to the effective concentration required for observation of the cellular responses. Consistent with results from mutagenesis studies of binding of apoE to LDLR, apoE(130-149,Arg142Glu) bound with a K(D) similar to that of the wild-type sequence, while apoE(130-149,Lys143Glu) showed a 10-fold decrease in K(D). Each of the peptides bound heparin, and heparin competed for sLRP binding.

  8. N,N′,N′′-Tris(2-nitrobenzyl-2,2′,2′′-nitrilotriethanaminium trichloride 1.41-hydrate

    Directory of Open Access Journals (Sweden)

    Perla Elizondo

    2009-07-01

    Full Text Available The title compound, C27H36N7O63+·3Cl−1.41H2O, is the hydrochloride of a tripodal amine, and was structurally characterized because the free base, used as a ligand in podate complexes, is an oily material. In the cation, the secondary amine groups are protonated, and, despite the induced Coulombic repulsions, a claw-like conformation is stabilized, with a cavity approximating C3 point symmetry. Such a topology, with the lone pair of the tertiary N atom placed inside the cavity, allows the encapsulation of guest species. Indeed, three chloride counter-ions balance the charges, one of which is located inside the cation cavity and is strongly bonded to the NH2+ groups. The asymmetric unit is completed by two water molecules with occupancies 0.793 (11 and 0.621 (9. The crystal structure is formed by a complex network of efficient N—H...Cl and O—H...Cl hydrogen bonds. One nitro group also forms weak contacts with a water molecule.

  9. Solvent hold tank sample results for MCU-17-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017): Quarterly Report

    Energy Technology Data Exchange (ETDEWEB)

    Fondeur, F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Jones, D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-09-13

    A trend summary of four Solvent Hold Tank (SHT) monthly samples; MCU-16-122-124 (March 2017), MCU-17-130-132 (April 2017), MCU-17-133-135 (May 2017), and MCU-17-141-149 (June 2017) are reported. Analyses of the June SHT sample (MCU-17-141-149) indicated that the modifier (CS-7SB) and the extractant (MaxCalix) concentrations were slightly below (4% each) their nominal recommended levels (169,000 mg/L and 46,400 mg/L respectively). The suppressor (TiDG) level has decreased since the January 2017 measurement but has remained steady in the range of 666 to 705 mg/L, well above the minimum recommended level (479 mg/L), but below the nominal level. The “flat” trends observed in the TiDG, MaxCalix, modifier, and Gamma measurement are consistent with the solvent being idle since January 10, 2017.

  10. A Pressure-distribution Investigation of the Aerodynamic Characteristics of a Body of Revolution in the Vicinity of a Reflection Plane at Mach Numbers of 1.41 and 2.01

    Science.gov (United States)

    Gapcynski, John P; Carlson, Harry W

    1955-01-01

    The changes in the aerodynamic characteristics of a body of revolution with a fineness ratio of 8 have been determined at Mach numbers of 1.41 and 2.01, a Reynolds number, based on body length, of 4.54 x 10 to the 6th power, and angles of incidence of 0 degrees and plus or minus 3 degrees as the position of the body is varied with respect to a reflection plane. The data are compared with theoretical results.

  11. Inelastic scattering of neutrons by spin waves in terbium

    DEFF Research Database (Denmark)

    Bjerrum Møller, Hans; Houmann, Jens Christian Gylden

    1966-01-01

    Measurements of spin-wave dispersion relations for magnons propagating in symmetry directions in ferromagnetic Tb; it is first experiment to give detailed information on magnetic excitations in heavy rare earths; Tb was chosen for these measurements because it is one of few rare-earth metals whic...... does not have very high thermal-neutron capture cross section, so that inelastic neutron scattering experiments can give satisfactory information on magnon dispersion relations....

  12. Coherent magnetic structures in terbium/holmium superlattices

    DEFF Research Database (Denmark)

    Bryn-Jacobsen, C.; Cowley, R.A.; McMorrow, D.F.

    1997-01-01

    Neutron-scattering techniques have been used to investigate the magnetic properties of three Tb/Ho superlattices grown by molecular-beam epitaxy. It is revealed that for temperatures in the range T = 10 to T-N(Ho)approximate to 130 K, there is a basal-plane ferromagnetic alignment of Tb moments w...

  13. Cytochrome P450 Monooxygenase CYP716A141 is a Unique β-Amyrin C-16β Oxidase Involved in Triterpenoid Saponin Biosynthesis in Platycodon grandiflorus.

    Science.gov (United States)

    Tamura, Keita; Teranishi, Yuga; Ueda, Shinya; Suzuki, Hideyuki; Kawano, Noriaki; Yoshimatsu, Kayo; Saito, Kazuki; Kawahara, Nobuo; Muranaka, Toshiya; Seki, Hikaru

    2017-05-01

    The roots of Platycodon grandiflorus are widely used as a crude drug. The active components include a variety of triterpenoid saponins. Recent studies have revealed that Cyt P450 monooxygenases (P450s) function as triterpene oxidases in triterpenoid saponin biosynthesis in many plant species. However, there have been no reports regarding triterpene oxidases in P. grandiflorus. In this study, we performed transcriptome analysis of three different P. grandiflorus tissues (roots, leaves and petals) using RNA sequencing (RNA-Seq) technology. We cloned six P450 genes that were highly expressed in roots, and classified them as belonging to the CYP716A, CYP716D and CYP72A subfamilies. We heterologously expressed these P450s in an engineered yeast strain that produces β-amyrin, one of the most common triterpenes in plants. Two of the CYP716A subfamily P450s catalyzed oxidation reactions of the β-amyrin skeleton. One of these P450s, CYP716A140v2, catalyzed a three-step oxidation reaction at C-28 on β-amyrin to produce oleanolic acid, a reaction performed by CYP716A subfamily P450s in a variety of plant species. The other P450, CYP716A141, catalyzed the hydroxylation of β-amyrin at C-16β. This reaction is unique among triterpene oxidases isolated to date. These results enhance our knowledge of functional variation among CYP716A subfamily enzymes involved in triterpenoid biosynthesis, and provide novel molecular tools for use in synthetic biology to produce triterpenoid saponins with pre-defined structures. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  14. Thyroid cancer GWAS identifies 10q26.12 and 6q14.1 as novel susceptibility loci and reveals genetic heterogeneity among populations.

    Science.gov (United States)

    Mancikova, Veronika; Cruz, Raquel; Inglada-Pérez, Lucía; Fernández-Rozadilla, Ceres; Landa, Iñigo; Cameselle-Teijeiro, José; Celeiro, Catuxa; Pastor, Susana; Velázquez, Antonia; Marcos, Ricard; Andía, Victor; Álvarez-Escolá, Cristina; Meoro, Amparo; Schiavi, Francesca; Opocher, Giuseppe; Quintela, Inés; Ansede-Bermejo, Juan; Ruiz-Ponte, Clara; Santisteban, Pilar; Robledo, Mercedes; Carracedo, Angel

    2015-10-15

    Thyroid cancer is the most heritable cancer of all those not displaying typical Mendelian inheritance. However, most of the genetic factors that would explain the high heritability remain unknown. Our aim was to identify additional common genetic variants associated with susceptibility to this disease. In order to do so, we performed a genome-wide association study in a series of 398 cases and 502 controls from Spain, followed by a replication in four well-defined Southern European case-control collections contributing a total of 1,422 cases and 1,908 controls. The association between the variation at the 9q22 locus near FOXE1 and thyroid cancer risk was consistent across all series, with several SNPs identified (rs7028661: OR = 1.64, p = 1.0 × 10(-22) , rs7037324: OR = 1.54, p = 1.2 × 10(-17) ). Moreover, the rare alleles of three SNPs (rs2997312, rs10788123 and rs1254167) at 10q26.12 showed suggestive evidence of association with higher risk of the disease (OR = 1.35, p = 1.2 × 10(-04) , OR = 1.26, p = 5.2 × 10(-04) and OR = 1.38, p = 5.9 × 10(-05) , respectively). Finally, the rare allele of rs4075570 at 6q14.1 conferred protection in the series studied (OR = 0.82, p = 2.0 × 10(-04) ). This study suggests that heterogeneity in genetic susceptibility between populations is a key feature to take into account when exploring genetic risk factors related to this disease. © 2015 UICC.

  15. Experimental myocardial infarct imaging following intravenous administration of iodine-131 labeled antibody (Fab')/sub 2/ fragments specific for cardiac myosin. [/sup 141/Ce scintiscanning

    Energy Technology Data Exchange (ETDEWEB)

    Khaw, B.A.; Beller, G.A.; Harber, E.

    1978-04-01

    Canine myocardial infarcts resulting from ligation of the left anterior descending coronary artery were localized in vivo by gamma scintigraphy following the intravenous injection of /sup 131/I anticardiac myosin antibody (Fab')/sub 2/. The anteroapical location of the image was confirmed by demonstration of the blood pool with /sup 99m/Tc sulfur colloid, and by subsequent imaging of the excised heart. The scintigram of the excised heart, following prior in vivo injection of /sup 141/Ce-microspheres, showed a region of diminished radioactivity near the apex which corresponded precisely to the region of /sup 131/I antibody (Fab')/sub 2/ uptake. Well defined areas of /sup 131/I antibody (Fab')/sub 2/ activity in the region of infarction were consistently imaged at 48 hours in animals in which the ligature occluding the coronary artery was released at 5 hours; 72 hours were at times required when coronary occlusion persisted throughout the experiment. In both reflow and persistent occlusion models, the concentration of /sup 131/I antibody (Fab')/sub 2/ was inversely related to blood flow as determined from microsphere distribution in the region of infarction; though in areas of equivalent flow (0 to 20% of normal) the mean concentration ratio of antibody uptake to normal tissue was 20.7 +- 2.2 in the reflow model as compared to 11.4 +- 0.7 in the persistent occlusion model. A reduction in blood flow to the affected area of <50% of normal did not result in the production of a localized scintigraphic image.

  16. COPPER-64 Production Studies with Natural Zinc Targets at Deuteron Energy up to 19 Mev and Proton Energy from 141 Down to 31 Mev

    Science.gov (United States)

    Bonardi, Mauro L.; Birattari, Claudio; Groppi, Flavia; Song Mainard, Hae; Zhuikov, Boris L.; Kokhanyuk, Vladimir M.; Lapshina, Elena V.; Mebel, Michail V.; Menapace, Enzo

    2004-07-01

    High specific activity no-carrier-added 64Cu is a β-/β+ emitting radionuclide of increasing interest for PET imaging, as well as systemic and targeted radioimmunotherapy of tumors. Its peculiarity of intense Auger emitter is still under investigation. The cross-sections for production of 64Cu from Zn target of natural isotopic composition were measured in the deuteron energy range from threshold up to 19 MeV and proton energy range from 141 down to 31 MeV. The stacked-foil technique was used at both K=38 cyclotron of JRC-Ispra of CEC, Italy and 160 MeV intersection point of INR proton-LINAC in Troitsk, Russia. Several Ga, Zn, Cu, Ni, Co, V, Fe and Mn radionuclides were detected in Zn targets at the EOB. Optimized irradiation conditions are reported as a function of deuteron energy and energy loss into the Zn target, as well as target irradiation time and cooling time after radiochemistry. The activity of n.c.a. 64Cu was measured through its only γ emission of 1346 keV (i.e. 0.473 % intensity) both by instrumental and radiochemical methods, due to the non-specificity of annihilation radiation at 511 keV. To this last purpose, it was necessary to carry out a selective radiochemical separation of GaIII radionuclides by liquid/liquid extraction from the bulk of irradiated Zn targets and other spallation products, which remained in the 7 M HCl aqueous phase. Anion exchange chromatography tests had been carried out to separate the 64Cu from all others radionuclides in n.c.a. form. Theoretical calculations of cross-sections were performed with codes EMPIRE II and PENELOPE for deuteron reactions and CEF model and HMS-ALICE hybrid model for proton reactions. The theoretical results are presented and compared with the experimental values.

  17. Peripheral phosphodiesterase 4 inhibition produced by 4-[2-(3,4-Bis-difluoromethoxyphenyl)-2-[4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)-phenyl]-ethyl]-3-methylpyridine-1-oxide (L-826,141) prevents experimental autoimmune encephalomyelitis

    DEFF Research Database (Denmark)

    Moore, Craig S.; Earl, Nathalie; Frenette, Richard

    2006-01-01

    observed. Only L-826,141 at a dose of 30 mg/kg p.o. significantly decreased the clinical severity of EAE compared with vehicle controls. Immunohistochemical detection of the neuronal activity marker Fos confirmed that L-826,141 did not reach concentrations in the central nervous system sufficient...... demonstrate that peripheral PDE4 inhibition, produced by L-826,141, prevents the progression of EAE after the first onset of clinical signs, and suggest that similar compounds may have clinical efficacy in the treatment of MS....

  18. Association of N176K and L141F dimorphisms of the PRNP gene with lack of pathological prion protein deposition in placentas of naturally and experimentally scrapie-affected ARQ/ARQ sheep.

    Science.gov (United States)

    Santucciu, Cinzia; Maestrale, Caterina; Madau, Laura; Attene, Sonia; Cancedda, Maria Giovanna; Demontis, Franca; Tilocca, Maria Giovanna; Saba, Mariangela; Macciocu, Simona; Carta, Antonello; Ligios, Ciriaco

    2010-09-01

    The placenta is important in the horizontal transmission of the aetiological agent in scrapie-affected sheep. It has been demonstrated that the placentas of fetuses carrying the dimorphism Q171R of the PRNP gene is resistant to pathological prion protein (PrP(Sc)) accumulation in the placenta. To test whether other PRNP polymorphisms are associated with a lack of placental PrP(Sc) deposition, we carried out a study on 26 naturally and 11 experimentally scrapie-affected ewes with or without clinical signs. PrP(Sc) was detected in the placenta of ARQ/ARQ(wild type) fetuses by Western blot and immunohistochemical analysis, but not in ARQN(176)/ARQK(176) or, as expected, ARQ/ARR samples. Furthermore, three of four AL(141)RQ/AF(141)RQ placentas were also PrP(Sc) negative, suggesting that the dimorphism at codon 141 may also mediate placental deposition of PrP(Sc). This finding demonstrates for the first time that fetal PRNP polymorphisms, other than those at codon 171, are associated with the lack of placental deposition of PrP(Sc).

  19. EAST AFRICAN MEDICAL JOURNAL 141

    African Journals Online (AJOL)

    2007-03-01

    Mar 1, 2007 ... tooth or periodontal ligament (5-7). Myxomas are predominantly found in young adults but may occur over a wide age range, the average age being 25 to ... dental surgeon extracted the tooth en bloc with the associated swelling. Although healing of the extraction socket was uneventful the swelling re-.

  20. WASP-South transiting exoplanets: WASP-130b, WASP-131b, WASP-132b, WASP-139b, WASP-140b, WASP-141b and WASP-142b

    Science.gov (United States)

    Hellier, C.; Anderson, D. R.; Cameron, A. Collier; Delrez, L.; Gillon, M.; Jehin, E.; Lendl, M.; Maxted, P. F. L.; Neveu-VanMalle, M.; Pepe, F.; Pollacco, D.; Queloz, D.; Ségransan, D.; Smalley, B.; Southworth, J.; Triaud, A. H. M. J.; Udry, S.; Wagg, T.; West, R. G.

    2017-03-01

    We describe seven exoplanets transiting stars of brightness V = 10.1-12.4. WASP-130b is a 'warm Jupiter' having an orbital period of 11.6 d around a metal-rich G6 star. Its mass and radius (1.23 ± 0.04 MJup and 0.89 ± 0.03 RJup) support the trend that warm Jupiters have smaller radii than hot Jupiters. WASP-131b is a bloated Saturn-mass planet (0.27 MJup and 1.22 RJup). Its large scaleheight and bright (V = 10.1) host star make it a good target for atmospheric characterization. WASP-132b (0.41 MJup and 0.87 RJup) is among the least irradiated and coolest of WASP planets, having a 7.1-d orbit around a K4 star. WASP-139b is a 'super-Neptune' akin to HATS-7b and HATS-8b, being the lowest mass planet yet found by WASP (0.12 MJup and 0.80 RJup). The metal-rich K0 host star appears to be anomalously dense, akin to HAT-P-11. WASP-140b is a 2.4-MJup planet in an eccentric (e = 0.047 ± 0.004) 2.2-d orbit. The planet's radius is large (1.4 RJup), but uncertain owing to the grazing transit (b = 0.93). The 10.4-d rotation period of the K0 host star suggests a young age, and the time-scale for tidal circularization is likely to be the lowest of all known eccentric hot Jupiters. WASP-141b (2.7 MJup, 1.2 RJup and P = 3.3 d) and WASP-142b (0.84 MJup, 1.53 RJup and P = 2.1 d) are typical hot Jupiters orbiting metal-rich F stars. We show that the period distribution within the hot-Jupiter bulge does not depend on the metallicity of the host star.

  1. Pattern dystrophy with high intrafamilial variability associated with Y141C mutation in the peripherin/RDS gene and successful treatment of subfoveal CNV related to multifocal pattern type with anti-VEGF (ranibizumab) intravitreal injections.

    Science.gov (United States)

    Vaclavik, Veronika; Tran, Hoai V; Gaillard, Marie-Claire; Schorderet, Daniel F; Munier, Francis L

    2012-10-01

    To identify disease causing mutation in three generations of a Swiss family with pattern dystrophy and high intrafamilial variability of phenotype. To assess the effect of intravitreal ranibizumab injections in the treatment of subfoveal choroidal neovascularization associated with pattern dystrophy in one patient. Affected family members were ascertained for phenotypic and genotypic characterization. Ophthalmic evaluations included fundus photography, autofluorescence imaging, optical coherence tomography, and International Society for Clinical Electrophysiology of Vision standard full-field electroretinography. When possible family members had genetic testing. The proband presented with choroidal neovascularization and had intravitreal injections as needed according to visual acuity and optical coherence tomography. Proband had a multifocal type pattern dystrophy, and his choroidal neovascularization regressed after four intravitreal injections. The vision improved from 0.8 to 1.0, and optical coherence tomography showed complete anatomical restoration. A butterfly-shaped pattern was observed in her cousin, whereas a fundus pulverulentus pattern was seen in a second cousin. Aunt had a multifocal atrophic appearance, simulating geographic atrophy in age-related macular degeneration. The Y141C mutation was identified in the peripherin/RDS gene and segregated with disease in the family. This is the first report of marked intrafamilial variation of pattern dystrophy because of peripherin/RDS Y141C mutation. Intravitreal ranibizumab injections might be a valuable treatment for associated subfoveal choroidal neovascularization.

  2. Cross sections of the 144Sm(n,α141Nd and 66Zn(n,α63Ni reactions at 4.0, 5.0 and 6.0 MeV

    Directory of Open Access Journals (Sweden)

    Yury Gledenov

    2017-01-01

    Full Text Available Cross sections of the 144Sm(n,α141Nd and 66Zn(n,α63Ni reactions were measured at En = 4.0, 5.0 and 6.0 MeV performed at the 4.5-MV Van de Graaff Accelerator of Peking University, China. A double-section gridded ionization chamber was used to detect the alpha particles. The foil samples of 144Sm2O3 and enriched 66Zn were placed at the common cathode plate of the chamber. Monoenergetic neutrons were produced by a deuterium gas target through the 2H(d,n3He reaction. The neutron flux was monitored by a BF3 long counter. Cross sections of the 238U(n,f reaction were used as the standard to perform the (n,α reaction measurement. Present results are compared with existing measurements and evaluations. They are generally in agreement with TALYS-1.6 code calculations. For the 144Sm(n,α141Nd reaction our measurements support the data of JEF-2.2. For the 66Zn(n,α63Ni reaction present results support the data of EAF-2010 and TENDL-2015 data.

  3. Cross sections of the 144Sm(n,α)141Nd and 66Zn(n,α)63Ni reactions at 4.0, 5.0 and 6.0 MeV

    Science.gov (United States)

    Yury, Gledenov; Guohui, Zhang; Khuukhenkhuu, Gonchigdorj; Milana, Sedysheva; Lubos, Krupa; Sansarbayar, Enkhbold; Igor, Chuprakov; Zhimin, Wang; Xiao, Fan; Luyu, Zhang; Huaiyong, Bai

    2017-09-01

    Cross sections of the 144Sm(n,α)141Nd and 66Zn(n,α)63Ni reactions were measured at En = 4.0, 5.0 and 6.0 MeV performed at the 4.5-MV Van de Graaff Accelerator of Peking University, China. A double-section gridded ionization chamber was used to detect the alpha particles. The foil samples of 144Sm2O3 and enriched 66Zn were placed at the common cathode plate of the chamber. Monoenergetic neutrons were produced by a deuterium gas target through the 2H(d,n)3He reaction. The neutron flux was monitored by a BF3 long counter. Cross sections of the 238U(n,f) reaction were used as the standard to perform the (n,α) reaction measurement. Present results are compared with existing measurements and evaluations. They are generally in agreement with TALYS-1.6 code calculations. For the 144Sm(n,α)141Nd reaction our measurements support the data of JEF-2.2. For the 66Zn(n,α)63Ni reaction present results support the data of EAF-2010 and TENDL-2015 data.

  4. Measurements of the differential cross sections for the elastic n-3H and n-2H scattering at 14.1 MeV by using an inertial confinement fusion facility.

    Science.gov (United States)

    Frenje, J A; Li, C K; Seguin, F H; Casey, D T; Petrasso, R D; McNabb, D P; Navratil, P; Quaglioni, S; Sangster, T C; Glebov, V Yu; Meyerhofer, D D

    2011-09-16

    For the first time the differential cross section for the elastic neutron-triton (n-(3)H) and neutron-deuteron (n-(2)H) scattering at 14.1 MeV has been measured by using an inertial confinement fusion facility. In these experiments, which were carried out by simultaneously measuring elastically scattered (3)H and (2)H ions from a deuterium-tritium gas-filled inertial confinement fusion capsule implosion, the differential cross section for the elastic n-(3)H scattering was obtained with significantly higher accuracy than achieved in previous accelerator experiments. The results compare well with calculations that combine the resonating-group method with an ab initio no-core shell model, which demonstrate that recent advances in ab initio theory can provide an accurate description of light-ion reactions.

  5. MiR-141 Activates Nrf2-Dependent Antioxidant Pathway via Down-Regulating the Expression of Keap1 Conferring the Resistance of Hepatocellular Carcinoma Cells to 5-Fluorouracil

    Directory of Open Access Journals (Sweden)

    Liang Shi

    2015-04-01

    Full Text Available Background: Hepatocellular carcinoma (HCC is one of the most lethal malignancies worldwide. A major cause for the failure of cancer therapy is the development of chemoresistance. Although progress has been made in the study of the mechanisms underlying cancer cells resistance, little is known about the role of microRNAs (miRNAs in cancer therapy resistance. Methods and Results: Fifteen miRNAs, including 6 up-regulated miRNAs (> 2.0-fold and 9 down-regulated miRNAs (Conclusion: Our study showed that miR-141 plays a key role in 5-FU resistance by down-regulating Keap1 expression, thereby reactivating the Nrf2-dependent antioxidant pathway, which may serve as a potential target for overcoming 5-FU resistance in hepatocellular carcinoma cells.

  6. Polymorphism of dopamine D2 receptor (TaqIA, TaqIB, and-141C Ins/Del) and dopamine degradation enzyme (COMT G158A, A-278G) genes and extrapyramidal symptoms in patients with schizophrenia and bipolar disorders.

    Science.gov (United States)

    Lafuente, Amalia; Bernardo, Miquel; Mas, Sergi; Crescenti, Anna; Aparici, Monica; Gasso, Patricia; Deulofeu, Ramon; Mane, Anna; Catalan, Rosa; Carne, Xavier

    2008-11-30

    The relationship is examined of the dopamine D2 receptor (DRD2) polymorphism (TaqIA, TaqIB, -141 C Ins/Del) and the catechol-O-methyltransferase (COMT) polymorphism (A-278G, G158A) to the risk of antipsychotic-induced extrapyramidal symptoms (EPS) in schizophrenia and bipolar disorders. Participants comprised 80 cases presenting with EPS (Simpson-Angus Scale score >3) and 188 controls presenting without EPS (Simpson-Angus Scale score

  7. Nivolumab versus standard, single-agent therapy of investigator's choice in recurrent or metastatic squamous cell carcinoma of the head and neck (CheckMate 141): health-related quality-of-life results from a randomised, phase 3 trial.

    Science.gov (United States)

    Harrington, Kevin J; Ferris, Robert L; Blumenschein, George; Colevas, A Dimitrios; Fayette, Jérôme; Licitra, Lisa; Kasper, Stefan; Even, Caroline; Vokes, Everett E; Worden, Francis; Saba, Nabil F; Kiyota, Naomi; Haddad, Robert; Tahara, Makoto; Grünwald, Viktor; Shaw, James W; Monga, Manish; Lynch, Mark; Taylor, Fiona; DeRosa, Michael; Morrissey, Laura; Cocks, Kim; Gillison, Maura L; Guigay, Joël

    2017-08-01

    Patients with platinum-refractory recurrent or metastatic squamous cell carcinoma of the head and neck have few treatment options and poor prognosis. Nivolumab significantly improved survival of this patient population when compared with standard single-agent therapy of investigator's choice in Checkmate 141; here we report the effect of nivolumab on patient-reported outcomes (PROs). CheckMate 141 was a randomised, open-label, phase 3 trial in patients with recurrent or metastatic squamous cell carcinoma of the head and neck who progressed within 6 months after platinum-based chemotherapy. Patients were randomly assigned (2:1) to nivolumab 3 mg/kg every 2 weeks (n=240) or investigator's choice (n=121) of methotrexate (40-60 mg/m(2) of body surface area), docetaxel (30-40 mg/m(2)), or cetuximab (250 mg/m(2) after a loading dose of 400 mg/m(2)) until disease progression, intolerable toxicity, or withdrawal of consent. On Jan 26, 2016, the independent data monitoring committee reviewed the data at the planned interim analysis and declared overall survival superiority for nivolumab over investigator's choice therapy (primary endpoint; described previously). The protocol was amended to allow patients in the investigator's choice group to cross over to nivolumab. All patients not on active therapy are being followed for survival. As an exploratory endpoint, PROs were assessed at baseline, week 9, and every 6 weeks thereafter using the European Organisation for Research and Treatment of Cancer (EORTC) Quality of Life Questionnaire-Core 30 (QLQ-C30), the EORTC head and neck cancer-specific module (EORTC QLQ-H&N35), and the three-level European Quality of Life-5 Dimensions (EQ-5D) questionnaire. Differences within and between treatment groups in PROs were analysed by ANCOVA among patients with baseline and at least one other assessment. All randomised patients were included in the time to clinically meaningful deterioration analyses. Median time to clinically meaningful

  8. 40 CFR 60.141a - Definitions.

    Science.gov (United States)

    2010-07-01

    ... refractory lining in which molten steel is produced by charging scrap metal, molten iron, and flux materials... torpedo car or hot metal car to the shop ladle. This includes the transfer of molten iron from the torpedo... vessel) to the ladle. This facility is also known as the reladling station or ladle transfer station...

  9. 40 CFR 61.141 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... is generated by a source subject to the provisions of this subpart. This term includes filters from...—or, in the case of woven friction products, the combining of textiles containing commercial asbestos...

  10. Publications | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    evidence for CHILE (open access). Even though connectivity actually generates a greater degree of efficiency in the teaching-learning process, test results can fall due to the fact that students can be distracted by having internet access. Access to internet at home shows in general a negative impact upon performance, but ...

  11. 14 CFR 141.79 - Flight training.

    Science.gov (United States)

    2010-01-01

    ... than a certificated flight instructor or commercial pilot with a lighter-than-air rating who has the... instructor or commercial pilot with a lighter-than-air rating who is present at that airport. (c) Each chief... approved flight instructor refresher course. (d) Each certificated flight instructor or commercial pilot...

  12. 40 CFR 141.170 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving... filtration and disinfection that are in addition to criteria under which filtration and disinfection are... installing and properly operating water treatment processes which reliably achieve: (1) At least 99 percent...

  13. 40 CFR 141.500 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving... for filtration and disinfection that are in addition to criteria under which filtration and... processes which reliably achieve: (a) At least 99 percent (2 log) removal of Cryptosporidium between a point...

  14. 12 CFR 303.141 - Filing procedures.

    Science.gov (United States)

    2010-01-01

    ... letter notice or letter application shall include the following information: (i) A brief description of... C or D of part 362 of this chapter; (iii) A copy of the association's business plan regarding the...

  15. Publications | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This brief summarizes lessons from the CCAA learning forum on improving access to and use of seasonal forecasts in Africa, which took place in Nairobi, Kenya in March 2010. CCAA Learning Paper 1 Integrating meteorological and indigenous knowledge-based seasonal climate forecasts for the agricultural sector.

  16. 40 CFR 141.73 - Filtration.

    Science.gov (United States)

    2010-07-01

    ... percent removal and/or inactivation of Giardia lamblia cysts at some turbidity level higher than 0.5 NTU... and/or inactivation of Giardia lamblia cysts and 99.99 percent removal and/or inactivation of viruses...

  17. 40 CFR 141.72 - Disinfection.

    Science.gov (United States)

    2010-07-01

    ... treatment must be sufficient to ensure at least 99.9 percent (3-log) inactivation of Giardia lamblia cysts... for Giardia lamblia cysts and viruses. If a system uses a disinfectant other than chlorine, the system....9 percent (3-log) inactivation and/or removal of Giardia lamblia cysts and at least 99.99 percent (4...

  18. 21 CFR 133.141 - Gorgonzola cheese.

    Science.gov (United States)

    2010-04-01

    ... peroxide with potassium alum, calcium sulfate, and magnesium carbonate used to bleach the dairy ingredients... ingredients being bleached, and the weight of the potassium alum, calcium sulfate, and magnesium carbonate... an amount to neutralize the natural yellow color of the curd. (ii) Calcium chloride in an amount not...

  19. 40 CFR 141.131 - Analytical requirements.

    Science.gov (United States)

    2010-07-01

    ... Spectrophotometry,” USEPA, May 2005, EPA 815-R-05-008 and EPA Method 552.3, Revision 1.0, “Determination of... 1.1, “Determination of Total Organic Carbon and Specific UV Absorbance at 254 nm in Source Water and... 6,7 Chlorite Amperometric titration 4500-ClO2 E 8 4500-ClO2 E-00 8 Spectrophotometry 327.0 Rev 1.1 8...

  20. 29 CFR 1910.141 - Sanitation.

    Science.gov (United States)

    2010-07-01

    ... toilet rooms. (i) Each water closet shall occupy a separate compartment with a door and walls or... that sex for whom the facilities are furnished. Where toilet rooms will be occupied by no more than one... contamination with toxic materials, change rooms equipped with storage facilities for street clothes and...

  1. 40 CFR 141.132 - Monitoring requirements.

    Science.gov (United States)

    2010-07-01

    ... least average residence time in the distribution system and representing the entire distribution system... quarter, taken at a point reflecting the maximum residence time in the distribution system, until the... treatment plant per quarter, taken at a point reflecting the maximum residence time in the distribution...

  2. 40 CFR 141.173 - Filtration.

    Science.gov (United States)

    2010-07-01

    ...), consistently achieves 99.9 percent removal and/or inactivation of Giardia lamblia cysts and 99.99 percent... any time at a level that consistently achieves 99.9 percent removal and/or inactivation of Giardia lamblia cysts, 99.99 percent removal and/or inactivation of viruses, and 99 percent removal of...

  3. 40 CFR 141.70 - General requirements.

    Science.gov (United States)

    2010-07-01

    ... technique requirements in lieu of maximum contaminant levels for the following contaminants: Giardia lamblia... achieve: (1) At least 99.9 percent (3-log) removal and/or inactivation of Giardia lamblia cysts between a...

  4. 141 137 Effect of Guanidium Hydrochloride o

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... tyrosine and tryptophan (Jones, 1997). The spectral characteristic of a protein molecule depends upon the molecular environments and upon the mobilities of its chromophores (Schmidt, 2004). Spectroscopic measurements can be conducted in solution requiring only minute quantities of the protein,.

  5. Reference: 141 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available s from the amino acid tryptophan (Trp), including the growth regulator indole-3-acetic acid (IAA) and defens...e compounds against pathogens and herbivores. In previous work, we found that a dominant overexpre...ssion allele of the Arabidopsis (Arabidopsis thaliana) Myb transcription factor ATR1, atr1D, activates expre...YP83B1, which encode enzymes implicated in production of IAA and indolic glucosinolate (IG) antiherbivore... compounds. Here, we show that ATR1 overexpression confers elevated levels of IAA an

  6. 40 CFR 141.705 - Approved laboratories.

    Science.gov (United States)

    2010-07-01

    ... Cryptosporidium samples analyzed by a laboratory that is approved under EPA's Laboratory Quality Assurance... certified by the EPA, the National Environmental Laboratory Accreditation Conference or the State for total...

  7. 31 CFR 14.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... been derived from, any record held by a financial institution pertaining to a customer's relationship... as a fiduciary, in relation to an account maintained in the person's name. (e) Law enforcement...

  8. Publications | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Econometric analysis reveals that education level, age and gender of the household head, family size, land holding size, and access to information influence ... The network meeting in London was an opportunity for project leaders to explore shared research issues in understanding emerging impacts of open data.

  9. 141 137 Effect of Guanidium Hydrochloride o

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... myoglobin causing its unfolding, in a two- state process, due to weak binding to the protein, which ... denaturation was protein folding, a purely .... presence of increasing concentrations of guanidium hydrochloride. 0. 0.1. 0.2. 0.3. 0.4. 0.5. 0.6. 0. 0.5. 1. 1.5. 2. 2.5. 3. Concentration of GuHCl (mol/l). A bs o rb a.

  10. 25 CFR 141.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...) Annual percentage rate means the annual percentage rate of finance charge determined in accordance with... credit primarily for a personal, family, household, or agricultural purpose. (c) Draft means a writing...; and (5) Is payable to order. (d) Finance charge means the cost of credit determined in accordance with...

  11. 40 CFR 141.5 - Siting requirements.

    Science.gov (United States)

    2010-07-01

    ... significant risk from earthquakes, floods, fires or other disasters which could cause a breakdown of the... of a 100-year flood or is lower than any recorded high tide where appropriate records exist. The U.S...

  12. 40 CFR 141.801 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., food preparation, dishwashing, and maintaining oral hygiene. Self inspection means an onsite review of... finished water to the aircraft. These facilities may include water trucks, carts, cabinets, and hoses. ...

  13. 47 CFR 36.141 - General.

    Science.gov (United States)

    2010-10-01

    ... AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 Telecommunications Property Information Origination... in Account 2310 and includes station apparatus, embedded customer premises wiring, large private branch exchanges, public telephone terminal equipment, and other terminal equipment. (b) The costs in...

  14. 22 CFR 141.12 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... financial assistance includes (1) grants and loans of Federal funds, (2) the grant or donation of Federal... principally engaged in the business of providing education, health care, housing, social services, or parks... the construction, expansion, renovation, remodeling, alteration, or acquisition of facilities. ...

  15. 40 CFR 141.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... public water system which serves at least 15 service connections used by year-round residents or regularly serves at least 25 year-round residents. Compliance cycle means the nine-year calendar year cycle... provide a 3-log inactivation of Giardia lamblia cysts. Diatomaceous earth filtration means a process...

  16. 7 CFR 905.141 - Minimum exemption.

    Science.gov (United States)

    2010-01-01

    ... and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE ORANGES, GRAPEFRUIT, TANGERINES, AND... shipment of fruit which meets each of the following requirements may be transported from the production...

  17. 40 CFR 408.141 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ..., the general definitions, abbreviations and methods of analysis set forth in 40 CFR part 401 shall... to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971... form in which it is received at the processing plant. ...

  18. Laboratory productivity and the rate of manual peripheral blood smear review: a College of American Pathologists Q-Probes study of 95,141 complete blood count determinations performed in 263 institutions.

    Science.gov (United States)

    Novis, David A; Walsh, Molly; Wilkinson, David; St Louis, Mary; Ben-Ezra, Jonathon

    2006-05-01

    Automated laboratory hematology analyzers are capable of performing differential counts on peripheral blood smears with greater precision and more accurate detection of distributional and morphologic abnormalities than those performed by manual examinations of blood smears. Manual determinations of blood morphology and leukocyte differential counts are time-consuming, expensive, and may not always be necessary. The frequency with which hematology laboratory workers perform manual screens despite the availability of labor-saving features of automated analyzers is unknown. To determine the normative rates with which manual peripheral blood smears were performed in clinical laboratories, to examine laboratory practices associated with higher or lower manual review rates, and to measure the effects of manual smear review on the efficiency of generating complete blood count (CBC) determinations. From each of 3 traditional shifts per day, participants were asked to select serially, 10 automated CBC specimens, and to indicate whether manual scans and/or reviews with complete differential counts were performed on blood smears prepared from those specimens. Sampling continued until a total of 60 peripheral smears were reviewed manually. For each specimen on which a manual review was performed, participants indicated the patient's age, hemoglobin value, white blood cell count, platelet count, and the primary reason why the manual review was performed. Participants also submitted data concerning their institutions' demographic profiles and their laboratories' staffing, work volume, and practices regarding CBC determinations. The rates of manual reviews and estimations of efficiency in performing CBC determinations were obtained from the data. A total of 263 hospitals and independent laboratories, predominantly located in the United States, participating in the College of American Pathologists Q-Probes Program. There were 95,141 CBC determinations examined in this study

  19. Intracranial haemorrhage in the course of ischaemic stroke in patients receiving IV thrombolytic therapy – a study of 141 patients from Gliwice and its vicinity. An attempt to determine risk factors based on authors’ own experience

    Directory of Open Access Journals (Sweden)

    Witold Opiełka

    2015-12-01

    Full Text Available Introduction: Systemic thrombolytic therapy using recombinant tissue plasminogen activator is a recognised method for the causative treatment of acute ischaemic stroke. The aim of this study was to determine the safety of thrombolytic treatment, the incidence of the most dangerous complication – intracranial haemorrhage and to assess its influence on the final therapeutic outcome. An additional aim was to identify risk factors. Material and methods: A total of 141 patients treated from January 2013 to June 2015 at the Stroke Unit were included in the analysis. The patients were assessed in terms of neurological deficit according to the National Institutes of Health Stroke Scale, their functional status using the modified Rankin Scale and Brunnstrom motor ability scale. A multivariate analysis of different risk factors for intracranial haemorrhage was performed. Results: Symptomatic intracranial haemorrhage occurred in 3.5% of cases, asymptomatic haemorrhage was reported in 7.1% of cases. A statistically significant difference was found in mortality rate (p = 0.0043 between the thrombolytic subgroup (5% and the group not receiving causative therapy (13%. The neurological status in the subgroup with symptomatic intracranial haemorrhage deteriorated in the 2nd hour of treatment, then it remained stable and reached a high value of the National Institutes of Health Stroke Scale median – 23; it differed significantly compared to other patients (p = 0.009 in the 2nd hour; p = 0.001 on day 7. The functional status of patients with symptomatic intracranial haemorrhage did not improve; it was assessed at baseline and at the end of treatment and remained at the same level (modified Rankin Scale – median = 5 and 5. There was a significant increase in mobility, presenting as a 2 point drop in the median, in other patients. Conclusions: Thrombolytic treatment is a relatively safe procedure. Mortality during hospital treatment in the

  20. De novo unbalanced translocation resulting in monosomy for distal 5p (5p14.1 → pter) and 14q (14q32.31 → qter) associated with fetal nuchal edema, microcephaly, intrauterine growth restriction, and single umbilical artery: prenatal diagnosis and molecular cytogenetic characterization.

    Science.gov (United States)

    Chen, Chih-Ping; Fu, Chung-Hu; Chern, Schu-Rern; Wu, Peih-Shan; Su, Jun-Wei; Lee, Chen-Chi; Lee, Meng-Shan; Wang, Wayseen

    2013-09-01

    To present prenatal diagnosis of partial monosomy 5p (5p14.1 → pter) and partial monosomy 14q (14q32.31 → qter). A 33-year-old woman underwent amniocentesis at 20 weeks of gestation because of abnormal fetal ultrasound. Amniocentesis revealed a dicentric chromosome of dic(5;14). Level II ultrasound at 23 weeks of gestation revealed a fetus with intrauterine growth restriction, microcephaly, nuchal edema, a single umbilical artery, and fetal biometry equivalent to 19 weeks. At 23 weeks of gestation, she requested repeated amniocentesis. Whole-genome array comparative genomic hybridization on uncultured amniocytes was performed. Quantitative fluorescent polymerase chain reaction analysis was performed on uncultured cord blood and parental blood. A fetus was delivered with microcephaly, low-set ears, hypertelorism, depressed nasal bridge, increased nuchal fold, and a single umbilical artery. The fetal karyotype was 45,XX,dic(5;14)(p14.1;q32.31)dn. Whole-genome array comparative genomic hybridization analysis on uncultured amniocytes detected arr 5p15.33p14.1 (36,238-28,798,509)×1 and arr 14q32.31q32.33 (101,508,967-107,349,540)×1. Quantitative fluorescent polymerase chain reaction assays showed that the aberrant dic(5;14) was from paternal origin. Concomitant occurrence of monosomy for distal 5p and distal 14q my present nuchal edema, microcephaly, IUGR, and single umbilical artery on prenatal ultrasound. Copyright © 2013. Published by Elsevier B.V.

  1. Photoluminescence studies of a Terbium(III) complex as a fluorescent probe for DNA detection

    Energy Technology Data Exchange (ETDEWEB)

    Khorasani-Motlagh, Mozhgan, E-mail: mkhorasani@chem.usb.ac.ir; Noroozifar, Meissam; Niroomand, Sona; Moodi, Asieh

    2013-11-15

    The photoluminescence properties of a Tb(III) complex of the form [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] (phen=1,10-phenanthroline) in different solvents are presented. It shows the characteristic luminescence of the corresponding Ln{sup 3+} ion in the visible region. The emission intensity of this complex in coordinating solvent is higher than non-coordinating one. The suggested mechanism for the energy transfer between the ligand and Tb{sup 3+} ion is the intramolecular energy transfer mechanism. The interactions of the Tb(III) complex with fish salmon DNA are studied by fluorescence spectroscopy, circular dichroism study and viscosity measurements. The results of fluorescence titration reveal that DNA strongly quenches the intrinsic fluorescence of the complex through a static quenching procedure. The binding constant (K{sub b}) of the above metal complex at 25 °C is determined by the fluorescence titration method and it is found to be (8.06±0.01)×10{sup 3} M{sup −1}. The thermodynamic parameters (ΔH{sup 0}>0, ΔS{sup 0}>0 and ΔG{sup 0}<0) indicate that the hydrophobic interactions play a major role in DNA–Tb complex association. The results support the claim that the title complex bonds to FS-DNA by a groove mode. -- Highlights: • Photoluminescence of [Tb(phen){sub 2}Cl{sub 3}·OH{sub 2}] in different solvents are studied. • Tb(III) complex shows good binding affinity to FS DNA with K{sub b}=(8.06±0.01)×10{sup 3} M{sup −1}. • Viscosity of DNA almost unchanged by increasing amount of Tb complex. • CD spectrum of DNA has a little change with increasing amount of Tb complex. • Thermodynamic parameters indicate that the binding reaction is entropically driven.

  2. Lanthanides in Nuclear Medicine. The Production of Terbium-149 by Heavy Ion Beams

    CERN Document Server

    Dmitriev, S N; Zaitseva, N G; Maslov, O D; Molokanova, L G; Starodub, G Ya; Shishkin, S V; Shishkina, T V

    2001-01-01

    Among radioactive isotopes of lanthanide series elements, finding the increasing using in nuclear medicine, alpha-emitter {149}Tb (T_{1/2} = 4.118 h; EC 76.2 %; beta^+ 7.1 %; alpha 16.7 %) is considered as a perspective radionuclide for radioimmunotherapy. The aim of the present work is to study experimental conditions of the {149}Tb production in reactions Nd({12}C, xn){149}Dy (4.23 min; beta^+, EC)\\to {149}Tb when the Nd targets have been irradiated by heavy ions of carbon. On the basis of results of formation and decay of {149}Dy\\to{149}Tb evaluation of the {149}Tb activity, is made which can be received under optimum conditions (enriched {142}Nd target, {12}C ions with the energy 120 MeV and up to current 100 mu A, time of irradiating 8-10 hours). Under these conditions {149}Tb can be obtained up to 30 GBq (up to 0.8 Ci).

  3. Poly[[aqua-?3-picolinato-?2-picolinato-dipicolinatopotassium(I)terbium(III)] 2.5-hydrate

    OpenAIRE

    Filipe A. Almeida Paz; João Rocha; Jacek Klinowski; Tito Trindade; Nogueira,Helena I. S.; Soares-Santos, Paula C. R.; Cunha-Silva, Lu?s

    2008-01-01

    In the title compound, [KTb(C6H4NO2)4(H2O)]·2.5H2O, each Tb3+ centre is coordinated by four N and five O atoms from five distinct picolinate ligands in a geometry resembling a highly distorted tricapped trigonal prism. One of the ligands establishes a skew bridge between neighbouring Tb3+ centres, leading to the formation of one-dimensional anionic polymeric chains, {[(C6H4NO2)4Tb]−}n, running along the direction [010]. Each K+ cation is seven-coordinated by six O atoms from one an...

  4. Spin waves in terbium. III. Magnetic anisotropy at zero wave vector

    DEFF Research Database (Denmark)

    Houmann, Jens Christian Gylden; Jensen, J.; Touborg, P.

    1975-01-01

    The energy gap at zero wave vector in the spin-wave dispersion relation of ferromagnetic. Tb has been studied by inelastic neutron scattering. The energy was measured as a function of temperature and applied magnetic field, and the dynamic anisotropy parameters were deduced from the results....... The axial anisotropy is found to depend sensitively on the orientation of the magnetic moments in the basal plane. This behavior is shown to be a convincing indication of considerable two-ion contributions to the magnetic anisotropy at zero wave vector. With the exception of the sixfold basal...... the effects of zero-point deviations from the fully aligned ground state, and we tentatively propose polarization-dependent two-ion couplings as their origin....

  5. Structural and Magnetic Anisotropy in Amorphous Terbium-Iron Thin Films

    Science.gov (United States)

    Hufnagel, Todd Clayton

    1995-01-01

    High density, removable media magnetooptic disk drives have recently begun to make significant gains in the information mass storage market. The media in these disks are amorphous rare-earth/transition-metal (RE-TM) alloys. One vital property of these materials is a large perpendicular magnetic anisotropy; that is, an easy axis of magnetization which is perpendicular to the plane of the film. A variety of theories, sometimes contradictory, have been proposed to account for this surprising presence of an anisotropic property in an amorphous material. Recent research indicates that there is an underlying atomic-scale structural anisotropy which is responsible for the observed magnetic anisotropy. Several different types of structural anisotropy have been proposed to account for the observed magnetic anisotropy, including pair-ordering anisotropy (anisotropic chemical short-range order) and bond orientation anisotropy (an anisotropy in coordination number or distances independent of chemical ordering). We have studied the structural origins of perpendicular magnetic anisotropy in amorphous Tb-Fe thin films by employing high-energy and anomalous dispersion x-ray scattering. The as-deposited films show a clear structural anisotropy, with a preference for Tb-Fe near neighbors to align in the out-of-plane direction. These films also have a large perpendicular magnetic anisotropy. Upon annealing, the magnetic anisotropy energy drops significantly, and we see a corresponding reduction in the structural anisotropy. The radial distribution functions indicate that the number of Tb-Fe near-neighbors increases in the in-plane direction, but does not change in the out-of-plane direction. Therefore, the distribution of Tb-Fe near-neighbors becomes more uniform upon annealing. We propose that the observed reduction in perpendicular magnetic anisotropy energy is a result of this change in structure. Our results support the pair -ordering anisotropy model of the structural anisotropy in amorphous Tb-Fe thin films. We see no evidence to support the bond orientation anisotropy model.

  6. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    Antonov-Romanovskii et al [2] firstly suggested applications of OSL for personal dosime- try. This technique got momentum for personnel dosime- try after the development of α-Al2O3:C. OSL properties of α-Al2O3:C have been investigated for personnel dosimetry, environmental dosimetry, medical dosimetry and space.

  7. Luminescence properties of terbium-doped Li3PO4 phosphor for ...

    Indian Academy of Sciences (India)

    The powder X-ray diffraction (PXRD), photoluminescence (PL) emission and excitation spectra, thermoluminescence (TL) and optically stimulated luminescence (OSL) were measured. The particle size was calculated using the Debye Scherrer formula and found to be 79.42 nm. PL emission spectra of Li 3 PO 4 :Tb 3 + ...

  8. Charge-transfer-based terbium MOF nanoparticles as fluorescent pH sensor for extreme acidity.

    Science.gov (United States)

    Qi, Zewan; Chen, Yang

    2017-01-15

    Newly emerged metal organic frameworks (MOFs) have aroused the great interest in designing functional materials by means of its flexible structure and component. In this study, we used lanthanide Tb 3+ ions and small molecular ligands to design and assemble a kind of pH-sensitive MOF nanoparticle based on intramolecular-charge-transfer effect. This kind of made-to-order MOF nanoparticle for H + is highly specific and sensitive and could be used to fluorescently indicate pH value of strong acidic solution via preset mechanism through luminescence of Tb 3+ . The long luminescence lifetime of Tb 3+ allows eliminating concomitant non-specific fluorescence by time-revised fluorescence techniques, processing an advantage in sensing H + in biological media with strong autofluorescence. Our method showed a great potential of MOF structures in designing and constructing sensitive sensing materials for specific analytes directly via the assembly of functional ions/ligands. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Assessment of terbium (III) as a luminescent probe for the detection of tuberculosis biomarkers

    Energy Technology Data Exchange (ETDEWEB)

    Bamogo, W. [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Mugherli, L. [CEA, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France); Banyasz, A. [CNRS, IRAMIS, LIDyL/Laboratoire Francis Perrin, URA 2453, F-91191 Gif-sur-Yvette (France); Novelli-Rousseau, A.; Mallard, F. [BioMérieux SA, F-38000 Grenoble (France); Tran-Thi, T.-H., E-mail: thu-hoa.tran-thi@cea.fr [CNRS, IRAMIS, UMR 3685 NIMBE/LEDNA, F-91191 Gif-sur-Yvette (France)

    2015-10-08

    A detection method for nicotinic acid, a specific metabolite marker of Mycobacterium tuberculosis present in cultures and patients' breath, is studied in complex solutions containing other metabolites and in biological media such as urine, saliva and breath condensate. The method is based on the analysis of the luminescence increase of Tb{sup 3+} complexes in the presence of nicotinic acid due to the energy transfer from the excited ligand to the lanthanide ion. It is shown that other potential markers found in M. tuberculosis culture supernatant, such as methyl phenylacetate, p-methyl anisate, methyl nicotinate and 2-methoxy biphenyl, can interfere with nicotinic acid via a competitive absorption of the excitation photons. A new strategy to circumvent these interferences is proposed with an upstream trapping of volatile markers preceding the detection of nicotinic acid in the liquid phase via the luminescence of Tb{sup 3+} complexes. The cost of the method is evaluated and compared with the Xpert MTB/RIF test endorsed by the World Health Organization. - Highlights: • Nicotinic acid, a specific marker of M. tuberculosis, can be detected via luminescence. • The detection limit with a commercial phosphorimeter is 0.4 µmol·L{sup -1}. • Other metabolites of M. tuberculosis can interfere via absorbed excitation light. • The interference can be removed via trapping of the most volatile metabolites. • A breath analysis procedure's cost is compared with the Xpert TBM/RIF test.

  10. A highly porous luminescent terbium-organic framework for reversible anion sensing

    Energy Technology Data Exchange (ETDEWEB)

    Wong, K.L.; Law, G.L.; Wong, W.T. [Department of Chemistry, The University of Hong Kong, Pokfulam Road, Hong Kong (China); Yang, Y.Y. [School of Chemistry and Chemical Engineering, Sun Yat-Sen University, Guangzhou 510275 (China)

    2006-04-18

    Unique tailored porous frameworks incorporating a lanthanide metal center have been designed to function as chemical detectors. A flexible multidentate ligand, mucic acid, is used to differentiate between several anions, thus creating an organic framework that is ideally suited for applications in gas separation, sensors, and chemical switches. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

  11. Synthesis and characterization of wide bandgap semiconductors doped with terbium for electroluminescent devices

    OpenAIRE

    Montañez Huamán, Liz Margarita

    2016-01-01

    En el presente trabajo de investigación se ha estudiado propiedades estequiometrias, estructurales y de emisión de luz de semiconductor de amplio ancho de banda dopados con terbio. La difracción de rayos-X en ángulo rasante confirma el estado amorfo de las películas. Los espectros de absorción infrarroja muestran la formación de óxidos en las películas y la espectroscopia de foto-electrones de rayos-X revela la formación de oxinitruro de aluminio y oxicarburo de silicio. Las pe...

  12. Synthesis and characterization of terbium-doped SrSnO3 pigments

    Czech Academy of Sciences Publication Activity Database

    Dohnalová, Ž.; Gorodylova, N.; Šulcová, P.; Vlček, Milan

    2014-01-01

    Roč. 40, č. 8 (2014), s. 12637-12645 ISSN 0272-8842 Institutional support: RVO:61389013 Keywords : pigments * solid state reaction * perovskites Subject RIV: CA - Inorganic Chemistry Impact factor: 2.605, year: 2014

  13. An optical material for the detection of β-hydroxybutyrate based on a terbium complex

    Science.gov (United States)

    Wang, Xiaomiao; Chen, Huili; Li, Hua

    2014-02-01

    A novel Tb3+ complex (Tb(C14H10O4)ṡCl, TbL2) based on benzoic acid (L+H) was successfully synthesized, and gave a weak green emission in methanol-water (V:V, 4:1, pH 4.49). With the addition of β-hydroxybutyrate (β-HB) to a semi-aqueous solution of TbL2, an increment of the luminescent intensity at 545 nm assigned to 5D4 → 7F5 transition of Tb3+ was measured, which was evident to the naked eye. The response showed high selectivity for β-HB compared with other common anions including Cl-, NO3-, CO32-, PO43-, HPO42-, HPO4-, CO42-, PO74-, SO42-, lactate, AcO-, citrate, malate therefore it has the potential to be applied as a luminescent sensor for β-HB.

  14. Circulating forms of immunoreactive parathyroid hormone-related protein for identifying patients with humoral hypercalcemia of malignancy. A comparative study with C-terminal (109-141)- and N-terminal (1-86)-region-specific PTHrP radioassay

    Energy Technology Data Exchange (ETDEWEB)

    Suehiro, Mitsuko; Murakami, Minoru; Fukuchi, Minoru (Hyogo Coll. of Medicine, Nishinomiya (Japan))

    1994-11-01

    We evaluated the circulating forms of immunoreactive parathyroid hormone-related protein(PTHrP) in 115 healthy subjects and 122 patients with malignant diseases by using radioassay systems (RAS) specific for the C-terminal (109-141) fragment of PTHrP (C-RAS) and for the N-terminal(1-86) (N-RAS). PTHrP levels in healthy controls ranged from 1.5 to 38.2 (mean: 24.5) pmol/L with the C-RAS and from 0.9 to 2.5 (mean: 1.7) pmol/L with the N-RAS. The ratio of circulating N-terminal fragment (N) to C-terminal fragment (C) of PTHrP was calculated to be about 1 : 14.4 in the healthy subjects. Of the 122 patients with malignant diseases, 40 (32.8%) had circulating PTHrP levels undetectable with the N-RAS, but only 11 (9.0%) patients had levels undetectable with the C-RAS. Of the former 122 patients, 41 (33.6%) had high PTHrP as determined with the C-RAS, and 10 (8.2%) had high PTHrP as determined with the N-RAS. The former of these included only 8 (19.5%) humoral hypercalcemia malignancy(HHM) patients, while the latter included 8 (80.0%) HHM patients. The circulating N to C ratio was about 1 : 70.7 in the HHM patients. The N and C obtained with the different RASs showed a close correlation (r=0.86). The values also showed a close correlation with serum Ca; r=0.75 for C-RAS and r=0.81 for N-RAS. In addition, the correlation between the PTHrP reading obtained with the different RASs and serum Cr were: r=0.42 with C-RAS and r=0.26 with N-RAS. The circulating form of immunoreactive PTHrP fragments is therefore comprised mainly of PTHrP (109-141). In contrast, circulating concentrations of the PTHrP (1-86) fragment are very low, but detection of the PTHrP (1-86) fragment with the N-RAS is a more useful indicator of HHM with fewer false positive results and is less likely to be influenced by renal function than the detection of the PHPrP (109-141) fragment with C-RAS. (author).

  15. Comparison of peptide retention prediction algorithm in reversed-phase chromatography. Comment on "Predictive chromatography of peptides and proteins as a complementary tool for proteomics", by I. A. Tarasova, C. D. Masselon, A. V. Gorshkov and M. V. Gorshkov, Analyst, 2016, 141, 4816.

    Science.gov (United States)

    Krokhin, Oleg V

    2017-05-30

    In a recent mini-review, Tarasova et al. (Analyst, 2016, 141, 4816) compared several peptide retention prediction models for reversed-phase HPLC developed for applied proteomics. The mechanism of peptide retention in RP-HPLC is very complex. Peptide separation selectivity is affected by multiple parameters of a separation system. Consequently, proper comparison of the models requires a detailed knowledge (to provide the best match) of separation conditions used to acquire both optimization and test datasets. Sequence-specific retention calculator - a benchmark tool in this field - consistently provides 0.96-0.965 R(2)-value correlations between experimental and predicted retention values, when applied correctly to extremely complex mixtures of peptides.

  16. Identification of miR-31-5p, miR-141-3p, miR-200c-3p, and GLT1 as human liver aging markers sensitive to donor-recipient age-mismatch in transplants.

    Science.gov (United States)

    Capri, Miriam; Olivieri, Fabiola; Lanzarini, Catia; Remondini, Daniel; Borelli, Vincenzo; Lazzarini, Raffaella; Graciotti, Laura; Albertini, Maria Cristina; Bellavista, Elena; Santoro, Aurelia; Biondi, Fiammetta; Tagliafico, Enrico; Tenedini, Elena; Morsiani, Cristina; Pizza, Grazia; Vasuri, Francesco; D'Errico, Antonietta; Dazzi, Alessandro; Pellegrini, Sara; Magenta, Alessandra; D'Agostino, Marco; Capogrossi, Maurizio C; Cescon, Matteo; Rippo, Maria Rita; Procopio, Antonio Domenico; Franceschi, Claudio; Grazi, Gian Luca

    2017-04-01

    To understand why livers from aged donors are successfully used for transplants, we looked for markers of liver aging in 71 biopsies from donors aged 12-92 years before transplants and in 11 biopsies after transplants with high donor-recipient age-mismatch. We also assessed liver function in 36 age-mismatched recipients. The major findings were the following: (i) miR-31-5p, miR-141-3p, and miR-200c-3p increased with age, as assessed by microRNAs (miRs) and mRNA transcript profiling in 12 biopsies and results were validated by RT-qPCR in a total of 58 biopsies; (ii) telomere length measured by qPCR in 45 samples showed a significant age-dependent shortage; (iii) a bioinformatic approach combining transcriptome and miRs data identified putative miRs targets, the most informative being GLT1, a glutamate transporter expressed in hepatocytes. GLT1 was demonstrated by luciferase assay to be a target of miR-31-5p and miR-200c-3p, and both its mRNA (RT-qPCR) and protein (immunohistochemistry) significantly decreased with age in liver biopsies and in hepatic centrilobular zone, respectively; (iv) miR-31-5p, miR-141-3p and miR-200c-3p expression was significantly affected by recipient age (older environment) as assessed in eleven cases of donor-recipient extreme age-mismatch; (v) the analysis of recipients plasma by N-glycans profiling, capable of assessing liver functions and biological age, showed that liver function recovered after transplants, independently of age-mismatch, and recipients apparently 'rejuvenated' according to their glycomic age. In conclusion, we identified new markers of aging in human liver, their relevance in donor-recipient age-mismatches in transplantation, and offered positive evidence for the use of organs from old donors. © 2016 The Authors. Aging Cell published by the Anatomical Society and John Wiley & Sons Ltd.

  17. Dicty_cDB: SFE141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  18. 21 CFR 146.141 - Canned orange juice.

    Science.gov (United States)

    2010-04-01

    ... and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED FRUIT JUICES Requirements for Specific Standardized Canned Fruit Juices and... of the species Citrus reticulata or Citrus reticulata hybrids (except that this limitation shall not...

  19. Dicty_cDB: AFF141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NCE, 5 ordered pieces. 36 0.14 8 BI435853 |BI435853.1 EST538614 P. infestans-challenged potato leaf, compati...0.30 1 BG591390 |BG591390.1 EST499232 P. infestans-challenged leaf Solanum tuberosum cDNA clone BPLI8D17 5' ...A clone STMCF59 3' end, mRNA sequence. 48 0.30 1 BI435340 |BI435340.1 EST538101 P. infestans-challenged leaf...DNA clone POAC219 3' end, mRNA sequence. 48 0.30 1 BI433279 |BI433279.1 EST536040 P. infestans-challenged

  20. 25 CFR 141.32 - Reservation pawnbroker license required.

    Science.gov (United States)

    2010-04-01

    ..., or credit union operating under the laws of the United States or the laws of New Mexico, Arizona, or... benefits of the customers of the licensee and shall specifically indemnify all customers who have recovered...

  1. Dicty_cDB: CHQ141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KVGDDWVGSSVIHLGDHN VPNSLVFIDKYTQISRIXSPIVLTIEYIPKITDPNLVAYIKNTFGGPQTLTKIILCDFFK H...NYVYQSLSLWQHILHDMFKLWYF AEIDLLCGHRYQLSNTGQGLNRIQQCPNVGKIMHSILRQTQKKVGDDWVGSSVIHLGDHN VPNSLVFIDKYTQISRIXS

  2. What we do | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The Government of China has adopted a national reform program aimed at making budgeting more transparent and accountable through public involvement and enhanced oversight. Central Asia ... This project addresses the issue of privacy and the Internet vis-à-vis the growth of collaborative spaces (Web 2. North And ...

  3. 40 CFR 141.66 - Maximum contaminant levels for radionuclides.

    Science.gov (United States)

    2010-07-01

    ..., U.S. Department of Commerce, 5285 Port Royal Road, Springfield, Virginia 22161. The toll-free number...) (g) Best available technologies (BATs) for radionuclides. The Administrator, pursuant to section 1412... alpha particle activity, and beta particle and photon radioactivity. Table B—BAT for Combined Radium-226...

  4. 47 CFR 0.141 - Functions of the Bureau.

    Science.gov (United States)

    2010-10-01

    ... library of commonly requested materials on issues of interest to all consumers. Ensures that alternative... Bureau. (j) Provides leadership to other Bureaus and Offices for dissemination of consumer information...

  5. Dicty_cDB: CHE141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r*mcrrhskm*skrsixdvrikdgsnl**rsflcfrscllryhpyrskgqnygcqlrpr* errfilkihptyrsydg*kd*tn*rlsmw*hcwfsrcrsipcqiwyh...hhl*scsqhsche ilritsrpccrrtkesi*ftktrrrsqtfsqirsmctlll*riw*thrcpvl--- Frame C: DE

  6. South of Sahara | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Language English. When Professor Monica Ayieko fries up some termites or crickets in the laboratory at Jaramogi Oginga Odinga University of Science and Technology in western Kenya, everyone on campus salivates because of the aromas. “Not only is the smell incredibly pleasing, but it tastes just as good!” explains the ...

  7. 21 CFR 516.141 - Qualified expert panels.

    Science.gov (United States)

    2010-04-01

    ... Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... another entity, such as a university). (ii) Has any employment, contractual, or other financial... remuneration (institution/self), time period, sponsor (government, firm, institution, individual), role of the...

  8. 40 CFR 141.720 - Inactivation toolbox components.

    Science.gov (United States)

    2010-07-01

    ... Cryptosporidium, Giardia lamblia, and virus treatment credits for ultraviolet (UV) light reactors by achieving the... unfiltered systems. UV Dose Table for Cryptosporidium, Giardia lamblia, and Virus Inactivation Credit Log credit Cryptosporidium UV dose (mJ/cm2) Giardia lamblia UV dose (mJ/cm2) VirusUV dose (mJ/cm2) (i) 0.5 1...

  9. All projects related to | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Region: New Zealand, South Africa. Program: Food, Environment, and Health. Total Funding: CA$ 547,730.00. Trade-Related Challenges to Tobacco Control in Southeast Asia. Project. Despite progress in implementing tobacco control policies, trade liberalization has significantly increased tobacco consumption among ...

  10. 7 CFR 1.141 - Procedure for hearing.

    Science.gov (United States)

    2010-01-01

    ... Judge shall order the verbatim transcription of the recording as requested by the party. (3) Recordings... shall be recorded verbatim by electronic recording device. Hearings conducted by audio-visual... be transcribed, unless the Judge finds that recording the hearing verbatim would expedite the...

  11. Phenotype-gene: 141 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available th in organ named hypocotyl in environment of continuous dark (no light) regimen for AT4G38750 Penfield Stev...67715i decreased length in organ named hypocotyl in environment of continuous dark (no light) regimen

  12. 7 CFR 1260.141 - Membership of Board.

    Science.gov (United States)

    2010-01-01

    .... Northeast 1 Connecticut 54 Delaware 23 Maine 90 Massachusetts 46 New Hampshire 38 New Jersey 41 Rhode Island... thousand (500,000) head of cattle shall be entitled to one representative on the Board; (2) States which do not have total cattle inventories equal to or greater than five hundred thousand (500,000) head of...

  13. 25 CFR 141.35 - Pawnbroker disclosure requirements.

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON... property pledged. (b) The date of the transaction. (c) Amount of the loan. (d) Name and social security or.... (h) The finance charges expressed as an annual percentage rate and computed in accordance with the...

  14. Dicty_cDB: VHF141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nce from clone RP11-560G8 on chromosome 9. 48 0.23 3 AW829533 |AW829533.1 ra41c11.y1 Bird-Rao Meloidogyne in...ce. 32 0.74 2 AW830038 |AW830038.1 ra48h04.y1 Bird-Rao Meloidogyne incognita J2 M

  15. Publications | Page 141 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Pour éviter des pénuries catastrophiques dans les décennies à venir, il faudra trouver de nouvelles façons de réduire la demande en eau, cette ressource si précieuse. C'est l'avis ... Intervention clé du domaine des politiques visant le marché du travail, le salaire minimum constitue une mesure de protection... ÉTUDE DE ...

  16. 14 CFR Appendix K to Part 141 - Special Preparation Courses

    Science.gov (United States)

    2010-01-01

    ..., proficiency, resourcefulness, self-confidence, and self-reliance in the student for performing that special... authorization sought, for developing competency, proficiency, resourcefulness, self-confidence, and self-reliance in the student. 4. Use of flight simulators or flight training devices. (a) The approved special...

  17. The way ahead for medicine with the genomic code ====141

    African Journals Online (AJOL)

    Using the PCR to detect a mutation in a gene. Double- stranded DNA is extracted from cells and dissociated by heating into single strands. The specially designed primer sequences complementary to regions above and below the mutated site are added in great excess. When these primers have annealed by ...

  18. 40 CFR 141.400 - General requirements and applicability.

    Science.gov (United States)

    2010-07-01

    ... receiving finished ground water. (c) General requirements. Systems subject to this subpart must comply with the following requirements: (1) Sanitary survey information requirements for all ground water systems... determination of whether ground water systems obtain water from hydrogeologically sensitive settings. (d...

  19. Dicty_cDB: SHB141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA sequence. 74 5e-09 2 BI742991 |BI742991.1 kx37e02.y1 Parastrongyloides trichosuri IL pAMP1 v1 Chiapelli McCarter Parastrongyloide...ION FACTOR 2-LIKE ;, mRNA sequence. 70 8e-09 2 BI743756 |BI743756.1 kx52f02.y1 Parastrongyloides trichosuri ...PA pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to TR:O08810 O08810 U5-116KD. ;,... mRNA sequence. 70 9e-09 2 BI501287 |BI501287.1 kx30d02.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastrongyloi...6KD. ;, mRNA sequence. 70 1e-08 2 BI743844 |BI743844.1 kx53f10.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastr

  20. Dicty_cDB: CHN141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ion 1 of 7 of the complete sequence. 66 9e-14 12 BI742991 |BI742991.1 kx37e02.y1 Parastrongyloides trichosur...i IL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to TR:Q19070 Q19070 ELONGATION... FACTOR 2-LIKE ;, mRNA sequence. 78 3e-11 2 BI743756 |BI743756.1 kx52f02.y1 Parastrongyloides trichosuri PA ...pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri cDNA 5' similar to TR:O0...8810 O08810 U5-116KD. ;, mRNA sequence. 78 3e-11 2 BI501287 |BI501287.1 kx30d02.y1 Parastrongyloides trichos

  1. 40 CFR 141.40 - Monitoring requirements for unregulated contaminants.

    Science.gov (United States)

    2010-07-01

    ... be used in all routine sample analyses used to comply with this regulation. Only straight line or... Equation 1: ER04JA07.000 Where: t is the Student's t value with df degrees of freedom and confidence level... replicates (n); Student's t value with a two-sided 99% confidence level for n number of replicates; the...

  2. 40 CFR 141.74 - Analytical and monitoring requirements.

    Science.gov (United States)

    2010-07-01

    ... Escherichia coli in water” by Brenner, K.P., et. al., 1993, Appl. Environ. Microbiol. 59:3534-3544. Also... Simultaneous Enumeration of Total Coliforms and Esherichia coli from Drinking Water: Comparison with the..., 1992, Great Lakes Instruments, Inc., 8855 North 55th Street, Milwaukee, WI 53223. 11 A description of...

  3. What we do | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Large-scale diffusion of information and communication technologies (ICTs) have opened up many opportunities for people with disabilities, such as building solidarity, ... Donation of personal computers - whether from Northern to Southern countries or from government or the private sector to civil society organizations - has ...

  4. 40 CFR 141.602 - System specific studies.

    Science.gov (United States)

    2010-07-01

    ... the residence time at the longest residence time storage facility in the distribution system showing... preliminary 24 hour average residence time predictions throughout the distribution system. (D) Timing and... a consistently repeating 24 hour pattern of residence time. (B) The model must represent the...

  5. 40 CFR 141.719 - Additional filtration toolbox components.

    Science.gov (United States)

    2010-07-01

    ...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Treatment for... membrane relative to that in the feed water. (B) For direct integrity tests that use a particulate or.... (4) The maximum feed water concentration that can be used during a challenge test must be based on...

  6. Dicty_cDB: CHO141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM608903 |BM608903.1 17000687086872 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449690492 5'...BM610376 |BM610376.1 17000687110678 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449712509 5'...BM598351 |BM598351.1 17000687619693 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449727612 5'...BM586494 |BM586494.1 17000687314976 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449681047 5'

  7. 75 FR 141 - Big Rivers Electric Corporation; Notice of Filing

    Science.gov (United States)

    2010-01-04

    ...: E9-31089] DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. NJ09-3-001] Big... Order and Granting Waivers,'' Big Rivers Elec. Corp., 128 FERC ] 61,264 (2009) (September 17 Order), Big... protests must be filed on or before the comment date. Anyone filing a motion to intervene or protest must...

  8. What we do | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Poverty, Job Quality and Labor Market Dynamics in the Middle East and North Africa. Unemployment is one of the main economic, social and political problems facing governments in the Middle East and North Africa. Middle East, North Of Sahara, South Of Sahara, Central Asia, Far East Asia, South Asia, Jordan, Morocco, ...

  9. 40 CFR 440.141 - Specialized definitions and provisions.

    Science.gov (United States)

    2010-07-01

    ... excavator (e.g., bucket line dredge), the beneficiation or gold-concentrating plant, and a tailings disposal... shaking tables. (7) “Infiltration water” means that water which permeates through the earth into the plant...

  10. 26 CFR 1.141-13 - Refunding issues.

    Science.gov (United States)

    2010-04-01

    ... date, and by disregarding any private security or private payments before the transition date. (iv... security or payment test—(1) Separate issue treatment. If the amount of private business use of a refunding...) or (b)(2)(ii)(B) of this section, then the amount of private security and private payments allocable...

  11. 26 CFR 1.141-0 - Table of contents.

    Science.gov (United States)

    2010-04-01

    ...-4Private security or payment test. (a) General rule. (1) Private security or payment. (2) Aggregation of private payments and security. (3) Underlying arrangement. (b) Measurement of private payments and security. (1) Scope. (2) Present value measurement. (c) Private payments. (1) In general. (2) Payments...

  12. 7 CFR 1703.141 - Approved purposes for loans.

    Science.gov (United States)

    2010-01-01

    ... relating to the establishment or expansion of the phase of the project that is being financed with the loan... distance learning or telemedicine network which meets the purposes of this subpart; (f) Providing for site... transmission facilities provided that no telecommunications carrier will install such facilities under the Act...

  13. 40 CFR 141.22 - Turbidity sampling and analytical requirements.

    Science.gov (United States)

    2010-07-01

    ... unfiltered systems until December 30, 1991, unless the State has determined prior to that date, in writing... filtered systems until June 29, 1993. The requirements in this section apply to unfiltered systems that the...

  14. 40 CFR 141.13 - Maximum contaminant levels for turbidity.

    Science.gov (United States)

    2010-07-01

    ... already exists. The added text follows. The requirements in this section apply to unfiltered systems until... until June 29, 1993. The requirements in this section apply to unfiltered systems that the State has...

  15. 40 CFR 141.75 - Reporting and recordkeeping requirements.

    Science.gov (United States)

    2010-07-01

    ... ground water source under the direct influence of surface water and does not provide filtration treatment..., 1990, or 6 months after the State determines that the ground water source is under the direct influence... determination of whether disinfection achieves adequate Giardia cyst and virus inactivation, i.e., whether...

  16. 40 CFR 141.71 - Criteria for avoiding filtration.

    Science.gov (United States)

    2010-07-01

    ... water immediately prior to the first or only point of disinfectant application in at least 90 percent of... water immediately prior to the first or only point of disinfectant application unless: (i) the State...) A review of the system's equipment maintenance program to ensure there is low probability for...

  17. 40 CFR 141.153 - Content of the reports.

    Science.gov (United States)

    2010-07-01

    ..., industrial or domestic wastewater discharges, oil and gas production, mining, or farming. (C) Pesticides and.... MCLs are set as close to the MCLGs as feasible using the best available treatment technology. (2) A... not to meet an MCL or a treatment technique under certain conditions. (3) A report that contains data...

  18. 40 CFR 141.805 - Notification to passengers and crew.

    Science.gov (United States)

    2010-07-01

    ... and should not be used for drinking, food or beverage preparation, hand washing, teeth brushing, or... beverage preparation, hand washing, teeth brushing, or any other consumptive use; (ii) A description of the... for drinking, food or beverage preparation, hand washing, teeth brushing, or any other consumptive use...

  19. 141 Development as Obligation and the Obligation of Development ...

    African Journals Online (AJOL)

    Tracie1

    1990) The Science of Right trans Hastie. Great Books of the Western World vol. 39 (edited) Alder. M. J. Chicago Encyclopedia Britannica Inc). Locke J. 1963. Leviathan in Somerville and Santoni (ed). Social and Political Philosophy Reading ...

  20. 7 CFR 457.141 - Rice crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... (Appropriate title for insurance provider) Both FCIC and Reinsured Policies Rice Crop Provisions If a conflict... Standards for Rice including, but not limited to, protein and oil content or milling quality will not be...

  1. Page 1 141 Ethiopian Journal of Environmental Studies ...

    African Journals Online (AJOL)

    USER

    2015-02-10

    Feb 10, 2015 ... This article bridges this knowledge gap by applying a social- environmental conceptual framework which consists ... Cameroon for example has prepared a growth and employment strategy paper (GESP) which ..... administrations will surely bridge the gap is appropriate resource is available for its efficient ...

  2. Dicty_cDB: VFB141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CB839842 |CB839842.1 Ac164 rat regenerating liver after partial hepatectomy Rattus norvegicus cDNA, mRNA...CB839821 |CB839821.1 Ac126 rat regenerating liver after partial hepatectomy Rattus norvegicus cDNA, mRNA

  3. What we do | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Partnership in Opportunities for Employment through Technologies in the Americas (POETA) : Eastern Caribbean Initiative. Topic(s): Youth Unemployment, Youth Unrest, Training Programmes, Information Technology, Young Workers. Region(s): Americas, Caribbean. The small island states of the Eastern Caribbean suffer ...

  4. 40 CFR 141.205 - Content of the public notice.

    Science.gov (United States)

    2010-07-01

    ... serving a large proportion of non-English speaking consumers, as determined by the primacy agency, the public notice must contain information in the appropriate language(s) regarding the importance of the... speaking consumers, the public water system must include in the public notice the same information as in...

  5. What we do | Page 141 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Partnership in Opportunities for Employment through Technologies in the Americas (POETA) : Eastern Caribbean Initiative. The small island states of the Eastern Caribbean suffer from high youth unemployment. North And Central America, South America, West Indies, Jamaica, Trinidad And Tobago ...

  6. 40 CFR 141.154 - Required additional health information.

    Science.gov (United States)

    2010-07-01

    ... Required additional health information. (a) All reports must prominently display the following language... MCL: (1) Must include a short informational statement about the impacts of nitrate on children using... the potential for lead exposure by flushing your tap for 30 seconds to 2 minutes before using water...

  7. 14 CFR Appendix C to Part 141 - Instrument Rating Course

    Science.gov (United States)

    2010-01-01

    ... personal observation of weather conditions; (7) Safe and efficient operation of aircraft under instrument...; (ii) Is a distance of at least 250 nautical miles along airways or ATC-directed routing with one...-directed routing with one segment of the flight consisting of at least a straight-line distance of 50...

  8. Dicty_cDB: SFF141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fspqikrwyanfcqnphw*dyytrs*rs**h*ec* sqnprqrrystrsttshfrr*tiggwsysl*lqhskgihspfssqvkrwyanfcknshw* nhy...fspqikrwyanfcqnphw*dyytrs*rs**h*ec* sqnprqrrystrsttshfrr*tiggwsysl*lqhskgihspfssqvkrwyanfcknshw* nhy

  9. PREFACE: Nobel Symposium 141: Qubits for Future Quantum Information Nobel Symposium 141: Qubits for Future Quantum Information

    Science.gov (United States)

    Claeson, Tord; Delsing, Per; Wendin, Göran

    2009-12-01

    Quantum mechanics is the most ground-breaking and fascinating theoretical concept developed in physics during the past century. Much of our present understanding of the microscopic world and its extension into the macroscopic world, including modern technical applications, is based upon quantum mechanics. We have experienced a remarkable development of information and communication technology during the past two decades, to a large extent depending upon successful fabrication of smaller and smaller components and circuits. However, we are finally approaching the physical limits of component miniaturization as we enter a microscopic world ruled by quantum mechanics. Present technology is mainly based upon classical physics such as mechanics and electromagnetism. We now face a similar paradigm shift as was experienced two hundred years ago, at the time of the industrial revolution. Engineered construction of systems is currently increasingly based on quantum physics instead of classical physics, and quantum information is replacing much of classical communication. Quantum computing is one of the most exciting sub-fields of this revolution. Individual quantum systems can be used to store and process information. They are called quantum bits, or qubits for short. A quantum computer could eventually be constructed by combining a number of qubits that act coherently. Important computations can be performed much more quickly than by classical computers. However, while we control and measure a qubit, it must be sufficiently isolated from its environment to avoid noise that causes decoherence at the same time. Currently, low temperature is generally needed to obtain sufficiently long decoherence times. Single qubits of many different kinds can be built and manipulated; some research groups have managed to successfully couple qubits and perform rudimentary logic operations. However, the fundamental problems, such as decoherence, entanglement, quantum measurements and error correction, have yet to be solved. It has been predicted that quantum computers will be able to perform certain complicated computations or simulations in minutes or hours instead of years as with present computers. So far there exist very few useful quantum algorithms; however there is hope that the development of these will be stimulated once there is a breakthrough in hardware. Remarkable progress has been made in quantum engineering and quantum measurements, but a large scale quantum computer is still far off. Quantum communication and cryptography are much closer to the market than a quantum computer. The development of quantum information has meant a large push in the field of quantum physics, that previously could only be studied in the microscopic world. Artificial atoms, realized by circuit technology and mimicking the properties of 'natural' atoms, are one example of the new possibilities opened up by quantum engineering. Several different types of qubits have been suggested. Some are based upon microscopic entities, like atoms and ions in traps, or nuclear spins in molecules. They can have long coherence times (i.e. a long period allowing many operations, of the order of 10 000, to be performed before the state needs to be refreshed) but they are difficult to integrate into large systems. Other qubits are based upon solid state components that facilitate integration and coupling between qubits, but they suffer from interactions with the environment and their coherent states have a limited lifetime. Advanced experiments have been performed with superconducting Josephson junctions and many breakthroughs have been reported in the last few years. They have an advantage in the inherent coherence of superconducting Cooper pairs over macroscopic distances. We chose to focus the Nobel Symposium on Qubits for Future Quantum Information on superconducting qubits to allow for depth in discussions, but at the same time to allow comparison with other types of qubits that may prevail in the long run. The purpose of the symposium was to bring together leading researchers in adjoining fields. Often, microscopic qubits are considered at conferences within atomic, molecular and optical physics, while macroscopic ones belong to the solid state community. At the symposium, we experienced objective comparisons between different types of qubits—pros and cons as well as prospects. One example was the topic of quantum electrodynamics of superconducting circuits where qubits are coupled to a high-Q microwave resonator. This breakthrough technology was covered in several talks and was compared, in detail, with the corresponding case of light coupled to atoms in a cavity. A highlight was the presentation of how arbitrary photon states can be created in a cavity and the measurement of the corresponding Wigner functions. A Nobel Symposium provides an excellent opportunity to bring together a group of outstanding scientists for a stimulating exchange of ideas and results. The present symposium took place in Gothenburg, 25-28 May 2009. In order to allow local researchers and students to get a feeling of what is happening in the field, the first day of the symposium was held at the Chalmers campus. The remaining three days were spent at the mansion built by William Chalmers, the benefactor behind Chalmers University of Technology. Thirty-three speakers gave popular lectures open to the general public, overviews of different types of qubits, quantum phenomena, and quantum computing requirements, as well as specialized contributions in six sessions, and ten posters were displayed. The list of participants, program, abstracts and summaries of presentations is given at www.chalmers.se/mc2/EN/nobel-symposium-2009. In order to encourage constructive interactions and discussions, ample time was given to extensive critical discussions and to individual meetings in relaxing and stimulating environments. Questions and discussions followed all talks but longer, more extensive, discussions of about one hour ended each session. These discussions were initiated by a special questioner (a kind of 'devil's advocate'). Receptions were given by the President of Chalmers and by the City of Gothenburg. The participants also sailed with SS Bohuslän in the archipelago outside the city. The symposium was sponsored by the Nobel Foundation through its Nobel Symposium Committee and was organized by Thilo Bauch, Tord Claeson, Per Delsing, Ann-Marie Frykestig, Eva Hellberg, Göran Johansson, Göoran Wendin, and Chris Wilson. Special thanks are given to the program committee: John Clarke, Daniel Estève, Steve Girvin, Anne l'Huillier, Anthony Leggett, and Mikko Paalanen. The editor of the proceedings is Göran Johansson.

  10. pH dependent photophysical studies of new europium and terbium complexes of tripodal ligand: Experimental and semiempirical approach

    Energy Technology Data Exchange (ETDEWEB)

    Akbar, Rifat [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India); Baral, Minati [Department of Chemistry, National Institute of Technology Kurukshetra, Haryana 136119 (India); Kanungo, B K, E-mail: b.kanungo@gmail.com [Department of Chemistry, Sant Longowal Institute of Engineering & Technology, Longowal, Punjab 148106 (India)

    2015-11-15

    The photophysical properties of adduct of a novel nonadentate tripodal ligand, 5,5′-(2-(((8-hydroxyquinolin-5-yl)methylamino)methyl)-2-methylpropane-1, 3-diyl)bis(azanediyl)bis(methylene diquinolin-8-ol, (TAME5OX), with Eu{sup 3+} and Tb{sup 3+} metal ions have been probed for photonics applications. The absorption spectroscopy of these complexes show remarkable spectral changes due to characteristic lanthanide transitions, which support the use of TAME5OX as a sensitive optical pH based sensor to detect Ln{sup 3+} metal ions in biological systems. In addition, these complexes have also been shown to exhibit strong green fluorescence allowing simultaneous sensing within the visible region under physiological pH in competitive medium for both Eu{sup 3+} and Tb{sup 3+} ions. The intense fluorescence from these compounds were revealed to intermittently get quenched under acidic as well as basic conditions due to the photoinduced intramolecular electron transfer from excited 8-hydroxyquinoline (8-HQ) moiety to metal ion, just an opposite process. This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensor. The thermodynamic stability and aqueous coordination chemistry of the chelator with the said lanthanide ions have also been probed by potentiometric, UV–visible and fluorescence spectrophotometric method. TAME5OX has been found to form two protonated complexes [Ln(H{sub 5}L)]{sup 5+} and [Ln(H{sub 4}L)]{sup 4+} below pH 2.5 with both metal ions, which consecutively deprotonates through one proton process with rise of pH. The formation constants (log β{sub 11n}) of neutral complexes have been determined to be 33.51 and 32.16 with pLn (pLn=−log[Ln{sup 3+}]) values of 16.14 and 19.48 for Eu{sup 3+} and Tb{sup 3+} ions, respectively, calculated at pH 7.4, indicating TAME5OX is a good lanthanide synthetic chelator. The emission lifetimes of the Eu{sup 3+} and Tb{sup 3+} complexes recorded in D{sub 2}O and H{sub 2}O suggest the presence of water molecules in the first coordination sphere of the metal ions. NMR titrations were carried out to determine the stoichiometry of chelates. The complexe's coordination geometries were optimized by using PM7 as sparkle/PM7 model. The theoretical electronic behavior was evaluated to support the experimental findings, based on ZINDO/S methodology at configuration interaction with single excitations (CIS) level. These results emphasize the capability of the use of the theoretical models in prediction of geometries and all other calculations of compounds containing lanthanide ions and create new interesting possibilities for the design in-silico of novel and highly efficient lanthanide–organic edifice. - Highlights: • Photophysical behavior of Eu{sup 3+} and Tb{sup 3+} complexes of TAME5OX has been investigated. • This tripodal ligand forms thermodynamically stable Ln{sup 3+} complexes. • These compounds exhibit strong green fluorescence under physiological pH. • Green fluorescence gets quenched under acidic and basic conditions, due to PET process. • This renders these compounds the OFF–ON–OFF type of pH-dependent fluorescent sensors.

  11. Visible photoluminescence in polycrystalline terbium doped aluminum nitride (Tb:AlN) ceramics with high thermal conductivity

    Science.gov (United States)

    Wieg, A. T.; Kodera, Y.; Wang, Z.; Imai, T.; Dames, C.; Garay, J. E.

    2012-09-01

    Thermal management continues to be one of the major challenges in the development of high powered light sources such as solid state lasers. In particular, the relatively low thermal conductivity of standard photoluminescent (PL) materials limits the overall power output and/or duty cycle. We present a method based on current activated pressure assisted densification for the fabrication of high thermal conductivity PL materials: rare earth doped polycrystalline bulk aluminum nitride. Specifically, the ceramics are translucent and are doped with Tb3+, allowing for emission in the visible. Remarkably, the ceramics have a room temperature thermal conductivity of 94 W/(m K) which is almost seven times higher than that of the state of the art host material, Nd-doped yttrium aluminum garnet. These light emitting properties coupled with very high thermal conductivity should enable the development of a wide variety of more powerful light sources.

  12. Preparation of extractive resins for producing terbium-161; Preparacion de resinas extractivas para produccion de terbio-161

    Energy Technology Data Exchange (ETDEWEB)

    De la Cruz B, C. C.; Monroy G, F. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)], e-mail: fabiola.monroy@inin.gob.mx

    2009-10-15

    This paper presents the development of a methodology for extractive resins preparation to base of HDEHP, which allows to separation of Tb from Gd generating an own technology of preparation of these resins. The study included the extractive resins preparation from 6 different supports: kieselguhr Dg, alumina, red volcanic rock, chiluca, quarry and fluorite; two treatment types of of supports and varied concentrations of HDEHP extractant (di(2-etil hexyl) orthophosphoric acid), in order to determine which resin has improved efficiency of Gd and Tb separation, and radionuclide purity of {sup 161}Tb. Resins were prepared to base of kieselguhr to determine the most appropriate silicon deposition process. Two silicon deposition treatments were realized: treatment I , by contact with silicon deposition solution (dimethyldichlorosilane / heptane 1:30) and treatment II by contact with vapors of dimethyldichlorosilane in vacuum. The extractant retention was carried out to different concentrations of HDEHP / acetone: 1:4, 1:8, 1:15, 1:20, 1:30 and 1:40. According to the results, there is not direct relation of HDEHP concentration used in extractive resins preparation to base of kieselguhr over the efficiency of Gd and Tb separation and of radionuclide purity of {sup 161}Tb. The effect of support in the efficiency of Gd and Tb separation was studied to prepare resins with the supports kieselguhr, alumina, quarry, chiluca, volcanic rock and fluorite, using the silicon deposition treatment II for the supports and a concentration of HDEHP / acetone 1:20, for extractant retention. Only resins based on kieselguhr could separate to Gd from Tb quantitatively, the resin at a concentration of HDEHP / Acetone 1:20 was the best results obtained in Gd and Tb separation, achieving a separation efficiency greater than 90% and a radionuclide purity higher than 99%. (Author)

  13. Synthesis and Characterization of Europium(III) and Terbium(III) Complexes: An Advanced Undergraduate Inorganic Chemistry Experiment

    Science.gov (United States)

    Swavey, Shawn

    2010-01-01

    Undergraduate laboratories rarely involve lanthanide coordination chemistry. This is unfortunate in light of the ease with which many of these complexes are made and the interesting and instructive photophysical properties they entail. The forbidden nature of the 4f transitions associated with the lanthanides is overcome by incorporation of…

  14. Sensitized green emission of terbium with dibenzoylmethane and 1, 10 phenanthroline in polyvinyl alcohol and polyvinyl pyrrolidone blends

    Science.gov (United States)

    Kumar, Brijesh; Kaur, Gagandeep; Rai, S. B.

    2017-12-01

    Tb doped polyvinyl alcohol: polyvinyl pyrrolidone blends with dibenzoylmethane (DBM) and 1, 10 Phenanthroline (Phen) have been prepared by solution cast technique. Bond formation amongst the ligands and Tb3 + ions in the doped polymer has been confirmed employing Fourier Transform Infrared (FTIR) techniques. Optical properties of the Tb3 + ions have been investigated using UV-Vis absorption, excitation and fluorescence studies excited by different radiations. Addition of dimethylbenzoate and 1, 10 Phenanthroline to the polymer blend increases the luminescence from Tb3 + ions along with energy transfer from the polymer blend itself. Luminescence decay curve analysis affirms the non-radiative energy transfer from DBM and Phen to Tb3 + ions, which is identified as the reason behind this enhancement. The fluorescence decay time of PVA-PVP host decreases from 6.02 ns to 2.31 ns showing an evidence of energy transfer from the host blend to the complexed Tb ions. Similarly the lifetime of DBM and Phen and both in the blend reduces in the complexed system showing the feasibility of energy transfer from these excited DBM and Phen to Tb3 + and is proposed as the cause of the above observations. These entire phenomena have been explained by the energy level diagram.

  15. A Terbium Metal-Organic Framework for Highly Selective and Sensitive Luminescence Sensing of Hg2+Ions in Aqueous Solution.

    Science.gov (United States)

    Xia, Tifeng; Song, Tao; Zhang, Gege; Cui, Yuanjing; Yang, Yu; Wang, Zhiyu; Qian, Guodong

    2016-12-19

    A series of isomorphic lanthanide metal-organic frameworks (MOFs) Ln(TATAB)⋅(DMF) 4 (H 2 O)(MeOH) 0.5 (LnTATAB, Ln=Eu, Tb, Sm, Dy, Gd; H 3 TATAB=4,4',4''-s-triazine-1,3,5-triyltri-p-aminobenzoic acid) have been solvothermally synthesized and structurally characterized. Among these MOFs, TbTATAB exhibits good water stability and a high fluorescence quantum yield. Because mercury ions (Hg 2+ ) have a high affinity to nitrogen atoms, and the space between multiple nitrogen atoms from triazine and imino groups is suitable for interacting with Hg 2+ ions, TbTATAB shows highly selective and sensitive detection of Hg 2+ in aqueous solution with a detection limit of 4.4 nm. Furthermore, it was successfully applied to detect Hg 2+ ions in natural water samples. © 2016 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Molecular structure, second- and third-order nonlinear optical properties and DFT studies of a novel non-centrosymmetric chalcone derivative: (2E)-3-(4-fluorophenyl)-1-(4-{[(1E)-(4-fluorophenyl)methylene]amino}phenyl)prop-2-en-1-one.

    Science.gov (United States)

    Maidur, Shivaraj R; Patil, Parutagouda Shankaragouda; Ekbote, Anusha; Chia, Tze Shyang; Quah, Ching Kheng

    2017-09-05

    In the present work, the title chalcone, (2E)-3-(4-fluorophenyl)-1-(4-{[(1E)-(4-fluorophenyl) methylene]amino}phenyl)prop-2-en-1-one (abbreviated as FAMFC), was synthesized and structurally characterized by single-crystal X-ray diffraction. The compound is crystallized in the monoclinic system with non-centrosymmetric space group P21 and hence it satisfies the essential condition for materials to exhibit second-order nonlinear optical properties. The molecular structure was further confirmed by using FT-IR and 1H NMR spectroscopic techniques. The title crystal is transparent in the Vis-NIR region and has a direct band gap. The third-order nonlinear optical properties were investigated in solution (0.01M) by Z-scan technique using a continuous wave (CW) DPSS laser at the wavelength of 532nm. The title chalcone exhibited significant two-photon absorption (β=35.8×10-5cmW-1), negative nonlinear refraction (n2=-0.18×10-8cm2W-1) and optical limiting (OL threshold=2.73kJcm-2) under the CW regime. In support of the experimental results, a comprehensive theoretical study was carried out on the molecule of FAMFC using density functional theory (DFT). The optimized geometries and frontier molecular orbitals were calculated by employing B3LYP/6-31+G level of theory. The optimized molecular structure was confirmed computationally by IR vibrational and 1H NMR spectral analysis. The experimental UV-Vis-NIR spectrum was interpreted using computational chemistry under time-dependent DFT. The static and dynamic NLO properties such as dipole moments (μ), polarizability (α), and first hyperpolarizabilities (β) were computed by using finite field method. The obtained dynamic first hyperpolarizability β(-2ω;ω,ω) at input frequency ω=0.04282a.u. is predicted to be 161 times higher than urea standard. The electronic excitation energies and HOMO-LUMO band gap for FAMFC were also evaluated by DFT. The experimental and theoretical results are in good agreement, and the NLO study

  17. Molecular structure, second- and third-order nonlinear optical properties and DFT studies of a novel non-centrosymmetric chalcone derivative: (2E)-3-(4-fluorophenyl)-1-(4-{[(1E)-(4-fluorophenyl)methylene]amino}phenyl)prop-2-en-1-one

    Science.gov (United States)

    Maidur, Shivaraj R.; Patil, Parutagouda Shankaragouda; Ekbote, Anusha; Chia, Tze Shyang; Quah, Ching Kheng

    2017-09-01

    In the present work, the title chalcone, (2E)-3-(4-fluorophenyl)-1-(4-{[(1E)-(4-fluorophenyl) methylene]amino}phenyl)prop-2-en-1-one (abbreviated as FAMFC), was synthesized and structurally characterized by single-crystal X-ray diffraction. The compound is crystallized in the monoclinic system with non-centrosymmetric space group P21 and hence it satisfies the essential condition for materials to exhibit second-order nonlinear optical properties. The molecular structure was further confirmed by using FT-IR and 1H NMR spectroscopic techniques. The title crystal is transparent in the Vis-NIR region and has a direct band gap. The third-order nonlinear optical properties were investigated in solution (0.01 M) by Z-scan technique using a continuous wave (CW) DPSS laser at the wavelength of 532 nm. The title chalcone exhibited significant two-photon absorption (β = 35.8 × 10- 5 cm W- 1), negative nonlinear refraction (n2 = - 0.18 × 10- 8 cm2 W- 1) and optical limiting (OL threshold = 2.73 kJ cm- 2) under the CW regime. In support of the experimental results, a comprehensive theoretical study was carried out on the molecule of FAMFC using density functional theory (DFT). The optimized geometries and frontier molecular orbitals were calculated by employing B3LYP/6-31 + G level of theory. The optimized molecular structure was confirmed computationally by IR vibrational and 1H NMR spectral analysis. The experimental UV-Vis-NIR spectrum was interpreted using computational chemistry under time-dependent DFT. The static and dynamic NLO properties such as dipole moments (μ), polarizability (α), and first hyperpolarizabilities (β) were computed by using finite field method. The obtained dynamic first hyperpolarizability β(- 2ω;ω,ω) at input frequency ω = 0.04282 a.u. is predicted to be 161 times higher than urea standard. The electronic excitation energies and HOMO-LUMO band gap for FAMFC were also evaluated by DFT. The experimental and theoretical results are in good

  18. Anti-L1CAM radioimmunotherapy is more effective with the radiolanthanide terbium-161 compared to lutetium-177 in an ovarian cancer model

    Energy Technology Data Exchange (ETDEWEB)

    Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)

    2014-10-15

    The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts. These results suggest that {sup 161}Tb is a promising candidate for future clinical applications in combination with internalising antibodies. (orig.)

  19. CCDC 954774: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4'-(tetrazol-2-id-5-yl)biphenyl-4-carboxylate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  20. CCDC 959634: Experimental Crystal Structure Determination : octakis(mu~3~-Hydroxo)-undecakis(mu~2~-2-fluorobenzoato)-(N,N-dimethylformamide)-nitrato-hexa-aqua-hexa-terbium

    KAUST Repository

    Guillerm, Vincent

    2014-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  1. CCDC 954773: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(4-(tetrazol-2-id-5-yl)benzoate) tetrahydroxide trihydrate unknown solvate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  2. CCDC 954775: Experimental Crystal Structure Determination : Dimethylammonium tri-terbium tris(2-fluoro-4-(1H-tetrazol-5-yl)benzoate) tetrahydroxide tetradecahydrate

    KAUST Repository

    Xue, Dongxu

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  3. CCDC 1411423: Experimental Crystal Structure Determination : catena-[dimethylammonium hexakis(mu-fumarato)-octakis(mu-hydroxo)-hexa-terbium N,N-dimethylformamide solvate hexahydrate

    KAUST Repository

    Assen, Ayalew H.

    2016-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  4. CCDC 1410946: Experimental Crystal Structure Determination : catena-[dimethylammonium tris(mu-naphthalene-1,4-dicarboxylato)-tetrakis(mu-hydroxo)-triaqua-tri-terbium(iii) unknown solvate

    KAUST Repository

    Xue, Dongxu

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  5. Phthalimides: Supramolecular Interactions in Crystals, Hypersensitive Solution 1H-NMR Dynamics and Energy Transfer to Europium(III and Terbium(III States

    Directory of Open Access Journals (Sweden)

    David J. Williams

    2003-07-01

    Full Text Available Detailed crystal structures and 1H-NMR characteristics of some alkylaminephthalimides, including dendritic polyphthalimides, are reported. These investigations were undertaken in order to obtain a better understanding of the relationship between solid-state supramolecular interactions, their persistence in solution and associated dynamics of magnetically hypersensitive phthalimide aromatic AA'BB'-AA'XX' proton NMR resonances. Some alkylamine phthalimides feature folded molecular geometries, which we attribute to n-π interactions among proximal amine-phthalimide sites; those alkylamine-phthalimides that have no possibility for such interactions feature fully extended phthalimide functionalities. Accordingly, alkylamine phthalimide compounds with folded solid-state geometries feature solvent and temperature dependent hypersensitive AA'BB'-AA'XX' 1H-NMR line profiles, which we attribute to the n-π interactions. Luminescence of Eu3+(5D0 and Tb3+(5D4 states show well defined metal ion environments in their complexes with dendritic phthalimides, as well as relatively weak phthalimide-lanthanide(III interactions.

  6. Analysis of tryptophan at nmoll(-1) level based on the fluorescence enhancement of terbium-gadolinium-tryptophan-sodium dodecyl benzene sulfonate system.

    Science.gov (United States)

    Liu, Shufang; Yang, Jinghe; Wu, Xia; Su, Benyu; Sun, Changxia; Wang, Feng

    2004-10-08

    It is found that Tb(3+) can react with tryptophan (Trp) and sodium dodecyl benzene sulfonate (SDBS), and emits the intrinsic fluoresence of Tb(3+). The fluorescence intensity can be enhanced by La(3+), Gd(3+), Lu(3+), Sc(3+) and Y(3+), among which Gd(3+) has the greatest enhancement. This is a new co-luminescence system. The studies indicate that in the Tb-Gd-Trp-SDBS system, there is both Tb-Trp-SDBS and Gd-Trp-SDBS complexes, and they aggregate together and form a large congeries. The fluorescence enhancement of the Tb-Gd-Trp-SDBS system is considered to originate from intramolecular and intermolecular energy transfers, and the energy-insulating sheath effect of Gd-Trp-SDBS complex. Under the optimum conditions, the enhanced intensity of fluorescence is in proportion to the concentration of Trp in the range from 4x10(-8) to 4x10(-5)moll(-1). The detection limit is 10(-9)moll(-1). The proposed method is one of the most sensitive fluoremetries of Trp.

  7. Preparation, characterization, and properties of PMMA-doped polymer film materials: a study on the effect of terbium ions on luminescence and lifetime enhancement.

    Science.gov (United States)

    Zhang, Hui-Jie; Fan, Rui-Qing; Wang, Xin-Ming; Wang, Ping; Wang, Yu-Lei; Yang, Yu-Lin

    2015-02-14

    Poly(methylmethacrylate) (PMMA) doped with Tb-based imidazole derivative coordination polymer {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) (1) (L = N,N'-bis(acetoxy)biimidazole) was synthesized and its photophysical properties were studied. The L'(L' = N,N'-bis(ethylacetate)biimidazole) ligand was synthesized by an N-alkylation reaction process followed by ester hydrolysis to produce ligand L. Polymer 1 and ligand L' have been characterized by (1)H NMR and IR spectroscopy, elemental analysis, PXRD and X-ray single-crystal diffraction. Coordination polymer 1 is the first observation of a CdCl(2) structure constructed with hydroxy groups and decorated by ligand L in lanthanide N-heterocyclic coordination polymers. In the 2D layered structure of 1, each Tb3 metal center is connected with three Tb1 and three Tb2 metal centers by seven hydroxyl groups in different directions, resulting in a six-membered ring. After doping, not only the luminescence intensity and lifetime enhanced, but also their thermal stability was increased in comparison with 1. When 1 was doped into poly(methylmethacrylate) (1@PMMA), polymer film materials were formed with the PMMA polymer matrix (w/w = 2.5%-12.5%) acting as a co-sensitizer for Tb(3+) ions. The luminescence intensity of the Tb(3+) emission at 544 nm increases when the content of Tb(3+) was 10%. The lifetime of 1@PMMA (914.88 μs) is more than four times longer than that of 1 (196.24 μs). All τ values for the doped polymer systems are higher than coordination polymer 1, indicating that radiative processes are operative in all the doped polymer films. This is because PMMA coupling with the O-H oscillators from {[Tb(3)(L)(μ(3)-OH)(7)]·H(2)O}(n) can suppress multiphonon relaxation. According to the variable-temperature luminescence (VT-luminescence) investigation, 1@PMMA was confirmed to be a stable green luminescent polymer film material.

  8. Changing Single-Molecule Magnet Properties of a Windmill-Like Distorted Terbium(III) α-Butoxy-Substituted Phthalocyaninato Double-Decker Complex by Protonation/Deprotonation.

    Science.gov (United States)

    Horii, Yoji; Horie, Yusuke; Katoh, Keiichi; Breedlove, Brian K; Yamashita, Masahiro

    2018-01-16

    Synthesis, structures, and magnetic properties of α-butoxy-substituted phthalocyaninato double-decker complexes Tb(α-obPc)2 (1-) (α-obPc: dianion of 1,4,8,11,15,18,22,25-octa(n-butoxy)phthalocyaninato) with protonated (1H), deprotonated (1[HDBU]), and diprotonated forms (1H2+) are discussed. X-ray analysis was used to confirm the position of the proton in 1H, and it was revealed that the protonation induced asymmetric distortion in 1H. In contrast, 1[HDBU] was distorted in a highly symmetric windmill-like fashion. 1H is arranged in a slipped column array in the crystal packing, whereas 1[HDBU] is arranged in a one-dimensional fashion, in which the magnetic easy axes of 1[HDBU] lie along the same line. From direct-current (dc) magnetic measurements, ferromagnetic Tb-Tb interactions occur in both 1H and 1[HDBU], and magnetic hysteresis was observed. However, the area of the magnetic hysteresis in 1[HDBU] is larger than that in 1H, meaning that magnetic relaxation time (τ) is longer in 1[HDBU]. In addition, the results of alternating-current magnetic measurements in a zero dc magnetic field indicate that τ of 1[HDBU] is longer as compared to 1H. In other words, protonation/deprotonation affects not only the molecular structures and crystal packing but also the single-molecule magnet properties.

  9. A Water-Stable Dual-Channel Luminescence Sensor for UO22+Ions Based on an Anionic Terbium(III) Metal-Organic Framework.

    Science.gov (United States)

    Ye, Junwei; Bogale, Raji F; Shi, Yangwei; Chen, Yanzhen; Liu, Xigang; Zhang, Siqi; Yang, Yaoyao; Zhao, Jianzhang; Ning, Guiling

    2017-06-07

    A stable 3D Tb III -based metal-organic framework [Tb(BPDC) 2 ]⋅(CH 3 ) 2 NH 2 (DUT-101) was synthesized, and it is the first efficient dual-channel luminescence sensor for aqueous UO 2 2+ ions. DUT-101 contains an anionic three-dimensional framework and protonated dimethylamine molecules embedded within the channels. The intense green emission of DUT-101 could be highly selectively and sensitively quenched by UO 2 2+ ions even in the presence of other competing metal ions. A possible sensing mechanism was proposed based on both suppression of luminescence resonance energy transfer and enhancement of intermolecular electron transfer. Furthermore, visual green fluorescent test papers based on DUT-101 were fabricated and could be used to discriminate UO 2 2+ ions among various metal ions. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. [?-N,N?-Bis(3-meth?oxy-2-oxidobenzyl?idene)propane-1,3-diamine]trinitratocopper(II)terbium(III) acetone solvate

    OpenAIRE

    Zhang Fang; Liu Fei

    2008-01-01

    In the title complex, [CuTb(C19H20N2O4)(NO3)3]·CH3COCH3, the CuII atom is four-coordinated by two O atoms and two N atoms from the deprotonated Schiff base in a square-planar geometry, while the TbIII atom is ten-coordinated by four O atoms from the deprotonated Schiff base and six O atoms from three bidentate nitrate anions. The compound is isostructural with the previously reported GdIII analogue [Elmali & Elerman (2004). Z. Naturforsch. Teil B, 59, 535–540], which was described ...

  11. Crystal structure of a mixed-ligand terbium(III coordination polymer containing oxalate and formate ligands, having a three-dimensional fcu topology

    Directory of Open Access Journals (Sweden)

    Chainok Kittipong

    2016-01-01

    Full Text Available The title compound, poly[(μ3-formato(μ4-oxalatoterbium(III], [Tb(CHO2(C2O4]n, is a three-dimensional coordination polymer, and is isotypic with the LaIII, CeIII and SmIII analogues. The asymmetric unit contains one TbIII ion, one formate anion (CHO2− and half of an oxalate anion (C2O42−, the latter being completed by application of inversion symmetry. The TbIII ion is nine-coordinated in a distorted tricapped trigonal–prismatic manner by two chelating carboxylate groups from two C2O42− ligands, two carboxylate oxygen atoms from another two C2O42− ligands and three oxygen atoms from three CHO2− ligands, with the Tb—O bond lengths and the O—Tb—O bond angles ranging from 2.4165 (19 to 2.478 (3 Å and 64.53 (6 to 144.49 (4°, respectively. The CHO2− and C2O42− anions adopt μ3-bridging and μ4-chelating-bridging coordination modes, respectively, linking adjacent TbIII ions into a three-dimensional 12-connected fcu topology with point symbol (324.436.56. The title compound exhibits thermal stability up to 623 K, and also displays strong green photoluminescence in the solid state at room temperature.

  12. 40 CFR 141.202 - Tier 1 Public Notice-Form, manner, and frequency of notice.

    Science.gov (United States)

    2010-07-01

    ... learns of the violation or situation, to determine additional public notice requirements; and (3) Comply... fit the specific situation, but must be designed to reach residential, transient, and non-transient... violations or situations require a Tier 1 public notice? Table 1 of this section lists the violation...

  13. Corrosion Tracking and Prediction for C-141A Aircraft Maintenance Scheduling

    Science.gov (United States)

    1978-04-01

    corporation, or conveying any rights or permission to manufacture, use, or sell any patented invention that may in any way be related thereto. This...presents the results of a t-test for the sig- fincance of difference between means for the data of Figure 17. The estimate for the mean is given at the

  14. African Journal of Drug & Alcohol Studies, 14(1), 2015 Copyright ...

    African Journals Online (AJOL)

    To compare the ability of a new Time-of-Flight Mass Spectrometry with direct sample analysis (TOF-DSA. MS) and Gas Chromatography ... sec while GC-MS takes 10 minutes per sample. The running cost for the GCMS is more expensive .... biological fluids (blood or urine) (Daugh- erty, 2011). RESULTS. Both GC-MS and ...

  15. Bawazeer et al., Afr J Tradit Complement Altern Med. (2017) 14(1 ...

    African Journals Online (AJOL)

    incubation with 200μM naringenin the gene expression activities of all the SREBP-1a, -1c, -2 and LDLr promoter- constructs were increased significantly. The effects of both 200μM naringenin on elevating LDLr mRNA are possibly due to regulation of gene transcription by SREBP-la and SREBP-2. However, the suppression ...

  16. African Journal of Drug & Alcohol Studies, 14(1), 2015 Copyright ...

    African Journals Online (AJOL)

    was associated with lower levels of substance use/dependence. Abstinence was achieved by 47% of participants. Key words: substance abuse, substance dependence, treatment outcomes, self-efficacy, motivation, evaluation. Corresponding author: Lynda Duffett, Department of Psychology, University of Cape Town, ...

  17. African Journal of Drug & Alcohol Studies, 14(1), 2015 Copyright ...

    African Journals Online (AJOL)

    However, logistic regression revealed that only alcohol abuse (B = -1.383, df = 1, p. = .002) predicted non adherence to ART. We recommend the screening of patients on. ART for substance abuse and a multi-disciplinary approach to the treatment of HIV/AIDS. Key words: HIV, substance abuse, medication adherence.

  18. 14 CFR Appendix I to Part 141 - Additional Aircraft Category and/or Class Rating Course

    Science.gov (United States)

    2010-01-01

    ... commercial pilot certificate, the following aeronautical knowledge areas must be included in a 15-hour ground... Administration for commercial pilot privileges, limitations, and flight operations; (2) Basic aerodynamics and... the date of the practical test. (3) For the commercial pilot certificate, the course must include 55...

  19. 14 CFR Appendix E to Part 141 - Airline Transport Pilot Certification Course

    Science.gov (United States)

    2010-01-01

    ... rating for which the course applies, and: (a) Hold a commercial pilot certificate and an instrument... experience requirements under § 61.73 of this chapter to qualify for a commercial pilot certificate and an... commercial pilot license and an instrument rating, if the person holds a pilot license issued by a...

  20. PHIP - a novel candidate breast cancer susceptibility locus on 6q14.1

    NARCIS (Netherlands)

    Jiao, X. (Xiang); Aravidis, C. (Christos); Marikkannu, R. (Rajeshwari); Rantala, J. (Johanna); Picelli, S. (Simone); Adamovic, T. (Tatjana); Liu, T. (Tao); Maguire, P. (Paula); B. Kremeyer (Barbara); Luo, L. (Liping); von Holst, S. (Susanna); Kontham, V. (Vinaykumar); Thutkawkorapin, J. (Jessada); Margolin, S. (Sara); Du, Q. (Quan); Lundin, J. (Johanna); Michailidou, K. (Kyriaki); Bolla, M.K. (Manjeet K.); Wang, Q. (Qin); Dennis, J. (Joe); Lush, M. (Michael); C.B. Ambrosone (Christine); I.L. Andrulis (Irene); H. Anton-Culver (Hoda); Antonenkova, N.N. (Natalia N.); Arndt, V. (Volker); M.W. Beckmann (Matthias); C. Blomqvist (Carl); W.J. Blot (William); Boeckx, B. (Bram); S.E. Bojesen (Stig); B. Bonnani (Bernardo); J.S. Brand (Judith S.); H. Brauch (Hiltrud); H. Brenner (Hermann); A. Broeks (Annegien); T. Brüning (Thomas); B. Burwinkel (Barbara); Cai, Q. (Qiuyin); J. Chang-Claude (Jenny); NBCS Collaborators, (); Couch, F.J. (Fergus J.); A. Cox (Angela); S.S. Cross (Simon); S.L. Deming-Halverson (Sandra); P. Devilee (Peter); I. dos Santos Silva (Isabel); Dörk, T. (Thilo); M. Eriksson (Mats); P.A. Fasching (Peter); J.D. Figueroa (Jonine); D. Flesch-Janys (Dieter); H. Flyger (Henrik); M. Gabrielson (Marike); M. García-Closas (Montserrat); Giles, G.G. (Graham G.); A. González-Neira (Anna); P. Guénel (Pascal); Q. Guo (Qi); Gündert, M. (Melanie); C.A. Haiman (Christopher); Hallberg, E. (Emily); U. Hamann (Ute); P. harrington (Patricia); M.J. Hooning (Maartje); J.L. Hopper (John); Huang, G. (Guanmengqian); A. Jakubowska (Anna); M. Jones (Michael); M. Kerin (Michael); V-M. Kosma (Veli-Matti); Kristensen, V.N. (Vessela N.); Lambrechts, D. (Diether); L. Le Marchand (Loic); J. Lubinski (Jan); A. Mannermaa (Arto); J.W.M. Martens (John); A. Meindl (Alfons); R.L. Milne (Roger); A.-M. Mulligan (Anna-Marie); S.L. Neuhausen (Susan); H. Nevanlinna (Heli); J. Peto (Julian); K. Pykäs (Katri); P. Radice (Paolo); V. Rhenius (Valerie); E.J. Sawyer (Elinor); M.K. Schmidt (Marjanka); R.K. Schmutzler (Rita); C.M. Seynaeve (Caroline); Shah, M. (Mitul); J. Simard (Jacques); Southey, M.C. (Melissa C.); A.J. Swerdlow (Anthony ); T. Truong (Thérèse); Wendt, C. (Camilla); R. Winqvist (Robert); W. Zheng (Wei); kConFab/AOCS Investigators, (); J. Benítez (Javier); A.M. Dunning (Alison); P.D.P. Pharoah (Paul); D.F. Easton (Douglas); K. Czene (Kamila); P. Hall (Per); A. Lindblom (Annika)

    2017-01-01

    textabstractMost non-BRCA1/2 breast cancer families have no identified genetic cause. We used linkage and haplotype analyses in familial and sporadic breast cancer cases to identify a susceptibility locus on chromosome 6q. Two independent genome-wide linkage analysis studies suggested a 3 Mb locus