WorldWideScience

Sample records for tenebrio molitor larvae

  1. Rapid bioassay to screen potential biopesticides in Tenebrio molitor larvae

    Science.gov (United States)

    A simplified assay was devised to evaluate the response of Tenebrio molitor larvae to potential insect control products. The assay incorporates punched disks of flattened whole-grain bread placed in 96-well plates, with treatments applied topically, and neonate larvae added to each well. To evalua...

  2. Enantiomerization and enantioselective bioaccumulation of metalaxyl in Tenebrio molitor larvae.

    Science.gov (United States)

    Gao, Yongxin; Wang, Huili; Qin, Fang; Xu, Peng; Lv, Xiaotian; Li, Jianzhong; Guo, Baoyuan

    2014-02-01

    The enantiomerization and enantioselective bioaccumulation of metalaxyl by a single dose of exposure to Tenebrio molitor larvae under laboratory condition were studied by high-performance liquid chromatography tandem mass spectroscopy (HPLC-MS/MS) based on a ChiralcelOD-3R [cellulosetris-tris-(3, 5-dichlorophenyl-carbamate)] column. Exposure of enantiopure R-metalaxyl and S-metalaxyl in Tenebrio molitor larvae exhibited significant enantiomerization, with formation of the R enantiomers from the S enantiomers, and vice versa, which might be attributed to the chiral pesticide catalyzed by a certain enzyme in Tenebrio molitor larvae. Enantiomerization was not observed in wheat bran during the period of 21 d. In addition, bioaccumulation of rac-metalaxyl in Tenebrio molitor larvae was enantioselective with a preferential accumulation of S-metalaxyl. These results showed that enantioselectivity was caused not only by actual degradation and metabolism but also by enantiomerization, which was an important process in the environmental fate and behavior of metalaxyl enantiomers. Copyright © 2013 Wiley Periodicals, Inc.

  3. Enantioselective bioaccumulation of diniconazole in Tenebrio molitor larvae.

    Science.gov (United States)

    Liu, Chen; LV, Xiao Tian; Zhu, Wen Xue; QU, Hao Yang; Gao, Yong Xin; Guo, Bao Yuan; Wang, Hui Li

    2013-12-01

    The enantioselective bioaccumulation of diniconazole in Tenebrio molitor Linne larva was investigated with liquid chromatography tandem mass spectrometry based on the ChiralcelOD-3R[cellulose tri-(3,5-dimethylphenyl carbamate)] column. In this study we documented the effects of dietary supplementation with wheat bran contaminated by racemic diniconazole at two dose levels of 20 mg kg(-1) and 2 mg kg(-1) (dry weight) in Tenebrio molitor. The results showed that both doses of diniconazole were taken up by Tenebrio molitor rapidly in the first few days, the concentrations of R-enantiomer and S-enantiomer at high doses reached the highest level of 0.55 mg kg(-1) and 0.48 mg kg(-1) , respectively, on the 1(st) d, and the concentrations of them obtained a maxima of 0.129 mg kg(-1) and 0.128 mg kg(-1) at low dose, respectively, on the 3(rd) d, which means that the concentration of diniconazole was proportional to the time of achieving the highest accumulated level. It afterwards attained equilibrium after a sharp decline at both 20 mg kg(-1) and 2 mg kg(-1) of diniconazole. The determination results from the feces of Tenebrio molitor demonstrated that the extraction recovery (ER) values of the high dose group were higher than that of the low dose group and the values were all above 1; therefore, it could be inferred that enantiomerization existed in Tenebrio molitor. Additionally, the biota accumulation factor was used to evaluate the bioaccumulation of diniconazole enantiomers, showing that the bioaccumulation of diniconazole in Tenebrio molitor was enantioselective with preferential accumulation of S-enantiomer. © 2013 Wiley Periodicals, Inc.

  4. A digestive prolyl carboxypeptidase in Tenebrio molitor larvae.

    Science.gov (United States)

    Goptar, Irina A; Shagin, Dmitry A; Shagina, Irina A; Mudrik, Elena S; Smirnova, Yulia A; Zhuzhikov, Dmitry P; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N

    2013-06-01

    Prolyl carboxypeptidase (PRCP) is a lysosomal proline specific serine peptidase that also plays a vital role in the regulation of physiological processes in mammals. In this report, we isolate and characterize the first PRCP in an insect. PRCP was purified from the anterior midgut of larvae of a stored product pest, Tenebrio molitor, using a three-step chromatography strategy, and it was determined that the purified enzyme was a dimer. The cDNA of PRCP was cloned and sequenced, and the predicted protein was identical to the proteomic sequences of the purified enzyme. The substrate specificity and kinetic parameters of the enzyme were determined. The T. molitor PRCP participates in the hydrolysis of the insect's major dietary proteins, gliadins, and is the first PRCP to be ascribed a digestive function. Our collective data suggest that the evolutionary enrichment of the digestive peptidase complex in insects with an area of acidic to neutral pH in the midgut is a result of the incorporation of lysosomal peptidases, including PRCP. Published by Elsevier Ltd.

  5. Enantiomerization and stereoselectivity in bioaccumulation of furalaxyl in Tenebrio molitor larvae.

    Science.gov (United States)

    Yin, Jing; Gao, Yongxin; Zhu, Feilong; Hao, Weiyu; Xu, Qi; Wang, Huili; Guo, Baoyuan

    2017-11-01

    Furalaxyl is a chiral pesticide and widely used in modern agriculture as racemate mixture. The enantiomerization and enantioselecive bioaccumulation by a single dose of furalaxyl to Tenebrio molitor larvae under laboratory conditions were studied using a high-performance liquid chromatography tandem mass spectroscopy method based on a ChiralPAK IC column. Our results showed that a significant enantiomerization (interconversion between R-enantiomer and S-enantiomer) was observed in Tenebrio molitor larvae under R- or S-furalaxyl exposure. Though the two furalaxyl enantiomers exhibited low-capacity of bioaccumulation in Tenebrio molitor larvae, bioaccumulation of rac-furalaxyl was enantioselective with a preferential accumulation of S-furalaxyl at 10mg/kg dosage exposure. In addition, enantiomerization and enantioselective degradation of the two enantiomers was not observed in wheat bran. These results showed that enantioselectivtiy of furalaxyl enantiomers was an important process combined with degradation, metabolism and enatiomerization in organisms. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Dipeptidyl peptidase 4 – an important digestive peptidase in Tenebrio molitor larvae

    Science.gov (United States)

    Dipeptidyl peptidase 4 (DPP 4) is a proline specific serine peptidase that plays an important role in different regulatory processes in mammals. In this report, we isolated and characterized a unique secreted digestive DPP 4 from the anterior midgut of a stored product pest, Tenebrio molitor larvae ...

  7. [Effects of fermented cattle dung on the growth and development of Tenebrio molitor larvae].

    Science.gov (United States)

    Zeng, Xiang-Wei; Wang, Xia; Guo, Li-Yue; Zhan, Li-Jie; Bo, Wen-Jing; Li, Zhan; Wu, Guang-Lei; Jiang, Gao-Ming

    2012-07-01

    In order to make use of and industrialize the animal dung from large cattle farms, this paper explored the feasibility of using Tenebrio molitor to digest and utilize cattle dung. Cattle dung was mixed with the conventional feed (65% wheat bran, 30% corn flour, and 5% bean pulp) of T. molitor in definite proportions, and fermented with effective microorganisms (EM). The fermented products containing 60% and 80% of cattle dung (FD1 and FD2, respectively) were selected to feed T. molitor larvae, and the effects of the fermented products on the growth curve, death rate, pupation rate, and antioxidant system of the larvae were compared. Compared with CK (conventional deed), the FD1 made the developmental duration of the larvae prolonged by 10 days and the larvae's death rate upraised somewhat, but made the single larva's total food intake, average body mass, crude fat content, and ratio of unsaturated to saturated fat acids increased by 49%, 28%, 26%, and 32%, respectively (P molitor larvae had weak adaptability to FD2. Our findings suggested that using FD1 to feed the 3rd instar of T. molitor larvae would have good practical prospects in industrializing cattle dung.

  8. Stereoselectivity in bioaccumulation and excretion of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae.

    Science.gov (United States)

    Lv, Xiaotian; Liu, Chen; Li, Yaobin; Gao, Yongxin; Wang, Huili; Li, Jianzhong; Guo, Baoyuan

    2014-09-01

    Stereoselectivity in bioaccumulation and excretion of stereoisomers of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae through dietary exposure was investigated. Liquid chromatography tandem mass spectrometry (HPLC-MS/MS) method that use a ChiralcelOD-3R[cellulosetris-Tris-(3, 5-dichlorophenyl-carbamate)] chromatography column was applied to carry out chiral separation of the stereoisomers. Wheat bran was spiked with racemic epoxiconazole at two dose levels of 20mg/kg and 2mg/kg (dry weight) to feed T. molitor larvae. The results showed that both the doses of epoxiconazole were taken up by Tenebrio molitor larvae rapidly at the initial stages. There was a significant trend of stereoselective bioaccumulation in the larvae with a preferential accumulation of (-)-epoxiconazole in the 20mg/kg dose. The stereoselectivity in bioaccumulation in the 2mg/kg dosage was not obvious compared to the 20mg/kg group. Results of excretion indicated an active excretion is an important pathway for the larvae to eliminate epoxiconazole which was a passive transport process with non stereoselectivity. The faster elimination might be the reason for the low accumulation of epoxiconazole, as measured by bioaccumulation factor (BAF). Copyright © 2014 Elsevier Inc. All rights reserved.

  9. Bioaccumulation and excretion of enantiomers of myclobutanil in Tenebrio molitor larvae through dietary exposure.

    Science.gov (United States)

    Lv, Xiaotian; Liu, Chen; Li, Yaobin; Gao, Yongxin; Guo, Baoyuan; Wang, Huili; Li, Jianzhong

    2013-12-01

    The bioaccumulation and excretion of enantiomers of myclobutanil in Tenebrio molitor larvae through dietary exposure under laboratory conditions were investigated using high-performance liquid chromatography tandem mass spectrometry (HPLC-MS/MS) based on a ChiralcelOD-3R [cellulosetris-tris-(3, 5-dichlorophenyl-carbamate)] column. The wheat bran fed to Tenebrio molitor larvae was spiked with racemic myclobutanil at two dose levels of 20 mg/kg and 2 mg/kg (dry weight). The results showed that there was a significant trend of enantioselective bioaccumulation in the larvae with a preferential accumulation of (-)-myclobutanil in 20 mg/kg dose exposure, but it was not obviously observed in the 2 mg/kg dose group. A kinetic model considering enantiomerization between the two enantiomers based on first-order reactions was built and the rate constants were estimated to discuss the kinetic reason for the different concentrations of individual enantiomers in the larvae. The approximations implied an inversion between the two enantiomers with a relatively higher rate of the inversion from (-)-myclobutanil to (+)-myclobutanil. Meanwhile, analysis of data of excretion samples suggested the active excretion is probably an important pathway for the insect to eliminate myclobutanil rapidly with nonenantioselectivity as a passive transport process, which was consistent with the low accumulation efficiency of myclobutanil measured by BAF (bioaccumulation factor). © 2013 Wiley Periodicals, Inc.

  10. Characteristic properties of proteins from pre-ecdysial cuticle of larvae and pupae of the mealworm Tenebrio molitor

    DEFF Research Database (Denmark)

    Andersen, Svend Olav

    2002-01-01

    Proteins extracted from the cuticle of pharate larvae and pupae of the mealworm Tenebrio molitor are more soluble at low temperatures than at higher temperatures, a behaviour characteristic of hydrophobic proteins. When the temperature of an unfractionated cuticular extract is raised from 4 to 25...

  11. Enantiomerization and enantioselective bioaccumulation of benalaxyl in Tenebrio molitor larvae from wheat bran.

    Science.gov (United States)

    Gao, Yongxin; Chen, Jinhui; Wang, Huili; Liu, Chen; Lv, Xiaotian; Li, Jianzhong; Guo, Baoyuan

    2013-09-25

    The enantiomerization and enatioselecive bioaccumulation of benalaxyl by dietary exposure to Tenebrio molitor larvae under laboratory conditions were studied by HPLC-MS/MS. Exposure of enantiopure R-benalaxyl and S-benalaxyl in T. molitor larvae revealed significant enantiomerization with formation of the R enantiomers from the S enantiomers, and vice versa. Enantiomerization was not observed in wheat bran during the period of 21 days. For the bioaccumulation experiment, the enantiomer fraction in T. molitor larvae was maintained approximately at 0.6, whereas the enantiomer fraction in wheat bran was maintained at 0.5; in other words, the bioaccumulation of benalaxyl was enantioselective in T. molitor larvae. Mathematical models for a process of uptake, degradation, and enantiomerization were developed, and the rates of uptake, degradation, and enantiomerization of R-benealaxyl and S-benealaxyl were estimated, respectively. The results were that the rate of uptake of R-benalaxyl (kRa = 0.052 h(-1)) was slightly lower than that of S-benalaxyl (kSa = 0.061 h(-1)) from wheat bran; the rate of degradation of R-benalaxyl (kRd = 0.285 h(-1)) was higher than that of S-benalaxyl (kSd = 0.114 h(-1)); and the rate of enantiomerization of R-benalaxyl (kRS = 0.126 h(-1)) was higher than that of S-benalaxyl (kSR = 0.116 h(-1)). It was suggested that enantioselectivtiy was caused not only by actual degradation and metabolism but also by enantiomerization, which was an important process in the environmental fate and behavior of chiral pesticides.

  12. Physical and catalytic properties of alpha-amylase from Tenebrio molitor L. larvae.

    Science.gov (United States)

    Buonocore, V; Poerio, E; Silano, V; Tomasi, M

    1976-01-01

    The amylase from Tenebrio molitor L. larvae (yellow mealworm) was characterized according to a number of its molecular and catalytic properties. The insect amylase is a single polypeptide chain with mol.wt. 68000, an isoelectric point of 4.0 and a very low content of sulphur-containing amino acids. The enzyme is a Ca2+-protein and behaves as an alpha-amylase. Removal of Ca2+ by exhaustive dialysis against water causes the irreversible inactivation of the enzyme. Moreover, the enzyme is activated by the presence in the assay mixture of Cl-, or some other inorganic anions that are less effective than Cl-, and is inhibited by F-. Optimal conditions of pH and temperature for the enzymic activity are 5.8 and 37 degrees C. The insect amylase exhibits an identical kinetic behaviour toward starch, amylose and amylopectin; the enzyme hydrolyses glycogen with a higher affinity constant. Compared with the non-insect alpha-amylases described in the literature, Tenebrio molitor amylase has a lower affinity for starch. PMID:942374

  13. Involvement of phenoloxidase in browning during grinding of Tenebrio molitor larvae.

    Science.gov (United States)

    Janssen, Renske H; Lakemond, Catriona M M; Fogliano, Vincenzo; Renzone, Giovanni; Scaloni, Andrea; Vincken, Jean-Paul

    2017-01-01

    Insects are investigated as alternative protein source to meet the increasing demand for proteins in the future. Enzymatic browning occurring during grinding of insect and subsequent extraction of proteins can influence the proteins' properties, but it is unclear which enzymes are responsible for this phenomenon. This study was performed on larvae of three commonly used insect species, namely Tenebrio molitor, Alphitobius diaperinus and Hermetia illucens. Oxygen consumption measurements on protein extracts showed activity on L-tyrosine, L-3,4-di-hydroxy-phenylalanine (L-DOPA) and L-dopamine, indicating phenoloxidase as a key player in browning. Furthermore, no reaction on 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) was observed, ruling out an important contribution of laccase to browning. The browning reaction was most prominent at pH 6 for T. molitor and A. diaperinus, and 7 for H. illucens. As the enzyme activity of H. illucens was the lowest with the darkest color formation, this was likely caused by another factor. The activity of phenoloxidase was confirmed for T. molitor and A. diaperinus by activity measurements after fractionation by anion-exchange chromatography. Color measurements showed the presence of activity on both L-DOPA and L-tyrosine in the same fractions. Both substrates were converted into dopachrome after incubation with enzyme-enriched fractions. No DOPA-decarboxylase, tyrosine hydroxylase and peroxidase activities were observed. By using native PAGE with L-DOPA as staining-solution, active T. molitor protein bands were resolved and characterized, identifying a tyrosinase/phenoloxidase as the active enzyme species. All together, these data confirmed that tyrosinase is an important enzyme in causing enzymatic browning in T. molitor and likely in A. diaperinus.

  14. Involvement of phenoloxidase in browning during grinding of Tenebrio molitor larvae.

    Directory of Open Access Journals (Sweden)

    Renske H Janssen

    Full Text Available Insects are investigated as alternative protein source to meet the increasing demand for proteins in the future. Enzymatic browning occurring during grinding of insect and subsequent extraction of proteins can influence the proteins' properties, but it is unclear which enzymes are responsible for this phenomenon. This study was performed on larvae of three commonly used insect species, namely Tenebrio molitor, Alphitobius diaperinus and Hermetia illucens. Oxygen consumption measurements on protein extracts showed activity on L-tyrosine, L-3,4-di-hydroxy-phenylalanine (L-DOPA and L-dopamine, indicating phenoloxidase as a key player in browning. Furthermore, no reaction on 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid was observed, ruling out an important contribution of laccase to browning. The browning reaction was most prominent at pH 6 for T. molitor and A. diaperinus, and 7 for H. illucens. As the enzyme activity of H. illucens was the lowest with the darkest color formation, this was likely caused by another factor. The activity of phenoloxidase was confirmed for T. molitor and A. diaperinus by activity measurements after fractionation by anion-exchange chromatography. Color measurements showed the presence of activity on both L-DOPA and L-tyrosine in the same fractions. Both substrates were converted into dopachrome after incubation with enzyme-enriched fractions. No DOPA-decarboxylase, tyrosine hydroxylase and peroxidase activities were observed. By using native PAGE with L-DOPA as staining-solution, active T. molitor protein bands were resolved and characterized, identifying a tyrosinase/phenoloxidase as the active enzyme species. All together, these data confirmed that tyrosinase is an important enzyme in causing enzymatic browning in T. molitor and likely in A. diaperinus.

  15. Effects of various diets on the calcium and phosphorus composition of mealworms (Tenebrio molitor larvae) and superworms (Zophobas morio larvae).

    Science.gov (United States)

    Latney, La'Toya V; Toddes, Barbara D; Wyre, Nicole R; Brown, Dorothy C; Michel, Kathryn E; Briscoe, Johanna A

    2017-02-01

    OBJECTIVE To evaluate whether the nutritive quality of Tenebrio molitor larvae and Zophobas morio larvae, which are commonly cultured as live food sources, is influenced by 4 commercially available diets used as nutritional substrates; identify which diet best improved calcium content of larvae; and identify the feeding time interval that assured the highest calcium intake by larvae. ANIMALS 2,000 Zophobas morio larvae (ie, superworms) and 7,500 Tenebrio molitor larvae (ie, mealworms). PROCEDURES Larvae were placed in control and diet treatment groups for 2-, 7-, and 10-day intervals. Treatment diets were as follows: wheat millings, avian hand feeding formula, organic avian mash diet, and a high-calcium cricket feed. Control groups received water only. After treatment, larvae were flash-frozen live with liquid nitrogen in preparation for complete proximate and mineral analyses. Analyses for the 2-day treatment group were performed in triplicate. RESULTS The nutrient composition of the high-calcium cricket feed groups had significant changes in calcium content, phosphorus content, and metabolizable energy at the 2-day interval, compared with other treatment groups, for both mealworms and superworms. Calcium content and calcium-to-phosphorus ratios for larvae in the high-calcium cricket feed group were the highest among the diet treatments for all treatment intervals and for both larval species. CONCLUSIONS AND CLINICAL RELEVANCE A 2-day interval with the high-calcium cricket feed achieved a larval nutrient composition sufficient to meet National Research Council dietary calcium recommendations for nonlactating rats. Mealworm calcium composition reached 2,420 g/1,000 kcal at 48 hours, and superworm calcium composition reached 2,070g/1,000 kcal at 48 hours. These findings may enable pet owners, veterinarians, insect breeders, and zoo curators to optimize nutritive content of larvae fed to insectivorous animals.

  16. Dipeptidyl peptidase 4 - An important digestive peptidase in Tenebrio molitor larvae.

    Science.gov (United States)

    Tereshchenkova, Valeriia F; Goptar, Irina A; Kulemzina, Irina A; Zhuzhikov, Dmitry P; Serebryakova, Marina V; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N

    2016-09-01

    Dipeptidyl peptidase 4 (DPP 4) is a proline specific serine peptidase that plays an important role in different regulatory processes in mammals. In this report, we isolated and characterized a unique secreted digestive DPP 4 from the anterior midgut of a stored product pest, Tenebrio molitor larvae (TmDPP 4), with a biological function different than that of the well-studied mammalian DPP 4. The sequence of the purified enzyme was confirmed by mass-spectrometry, and was identical to the translated RNA sequence found in a gut EST database. The purified peptidase was characterized according to its localization in the midgut, and substrate specificity and inhibitor sensitivity were compared with those of human recombinant DPP 4 (rhDPP 4). The T. molitor enzyme was localized mainly in the anterior midgut of the larvae, and 81% of the activity was found in the fraction of soluble gut contents, while human DPP 4 is a membrane enzyme. TmDPP 4 was stable in the pH range 5.0-9.0, with an optimum activity at pH 7.9, similar to human DPP 4. Only specific inhibitors of serine peptidases, diisopropyl fluorophosphate and phenylmethylsulfonyl fluoride, suppressed TmDPP 4 activity, and the specific dipeptidyl peptidase inhibitor vildagliptin was most potent. The highest rate of TmDPP 4 hydrolysis was found for the synthetic substrate Arg-Pro-pNA, while Ala-Pro-pNA was a better substrate for rhDPP 4. Related to its function in the insect midgut, TmDPP 4 efficiently hydrolyzed the wheat storage proteins gliadins, which are major dietary proteins of T. molitor. Published by Elsevier Ltd.

  17. Prolidase is a critical enzyme for complete gliadin digestion in Tenebrio molitor larvae

    Science.gov (United States)

    Prolidase is a proline specific metallopeptidase that cleaves imidodipeptides with C-terminal Pro residue. Prolidase was purified and characterized from the Tenebrio molitor larval midgut. The enzyme was localized in the soluble fraction of posterior midgut tissues, corresponding to a predicted cyto...

  18. Evaluation of Genotoxicity and 28-day Oral Dose Toxicity on Freeze-dried Powder of Tenebrio molitor Larvae (Yellow Mealworm)

    Science.gov (United States)

    Han, So-Ri; Yun, Eun-Young; Kim, Ji-Young; Hwang, Jae Sam; Jeong, Eun Ju

    2014-01-01

    The larval form of Tenebrio molitor (T. molitor) has been eaten in many countries and provides benefits as a new food source of protein for humans. However, no information exists regarding its safety for humans. The objective of the present study was to evaluate the genotoxicity and repeated dose oral toxicity of the freeze-dried powder of T. molitor larvae. The genotoxic potential was evaluated by a standard battery testing: bacterial reverse mutation test, in vitro chromosome aberration test, and in vivo micronucleus test. To assess the repeated dose toxicity, the powder was administered once daily by oral gavage to Sprague-Dawley (SD) rats at dose levels of 0, 300, 1000 and 3000 mg/kg/day for 28 days. The parameters which were applied to the study were mortality, clinical signs, body and organ weights, food consumption, ophthalmology, urinalysis, hematology, serum chemistry, gross findings and histopathologic examination. The freezedried powder of T. molitor larvae was not mutagenic or clastogenic based on results of in vitro and in vivo genotoxicity assays. Furthermore, no treatment-related changes or findings were observed in any parameters in rats after 28 days oral administration. In conclusion, the freeze-dried powder of T. molitor larvae was considered to be non-genotoxic and the NOAEL (No Observed Adverse Effect Level) was determined to be 3000 mg/kg/day in both sexes of SD rats under our experimental conditions. PMID:25071922

  19. Evaluation of Genotoxicity and 28-day Oral Dose Toxicity on Freeze-dried Powder of Tenebrio molitor Larvae (Yellow Mealworm).

    Science.gov (United States)

    Han, So-Ri; Yun, Eun-Young; Kim, Ji-Young; Hwang, Jae Sam; Jeong, Eun Ju; Moon, Kyoung-Sik

    2014-06-01

    The larval form of Tenebrio molitor (T. molitor) has been eaten in many countries and provides benefits as a new food source of protein for humans. However, no information exists regarding its safety for humans. The objective of the present study was to evaluate the genotoxicity and repeated dose oral toxicity of the freeze-dried powder of T. molitor larvae. The genotoxic potential was evaluated by a standard battery testing: bacterial reverse mutation test, in vitro chromosome aberration test, and in vivo micronucleus test. To assess the repeated dose toxicity, the powder was administered once daily by oral gavage to Sprague-Dawley (SD) rats at dose levels of 0, 300, 1000 and 3000 mg/kg/day for 28 days. The parameters which were applied to the study were mortality, clinical signs, body and organ weights, food consumption, ophthalmology, urinalysis, hematology, serum chemistry, gross findings and histopathologic examination. The freezedried powder of T. molitor larvae was not mutagenic or clastogenic based on results of in vitro and in vivo genotoxicity assays. Furthermore, no treatment-related changes or findings were observed in any parameters in rats after 28 days oral administration. In conclusion, the freeze-dried powder of T. molitor larvae was considered to be non-genotoxic and the NOAEL (No Observed Adverse Effect Level) was determined to be 3000 mg/kg/day in both sexes of SD rats under our experimental conditions.

  20. The influence of synthetic food additives and surfactants on the body weight of larvae of Tenebrio molitor (Coleoptera, Tenebrionidae

    Directory of Open Access Journals (Sweden)

    V. O. Martynov

    2017-08-01

    Full Text Available The broad spectrum of negative effects of food additives and surfactants on living organisms and the environment in general indicate a necessity of a detailed study on this issue. The aim of this article is to evaluate the impact of food additives and surfactants in a concentration of 350 mg/kg of fodder on the body weight of third age Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae larvae. A significant change in the body weight of T. molitor larvae was observed when they consumed a diet containing 350 mg/kg of sodium glutamate, sodium cyclamate and sodium benzoate. We observed a tendency towards increase in body weight after addition of the food colouring Allura Red, saccharin, benzoic acid, betaine, emulsifying wax, AOS and SLES, and also we observed a decrease in body weight after addition of Tartrazine and Indigo Carmine in the same concentration. Out of the 18 tested food additives, 3 significantly stimulated an increase in the body weight of third age T. molitor larvae, and 3 manifested the same effect at the level of tendency (stimulated an increase in mass on average by 43–58% over the 14-day experiment, and 2 caused decrease in the body weight of larvae. Also, the 4 studied surfactants manifested a tendency towards increase in the body weight of T. molitor. This study on the impact of food additives and surfactants on organisms of insects is of great significance for protecting rare species of insects.

  1. Development of Supputius cincticeps (Heteroptera, Pentatomidae) fed with Zophobas confusa, Tenebrio molitor (Coleoptera, Tenebrionidae) and Musca domestica (Diptera, Muscidae) larvae

    OpenAIRE

    Beserra, Eduardo B.; Zanuncio, Teresinha V.; Zanuncio, José C.; Santos, Germi P.

    1995-01-01

    Egg viability and nymphal development of the predatory bug Supputius cincticeps (Stål, 1860) were evaluated during two generations in the Biological Control Laboratory of the Núcleo de Biotecnologia Aplicada à Agropecuária (Bioagro/UFV) in Viçosa (Minas Gerais, Brazil) at 24.72±1.10ºC and photophase of 12 hours. Three treatments were represented by S. cincticeps fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 and Musca domestica Linnaeus, 1758 larvae. Higher egg viabil...

  2. Rapid biodegradation of plastics by mealworms (larvae of Tenebrio molitor) brings hope to solve wasteplastic pollution

    Science.gov (United States)

    Wu, W.; Yang, S.; Brandon, A. M.; Yang, Y.; Flanagan, J. A.; Fan, H. Q.; Cai, S. Y.; Wang, Z. Y.; Din, L. Y.; Daliang, N.; Yang, J.; Ren, J.; Tao, H. C.; Phillips, D.; Ren, N. Q.; Zhou, J.; Waymouth, R.; Criddle, C. S.

    2016-12-01

    Pollution of waste plastics in soil, river, ocean, landfill and potentially groundwater has been a major environment concern for decades. They include polystyrene (PS), polyethylene (PE) and others. Plastic particles could penetrate into groundwater and become potential threats to our groundwater Our recent research demonstrated that mealworm (larvae of Tenebrio molitor ), which are commercially used as animal and bird food and insect protein, can biodegrade PS and convert it to CO2 up within 48% within 12-14 hrs in mealworm gut. PS degradation was performed initially via depolymerization and then degradation within the mealworm guts. Gut microbiota plays a major role in PS biodegradation because the degradation is nearly completely inhibited when mealworms were fed with antibiotics. Physical and chemical analysis as well 13C labeled tests confirmed the biodegradation and mineralization of PS. The generality of plastic eating behavior of mealworms and biodegradation has been observed by testing mealworms from 11 different sources in China and the USA. All of the mealworms tested consume PS although at different relative rates. At ambient temperature (20-24 oC), the average daily consumption rate of PS ranged from 0.01 to 0.3 mg per 100 mealworms when fed PS alone. The mealworms also consumed low density polyethylene (LDPE) foam as sole diet. When mealworms were fed PS alone, the consumption rate and total amount consumed increased slightly as a function of temperature from 20 to 30 oC. Supplementing the diet with normal food (bran) enhanced the PS consumption rate and the total PS mass consumed. Microbial community analysis indicated that the microbial structure changed significantly after the diet was switched from normal food bran to PS or PS plus bran. PS-degrading bacterial strains have isolated and characterized. Our discoveries brings hopes to prevent or solve potential microplastics threats to groundwater.

  3. Intraventricular administration of Tenebrio molitor larvae extract regulates food intake and body weight in mice with high-fat diet-induced obesity.

    Science.gov (United States)

    Seo, Minchul; Kim, Jongwan; Moon, Seong-Su; Hwang, Jae-Sam; Kim, Mi-Ae

    2017-08-01

    We recently reported the in vitro and in vivo antiobesity effects of Tenebrio molitor larvae, a traditional food in many countries, but it remains unknown how the larvae affect appetite regulation in mice with diet-induced obesity. We hypothesized that the extract of T molitor larvae mediates appetite by regulating neuropeptide expression. We investigated T molitor larvae extract's (TME's) effects on anorexigenesis and endoplasmic reticulum (ER) stress-induced orexigenic neuropeptide expression in the hypothalami of obese mice. Intracerebroventricular TME administration suppressed feeding by down-regulating the expression of the orexigenic neuropeptides neuropeptide Y and agouti-related protein. T molitor larvae extract significantly reduced the expression of ER stress response genes. These results suggest that TME and its bioactive components are potential therapeutics for obesity and ER stress-driven disease states. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Self-selection of two diet components by Tenebrio molitor (Coleoptera: Tenebrionidae) larvae and its impact on fitness.

    Science.gov (United States)

    Morales-Ramos, J A; Rojas, M G; Shapiro-Ilan, D I; Tedders, W L

    2011-10-01

    We studied the ability of Tenebrio molitor L. (Coleoptera: Tenebrionidae) to self-select optimal ratios of two dietary components to approach nutritional balance and maximum fitness. Relative consumption of wheat bran and dry potato flakes was determined among larvae feeding on four different ratios of these components (10, 20, 30, and 40% potato). Groups of early instars were provided with a measured amount of food and the consumption of each diet component was measured at the end of 4 wk and again 3 wk later. Consumption of diet components by T. molitor larvae deviated significantly from expected ratios indicating nonrandom self-selection. Mean percentages of dry potato consumed were 11.98, 19.16, 19.02, and 19.27% and 11.89, 20.48, 24.67, and 25.97% during the first and second experimental periods for diets with 10, 20, 30, and 40% potato, respectively. Life table analysis was used to determine the fitness of T. molitor developing in the four diet mixtures in a no-choice experiment. The diets were compared among each other and a control diet of wheat bran only. Doubling time was significantly shorter in groups consuming 10 and 20% potato than the control and longer in groups feeding on 30 and 40% potato. The self-selected ratios of the two diet components approached 20% potato, which was the best ratio for development and second best for population growth. Our findings show dietary self-selection behavior in T. molitor larvae, and these findings may lead to new methods for optimizing dietary supplements for T. molitor.

  5. Tenebrio molitor L. (Coleoptera: Tenebrionidae) larva ve pupasının yağ asidi bileşimi

    OpenAIRE

    TAŞKIN, Deniz; AKSOYLAR, M. Yaşar

    2010-01-01

    Fatty acid compositions of last instar larvae and pupae of Tenebrio molitor were analysed by gas chromatographic methods. It was determined that total fatty acid compositions of both stages were contituted C12:0-C18:2 fatty acids. Oleic acid was found as the major fatty acid. Palmitic and linoleic acids also were high pencentage fatty acids.

  6. Prolidase is a critical enzyme for complete gliadin digestion in Tenebrio molitor larvae.

    Science.gov (United States)

    Tereshchenkova, Valeriia F; Goptar, Irina A; Zhuzhikov, Dmitry P; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N

    2017-08-01

    Prolidase is a proline-specific metallopeptidase that cleaves imidodipeptides with C-terminal Pro residue. Prolidase was purified and characterized from the Tenebrio molitor larval midgut. The enzyme was localized in the soluble fraction of posterior midgut tissues, corresponding to a predicted cytoplasmic localization of prolidase according to the structure of the mRNA transcript. Expression of genes encoding prolidase and the major digestive proline-specific peptidase (PSP)-dipeptidyl peptidase 4-were similar. The pH optimum of T. molitor prolidase was 7.5, and the enzyme was inhibited by Z-Pro, indicating that it belongs to type I prolidases. In mammals, prolidase is particularly important in the catabolism of a proline-rich protein-collagen. We propose that T. molitor larval prolidase is a critical enzyme for the final stages of digestion of dietary proline-rich gliadins, providing hydrolysis of imidodipeptides in the cytoplasm of midgut epithelial cells. We propose that the products of hydrolysis are absorbed from the luminal contents by peptide transporters, which we have annotated in the T. molitor larval gut transcriptome. The origin of prolidase substrates in the insect midgut is discussed in the context of overall success of grain feeding insects. © 2017 Wiley Periodicals, Inc.

  7. Yellow mealworm larvae (Tenebrio molitor, L.) as a possible alternative to soybean meal in broiler diets.

    Science.gov (United States)

    Bovera, F; Piccolo, G; Gasco, L; Marono, S; Loponte, R; Vassalotti, G; Mastellone, V; Lombardi, P; Attia, Y A; Nizza, A

    2015-01-01

    The aim of the study was to evaluate the feasibility of replacing soybean meal (SBM) with Tenebrio molitor larvae (TML) meal in broiler diets. A total of 80 30-d-old male Shaver brown broilers were divided into two groups fed on two isoproteic and isoenergetic diets differing for protein source (SBM vs. TML). Up to 62 d of age, body weight and feed intake were recorded weekly and body weight gain, feed conversion ratio (FCR), protein efficiency ratio (PER) and European efficiency factor (EEF) were calculated. At 62 d, blood samples were collected from 16 birds/group for evaluation of blood profiles. Feed intake was not different between groups considering the entire period of the trial. The FCR was more favourable in the TML than SBM group from 46 d of age and in the entire period of the trial (4.13 vs. 3.62). The PER was higher in the SBM than in the TML group (1.92 vs. 1.37) while the EEF was higher in broilers fed on the TML diet (132.6 vs. 156.2). Albumin-to-globulin ratio was higher in broilers fed on SBM than in the other group (0.44 vs. 0.30). aspartate aminotransferase and alanine aminotransferase were higher in TML than SBM (195.1 vs. 178.6 U/l and 82.07 vs. 46.71 U/l, respectively). Uric acid was higher in broilers fed on SBM than TML (5.40 vs. 4.16 mg/dl). TML did not affect feed intake and growth rate of broilers from 30 to 62 d of age when compared to an isoproteic and isoenergetic SBM diet, but FCR of the TML group was more favourable than that of the SBM group. The lowest albumin-to-globulin ratio in broilers fed on TML suggests a higher immune response, probably due to the prebiotic effects of chitin.

  8. Nutritional Value of Pupae Versus Larvae of Tenebrio molitor (Coleoptera: Tenebrionidae) as Food for Rearing Podisus maculiventris (Heteroptera: Pentatomidae).

    Science.gov (United States)

    Morales-Ramos, Juan A; Rojas, M Guadalupe; Shelby, Kent S; Coudron, Thomas A

    2016-04-01

    Life-table analysis yielded demographic parameter values that indicate that Tenebrio molitor (L.) pupae are potentially more suitable factitious prey to mass-produce the predator Podisus maculiventris (Say) and are more suitable prey than the larvae. P. maculiventris developed faster (23.2 vs. 25.5 d), weighed more (females 80.9 vs. 66.6 mg and males 64.7 vs. 53.7 mg), and had a higher survival rate (0.88 vs. 0.7), fecundity, and reproductive output (87.1 vs. 22.8 eggs/female) when reared on pupae compared with larvae of T. molitor. The total protein content and soluble protein content were significantly higher in pupae (60.2 and 23%, respectively) than larvae (53.1 and 14.4%, respectively). Lipid content was significantly lower in pupae (32.1%) than larvae (35.9%), and larvae had more polyunsaturated fatty acids (83.6 vs. 56.6 mg/g) and less oleic (0.1 mg/g) and steric (6.1 mg/g) acids than pupae (37.3 and 12.3 mg/g, respectively). The total sugar content was not significantly different between pupae and larvae. However, larvae had significantly more fructose than pupae, but pupae had more galactose, glucosamine, glucose, mannose, and trehalose than larvae. Differences in nutritional composition and its impact on predator demographic parameters are potential factors that make the pupal stage a better food source.

  9. Effectiveness of the Entomopathogenic Nematodes Heterorhabditis bacteriophora and Steinernema feltiae against Tenebrio molitor (Yellow Mealworm) Larvae in Different Soil Types at Different Temperatures

    OpenAIRE

    SUSURLUK, Alper

    2006-01-01

    The efficiency of the entomopathogenic nematodes Steinernema feltiae Tur-S3 and Heterorhabditis bacteriophora Tur-H2, isolated in Turkey, against larvae of Tenebrio molitor L. was investigated in different soil type and temperature conditions. Sterilized and non-sterilized silver sand, clay-loam soil, and compost soil were tested, each at 12, 18, and 24 ºC. Temperature had the greatest effect on the mortality of T. molitor larvae caused by both nematode species. The efficiency of the 2 nemato...

  10. Tenebrio molitor Larvae Inhibit Adipogenesis through AMPK and MAPKs Signaling in 3T3-L1 Adipocytes and Obesity in High-Fat Diet-Induced Obese Mice.

    Science.gov (United States)

    Seo, Minchul; Goo, Tae-Won; Chung, Mi Yeon; Baek, Minhee; Hwang, Jae-Sam; Kim, Mi-Ae; Yun, Eun-Young

    2017-02-28

    Despite the increasing interest in insect-based bioactive products, the biological activities of these products are rarely studied adequately. Larvae of Tenebrio molitor , the yellow mealworm, have been eaten as a traditional food and provide many health benefits. Therefore, we hypothesized that T. molitor larvae might influence adipogenesis and obesity-related disorders. In the present study, we investigated the anti-adipogenic and antiobesity effects of T. molitor larvae in vitro and in vivo. The lipid accumulation and triglyceride content in mature adipocytes was reduced significantly (up to 90%) upon exposure to an ethanol extract of T. molitor larvae, without a reduction in cell viability. Exposure also resulted in key adipogenic and lipogenic transcription factors. Additionally, in adipogenic differentiation medium the extract induced phosphorylation of adenosine monophosphate (AMP)-activated protein kinase and mitogen-activated protein kinases. Daily oral administration of T. molitor larvae powder to obese mice fed high-fat diet attenuated body weight gain. We also found that the powder efficiently reduced hepatic steatosis as well as aspartate and alanine transaminase enzyme levels in mice fed a high-fat diet. Our results suggest that T. molitor larvae extract has an antiobesity effect when administered as a food supplement and has potential as a therapeutic agent for obesity.

  11. Tenebrio molitor Larvae Inhibit Adipogenesis through AMPK and MAPKs Signaling in 3T3-L1 Adipocytes and Obesity in High-Fat Diet-Induced Obese Mice

    Directory of Open Access Journals (Sweden)

    Minchul Seo

    2017-02-01

    Full Text Available Despite the increasing interest in insect-based bioactive products, the biological activities of these products are rarely studied adequately. Larvae of Tenebrio molitor, the yellow mealworm, have been eaten as a traditional food and provide many health benefits. Therefore, we hypothesized that T. molitor larvae might influence adipogenesis and obesity-related disorders. In the present study, we investigated the anti-adipogenic and antiobesity effects of T. molitor larvae in vitro and in vivo. The lipid accumulation and triglyceride content in mature adipocytes was reduced significantly (up to 90% upon exposure to an ethanol extract of T. molitor larvae, without a reduction in cell viability. Exposure also resulted in key adipogenic and lipogenic transcription factors. Additionally, in adipogenic differentiation medium the extract induced phosphorylation of adenosine monophosphate (AMP-activated protein kinase and mitogen-activated protein kinases. Daily oral administration of T. molitor larvae powder to obese mice fed high-fat diet attenuated body weight gain. We also found that the powder efficiently reduced hepatic steatosis as well as aspartate and alanine transaminase enzyme levels in mice fed a high-fat diet. Our results suggest that T. molitor larvae extract has an antiobesity effect when administered as a food supplement and has potential as a therapeutic agent for obesity.

  12. Oleic acid and linoleic acid from Tenebrio molitor larvae inhibit BACE1 activity in vitro: molecular docking studies.

    Science.gov (United States)

    Youn, Kumju; Yun, Eun-Young; Lee, Jinhyuk; Kim, Ji-Young; Hwang, Jae-Sam; Jeong, Woo-Sik; Jun, Mira

    2014-02-01

    In our ongoing research to find therapeutic compounds for Alzheimer's disease (AD) from natural resources, the inhibitory activity of the BACE1 enzyme by Tenebrio molitor larvae and its major compounds were evaluated. The T. molitor larvae extract and its fractions exhibited strong BACE1 suppression. The major components of hexane fraction possessing both high yield and strong BACE1 inhibition were determined by thin layer chromatography, gas chromatography, and nuclear magnetic resonance analysis. A remarkable composition of unsaturated long chain fatty acids, including oleic acid and linoleic acid, were identified. Oleic acid, in particular, noncompetitively attenuated BACE1 activity with a half-maximal inhibitory concentration (IC₅₀) value of 61.31 μM and Ki value of 34.3 μM. Furthermore, the fatty acids were stably interacted with BACE1 at different allosteric sites of the enzyme bound with the OH of CYS319 and the NH₃ of TYR320 for oleic acid and with the C=O group of GLN304 for linoleic acid. Here, we first revealed novel pharmacophore features of oleic acids and linoleic acid to BACE1 by in silico docking studies. The present findings would clearly suggest potential guidelines for designing novel BACE1 selective inhibitors.

  13. Immunomodulatory effects of supercritical fluid CO2 extracts from freeze-dried powder of Tenebrio molitor larvae (yellow mealworm

    Directory of Open Access Journals (Sweden)

    QingFeng TANG

    2016-01-01

    Full Text Available Abstract In order to take full advantage of Tenebrio molitor larvae (yellow mealworm resources, the supercritical CO2 fluid freeze-dried powder of T. molitor larvae (fdTML extraction on the immune systems of mice was carried out. The results about the effects of supercritical CO2 fluid fdTML extraction on carbon expurgation and phagocytosis of peritoneal macrophages experiments of mice indicated that the fdTML extraction enhanced observably carbon expurgatory index, phagocytic rate and phagocytic index. The fdTML extraction could stimulate response of delayed hypersensitivity. The proliferation of ConA-induced mitogenic reponse for spleen lymphocyte was also increased. The amount of hemolytic antibody in mice serum increased compared with those of the control group mice. The half of hemolysis values in serum of treated mice increased compared to the control group. Furthermore, serum NO content in all treatment groups was higher than that of the control group whereas acid phosphatase and alkaline phosphatase activity was only significantly higher relative to the control group. Our findings suggest that supercritical CO2 fluid the fdTML extraction has potential as a health food supplement.

  14. Reproduction and longevity of Supputius cincticeps (Het.: Pentatomidae fed with larvae of Zophobas confusa, Tenebrio molitor (Col.: Tenebrionidae or Musca domestica (Dip.: Muscidae

    Directory of Open Access Journals (Sweden)

    José Cola Zanuncio

    2005-09-01

    Full Text Available Reproduction and longevity of Supputius cincticeps (Stål (Heteroptera: Pentatomidae fed on Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae or Musca domestica (L. (Diptera: Muscidae larvae were studied during two generations at 24.7 ± 1.1ºC, 70 ± 10% R.H. and 12 h of photophase. Body weight of newly-emerged adults, oviposition period, number of egg masses, total number of eggs and longevity of S. cincticeps were higher when fed on Z. confusa or T. molitor larvae than on M. domestica larvae. Regardless of diet, S. cincticeps showed better reproduction and longevity in the second generation in laboratory conditions.Foram avaliadas, em duas gerações, a reprodução e a longevidade de Supputius cincticeps (Stål (Heteroptera: Pentatomidae alimentado com larvas de Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae ou Musca domestica (L. (Diptera: Muscidae a 24,7 ± 1,1ºC, 70 ± 10% de U.R. e fotofase de 12 h. O peso de adultos recém emergidos, o período de oviposição, o número de posturas, de ovos totais e a longevidade de fêmeas de S. cincticeps foram maiores com larvas de Z. confusa ou T. molitor que com M. domestica. Independentemente do tipo de presa, S. cincticeps mostrou melhor performance reprodutiva e longevidade na segunda geração.

  15. Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

    Directory of Open Access Journals (Sweden)

    Brenda Oppert

    Full Text Available Bacillus thuringiensis (Bt crystal (Cry proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence

  16. Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

    Science.gov (United States)

    Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis

    2012-01-01

    Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence dataset for T. molitor

  17. Regulatory effects of Tenebrio molitor Linnaeus on immunological ...

    African Journals Online (AJOL)

    This paper describes the results of experiments to test the effect of the larvae of Tenebrio molitor Linnaeus on the immune systems of mice. Mice were given a decoction of T. molitor in water at doses of 1.87, 3.75 and 7.50 g/kg/d for four weeks, after which their immune function was studied. The results indicate that T. molitor ...

  18. Aflatoxin B1 Tolerance and Accumulation in Black Soldier Fly Larvae (Hermetia illucens) and Yellow Mealworms (Tenebrio molitor).

    Science.gov (United States)

    Bosch, Guido; Fels-Klerx, H J van der; Rijk, Theo C de; Oonincx, Dennis G A B

    2017-06-02

    Crops contaminated with fungal mycotoxins such as aflatoxin B1 (AFB1) are often downgraded or removed from the food chain. This study aimed to evaluate the tolerance and accumulation of AFB1 in two insect species to determine whether they could be used to retain condemned mycotoxin contaminated crops in the food chain. First, instar black soldier fly larvae ( Hermetia illucens , BSF) and yellow mealworm ( Tenebrio molitor , YMW) were fed poultry feed spiked with AFB1 and formulated to contain levels of 0.01, 0.025, 0.05, 0.10, 0.25, and up to 0.5 mg/kg dry feed. Poultry feed without any additions and feed with only the solvent added served as controls. The AFB1 in the feed did not affect survival and body weight in the BSF and YMW larvae ( p > 0.10), indicating a high tolerance to aflatoxin B1 in both species. Furthermore, AFB1 and aflatoxin M1 (AFM1) were below the detection limit (0.10 µg/kg) in BSF larvae, whereas the YMW had AFB1 levels that were approximately 10% of the European Union's legal limit for feed materials and excreted AFM1. It is concluded that both BSF larvae and YMW have a high AFB1 tolerance and do not accumulate AFB1.

  19. Nutritional value of pupae versus larvae of Tenebrio molitor (Coleoptera: Tenebrionidae) as food for rearing Podisus maculiventris (Heteroptera: Pentatomidae)

    Science.gov (United States)

    Factitious prey are often more suitable for use in mass production of beneficial insects than natural prey. Life table analysis yielded demographic parameter values that indicate Tenebrio molitor (L.) pupae are promising as factitious prey to mass produce Podisus maculiventris (Say) and are more sui...

  20. Trealose e trealase em tenebrio molitor L Trehalose and Trehalase in Tenebrio molitor L

    Directory of Open Access Journals (Sweden)

    Cristina Piedras Lopes

    1972-01-01

    Full Text Available Foi estudada a concentração em trealose e a atividade em trealase do Tenebrio molitor L. durante as tres fases da metamorfose (larva, ninfa, imago. Verificou-se que na larva e no adulto os valores são mais elevados conforme a curva da fig. 3. A trealose foi expressa em mg/g de Tenebrio e a trealose por µg de glicose/mg proteina.Trehalose and trehalase were determined in the Tenebrio molitor L., using larva, pupa and imago. A total number of 895 animals was analyzed. A growth curve up to the end of the larval stage was established (Fig. 1 and compared with the normal one obtained by Fraenkel. It was shown that trehalose and trehalase are more concentrated in the larva and imago presenting a curve with two arms as depicted in the Fig. 3. Trehalase was expressed in mg/g of Tenebrio and trehalase in µg of glucose /mg proteín.

  1. Effect of Fungal Colonization of Wheat Grains with Fusarium spp. on Food Choice, Weight Gain and Mortality of Meal Beetle Larvae (Tenebrio molitor)

    Science.gov (United States)

    Guo, Zhiqing; Döll, Katharina; Dastjerdi, Raana; Karlovsky, Petr; Dehne, Heinz-Wilhelm; Altincicek, Boran

    2014-01-01

    Species of Fusarium have significant agro-economical and human health-related impact by infecting diverse crop plants and synthesizing diverse mycotoxins. Here, we investigated interactions of grain-feeding Tenebrio molitor larvae with four grain-colonizing Fusarium species on wheat kernels. Since numerous metabolites produced by Fusarium spp. are toxic to insects, we tested the hypothesis that the insect senses and avoids Fusarium-colonized grains. We found that only kernels colonized with F. avenaceum or Beauveria bassiana (an insect-pathogenic fungal control) were avoided by the larvae as expected. Kernels colonized with F. proliferatum, F. poae or F. culmorum attracted T. molitor larvae significantly more than control kernels. The avoidance/preference correlated with larval feeding behaviors and weight gain. Interestingly, larvae that had consumed F. proliferatum- or F. poae-colonized kernels had similar survival rates as control. Larvae fed on F. culmorum-, F. avenaceum- or B. bassiana-colonized kernels had elevated mortality rates. HPLC analyses confirmed the following mycotoxins produced by the fungal strains on the kernels: fumonisins, enniatins and beauvericin by F. proliferatum, enniatins and beauvericin by F. poae, enniatins by F. avenaceum, and deoxynivalenol and zearalenone by F. culmorum. Our results indicate that T. molitor larvae have the ability to sense potential survival threats of kernels colonized with F. avenaceum or B. bassiana, but not with F. culmorum. Volatiles potentially along with gustatory cues produced by these fungi may represent survival threat signals for the larvae resulting in their avoidance. Although F. proliferatum or F. poae produced fumonisins, enniatins and beauvericin during kernel colonization, the larvae were able to use those kernels as diet without exhibiting increased mortality. Consumption of F. avenaceum-colonized kernels, however, increased larval mortality; these kernels had higher enniatin levels than F

  2. Effect of fungal colonization of wheat grains with Fusarium spp. on food choice, weight gain and mortality of meal beetle larvae (Tenebrio molitor.

    Directory of Open Access Journals (Sweden)

    Zhiqing Guo

    Full Text Available Species of Fusarium have significant agro-economical and human health-related impact by infecting diverse crop plants and synthesizing diverse mycotoxins. Here, we investigated interactions of grain-feeding Tenebrio molitor larvae with four grain-colonizing Fusarium species on wheat kernels. Since numerous metabolites produced by Fusarium spp. are toxic to insects, we tested the hypothesis that the insect senses and avoids Fusarium-colonized grains. We found that only kernels colonized with F. avenaceum or Beauveria bassiana (an insect-pathogenic fungal control were avoided by the larvae as expected. Kernels colonized with F. proliferatum, F. poae or F. culmorum attracted T. molitor larvae significantly more than control kernels. The avoidance/preference correlated with larval feeding behaviors and weight gain. Interestingly, larvae that had consumed F. proliferatum- or F. poae-colonized kernels had similar survival rates as control. Larvae fed on F. culmorum-, F. avenaceum- or B. bassiana-colonized kernels had elevated mortality rates. HPLC analyses confirmed the following mycotoxins produced by the fungal strains on the kernels: fumonisins, enniatins and beauvericin by F. proliferatum, enniatins and beauvericin by F. poae, enniatins by F. avenaceum, and deoxynivalenol and zearalenone by F. culmorum. Our results indicate that T. molitor larvae have the ability to sense potential survival threats of kernels colonized with F. avenaceum or B. bassiana, but not with F. culmorum. Volatiles potentially along with gustatory cues produced by these fungi may represent survival threat signals for the larvae resulting in their avoidance. Although F. proliferatum or F. poae produced fumonisins, enniatins and beauvericin during kernel colonization, the larvae were able to use those kernels as diet without exhibiting increased mortality. Consumption of F. avenaceum-colonized kernels, however, increased larval mortality; these kernels had higher enniatin

  3. Subcellular partitioning of cadmium and zinc in mealworm beetle (Tenebrio molitor) larvae exposed to metal-contaminated flour.

    Science.gov (United States)

    Bednarska, Agnieszka J; Świątek, Zuzanna

    2016-11-01

    By studying the internal compartmentalization of metals in different subcellular fractions we are able to better understand the mechanisms of metal accumulation in organisms and the transfer of metals through trophic chains. We investigated the internal compartmentalization of cadmium (Cd) and zinc (Zn) in mealworm beetle (Tenebrio molitor) larvae by breeding them in flour contaminated with either Cd at 100, 300 and 600mgkg(-1), or Zn at 1000 and 2000mgkg(-1). We separated the cellular components of the larvae into 3 fractions: the S1 or cytosolic fraction containing organelles, heat-sensitive and heat-stable proteins, the S2 or cellular debris fraction and the G or metal-rich granule fraction. The concentration of Cd and Zn in each fraction was measured at 0, 7, 14 and 21 days of being fed the flour. The concentration of Cd in the flour affected the concentration of Cd measured in each larval subcellular fraction (p≤0.0001), while the concentration of Zn in the flour only affected the Zn concentration in the S2 and G fractions (p≤0.02). Both Cd and Zn concentrations in mealworms remained relatively constant during the exposure (days 7, 14 and 21) in all three fractions, but the Cd concentrations were much higher than those found in larvae before the exposure (day 0). The concentration of Cd in the flour, however, did not affect the percentage of Cd in the S1 fraction. The contribution of Cd in the G fraction to the total Cd amount was similar (30-40%) in all Cd treatments. The percentage of Zn in all three fractions was not affected by the concentration of Zn in the flour and the relative contributions of each subcellular fraction to the total burden of Zn remained generally constant for both control and treated larvae. In general, larvae sequestered approximately 30% of Cd and Zn in the S1 fraction, which is important for the transport of metals to higher trophic levels in a food web. Copyright © 2016 Elsevier Inc. All rights reserved.

  4. Morphometric analysis of instar variation in Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    Measurements of head capsule, mandible, metanotum, and body weight were done on larvae of Tenebrio molitor L. (Coleoptera: Tenebrionide) from the second to the last instar. Instar number varied from 14 to 18, but 15 or 16 instars were the most common. The value of dimensional measurements was evalua...

  5. The study of the peptide composition of the supernatants from mealworm Tenebrio molitor larvae and goldfish Carassius auratus during cold acclimation

    Directory of Open Access Journals (Sweden)

    А. К. Гулевский

    2016-11-01

    Full Text Available The molecular-mass distribution of peptides from supernatants, obtained from the tissues of larvae Tenebrio molitor and goldfish Carassius auratus during cold acclimation, has been determined by chromatography. The results showed that peptide spectrum of the supernatants from larvae T. molitor and C. auratus varied during cold acclimation. The supernatants from non-acclimated larvae of T. molitor and deacclimated fish possessed the highest number of peptide fractions. Furthermore, the cold-acclimated larvae of T. molitor had the peptide fractions of the low molecular weight (ca. 5.4×102 ÷22.6×102 Da, and non-acclimated insects had the peptides of the high molecular weight (ca. 46.8×102÷66×102 Da. Next, the organ-specific changes of the peptide composition of the goldfish during winter deacclimation have been revealed. Specifically, the low molecular weight peptides (ca. (14.1 ± 0.3×102 and (6.75 ± 0.25×102 Da, have been detected in the C. auratus muscles, and both the high (ca. (67.83 ± 0.21×102 ( ca. 64.16 ± 0.26×102 Da and low (ca. (34.1 ± 1.0×102 and (14.29 ± 0.15×102 Da molecular weight peptides have been detected in the liver. Quantitative and qualitative changes in the peptide spectra from supernatants of the T. molitor and C. auratus during cold acclimation could be one of the mechanisms of their natural adaptation to low temperatures.

  6. Supplementation of Dried Mealworm (Tenebrio molitor larva) on Growth Performance, Nutrient Digestibility and Blood Profiles in Weaning Pigs

    Science.gov (United States)

    Jin, X. H.; Heo, P. S.; Hong, J. S.; Kim, N. J.; Kim, Y. Y.

    2016-01-01

    This experiment was conducted to investigate the effects of dried mealworm (Tenebrio molitor larva) on growth performance, nutrient digestibility and blood profiles in weaning pigs. A total of 120 weaning pigs (28±3 days and 8.04±0.08 kg of body weight) were allotted to one of five treatments, based on sex and body weight, in 6 replicates with 4 pigs per pen by a randomized complete block design. Supplementation level of dried mealworm was 0%, 1.5%, 3.0%, 4.5%, or 6.0% in experimental diet as treatment. Two phase feeding programs (phase I from 0 day to 14 day, phase II from 14 day to 35 day) were used in this experiment. All animals were allowed to access diet and water ad libitum. During phase I, increasing level of dried mealworm in diet linearly improved the body weight (pmealworm (p = 0.08). In addition, increasing level of dried mealworm improved the ADG (pmealworm level was increased, nitrogen retention and digestibility of dry matter as well as crude protein were linearly increased (p = 0.05). In the results of blood profiles, decrease of blood urea nitrogen (linear, p = 0.05) and increase of insulin-like growth factor (linear, p = 0.03) were observed as dried mealworm was increased in diet during phase II. However, there were no significant differences in immunoglobulin A (IgA) and IgG concentration by addition of dried mealworm in the growth trial. Consequently, supplementation of dried mealworm up to 6% in weaning pigs’ diet improves growth performance and nutrient digestibility without any detrimental effect on immune responses. PMID:27282974

  7. Regulatory effects of Tenebrio molitor Linnaeus on immunological ...

    African Journals Online (AJOL)

    AJL

    2012-04-24

    Apr 24, 2012 ... function of mice and therefore, this insect has the potential of a health food supplement. Key words: Tenebrio molitor Linnaeus, mice, immunoregulation, immunological function. INTRODUCTION. Yellow mealworm beetles Tenebrio molitor Linnaeus. (Tenebrionidae, Coleoptera) are considered scavengers.

  8. Ganho de peso e comportamento de oviposição de Podisus nigrispinus utilizando lagartas de Spodoptera frugiperda e larvas de Tenebrio molitor como presas

    Directory of Open Access Journals (Sweden)

    Oliveira Harley Nonato de

    2004-01-01

    Full Text Available Esse trabalho avaliou o efeito de diferentes presas e da combinação destas sobre percevejo Podisus nigrispinus. O delineamento experimental foi inteiramente casualizado com três tratamentos e 60 repetições. No tratamento um (T1, os percevejos receberam como alimento, lagartas de Spodoptera frugiperda, de 4o estádio, durante todo o seu ciclo de vida, no tratamento dois (T2, larvas de Tenebrio molitor, também durante o todo ciclo, enquanto que, no tratamento três (T3, foram oferecidas lagartas de S. frugiperda do 2masculine ao 4masculine estádios, e larvas de T. molitor do 4masculine estádio até o final do ciclo de vida. O ganho de peso em todas as fases ninfais e em adultos de até terceiro dia mostrou valores semelhantes de incremento, para todas as dietas utilizadas. No entanto, para os percevejos alimentados, com S. frugiperda (T1, observaram-se uma maior produção de ovos num menor período, com 80% dos ovos até 31masculine dia, enquanto que, no tratamento com larvas de T. molitor (T2, os mesmos 80% foram conseguidos somente no 45masculine dia, e no tratamento com a combinação de presas (T3, no 48masculine dia.

  9. Growth performance, blood profiles and carcass traits of Barbary partridge (Alectoris barbara) fed two different insect larvae meals (Tenebrio molitor and Hermetia illucens)

    Czech Academy of Sciences Publication Activity Database

    Loponte, R.; Nizza, S.; Bovera, F.; De Riu, N.; Fliegerová, Kateřina; Lombardi, P.; Vassalotti, G.; Mastellone, V.; Nizza, A.; Moniello, G.

    2017-01-01

    Roč. 115, č. 3 (2017), s. 183-188 ISSN 0034-5288 Institutional support: RVO:67985904 Keywords : Barbary partridge * Hermetia illucens * Tenebrio molitor Subject RIV: EE - Microbiology, Virology Impact factor: 1.298, year: 2016

  10. Activity changes of antioxidant and detoxifying enzymes in Tenebrio molitor (Coleoptera: Tenebrionidae) larvae infected by the entomopathogenic nematode Heterorhabditis beicherriana (Rhabditida: Heterorhabditidae).

    Science.gov (United States)

    Li, Xingyue; Liu, Qizhi; Lewis, Edwin E; Tarasco, Eustachio

    2016-12-01

    Entomopathogenic nematodes (EPNs) of the genera Steinernema and Heterorhabditis are lethal parasites of many insect species. To investigate defensive mechanisms towards EPNs in relation to antioxidative and detoxifying enzymes, we chose Tenebrio molitor (Coleoptera: Tenebrionidae) as experimental insect. We studied the activity changes of superoxide dismutases (SODs), peroxidases (PODs), and catalases (CATs), as well as tyrosinase (TYR), acetylcholinesterase (AChE), carboxylesterase (CarE), and glutathione S-transferase (GSTs) for 40 h in T. molitor larvae infected with Heterorhabditis beicherriana infective juveniles (IJs) at 5 rates (0, 20, 40, 80, and 160 IJs/larva). We found that when T. molitor larvae infected with H. beicherriana at higher rates (80 and 160 IJs/larva), SOD activity quickly increased to more than 70 % higher than that control levels. The activities of POD and CAT increased after 24 h. TYR activity increased slowly at lower rates of infection for 16 h, followed by a slight decrease, and then increasing from 32 to 40 h. The other detoxifying enzymes (GST, CarE, and AChE) were enhanced at lower infection rates, but were inhibited at higher rates. Our results suggested that host antioxidative response and detoxification reactions played a central role in the defensive reaction to EPNs, and that this stress which was reflected by the higher level enzymes activity contributed to the death of hosts. Further study should explore the exact function of these enzymes using different species of EPNs and investigate the links between enzyme activity and host susceptibility to EPNs.

  11. Use of nutrient self selection as a diet refining tool in Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    A new method to refine existing dietary supplements for improving production of the yellow mealworm, Tenebrio molitor L. (Coleoptera: Tenebrionidae), was tested. Self selected ratios of 6 dietary ingredients by T. molitor larvae were used to produce a dietary supplement. This supplement was compared...

  12. Safety assessment of freeze-dried powdered Tenebrio molitor larvae (yellow mealworm) as novel food source: Evaluation of 90-day toxicity in Sprague-Dawley rats.

    Science.gov (United States)

    Han, So-Ri; Lee, Byoung-Seok; Jung, Kyung-Jin; Yu, Hee-Jin; Yun, Eun-Young; Hwang, Jae Sam; Moon, Kyoung-Sik

    2016-06-01

    Worldwide demand for novel food source has grown and edible insects are a promising food sources for humans. Tenebrio molitor, as known as yellow mealworm, has advantages of being rich in protein, and easy to raise as a novel food source. The objective of this study was to evaluate subchronic toxicity, including potential hypersensitivity, of freeze-dried powdered T. molitor larvae (fdTML) in male and female Sprague-Dawley rats. The fdTML was administered orally once daily at dose levels of 0, 300, 1000 and 3000 mg/kg/day for 90 days. A toxicological assessment was performed, which included mortality, clinical signs, body and organ weights, food consumption, ophthalmology, urinalysis, hematology, serum chemistry, gross findings, histopathologic examination and allergic reaction. There were no fdTML- related findings in clinical signs, urinalysis, hematology and serum chemistry, gross examination, histopathologic examination or allergic reaction. In conclusion, the No Observed Adverse Effect Level (NOAEL) for fdTML was determined to be in excess of 3000 mg/kg/day in both sexes of rats under the experimental conditions of this study. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Digestion of Starch Granules from Maize, Potato and Wheat by Larvae of the the Yellow Mealworm, Tenebrio molitor and the Mexican Bean Weevil, Zabrotes subfasciatus

    Science.gov (United States)

    Meireles, Elaine A.; Carneiro, Cíntia N. B.; DaMatta, Renato A.; Samuels, Richard I.; Silva, Carlos P.

    2009-01-01

    Scanning electron microscopy images were taken of starch granules from different sources following exposure in vivo and in vitro to gut α-amylases isolated from Tenebrio molitor L. (Coleoptera: Tenebrionidae) and Zabrotes subfasciatus Boheman (Coleoptera: Bruchidae). One α-amylase was isolated from whole larval midguts of T. molitor using non-denaturing SDS-PAGE, while two other α-amylase fractions were isolated from whole larval midguts of Z. subfasciatus using hydrophobic interaction chromatography., Digested starch granules from larvae fed on maize, potato or wheat were isolated from midgut contents. Combinations of starch granules with isolated α-amylases from both species showed similar patterns of granule degradation. In vitro enzymatic degradation of maize starch granules by the three different α-amylase fractions began by creating small holes and crater-like areas on the surface of the granules. Over time, these holes increased in number and area resulting in extensive degradation of the granule structure. Granules from potato did not show formation of pits and craters on their surface, but presented extensive erosion in their interior. For all types of starch, as soon as the interior of the starch granule was reached, the inner layers of amylose and amylopectin were differentially hydrolyzed, resulting in a striated pattern. These data support the hypothesis that the pattern of starch degradation depends more on the granule type than on the α-amylase involved. PMID:19619014

  14. Desenvolvimento de Supputius cincticeps (Heteroptera, Pentatomidae alimentado com larvas de Zophobas confusa, Tenebrio molitor (Coleoptera, Tenebrionidae e Musca domestica (Diptera, Muscidae Development of Supputius cincticeps (Heteroptera, Pentatomidae fed with Zophobas confusa, Tenebrio molitor (Coleoptera, Tenebrionidae and Musca domestica (Diptera, Muscidae larvae

    Directory of Open Access Journals (Sweden)

    Eduardo B. Beserra

    1995-09-01

    Full Text Available Egg viability and nymphal development of the predatory bug Supputius cincticeps (Stål, 1860 were evaluated during two generations in the Biological Control Laboratory of the Núcleo de Biotecnologia Aplicada à Agropecuária (Bioagro/UFV in Viçosa (Minas Gerais, Brazil at 24.72±1.10ºC and photophase of 12 hours. Three treatments were represented by S. cincticeps fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 and Musca domestica Linnaeus, 1758 larvae. Higher egg viability of this predator was found when the preys were Z. confusa and T. molitor, 74.46% and 80.91 %, than in M. domestica, 57.02%, but incubation period showed no differences between preys. Shorter nymphal development and higher nymphal viability were found with Z. confusa and T. molitor than with M. domestica. Higher weight increase was found for nymphs which originated males and females in the second generation specialy with the first two preys.

  15. Melanization and Pathogenicity in the Insect, Tenebrio molitor, and the Crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3: e15728

    National Research Council Canada - National Science Library

    Chadanat Noonin; Pikul Jiravanichpaisal; Irene Söderhäll; Susana Merino; Juan M Tomás; Kenneth Söderhäll

    2010-01-01

    ...) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved...

  16. Melanization and pathogenicity in the insect, Tenebrio molitor, and the crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3

    National Research Council Canada - National Science Library

    Noonin, Chadanat; Jiravanichpaisal, Pikul; Söderhäll, Irene; Merino, Susana; Tomás, Juan M; Söderhäll, Kenneth

    2010-01-01

    ...) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved...

  17. Functional analysis of C1 family cysteine peptidases in the larval gut of Tenebrio molitor and Tribolium castaneum

    Science.gov (United States)

    We studied protein digestion the tenebrionids Tenebrio molitor and Tribolium castaneum, pests of stored grains and grain products, to identify potential targets for biopesticide development. Tenebrionid larvae have highly compartmentalized guts, with primarily cysteine peptidases in the acidic anter...

  18. Yellow mealworm larvae (Tenebrio molitor) inclusion in diets for male broiler chickens: effects on growth performance, gut morphology, and histological findings.

    Science.gov (United States)

    Biasato, I; Gasco, L; De Marco, M; Renna, M; Rotolo, L; Dabbou, S; Capucchio, M T; Biasibetti, E; Tarantola, M; Sterpone, L; Cavallarin, L; Gai, F; Pozzo, L; Bergagna, S; Dezzutto, D; Zoccarato, I; Schiavone, A

    2018-02-01

    This study evaluated the effects of Tenebrio molitor (TM) larvae meal inclusion in diets for broilers. A total of 160 male broiler chicks (Ross 708) at one-day of age were randomly allotted to four dietary treatments: a control (C) group and three TM groups, in which TM meal was included at 50 (TM5), 100 (TM10), and 150 (TM15) g/kg, respectively. The experimental diets were isonitrogenous and isoenergetic. Each group consisted of five pens as replicates (8 chicks/pen). After the evaluation of growth performance and haematochemical parameters, the animals were slaughtered at 53 days and carcass traits were recorded. Morphometric investigations were performed on duodenum, jejunum, and ileum and histopathological alterations were assessed for liver, spleen, thymus, bursa of Fabricius, kidney, and heart. The live weight (LW) showed a linear (12 and 25 days, P 0.05). TM15 birds showed lower villus height (P < 0.05), higher crypt depth (P < 0.05), and lower villus height to crypt depth ratio (P = 0.001) compared with C and TM5. In conclusion, increasing levels of dietary TM meal inclusion in male broiler chickens may improve body weight and feed intake, but negatively affect feed efficiency and intestinal morphology, thus suggesting that low levels may be more suitable. However, no effect on haematochemical parameters, carcass traits, and histological findings were observed in relation to TM meal utilization. © 2017 Poultry Science Association Inc.

  19. Recovery and techno-functionality of flours and proteins from two edible insect species: Meal worm (Tenebrio molitor) and black soldier fly (Hermetia illucens) larvae.

    Science.gov (United States)

    Bußler, Sara; Rumpold, Birgit A; Jander, Elisabeth; Rawel, Harshadrai M; Schlüter, Oliver K

    2016-12-01

    Depending on the species, edible insects are highly nutritious and thus represent a noteworthy alternative food and feed source. The current work investigates the protein extractability and techno-functionality of insect flour fractions recovered from Tenebrio molitor and Hermetia illucens. T. molitor and H. illucens flours contained about 20% crude fat and 60% and 36 % crude protein, respectively. Defatting reduced the crude fat content to 2.8% (T. molitor) and 8.8% (H. illucens) and increased the crude protein content to 68% and 47%, respectively. To isolate proteins from the flours, protein solubility was optimized by varying the pH, the ionic strength, and the extraction temperature of the solvent. All products and by-products accumulated in the protein production process were characterized by composition, selected techno-functional properties, protein solubility, composition and structure as well as their microbial load.

  20. Recovery and techno-functionality of flours and proteins from two edible insect species: Meal worm (Tenebrio molitor and black soldier fly (Hermetia illucens larvae

    Directory of Open Access Journals (Sweden)

    Sara Bußler

    2016-12-01

    Full Text Available Depending on the species, edible insects are highly nutritious and thus represent a noteworthy alternative food and feed source. The current work investigates the protein extractability and techno-functionality of insect flour fractions recovered from Tenebrio molitor and Hermetia illucens. T. molitor and H. illucens flours contained about 20% crude fat and 60% and 36 % crude protein, respectively. Defatting reduced the crude fat content to 2.8% (T. molitor and 8.8% (H. illucens and increased the crude protein content to 68% and 47%, respectively. To isolate proteins from the flours, protein solubility was optimized by varying the pH, the ionic strength, and the extraction temperature of the solvent. All products and by-products accumulated in the protein production process were characterized by composition, selected techno-functional properties, protein solubility, composition and structure as well as their microbial load.

  1. The studies on waste biodegradation by Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Bożek Magdalena

    2017-01-01

    Full Text Available As cities are growing in size with a rise in the population, the amount of plastic waste generated is increasing and becoming unmanageable. The treatment and disposal of plastic waste is an urgent need of our present and future. It has been proved recently that mealworms, the larvae of Tenebrio molitor Linnaeus, are able eat styrofoam, a common polystyrene product. Polystyrene is one of the most widely used plastics, the scale of its production being several million tons per year. Tenebrio molitor is one of the largest pests found in stored-grain products. The insect is indigenous to Europe, but is currently cosmopolitan in distribution. The styrofoam is efficiently degraded in the larval gut by microorganisms. We have used the larvae of T. molitor to biodegrade three types of food packaging plastics: polystyrene (PS, polyvinyl chloride (PVC and polylactide (PLA. PVC is a thermoplastic made of 57% chlorine (derived from industrial grade salt and 43% carbon (derived predominantly from oil /gas via ethylene. It is the world's third-most widely produced synthetic plastic polymer, which is not biodegradable easily. On the other hand, PLA is an easily biodegradable and bioactive thermoplastic aliphatic polyester derived from corn and tapioca starch or sugarcane. Three groups of larvae were fed selected types of polymers as an only food, while a control population was fed on oatmeal. The mass loss, dry matter content and biochemical composition of mealworms were assessed in the performed laboratory experiments. The protein concentration in homogenates of the larvae was determined by the Bradford method. To determine the level of hydrolized carbohydrates we used anthrone method. The classical sulfo-phospho-vanillin assay (SPVA was used to quantitate total lipids in mealworms. The results allowed to compare the decomposition efficiency of selected polymer materials by mealworms and to recognize the mechanism of decomposition contributing to the future

  2. Activated phenoloxidase from Tenebrio molitor larvae enhances the synthesis of melanin by using a vitellogenin-like protein in the presence of dopamine.

    Science.gov (United States)

    Lee, K M; Lee, K Y; Choi, H W; Cho, M Y; Kwon, T H; Kawabata, S; Lee, B L

    2000-06-01

    One of the biological functions of activated phenoloxidase in arthropods is the synthesis of melanin around invaded foreign materials. However, little is known about how activated phenoloxidase synthesizes melanin at the molecular level. Even though it has been suggested that the quinone derivatives generated by activated phenoloxidase might use endogenous protein components for melanin synthesis in arthropods, there is no report of protein components engaged in melanin synthesis induced by activated phenoloxidase. In this study, to isolate and characterize proteins involved in melanin synthesis, we prepared in vitro prophenoloxidase activating solution (designated G-100 solution), specifically showing phenoloxidase activity in the presence of Ca2+ and beta-1, 3-glucan, from the hemolymph of larvae of the coleopteran Tenebrio molitor by using a Sephadex G-100 column. When G-100 solution was incubated with dopamine to induce melanin synthesis in the presence of Ca2+ and beta-1,3-glucan, four types of protein (160 kDa, prophenoloxidase, phenoloxidase and 45 kDa) disappeared from SDS/PAGE under reducing conditions. Under identical conditions, but including phenylthiourea as a phenoloxidase inhibitor added to the G-100 solution, three of these proteins (160 kDa, phenoloxidase and 45 kDa) did not disappear. To characterize these melanization-engaging proteins, we first purified the 160-kDa melanization-engaging protein to homogeneity and raised a polyclonal antibody against it. Analysis of the cDNA revealed that it consisted of 1439 amino-acid residues and showed partial homology with Caenorhabditis elegans vitellogenin precursor-6 (19.7%). Western blot analysis showed that it disappeared when active phenoloxidase induced melanin synthesis. Furthermore, when the purified 160-kDa melanization-engaging protein was added to a G-100 solution deficient in it, melanin synthesis was enhanced compared with the same solution without the protein. These data support the conclusion

  3. Growth performance, blood profiles and carcass traits of Barbary partridge (Alectoris barbara) fed two different insect larvae meals (Tenebrio molitor and Hermetia illucens).

    Science.gov (United States)

    Loponte, Rosa; Nizza, Sandra; Bovera, Fulvia; De Riu, Nicola; Fliegerova, Katerina; Lombardi, Pietro; Vassalotti, Giuseppe; Mastellone, Vincenzo; Nizza, Antonino; Moniello, Giuseppe

    2017-12-01

    To investigate the effect of two insect meals (from Hermetia illucens, HI and Tenebrio molitor, TM larvae) on productive performance and blood profiles of Barbary partridge, ninety, seven days old partridges were divided into 5 groups (6 replicates, 3 partridges/replicate). Up to 64d, the groups fed 5 isoproteic and isoenergetic diets: the control fed a corn-soybean meal diet (SBM group); in TM25 and TM50 groups the 25 and 50% of SBM proteins were substituted by the protein from TM, respectively; in HI25 and HI50 groups the 25 and 50% of SBM were substituted by the protein from HI, respectively. The birds fed TM25 and both the HI levels reached a higher (P<0.01) live weight at 64d than the control. Considering the entire experimental period the TM groups had a more favorable FCR than SBM. The carcass weights of all the insect groups were higher (P<0.01) than the control. The weight of the full digestive tract in SBM group was the highest (P<0.01). The caecal weight, the intestinal and caecal length were the highest (P<0.01) in the SBM group. The SBM group the highest value of albumin/globulin (P<0.01) and creatinine (P<0.05). TM seems to be more effective than HI in improving FCR. The reduced albumin/globulin ratio in the insect meal fed groups could be ascribed to the chitin content and this result was not affected by the amount of chitin intake, suggesting that also the lowest values are able to express their potential effects in partridges. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Pesticide contamination of Tenebrio molitor (Coleoptera: Tenebrionidae) for human consumption.

    Science.gov (United States)

    Houbraken, Michael; Spranghers, Thomas; De Clercq, Patrick; Cooreman-Algoed, Margot; Couchement, Tasmien; De Clercq, Griet; Verbeke, Sarah; Spanoghe, Pieter

    2016-06-15

    The use of pesticides contributes to the productivity and the quality of the cultivated crop. A large portion of the agricultural produce is not consumed as it is not an edible part or the quality of the product is too low. This waste of agricultural produce can be valorised as a substrate for the production of certain insects for human consumption. However, pesticides applied on the plants might accumulate during the life cycle of the insects fed on the waste materials and may cause a health risk to humans consuming the insects. Pesticide residues in larvae of the yellow mealworm, Tenebrio molitor, were investigated. We monitored the accumulation of pesticides in the larvae upon consumption of contaminated fresh produce. An increased uptake rate by the insects was found for pesticides with higher Kow-values. Excretion of pesticides by the insect was inversely related to the log(Kow) values of the pesticides. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Gut microbiota of Tenebrio molitor and their response to environmental change.

    Science.gov (United States)

    Jung, Jaejoon; Heo, Aram; Park, Yong Woo; Kim, Ye Ji; Koh, Hyelim; Park, Woojun

    2014-07-01

    A bacterial community analysis of the gut of Tenebrio molitor larvae was performed using pyrosequencing of the 16S rRNA gene. A predominance of genus Spiroplasma species in phylum Tenericutes was observed in the gut samples, but there was variation found in the community composition between T. molitor individuals. The gut bacteria community structure was not significantly affected by the presence of antibiotics or by the exposure of T. molitor larvae to a highly diverse soil bacteria community. A negative relationship was identified between bacterial diversity and ampicillin concentration; however, no negative relationship was identified with the addition of kanamycin. Ampicillin treatment resulted in a reduction in the bacterial community size, estimated using the 16S rRNA gene copy number. A detailed phylogenetic analysis indicated that the Spiroplasma-associated sequences originating from the T. molitor larvae were distinct from previously identified Spiroplasma type species, implying the presence of novel Spiroplasma species. Some Spiroplasma species are known to be insect pathogens; however, the T. molitor larvae did not experience any harmful effects arising from the presence of Spiroplasma species, indicating that Spiroplasma in the gut of T. molitor larvae do not act as a pathogen to the host. A comparison with the bacterial communities found in other insects (Apis and Solenopsis) showed that the Spiroplasma species found in this study were specific to T. molitor.

  6. Desenvolvimento do predador Podisus nigrispinus alimentado com Spodoptera frugiperda e Tenebrio molitor Development of the predator Podisus nigrispinus fed on Spodoptera frugiperda and Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Harley Nonato de Oliveira

    2004-10-01

    Full Text Available Ninfas de Podisus nigrispinus (Heteroptera: Pentatomidae têm sido criadas em laboratório com larvas de Tenebrio molitor L. (Coleoptera: Tenebrionidae. No entanto, não existem relatos sobre a predação, no campo ou em laboratório, de P. nigrispinus em Spodoptera frugiperda (Lepidoptera: Noctuidae, uma das principais pragas de inúmeras culturas no Brasil. Este trabalho teve o objetivo de avaliar o desenvolvimento ninfal e características reprodutivas do percevejo predador P. nigrispinus em lagartas de S. frugiperda e em larvas de T. molitor, em laboratório. A presa S. frugiperda proporcionou ao predador menor longevidade, maior produção e viabilidade de ovos do que as larvas de T. molitor. Esses resultados demonstram que a lagarta S. frugiperda melhora as características reprodutivas de P. nigrispinus, de forma que a sua utilização como presa alternativa pode servir para incrementar a produção massal desse inimigo natural.Nymphys of Podisus nigrispinus (Heteroptera: Pentatomidae have been reared on Tenebrio molitor L. (Coleoptera: Tenebrionidae, in laboratory conditions. However, there are no reports on P. nigrispinus predation, in field or laboratory, on Spodoptera frugiperda (Lepidoptera: Noctuidae, one of the most damaging pests in crops in Brazil. This research had the objective to evaluate nymphal development and reproductive characteristics of the predator P. nigrispinus when reared on caterpillars of S. frugiperda and on larvae of T. molitor, in laboratory conditions. S. frugiperda provided a smaller longevity, higher egg production and viability to predator than T. molitor. The nutricional quality of this caterpillar improves the reproductive characteristics of the predator, so that its utilization as factitious host can increase mass production of this natural enemy.

  7. Microbial community assessment of mealworm larvae (Tenebrio molitor) and grasshoppers (Locusta migratoria migratorioides) sold for human consumption.

    Science.gov (United States)

    Stoops, J; Crauwels, S; Waud, M; Claes, J; Lievens, B; Van Campenhout, L

    2016-02-01

    In Western countries, the popularity of edible insects as an alternative animal protein source is increasing. Nevertheless, there is a lack of profound insight into the microbial safety and shelf life of living insects sold for human consumption. The purpose of this study was to characterise the microflora of fresh edible mealworm larvae and grasshoppers in a quantitative and qualitative way. Therefore, culture-dependent analyses (the total viable aerobic count, Enterobacteriaceae, lactic acid bacteria, yeasts and moulds, and bacterial endospores) and next-generation sequencing (454amplicon pyrosequencing) were performed. High microbial counts were obtained for both insect species. Different insect batches resulted in quite similar microbial numbers, except for bacterial endospores. However, the bacterial community composition differed between both insect species. The most abundant operational taxonomic unit in mealworm larvae was Propionibacterium. Also members of the genera Haemophilus, Staphylococcus and Clostridium were found. Grasshoppers were mainly dominated by Weissella, Lactococcus and Yersinia/Rahnella. Overall, a variety of potential spoilage bacteria and food pathogens were characterised. The results of this study suggest that a processing step with a microbiocidal effect is required to avoid or minimize risks involved with the consumption of edible insects. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. Tenebrio molitor Extracts Modulate the Response to Environmental Stressors and Extend Lifespan in Caenorhabditis elegans.

    Science.gov (United States)

    Won, Seong-Min; Cha, Hye-Uk; Yi, Sun Shin; Kim, Sung-Jo; Park, Sang-Kyu

    2016-09-08

    Tenebrio molitor are large insects and their larvae are consumed as food in many countries. The nutritional composition of T. molitor has been studied and contains high amounts of proteins, unsaturated fatty acids, and valuable minerals. However, the bioactivity of T. molitor has not been fully understood. We examined the effects of T. molitor extracts on resistance to oxidative stress and organism's lifespan using Caenorhabditis elegans as a model system. The response to heat shock and ultraviolet (UV) irradiation was monitored in vivo. The extracts from T. molitor showed significant effects on resistance to oxidative stress and UV irradiation and extend both mean and maximum lifespan of C. elegans. The number of progeny produced significantly increased in animals supplemented with T. molitor extracts. In addition, the expression of hsp-16.2 and sod-3 was markedly upregulated by supplementation with T. molitor extracts. These findings suggest that T. molitor extracts can increase response to stressors and extend lifespan by the induction of longevity assurance genes in C. elegans.

  9. A nuptially transmitted Ichthyosproean symbiont of Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    The yellow mealworm, Tenebrio molitor, harbors a symbiont that has spores with a thick, laminated wall and infects the fat body and ventral nerve chord of adult and larval beetles. In adult males, there is heavy infection of the epithelial cells of the testes and between testes lobes with occasional...

  10. [Cloning, prokaryotic expression and antibacterial assay of Tenecin gene encoding an antibacterial peptide from Tenebrio molitor].

    Science.gov (United States)

    Liu, Ying; Jiang, Yu-xin; Li, Chao-pin

    2011-12-01

    To clone tenecin gene, an antibacterial peptide gene, from Tenebrio molitor for its prokaryotic expression and explore the molecular mechanism for regulating the expression of antibacterial peptide in Tenebrio molitor larvae. The antibacterial peptide was induced from the larvae of Tenebrio molitor by intraperitoneal injection of Escherichia coli DH-5α (1×10(8)/ml). RT-PCR was performed 72 h after the injection to clone Tenecin gene followed by sequencing and bioinformatic analysis. The recombinant expression vector pET-28a(+)-Tenecin was constructed and transformed into E. coli BL21(DE3) cells and the expression of tenecin protein was observed after IPTG induction. Tenecin expression was detected in transformed E.coli using SDS-PAGE after 1 mmol/L IPTG induction. Tenecin gene, which was about 255 bp in length, encoded Tenecin protein with a relative molecular mass of 9 kD. Incubation of E.coli with 80, 60, 40, and 20 µg/ml tenecin for 18 h resulted in a diameter of the inhibition zone of 25.1∓0.03, 20.7∓0.06, 17.2∓0.11 and 9.3∓0.04 mm, respectively. Tenecin protein possesses strong antibacterial activity against E. coli DH-5α, which warrants further study of this protein for its potential as an antibacterial agent in clinical application.

  11. Nutritional values of edible Coleoptera (Tenebrio molitor, Zophobas morio and Alphitobius diaperinus) reared in the Czech Republic

    OpenAIRE

    Adámková, Anna; Kouřimská, Lenka; Borkovcová, Marie; Kulma, Martin; Mlček, Jiří

    2016-01-01

    Edible insects have gained the status of highly nutritious food with high protein and fat content. However, nutritional value of insects is not constant. It could be affected by species, developmental stage, rearing technology, nutrition or sex. This study's goal is to determine the protein and fat contents of three edible beetle species (giant mealworm - larvae of Zophobas morio, mealworm - larvae of Tenebrio molitor and, lesser mealworm - larvae of Alphitobius diaperinus) bred in the Czech ...

  12. Gene structure, cDNA characterization and RNAi-based functional analysis of a myeloid differentiation factor 88 homolog in Tenebrio molitor larvae exposed to Staphylococcus aureus infection.

    Science.gov (United States)

    Patnaik, Bharat Bhusan; Patnaik, Hongray Howrelia; Seo, Gi Won; Jo, Yong Hun; Lee, Yong Seok; Lee, Bok Luel; Han, Yeon Soo

    2014-10-01

    Myeloid differentiation factor 88 (MyD88), an intracellular adaptor protein involved in Toll/Toll-like receptor (TLR) signal processing, triggers activation of nuclear factor-kappaB (NF-κB) transcription factors. In the present study, we analyzed the gene structure and biological function of MyD88 in a coleopteran insect, Tenebrio molitor (TmMyD88). The TmMyD88 gene was 1380 bp in length and consisted of five exons and four introns. The 5'-flanking sequence revealed several putative transcription factor binding sites, such as STAT-4, AP-1, cJun, cfos, NF-1 and many heat shock factor binding elements. The cDNA contained a typical death domain, a conservative Toll-like interleukin-1 receptor (TIR) domain, and a C-terminal extension (CTE). The TmMyD88 TIR domain showed three significantly conserved motifs for interacting with the TIR domain of TLRs. TmMyD88 was grouped within the invertebrate cluster of the phylogenetic tree and shared 75% sequence identity with the TIR domain of Tribolium castaneum MyD88. Homology modeling of the TmMyD88 TIR domain revealed five parallel β-strands surrounded by five α-helices that adopted loop conformations to function as an adaptor. TmMyD88 expression was upregulated 7.3- and 4.79-fold after 12 and 6h, respectively, of challenge with Staphylococcus aureus and fungal β-1,3 glucan. Silencing of the TmMyD88 transcript by RNA interference led to reduced resistance of the host to infection by S. aureus. These results indicate that TmMyD88 is required for survival against Staphylococcus infection. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Rearing Tenebrio molitor in BLSS: Dietary fiber affects larval growth, development, and respiration characteristics

    Science.gov (United States)

    Li, Leyuan; Stasiak, Michael; Li, Liang; Xie, Beizhen; Fu, Yuming; Gidzinski, Danuta; Dixon, Mike; Liu, Hong

    2016-01-01

    Rearing of yellow mealworm (Tenebrio molitor L.) will provide good animal nutrition for astronauts in a bioregenerative life support system. In this study, growth and biomass conversion data of T. molitor larvae were tested for calculating the stoichiometric equation of its growth. Result of a respiratory quotient test proved the validity of the equation. Fiber had the most reduction in mass during T. molitor‧s consumption, and thus it is speculated that fiber is an important factor affecting larval growth of T. molitor. In order to further confirm this hypothesis and find out a proper feed fiber content, T. molitor larvae were fed on diets with 4 levels of fiber. Larval growth, development and respiration in each group were compared and analyzed. Results showed that crude-fiber content of 5% had a significant promoting effect on larvae in early instars, and is beneficial for pupa eclosion. When fed on feed of 5-10% crude-fiber, larvae in later instars reached optimal levels in growth, development and respiration. Therefore, we suggest that crude fiber content in feed can be controlled within 5-10%, and with the consideration of food palatability, a crude fiber of 5% is advisable.

  14. Toxic effects of two essential oils and their constituents on the mealworm beetle, Tenebrio molitor.

    Science.gov (United States)

    Martínez, L C; Plata-Rueda, A; Colares, H C; Campos, J M; Dos Santos, M H; Fernandes, F L; Serrão, J E; Zanuncio, J C

    2017-12-14

    The study identified insecticidal effects from the cinnamon and clove essential oils in Tenebrio molitor L. (Coleoptera: Tenebrionidae). The lethal concentrations (LC50 and LC90), lethal time, and repellent effect on larvae, pupae, and adults of T. molitor after exposure to six concentrations of each essential oil and toxic compounds were evaluated. The chemical composition of the cinnamon oil was also determined and primary compounds were eugenol (10.19%), trans-3-caren-2-ol (9.92%), benzyl benzoate (9.68%), caryophyllene (9.05%), eugenyl acetate (7.47%), α-phellandrene (7.18%), and α-pinene (6.92%). In clove essential oil, the primary compounds were eugenol (26.64%), caryophyllene (23.73%), caryophyllene oxide (17.74%), 2-propenoic acid (11.84%), α-humulene (10.48%), γ-cadinene (4.85%), and humulene oxide (4.69%). Cinnamon and clove essential oils were toxic to T. molitor. In toxic chemical compounds, eugenol have stronger contact toxicity in larvae, pupae, and adult than caryophyllene oxide, followed by α-pinene, α-phellandrene, and α-humulene. In general, the two essential oils were toxic and repellent to adult T. molitor. Cinnamon and clove essential oils and their compounds caused higher mortality and repellency on T. molitor and, therefore, have the potential for integrated management programs of this insect.

  15. In vitro crude protein digestibility of Tenebrio molitor and Hermetia illucens insect meals and its correlation with chemical composition traits

    Directory of Open Access Journals (Sweden)

    Stefania Marono

    2015-07-01

    Full Text Available The aims of this study were to evaluate the correlation between in vitro crude protein digestibility coefficients of insect meals from Tenebrio molitor (TI and Hermetia illucens (HI and their chemical composition traits as well as to develop regression equations able to estimate the in vitro crude protein digestibility (CPd from proximate analysis of insect meals. Twelve samples of insect meals (6 from TM larvae, TM 1-6 and 6 from HI larvae, HI 1-6 were obtained from different producers and analysed for chemical composition and in vitro crude protein digestibility by a two-step enzymatic method (digestion with pepsin and trypsin-enriched pancreatin. For both insect meal samples, CPd was negatively correlated to ADF and chitin contents, while just for HI there was a positive correlation (P<0.01 between CP percentage of the samples and CPd. For both insect meals the former variable chosen in the stepwise analysis was the chitin, explaining the 79.45% of CPd variability for Tenebrio molitor samples and the 98.30% for Hermetia illucens. In the second step, the amount of protein linked to ADF was added in the model for T. molitor and CP for H. illucens samples. The coefficients chitin is the main constituent of insect body able to affect the crude protein digestibility of Tenebrio molitor and Hermetia illucens larvae meals estimated by an in vitro enzymatic method.

  16. Determinación de antocianinas y valor nutricional de los tenebrios (tenebrio molitor) alimentados con dietas enriquecidas con maíz morado (Zea Mays L.)

    OpenAIRE

    Intriago Sánchez, Thalía Cerela; Valencia Burgos, Yamilet

    2014-01-01

    Purple corn traditionally been considered as a food source, nowadays known to contain large amounts of, especially natural antioxidants anthocyanins; For this reason, this paper aims to encourage the feeding of insectivorous animals by a natural food supplement based on beetle larvae (Tenebrio molitor) fed cornmeal morado.- El maíz morado ha sido considerado tradicionalmente como fuente alimenticia, hoy en día se sabe que contiene grandes cantidades de antioxidantes naturales, especialment...

  17. Development of the predator Podisus nigrispinus fed on Spodoptera frugiperda and Tenebrio molitor

    OpenAIRE

    Oliveira, Harley Nonato de; Pratissoli, Dirceu; Pedruzzi, Eder Pin; Espindula, Marcelo Curitiba

    2004-01-01

    Ninfas de Podisus nigrispinus (Heteroptera: Pentatomidae) têm sido criadas em laboratório com larvas de Tenebrio molitor L. (Coleoptera: Tenebrionidae). No entanto, não existem relatos sobre a predação, no campo ou em laboratório, de P. nigrispinus em Spodoptera frugiperda (Lepidoptera: Noctuidae), uma das principais pragas de inúmeras culturas no Brasil. Este trabalho teve o objetivo de avaliar o desenvolvimento ninfal e características reprodutivas do percevejo predador P. nigrispinus em la...

  18. Desenvolvimento do predador Podisus nigrispinus alimentado com Spodoptera frugiperda e Tenebrio molitor.

    OpenAIRE

    OLIVEIRA, H.N. de; PRATISSOLI, D.; PEDRUZZI, E.P.; ESPINDULA, M.C.

    2004-01-01

    Ninfas de Podisus nigrispinus (Heteroptera: Pentatomidae) têm sido criadas em laboratório com larvas de Tenebrio molitor L. (Coleoptera: Tenebrionidae). No entanto, não existem relatos sobre a predação, no campo ou em laboratório, de P. nigrispinus em Spodoptera frugiperda (Lepidoptera: Noctuidae), uma das principais pragas de inúmeras culturas no Brasil. Este trabalho teve o objetivo de avaliar o desenvolvimento ninfal e características reprodutivas do percevejo predador P. nigrispinus em la...

  19. Process optimization for the preparation of straw feedstuff for rearing yellow mealworms (Tenebrio molitor L.) in BLSS

    Science.gov (United States)

    Li, Leyuan; Liu, lh64. Hong

    2012-07-01

    It has been confirmed in our previous work that in bioregenerative life support systems, feeding yellow mealworms (Tenebrio molitor L.) using fermented straw has the potential to provide good animal protein for astronauts, meanwhile treating with plant wastes. However, since the nitrogen content in straw is very low, T. molitor larvae can not obtain sufficient nitrogen, which results in a relatively low growth efficiency. In this study, wheat straw powder was mixed with simulated human urine before fermentation. Condition parameters, e.g. urine:straw ratio, moisture content, inoculation dose, fermentation time, fermentation temperature and pH were optimized using Taguchi method. Larval growth rate and average individual mass of mature larva increased significantly in the group of T. molitor larvae fed with feedstuff prepared with the optimized process.

  20. Rearing Tenebrio molitor L. (Coleptera: Tenebrionidae) in the "Lunar Palace 1" during a 105-day multi-crew closed integrative BLSS experiment

    Science.gov (United States)

    Li, Leyuan; Xie, Beizhen; Dong, Chen; Hu, Dawei; Wang, Minjuan; Liu, Guanghui; Liu, Hong

    2015-11-01

    Yellow mealworm (Tenebrio molitor L.) is one of the animal candidates for space bioregenerative life support systems. In this study, T. molitor was involved in a 105-day multi-crew closed integrative BLSS experiment for a tentative rearing study. The results showed that the overall bioconversion rate (ratio of T. molitor gained to the total feed consumed) of T. molitor reared in the closed system was 8.13%, while 78.43% of the feed was excreted as frass. T. molitor reared in the closed system had a good nutritional composition. The eight essential amino acids (EAAs) in T. molitor larvae accounted for 41.30% of its total amino acids, and most EAA contents were higher than the suggested amino acid pattern recommended by the FAO/WHO. T. molitor sample obtained in this work was high in polyunsaturated fatty acids, and low in saturated fatty acids, indicating that the composition of fatty acids was beneficial to human health. In the open environment outside the experimental system, we simultaneously reared three parallel groups of larval T. molitor using the same feeding regime and temperature condition. Compared with T. molitor reared in the open environment, larvae reared in the closed system grew slower. With the course of time t, the growth rate of T. molitor in the open environment was 0.839e0.017t times that of larvae in the closed system. This paper can provide data for future design and improvement of BLSS containing a T. molitor rearing unit.

  1. Effect of Larval Density on Food Utilization Efficiency of Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Morales-Ramos, Juan A; Rojas, M Guadalupe

    2015-10-01

    Crowding conditions of larvae may have a significant impact on commercial production efficiency of some insects, such as Tenebrio molitor L. (Coleoptera: Tenebrionidae). Although larval densities are known to affect developmental time and growth in T. molitor, no reports were found on the effects of crowding on food utilization. The effect of larval density on food utilization efficiency of T. molitor larvae was studied by measuring efficiency of ingested food conversion (ECI), efficiency of digested food conversion (EDC), and mg of larval weight gain per gram of food consumed (LWGpFC) at increasing larval densities (12, 24, 36, 48, 50, 62, 74, and 96 larvae per dm(2)) over four consecutive 3-wk periods. Individual larval weight gain and food consumption were negatively impacted by larval density. Similarly, ECI, ECD, and LWGpFC were negatively impacted by larval density. Larval ageing, measured as four consecutive 3-wk periods, significantly and independently impacted ECI, ECD, and LWGpFC in a negative way. General linear model analysis showed that age had a higher impact than density on food utilization parameters of T. molitor larvae. Larval growth was determined to be responsible for the age effects, as measurements of larval mass density (in grams of larvae per dm(2)) had a significant impact on food utilization parameters across ages and density treatments (in number of larvae per dm(2)). The importance of mass versus numbers per unit of area as measurements of larval density and the implications of negative effects of density on food utilization for insect biomass production are discussed. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  2. Role of 24- and 28-hydroxylated intermediates in the metabolism of beta-sitosterol in the insect Tenebrio molitor.

    Science.gov (United States)

    Nicotra, F; Ronchetti, F; Russo, G; Toma, L

    1979-01-01

    1. [28-3H]Stigmast-5-ene-3 beta, 28-diol and [23,23,25-3H]stigmast-5-ene-3 beta, 24-diol were synthesized. 2. Each of the samples was mixed with beta-[4-14C]sitosterol and administered to Tenebrio molitor larvae. 3. The former compound is not utilized by the insect; the latter, although metabolized to 24(28)-ethylidene sterols and cholesterol, is not a beta-sitosterol metabolite. 4. The above results are discussed in relation to the mechanism of formation of the 24(28)-double bond in beta-sitosterol metabolism in T. molitor. PMID:540027

  3. Effects of some sesquiterpenes on the stored-product insect Tenebrio molitor (Coleoptera: Tenebrionidae Efectos de algunos sesquiterpenos sobre el insecto de productos almacenados, Tenebrio molitor (Coleoptera: Tenebrionidae

    Directory of Open Access Journals (Sweden)

    Matías García

    2003-12-01

    Full Text Available In order to evaluate the allelochemical activity of some sesquiterpenes isolated from the native plant Tessaria absinthioides (Hook. et Arn. DC, and some semi synthetic derivatives against Tenebrio molitor L. larvae, we have developed bioassays directed to quantify repellency, larval mortality, and its effects on the development. Although costic aldehyde caused the maximum repellent effect, all the compounds showed a significant effect at some dose or time, indicating behavioral avoidance. The topical application of costic aldehyde produced the largest increase on the duration of the pupal stage. Tessaric acid exhibited the highest toxicity by topical application at the experiment closure. Both eremophilane-1(10,2,11(13-triene-12-oic, and -costic acids induced some morphological deformities.Con el objeto de evaluar sesquiterpenos aislados de la planta nativa Tessaria absinthioides (Hook et Arn y algunos derivados semisintéticos frente a larvas de Tenebrio molitor L., se desarrollaron bioensayos orientados a la cuantificación de la repelencia, mortalidad de larvas y efectos sobre el desarrollo. Aldehído cóstico produjo el mayor incremento en la duración del estado pupal por aplicación tópica. Acido tessárico exhibió el más alto porcentaje de mortalidad al finalizar el período de experimentación. Los productos eremophilan-1(10,2, 11(13-trien-12-oico y ácido -cóstico dieron lugar al mayor número de malformaciones. Si bien aldehído cóstico mostró la máxima actividad de repelencia, todos los compuestos evaluados produjeron efectos significativos en el ensayo de elección.

  4. Complete mitochondrial genome of yellow meal worm (Tenebrio molitor).

    Science.gov (United States)

    Liu, Li-Na; Wang, Cheng-Ye

    2014-11-18

    The yellow meal worm (Tenebrio molitor L.) is an important resource insect typically used as animal feed additive. It is also widely used for biological research. The first complete mitochondrial genome of T. molitor was determined for the first time by long PCR and conserved primer walking approaches. The results showed that the entire mitogenome of T. molitor was 15 785 bp long, with 72.35% A+T content [deposited in GenBank with accession number KF418153]. The gene order and orientation were the same as the most common type suggested as ancestral for insects. Two protein-coding genes used atypical start codons (CTA in ND2 and AAT in COX1), and the remaining 11 protein-coding genes started with a typical insect initiation codon ATN. All tRNAs showed standard clover-leaf structure, except for tRNA(Ser) (AGN), which lacked a dihydrouridine (DHU) arm. The newly added T. molitor mitogenome could provide information for future studies on yellow meal worm.

  5. Tenebrio molitor (Coleoptera: Tenebrionidae) as an alternative host to study fungal infections.

    Science.gov (United States)

    de Souza, Patrícia Canteri; Morey, Alexandre Tadachi; Castanheira, Gabriel Marcondes; Bocate, Karla Paiva; Panagio, Luciano Aparecido; Ito, Fabio Augusto; Furlaneto, Márcia Cristina; Yamada-Ogatta, Sueli Fumie; Costa, Idessânia Nazareth; Mora-Montes, Hector Manuel; Almeida, Ricardo Sergio

    2015-11-01

    Models of host–pathogen interactions are crucial for the analysis of microbial pathogenesis. In this context, invertebrate hosts, including Drosophila melanogaster (fruit fly), Caenorhabditis elegans (nematode) and Galleria mellonella (moth), have been used to study the pathogenesis of fungi and bacteria. Each of these organisms offers distinct benefits in elucidating host–pathogen interactions. In this study,we present a newinvertebrate infection model to study fungal infections: the Tenebrio molitor (beetle) larvae. Here we performed T. molitor larvae infection with one of two important fungal human pathogens, Candida albicans or Cryptococcus neoformans, and analyzed survival curves and larva infected tissues.We showed that increasing concentrations of inoculum of both fungi resulted in increased mortality rates, demonstrating the efficiency of the method to evaluate the virulence of pathogenic yeasts. Additionally, following 12 h post-infection, C. albicans formsmycelia, spreading its hyphae through the larva tissue,whilst GMS stain enabled the visualization of C. neoformans yeast and theirmelanin capsule. These larvae are easier to cultivate in the laboratory than G. mellonella larvae, and offer the same benefits. Therefore, this insect model could be a useful alternative tool to screen clinical pathogenic yeast strainswith distinct virulence traits or different mutant strains.

  6. Insecticidal activity of garlic essential oil and their constituents against the mealworm beetle, Tenebrio molitor Linnaeus (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola

    2017-04-20

    This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20-40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control.

  7. A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*

    Science.gov (United States)

    Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis

    2009-01-01

    Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera. PMID:19416969

  8. A novel Tenebrio molitor cadherin is a functional receptor for Bacillus thuringiensis Cry3Aa toxin.

    Science.gov (United States)

    Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis

    2009-07-03

    Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera.

  9. A nuptially transmitted ichthyosporean symbiont of Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Lord, Jeffrey C; Hartzer, Kris L; Kambhampati, Srinivas

    2012-01-01

    The yellow mealworm, Tenebrio molitor, harbors a symbiont that has spores with a thick, laminated wall and infects the fat body and ventral nerve chord of adult and larval beetles. In adult males, there is heavy infection of the epithelial cells of the testes and between testes lobes with occasional penetration of the lobes. Spores are enveloped in the spermatophores when they are formed at the time of mating and transferred to the female's bursa copulatrix. Infection has not been found in the ovaries. The sequence of the nuclear small subunit rDNA indicates that the symbiont is a member of the Ichthyosporea, a class of protists near the animal-fungi divergence. © 2012 The Author(s) Journal of Eukaryotic Microbiology © 2012 International Society of Protistologists.

  10. The Effect of Chemical Composition and Bioactivity of Several Essential Oils on Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    Wang, Xuegui; Hao, Qiang; Chen, Yiqu; Jiang, Surong; Yang, Qunfang; Li, Qing

    2015-01-01

    The major chemical components of four essential oils (EOs) extracted from dry leaves of Citrus limonum, Cymbopogon citratus, Litsea cubeba, and Muristica fragrans were analyzed with gas chromatograph-mass spectrometer and their fumigant, contact, and repellent activities against 10th instar and adults of Tenebrio molitor were also assayed. The results indicated that the major constituents of C. limonum and Cy. citrates were D-limonene (38.22%) and 3,7-dimethyl-6-octenal (26.21%), while which of L. cubeba and M. fragrans were (E)-3, 7-dimethyl-2, 6-octadienal (49.78%) and (E)-cinnamaldehyde (79.31%), respectively. Contact activities of L. cubeba and C. limonum with LC50 values of 21.2 and 13.9 µg/cm2 at 48 h and repellence activities (>89.0% repellence indexes) (P < 0.05) at 12 h on 10th instar were better than those of the other two EOs. Nevertheless, the fumigation activities of L. cubeba on 10th instar and adults (LC50 = 2.7, 3.7 μl/liter) were stronger than those of C. limonum (LC50 = 10.9, 12.0 μl/liter) at 96 h and significant (not overlapping confidence intervals). The EOs of L. cubeba and C. limonum have clearly elongated the growth and development of larvae, egg, and slightly shorten pupae and adults of T. molitor compared with the control. The mainly active ingredients of L. cubeba and C. limonum, including D-limonene and β-pinene, were demonstrated to coinhibit the actives of AChE and enhance the toxicities on 10th instar of T. molitor. These results indicate that the EOs of L. cubeba and C. limonum could have great potential as botanical insecticides against T. molitor. PMID:26254287

  11. Rearing Tenebrio molitor L. (Coleptera: Tenebrionidae) in the "Lunar Palace 1" during a 105-day multi-crew closed integrative BLSS experiment.

    Science.gov (United States)

    Li, Leyuan; Xie, Beizhen; Dong, Chen; Hu, Dawei; Wang, Minjuan; Liu, Guanghui; Liu, Hong

    2015-11-01

    Yellow mealworm (Tenebrio molitor L.) is one of the animal candidates for space bioregenerative life support systems. In this study, T. molitor was involved in a 105-day multi-crew closed integrative BLSS experiment for a tentative rearing study. The results showed that the overall bioconversion rate (ratio of T. molitor gained to the total feed consumed) of T. molitor reared in the closed system was 8.13%, while 78.43% of the feed was excreted as frass. T. molitor reared in the closed system had a good nutritional composition. The eight essential amino acids (EAAs) in T. molitor larvae accounted for 41.30% of its total amino acids, and most EAA contents were higher than the suggested amino acid pattern recommended by the FAO/WHO. T. molitor sample obtained in this work was high in polyunsaturated fatty acids, and low in saturated fatty acids, indicating that the composition of fatty acids was beneficial to human health. In the open environment outside the experimental system, we simultaneously reared three parallel groups of larval T. molitor using the same feeding regime and temperature condition. Compared with T. molitor reared in the open environment, larvae reared in the closed system grew slower. With the course of time t, the growth rate of T. molitor in the open environment was 0.839e(0.017t) times that of larvae in the closed system. This paper can provide data for future design and improvement of BLSS containing a T. molitor rearing unit. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.

  12. Novel direct factor Xa inhibitory compounds from Tenebrio molitor with anti-platelet aggregation activity.

    Science.gov (United States)

    Lee, Wonhwa; Kim, Mi-Ae; Park, InWha; Hwang, Jae Sam; Na, MinKyun; Bae, Jong-Sup

    2017-11-01

    Tenebrio molitor is an edible insect that has antimicrobial, anticancer, and antihypertensive effects. The aim of this study was to identify the unreported bioactive compounds from T. molitor larvae with inhibitory activities against factor Xa (FXa) and platelet aggregation. Isolated compounds were evaluated for their anti-FXa and anti-platelet aggregation properties by monitoring clotting time, platelet aggregation, FXa activity, and thrombus formation. A diketopiperazine (1, cyclo(L-Pro-L-Tyr)) and a phenylethanoid (2, N-acetyltyramine) were isolated and inhibited the catalytic activity of FXa in a mixed inhibition model and inhibited platelet aggregation induced by adenosine diphosphate (ADP) and U46619. They inhibited ADP- and U46619-induced phosphorylation of myristoylated alanine-rich C kinase substrate (MARCKS) and the expression of P-selectin and PAC-1 in platelets. They also improved the production of nitric oxide and inhibited the oversecretion of endothelin-1 compared to that of the ADP- or U46619-treated group. In an animal model of arterial and pulmonary thrombosis, the isolated compounds showed enhanced antithrombotic effects. They also elicited anticoagulant effects in mice. Compounds 1-2 inhibited ADP-, collagen-, or U46619-induced platelet aggregation and showed similar anti-thrombotic efficacy to rivaroxaban, a positive control. Therefore, 1-2 could serve as candidates and provide scaffolds for the development of new anti-FXa and anti-platelet drugs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Parasitization by Scleroderma guani influences expression of superoxide dismutase genes in Tenebrio molitor.

    Science.gov (United States)

    Zhu, Jia-Ying; Ze, Sang-Zi; Stanley, David W; Yang, Bin

    2014-09-01

    Superoxide dismutase (SOD) is an antioxidant enzyme involved in detoxifying reactive oxygen species. In this study, we identified genes encoding the extracellular and intracellular copper-zinc SODs (ecCuZnSOD and icCuZnSOD) and a manganese SOD (MnSOD) in the yellow mealworm beetle, Tenebrio molitor. The cDNAs for ecCuZnSOD, icCuZnSOD, and MnSOD, respectively, encode 24.55, 15.81, and 23.14 kDa polypeptides, which possess structural features typical of other insect SODs. They showed 20-94% identity to other known SOD sequences from Bombyx mori, Musca domestica, Nasonia vitripennis, Pediculus humanus corporis, and Tribolium castaneum. Expression of these genes was analyzed in selected tissues and developmental stages, and following exposure to Escherichia coli and parasitization by Scleroderma guani. We recorded expression of all three SODs in cuticle, fat body, and hemocytes and in the major developmental stages. Relatively higher expressions were detected in late-instar larvae and pupae, compared to other developmental stages. Transcriptional levels were upregulated following bacterial infection. Analysis of pupae parasitized by S. guani revealed that expression of T. molitor SOD genes was significantly induced following parasitization. We infer that these genes act in immune response and in host-parasitoid interactions. © 2014 Wiley Periodicals, Inc.

  14. Microbial counts of mealworm larvae (Tenebrio molitor) and crickets (Acheta domesticus and Gryllodes sigillatus) from different rearing companies and different production batches.

    Science.gov (United States)

    Vandeweyer, D; Crauwels, S; Lievens, B; Van Campenhout, L

    2017-02-02

    The rising interest in insects for human consumption and the changing regulations in Europe require a profound insight into the food safety of insects reared and sold in Western society. The microbial quality of edible insects has only been studied occasionally. This study aimed at generating an overview of intrinsic parameters (pH, water activity and moisture content) and microbial quality of fresh mealworm larvae and crickets for several rearing companies and for several batches per rearer. In total, 21 batches obtained from 7 rearing companies were subjected to analysis of intrinsic parameters, a range of plate counts and presence-absence tests for Salmonella spp. and Listeria monocytogenes. The microbial counts of the fresh insects were generally high. Different rearing batches from a single rearing company showed differences in microbial counts which could not be explained by variations in intrinsic properties. The largest variations were found in numbers of bacterial endospores, psychrotrophs and fungi. Salmonella spp. and L. monocytogenes were not detected in any of the samples. Altogether, our study shows that large variations were found between batches from individual rearers. As a consequence, no overall differences between rearers could be observed. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Bacillus thuringiensis Cry3Aa protoxin intoxication of Tenebrio molitor induces widespread changes in the expression of serine peptidase transcripts.

    Science.gov (United States)

    Oppert, Brenda; Martynov, Alexander G; Elpidina, Elena N

    2012-09-01

    The yellow mealworm, Tenebrio molitor, is a pest of stored grain products and is sensitive to the Bacillus thuringiensis (Bt) Cry3Aa toxin. As digestive peptidases are a determining factor in Cry toxicity and resistance, we evaluated the expression of peptidase transcripts in the midgut of T. molitor larvae fed either a control or Cry3Aa protoxin diet for 24 h (RNA-Seq), or in larvae exposed to the protoxin for 6, 12, or 24 h (microarrays). Cysteine peptidase transcripts (9) were similar to cathepsins B, L, and K, and their expression did not vary more than 2.5-fold in control and Cry3Aa-treated larvae. Serine peptidase transcripts (48) included trypsin, chymotrypsin and chymotrypsin-like, elastase 1-like, and unclassified serine peptidases, as well as homologs lacking functional amino acids. Highly expressed trypsin and chymotrypsin transcripts were severely repressed, and most serine peptidase transcripts were expressed 2- to 15-fold lower in Cry3Aa-treated larvae. Many serine peptidase and homolog transcripts were found only in control larvae. However, expression of a few serine peptidase transcripts was increased or found only in Cry3Aa-treated larvae. Therefore, Bt intoxication significantly impacted the expression of serine peptidases, potentially important in protoxin processing, while the insect maintained the production of critical digestive cysteine peptidases. Published by Elsevier Inc.

  16. Ganancia de peso del depredador Podisus distinctus (Heteroptera: Pentatomidae en combinaciones de las presas Tenebrio molitor (Coleoptera: Tenebrionidae y Musca domestica (Diptera: Muscidae

    Directory of Open Access Journals (Sweden)

    Fausto da Costa Matos Neto

    2004-03-01

    Full Text Available Entre las ninfas de los asopíneos usados para el control de gusanos desfoliadores en plantaciones de eucalipto, Podisus distinctus (Stal (Heteroptera: Pentatomidae representa un potencial agente de control biológico, sin embargo esta especie ha sido poco estudiada. El presente trabajo evaluó el efecto de las diferentes combinaciones de las presas Musca domestica L. (Diptera: Muscidae y Tenebrio molitor L. (Coleoptera: Tenebrionidae sobre el peso de ninfas de P. distinctus. El experimento se realizó en laboratorio do "Instituto de Biotecnologia Aplicada à Agropecuaria (BIOAGRO", a 25 ± 0.5ºC, 60 ± 10% de humedad relativa y 14 horas de fotoperiodo. Las ninfas de P. distinctus fueron individualizadas en cajas de Petri y alimentadas de acuerdo con los siguientes tratamientos: T1- larvas de M. domestica durante toda la fase ninfal; T2- larvas de M. domestica en el II estadio y de T. molitor en los III, IV y V estadios; T3- larvas de M. domestica en el II y III estadios y de T. molitor en los IV y V estadios; T4- larvas de M. domestica en el II, III y IV estadios y de T. molitor en el V estadio; T5- larvas de T. molitor en todos los estadios. Los mejores resultados de peso y ganancia de peso fueron encontrados cuando P. distinctus fue alimentado alternadamente con larvas de M. domestica y T. molitor. Cuando esse depredador fue solamente alimentado con larvas de M. domestica, presentó pesos menoresLitlle is known about Podisus distinctus (Stal (Heteroptera: Pentatomidae one of the Asopinae species with good possibilities for mass rearing and releasing against defoliator caterpillars in eucalyptus reforested areas in Brazil. We evaluated the impact of prey combinations on weight of nymphs and adults of P. distinctus. The prey were Musca domestica L. (Diptera: Muscidae and Tenebrio molitor L. (Coleoptera: Tenebrionidae. The experiment was developed under 25 ± 0.5ºC, 60 ± 10% R.H. and photophase of 14 hr, with nymphs of P. distinctus

  17. Impact of Adult Weight, Density, and Age on Reproduction of Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    The impact of adult weight, age, and density on reproduction of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied. The impact of adult weight on reproduction was determined in two ways: 1) counting the daily progeny of individual adult pairs of known weight and analyzing the data with line...

  18. Protein identification and in vitro digestion of fractions from Tenebrio molitor

    NARCIS (Netherlands)

    Yi, Liya; Boekel, van M.A.J.S.; Boeren, Sjef; Lakemond, Catriona M.M.

    2016-01-01

    The nutritional value of insect protein is evaluated not only in amino acid composition, but also in protein digestibility. The general amino acid composition of Tenebrio molitor has been reported before, but limited knowledge is available on its digestibility. The objective of this study was to

  19. Uptake of Cadmium, Lead and Arsenic by Tenebrio molitor and Hermetia illucens from Contaminated Substrates.

    Science.gov (United States)

    van der Fels-Klerx, H J; Camenzuli, L; van der Lee, M K; Oonincx, D G A B

    2016-01-01

    Insects have potential as a novel source of protein in feed and food production in Europe, provided they can be used safely. To date, limited information is available on the safety of insects, and toxic elements are one of the potential hazards of concern. Therefore, we aimed to investigate the potential accumulation of cadmium, lead and arsenic in larvae of two insect species, Tenebrio molitor (yellow mealworm) and Hermetia illucens (black soldier fly), which seem to hold potential as a source of food or feed. An experiment was designed with 14 treatments, each in triplicate, per insect species. Twelve treatments used feed that was spiked with cadmium, lead or arsenic at 0.5, 1 and 2 times the respective maximum allowable levels (ML) in complete feed, as established by the European Commission (EC). Two of the 14 treatments consisted of controls, using non-spiked feed. All insects per container (replicate) were harvested when the first larva in that container had completed its larval stage. Development time, survival rates and fresh weights were similar over all treatments, except for development time and total live weight of the half of the maximum limit treatment for cadmium of the black soldier fly. Bioaccumulation (bioaccumulation factor > 1) was seen in all treatments (including two controls) for lead and cadmium in black soldier fly larvae, and for the three arsenic treatments in the yellow mealworm larvae. In the three cadmium treatments, concentrations of cadmium in black soldier fly larvae are higher than the current EC maximum limit for feed materials. The same was seen for the 1.0 and 2.0 ML treatments of arsenic in the yellow mealworm larvae. From this study, it can be concluded that if insects are used as feed materials, the maximum limits of these elements in complete feed should be revised per insect species.

  20. Cloning, characterization and effect of TmPGRP-LE gene silencing on survival of Tenebrio molitor against Listeria monocytogenes infection.

    Science.gov (United States)

    Tindwa, Hamisi; Patnaik, Bharat Bhusan; Kim, Dong Hyun; Mun, Seulgi; Jo, Yong Hun; Lee, Bok Luel; Lee, Yong Seok; Kim, Nam Jung; Han, Yeon Soo

    2013-11-14

    Peptidoglycan recognition proteins (PGRPs) are a family of innate immune molecules that recognize bacterial peptidoglycan. PGRP-LE, a member of the PGRP family, selectively binds to diaminopimelic acid (DAP)-type peptidoglycan to activate both the immune deficiency (Imd) and proPhenoloxidase (proPO) pathways in insects. A PGRP-LE-dependent induction of autophagy to control Listeria monocytogenes has also been reported. We identified and partially characterized a novel PGRP-LE homologue, from Tenebrio molitor and analyzed its functional role in the survival of the insect against infection by a DAP-type PGN containing intracellular pathogen, L. monocytogenes. The cDNA is comprised of an open reading frame (ORF) of 990 bp and encodes a polypeptide of 329 residues. TmPGRP-LE contains one PGRP domain, but lacks critical residues for amidase activity. Quantitative RT-PCR analysis showed a broad constitutive expression of the transcript at various stages of development spanning from larva to adult. RNAi mediated knockdown of the transcripts, followed by a challenge with L. monocytogenes, showed a significant reduction in survival rate of the larvae, suggesting a putative role of TmPGRP-LE in sensing and control of L. monocytogenes infection in T. molitor. These results implicate PGRP-LE as a defense protein necessary for survival of T. molitor against infection by L. monocytogenes.

  1. Cloning, Characterization and Effect of TmPGRP-LE Gene Silencing on Survival of Tenebrio Molitor against Listeria monocytogenes Infection

    Directory of Open Access Journals (Sweden)

    Yeon Soo Han

    2013-11-01

    Full Text Available Peptidoglycan recognition proteins (PGRPs are a family of innate immune molecules that recognize bacterial peptidoglycan. PGRP-LE, a member of the PGRP family, selectively binds to diaminopimelic acid (DAP-type peptidoglycan to activate both the immune deficiency (Imd and proPhenoloxidase (proPO pathways in insects. A PGRP-LE-dependent induction of autophagy to control Listeria monocytogenes has also been reported. We identified and partially characterized a novel PGRP-LE homologue, from Tenebrio molitor and analyzed its functional role in the survival of the insect against infection by a DAP-type PGN containing intracellular pathogen, L. monocytogenes. The cDNA is comprised of an open reading frame (ORF of 990 bp and encodes a polypeptide of 329 residues. TmPGRP-LE contains one PGRP domain, but lacks critical residues for amidase activity. Quantitative RT-PCR analysis showed a broad constitutive expression of the transcript at various stages of development spanning from larva to adult. RNAi mediated knockdown of the transcripts, followed by a challenge with L. monocytogenes, showed a significant reduction in survival rate of the larvae, suggesting a putative role of TmPGRP-LE in sensing and control of L. monocytogenes infection in T. molitor. These results implicate PGRP-LE as a defense protein necessary for survival of T. molitor against infection by L. monocytogenes.

  2. Differences in critical thermal maxima and mortality across life stages of the mealworm beetle Tenebrio molitor.

    Science.gov (United States)

    Vorhees, Ashley S; Bradley, Timothy J

    2012-07-01

    Thermal limits to activity profoundly affect the abundance and distribution of ectothermic animals. Upper thermal limits to activity are typically reported as the critical thermal maximum (CT(max)), the temperature at which activity becomes uncontrolled. Thermolimit respirometry is a new technique that allows CT(max) to be quantified in small animals, such as insects, as the point of spiracular failure by measuring CO(2) release from the animal as temperature increases. Although prior studies have reported a characteristic pattern of CO(2) release for insects during thermolimit respirometry trials, no studies have been carried out to determine the universality of this pattern across development, or at what point death occurs along this pattern. Here, we compared the CT(max) and patterns of CO(2) release among three life stages of a beetle species, Tenebrio molitor, and mapped heat death onto these patterns. Our study is the first to report distinct patterns of CO(2) release in different life stages of an insect species during thermolimit respirometry. Our results show that CT(max) was significantly higher in adult beetles than in either larvae or pupae (P<0.001) and, similarly, death occurred at higher temperatures in adults than in larvae and pupae. We also found that death during heating closely follows CT(max) in these animals, which confirms that measuring the loss of spiracular control with thermolimit respirometry successfully identifies the point of physiological limitation during heat stress.

  3. Is there a relationship between insect metabolic rate and mortality of mealworms Tenebrio molitor L. after insecticide exposure?

    OpenAIRE

    Justyna MALISZEWSKA; Eugenia TĘGOWSKA

    2016-01-01

    Pesticides are known to affect insects metabolic rate and CO2 release patterns. In the presented paper metabolic rate and mortality of mealworms Tenebrio molitor L. exposed to four different insecticides was evaluated, to find out whether there is a relationship between mealworms sensitivity to pesticides and their metabolic rate. Tenebrio molitor mortality was determined after intoxication with pyrethroid, oxadiazine, neonicotinoid and organophosphate. Metabolic rate before and after intoxic...

  4. Genetic and phenotypic relationships between immune defense, melanism and life-history traits at different temperatures and sexes in Tenebrio molitor

    National Research Council Canada - National Science Library

    Prokkola, J; Roff, D; Kärkkäinen, T; Krams, I; Rantala, M J

    2013-01-01

    .... In this study, the phenotypic and genetic relationships between cuticular melanization, innate immune defense, individual development time and body size were studied in the mealworm beetle (Tenebrio molitor...

  5. Dietary fatty acids influence the growth and fatty acid composition of the yellow mealworm Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Dreassi, Elena; Cito, Annarita; Zanfini, Assunta; Materozzi, Lara; Botta, Maurizio; Francardi, Valeria

    2017-03-01

    Fat is the second most abundant component of the nutrient composition of the mealworm Tenebrio molitor (Coleoptera: Tenebrionidae) that represents also an interesting source of PUFA, especially n-6 and n-3 fatty acids, involved in prevention of cardiovascular diseases. This study investigated the possibility of modifying the fat content and the FA composition of yellow mealworms through feeding and how this would be influenced by developmental stages, pupal sex, and generation with the future aim of applying this coleopteran as a diet supplement for human health. Growth rate and cumulative mortality percentage on the different feeding substrates were also evaluated to select the optimal conditions for a mass-raising of this insect species. Despite the different fat content in the six different breeding substrates used, T. molitor larvae and pupae contained a constant fat percentage (>34% in larvae and >30% in pupae). A similar total fat content was found comparing larvae and male and female pupae of the second generation to those of the first generation. On the contrary, FA composition differed both in larvae and pupae reared on the different feeding substrates. However, the exemplars reared on the diets based on 100% bread and 100% oat flour showed SFA, PUFA percentages, and an n-6/n-3 ratio more suitable for human consumption; the diet based on beer yeast, wheat flour, and oat flour resulted in a contemporary diet that most satisfied the balance between a fat composition of high quality and favorable growth conditions.

  6. Nitrogen-to-Protein Conversion Factors for Three Edible Insects: Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens.

    Science.gov (United States)

    Janssen, Renske H; Vincken, Jean-Paul; van den Broek, Lambertus A M; Fogliano, Vincenzo; Lakemond, Catriona M M

    2017-03-22

    Insects are considered a nutritionally valuable source of alternative proteins, and their efficient protein extraction is a prerequisite for large-scale use. The protein content is usually calculated from total nitrogen using the nitrogen-to-protein conversion factor (Kp) of 6.25. This factor overestimates the protein content, due to the presence of nonprotein nitrogen in insects. In this paper, a specific Kp of 4.76 ± 0.09 was calculated for larvae from Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens, using amino acid analysis. After protein extraction and purification, a Kp factor of 5.60 ± 0.39 was found for the larvae of three insect species studied. We propose to adopt these Kp values for determining protein content of insects to avoid overestimation of the protein content.

  7. Welfare of the mealworm (Tenebrio molitor breeding with regard to nutrition value and food safety

    Directory of Open Access Journals (Sweden)

    Anna Adámková

    2017-01-01

    Full Text Available Livestock welfare is an important condition for obtaining high-quality and safe food. According to the legislation edible insects are classified as livestock; and for this reason it is necessary to comply with the edible insect welfare conditions. This article focuses on selected welfare conditions for mealworm (Tenebrio molitor breeding, with special focus on the fat content influenced by different breeding temperature (17 °C, 23 °C and 28 °C. Maximum fat content 24.56% was observed at 23 °C. To obtain maximum fat content this appears to be the optimal breeding temperature. Another evaluated aspect was the nutritional stress and a way of killing, and their impact on fat content, which showed to decrease with the nutrient stress. The most decline was detected towards the end of the observation period. The analysis showed that in terms of preservation of the fat content, the best way is killing by freezing, due to the metabolism slowdown. We also analysed the content of heavy metals in a mealworm larvae using cyclic voltammetry with subsequent evaluation. In the measured sample concentrations of heavy metals did not exceed the maximum allowable concentration of heavy metals in this commodity. From this point of view mealworm appears to be a safe food.

  8. A new biological recovery approach for PHA using mealworm, Tenebrio molitor.

    Science.gov (United States)

    Murugan, Paramasivam; Han, Lizhu; Gan, Chee-Yuen; Maurer, Frans H J; Sudesh, Kumar

    2016-12-10

    Bacterial polyhydroxyalkanoates (PHA) are expensive partly due to the recovery and purification processes. Thus, many studies have been carried out in order to minimize the cost. Here we report on the use of mealworm, which is the larva of mealworm beetle (Tenebrio molitor) to recover PHA granules from Cupriavidus necator. Mealworms were shown to readily consume the freeze-dried C. necator cells and excrete the PHA granules in the form of whitish feces. Further purification using water, detergent and heat resulted in almost 100% pure PHA granules. Comparison with chloroform extraction showed no signs of reduction in the molecular weight and dispersion of the PHA molecules. Scanning electron microscopy and dynamic light scattering measurements revealed that the biologically recovered PHA granules retained their native spherical morphology. The PHA granules were subjected to a battery of tests to determine their purity and properties in comparison to the chloroform extracted PHA. This study has demonstrated the possibility of using mealworms as a biological agent to partially purify the PHA granules. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Feasibility of feeding yellow mealworm (Tenebrio molitor L.) in bioregenerative life support systems as a source of animal protein for humans

    Science.gov (United States)

    Li, LeYuan; Zhao, ZhiRuo; Liu, Hong

    2013-11-01

    In bioregenerative life support systems, using inedible plant biomass to feed animals can provide animal protein for astronauts, while at the same time treating with wastes so as to increase the degree of system closure. In this study, the potential of yellow mealworms (Tenebrio molitor L.) as an animal candidate in the system was analyzed. The feasibility of feeding T. molitor with inedible parts of wheat and vegetable was studied. To improve the feed quality of wheat straw, three methods of fermentation were tested. A feeding regime was designed to contain a proper proportion of bran, straw and old leaves. The results showed that T. molitor larvae fed on the plant waste diets grew healthily, their fresh and dry weight reached 56.15% and 46.76% of the larvae fed on a conventional diet (control), respectively. The economic coefficient of the larvae was 16.07%, which was 88.05% of the control. The protein and fat contents of the larvae were 76.14% and 6.44% on dry weigh basis, respectively. Through the processes of facultative anaerobic fermentation and larval consumption, the straw lost about 47.79% of the initial dry weight, and its lignocellulose had a degradation of about 45.74%. Wheat germination test indicated that the frass of T. molitor needs a certain treatment before the addition to the cultivation substrate.

  10. A Tenebrio molitor GPI-anchored alkaline phosphatase is involved in binding of Bacillus thuringiensis Cry3Aa to brush border membrane vesicles.

    Science.gov (United States)

    Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Bravo, Alejandra; Soberón, Mario

    2013-03-01

    Bacillus thuringiensis Cry toxins recognizes their target cells in part by the binding to glycosyl-phosphatidyl-inositol (GPI) anchored proteins such as aminopeptidase-N (APN) or alkaline phosphatases (ALP). Treatment of Tenebrio molitor brush border membrane vesicles (BBMV) with phospholipase C that cleaves out GPI-anchored proteins from the membranes, showed that GPI-anchored proteins are involved in binding of Cry3Aa toxin to BBMV. A 68 kDa GPI-anchored ALP was shown to bind Cry3Aa by toxin overlay assays. The 68 kDa GPI-anchored ALP was preferentially expressed in early instar larvae in comparison to late instar larvae. Our work shows for the first time that GPI-anchored ALP is important for Cry3Aa binding to T. molitor BBMV suggesting that the mode of action of Cry toxins is conserved in different insect orders. Copyright © 2012 Elsevier Inc. All rights reserved.

  11. Molecular cloning, sequence characterization and expression analysis of a CD63 homologue from the coleopteran beetle, Tenebrio molitor.

    Science.gov (United States)

    Patnaik, Bharat Bhusan; Kang, Seong Min; Seo, Gi Won; Lee, Hyo Jeong; Patnaik, Hongray Howrelia; Jo, Yong Hun; Tindwa, Hamisi; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung; Bang, In Seok; Han, Yeon Soo

    2013-10-15

    CD63, a member of the tetraspanin membrane protein family, plays a pivotal role in cell growth, motility, signal transduction, host-pathogen interactions and cancer. In this work, the cDNA encoding CD63 homologue (TmCD63) was cloned from larvae of a coleopteran beetle, Tenebrio molitor. The cDNA is comprised of an open reading frame of 705 bp, encoding putative protein of 235 amino acid residues. In silico analysis shows that the protein has four putative transmembrane domains and one large extracellular loop. The characteristic "Cys-Cys-Gly" motif and "Cys188" residues are highly conserved in the large extracellular loop. Phylogenetic analysis of TmCD63 revealed that they belong to the insect cluster with 50%-56% identity. Analysis of spatial expression patterns demonstrated that TmCD63 mRNA is mainly expressed in gut and Malphigian tubules of larvae and the testis of the adult. Developmental expression patterns of CD63 mRNA showed that TmCD63 transcripts are detected in late larval, pupal and adult stages. Interestingly, TmCD63 transcripts are upregulated to the maximum level of 4.5 fold, in response to DAP-type peptidoglycan during the first 6 h, although other immune elicitors also caused significant increase to the transcript level at later time-points. These results suggest that CD63 might contribute to T. molitor immune response against various microbial pathogens.

  12. Molecular Cloning, Sequence Characterization and Expression Analysis of a CD63 Homologue from the Coleopteran Beetle, Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Yeon Soo Han

    2013-10-01

    Full Text Available CD63, a member of the tetraspanin membrane protein family, plays a pivotal role in cell growth, motility, signal transduction, host-pathogen interactions and cancer. In this work, the cDNA encoding CD63 homologue (TmCD63 was cloned from larvae of a coleopteran beetle, Tenebrio molitor. The cDNA is comprised of an open reading frame of 705 bp, encoding putative protein of 235 amino acid residues. In silico analysis shows that the protein has four putative transmembrane domains and one large extracellular loop. The characteristic “Cys-Cys-Gly” motif and “Cys188” residues are highly conserved in the large extracellular loop. Phylogenetic analysis of TmCD63 revealed that they belong to the insect cluster with 50%–56% identity. Analysis of spatial expression patterns demonstrated that TmCD63 mRNA is mainly expressed in gut and Malphigian tubules of larvae and the testis of the adult. Developmental expression patterns of CD63 mRNA showed that TmCD63 transcripts are detected in late larval, pupal and adult stages. Interestingly, TmCD63 transcripts are upregulated to the maximum level of 4.5 fold, in response to DAP-type peptidoglycan during the first 6 h, although other immune elicitors also caused significant increase to the transcript level at later time-points. These results suggest that CD63 might contribute to T. molitor immune response against various microbial pathogens.

  13. Potential of Tenebrio molitor (Coleoptera: Tenebrionidae) as a bioassay probe for Metarhizium brunneum (Hypocreales: Clavicipitaceae) activity against Ixodes scapularis (Acari: Ixodidae).

    Science.gov (United States)

    Bharadwaj, Anuja; Stafford, Kirby C

    2011-12-01

    The yellow mealworm, Tenebrio molitor L., has been used to indicate qualitatively the presence of entomopathogenic fungi in the soil or as a model for evaluating stress and other factors on fungal activity. Although this beetle appears highly susceptible to many of these fungi, little quantitative information is available on the sensitivity of T. molitor to a specific fungus and, therefore, fungal presence or as an indicator for pathogenicity to other species. The purpose of this study was to establish the suitability of T. molitor larvae as a bioassay probe for Metarhizium brunneum for comparison against the blacklegged tick, Ixodes scapularis. Nine concentrations of M. brunneum strain F52 ranging from 1.0 x 10(1) to 8.4 x 10(8) conidial/ml were simultaneously tested against T. molitor larvae and I. scapularis adults. Larvae of yellow mealworm were less sensitive to M. brunneum than I. scapularis adults (LC50's 4.4 x 10(7) and 1.7 x 10(5) conidia/ml, respectively, 4-wk post-treatment). The greater sensitivity of I. scapularis to the fungus suggests that the detection of fungal mycosis in mealworms would indicate sufficient inoculum to be pathogenic to I. scapularis and make this insect a suitable probe for evaluation of the presence and activity of M. brunneum against the blacklegged tick in field applications.

  14. The 3D structure and function of digestive cathepsin L-like proteinases of Tenebrio molitor larval midgut.

    Science.gov (United States)

    Beton, Daniela; Guzzo, Cristiane R; Ribeiro, Alberto F; Farah, Chuck S; Terra, Walter R

    2012-09-01

    Cathepsin L-like proteinases (CAL) are major digestive proteinases in the beetle Tenebrio molitor. Procathepsin Ls 2 (pCAL2) and 3 (pCAL3) were expressed as recombinant proteins in Escherichia coli, purified and activated under acidic conditions. Immunoblot analyses of different T. molitor larval tissues demonstrated that a polyclonal antibody to pCAL3 recognized pCAL3 and cathepsin L 3 (CAL3) only in the anterior two-thirds of midgut tissue and midgut luminal contents of T. molitor larvae. Furthermore, immunocytolocalization data indicated that pCAL3 occurs in secretory vesicles and microvilli in anterior midgut. Therefore CAL3, like cathepsin L 2 (CAL2), is a digestive enzyme secreted by T. molitor anterior midgut. CAL3 hydrolyses Z-FR-MCA and Z-RR-MCA (typical cathepsin substrates), whereas CAL2 hydrolyses only Z-FR-MCA. Active site mutants (pCAL2C25S and pCAL3C26S) were constructed by replacing the catalytic cysteine with serine to prevent autocatalytic processing. Recombinant pCAL2 and pCAL3 mutants (pCAL2C25S and pCAL3C26S) were prepared, crystallized and their 3D structures determined at 1.85 and 2.1 Å, respectively. While the overall structure of these enzymes is similar to other members of the papain superfamily, structural differences in the S2 subsite explain their substrate specificities. The data also supported models for CAL trafficking to lysosomes and to secretory vesicles to be discharged into midgut contents. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Nutritional valuse of edible coleoptera (Tenebrio molitor, Zophobas morio and Alphitobius diaperinus reared reared in the Czech Republic

    Directory of Open Access Journals (Sweden)

    Anna Adámková

    2016-12-01

    Full Text Available Edible insects have gained the status of highly nutritious food with high protein and fat content. However, nutritional value of insects is not constant. It could be affected by species, developmental stage, rearing technology, nutrition or sex. This study's goal is to determine the protein and fat contents of three edible beetle species (giant mealworm - larvae of Zophobas morio, mealworm - larvae of Tenebrio molitor and, lesser mealworm - larvae of Alphitobius diaperinus bred in the Czech Republic. Based on the obtained results, all investigated species could be considered as a reasonable source of lipids and two of them (mealworm and lesser mealworm are also an excellent source of protein. Crude protein content of mealworm (630 g. kg-1 DM was found to be higher than in other studies. The investigated species of lesser mealworm contained 600 g of crude protein/kg DM, which was equal to the results of other authors. Most authors report a higher content of nitrogen in the giant mealworm than were the values measured by this experiment (390 g.kg-1 DM. The lipid content in the tested samples was found in a range of 170 - 390 g.kg-1 DM. The highest lipid content was found in the larvae of giant mealworm and the lowest lipid content was found in the larvae of mealworm. The determined fat content of lesser mealworms was 290 g.kg-1. The fatty acid profiles of all samples were also determined.

  16. The introduction of yellow mealworm (Tenebrio Molitor L.) into BLSS as a source of animal protein for humans: experiments and modeling

    Science.gov (United States)

    Li, Leyuan; Liu, lh64. Hong; Ruo Zhao, Zhi

    2012-07-01

    In bioregenerative life support systems, using inedible plant biomass to feed animals can provide animal protein for astronauts, while at the same time treating with wastes so as to increase the degree of system closure and the efficiency of material cycling. In this study, an analysis and demonstration on the potential of yellow mealworms (Tenebrio molitor L.) as an animal candidate in the system was presented. The feasibility of feeding T. molitor with inedible parts of wheat and vegetables was studied. Moreover, a process for straw fermentation was selected. T. molitor was fed on wheat bran for the first 10 days, and then gradually, fermented straw was added. Old leaves of Chinese cabbage were used as supplementary feedstuff. The results showed that T. molitor larvae fed on this diet survived and grew normally, their fresh and dry weight achieved 56.15% and 46.76% of the larvae fed on a conventional diet, respectively. The bioconversion rate of the larvae was 16.07%, which was 88.05% of the conventional diet group. The protein and fat contents were 76.14% and 6.44% on dry weigh, respectively. Through the processes of anaerobic fermentation and mealworm consumption, the straw lost about 47.79% of the initial dry weight, and its lignocellulose had a degradation of about 45.74%. Wheat germination test indicated that the frass of T. molitor has the potential to be utilized as plant cultivation substrate after certain treatment. Stoichiometric modeling of BLSS containing T. molitor was also conducted.

  17. Transcriptomic immune response of Tenebrio molitor pupae to parasitization by Scleroderma guani.

    Directory of Open Access Journals (Sweden)

    Jia-Ying Zhu

    Full Text Available BACKGROUND: Host and parasitoid interaction is one of the most fascinating relationships of insects, which is currently receiving an increasing interest. Understanding the mechanisms evolved by the parasitoids to evade or suppress the host immune system is important for dissecting this interaction, while it was still poorly known. In order to gain insight into the immune response of Tenebrio molitor to parasitization by Scleroderma guani, the transcriptome of T. molitor pupae was sequenced with focus on immune-related gene, and the non-parasitized and parasitized T. molitor pupae were analyzed by digital gene expression (DGE analysis with special emphasis on parasitoid-induced immune-related genes using Illumina sequencing. METHODOLOGY/PRINCIPAL FINDINGS: In a single run, 264,698 raw reads were obtained. De novo assembly generated 71,514 unigenes with mean length of 424 bp. Of those unigenes, 37,373 (52.26% showed similarity to the known proteins in the NCBI nr database. Via analysis of the transcriptome data in depth, 430 unigenes related to immunity were identified. DGE analysis revealed that parasitization by S. guani had considerable impacts on the transcriptome profile of T. molitor pupae, as indicated by the significant up- or down-regulation of 3,431 parasitism-responsive transcripts. The expression of a total of 74 unigenes involved in immune response of T. molitor was significantly altered after parasitization. CONCLUSIONS/SIGNIFICANCE: obtained T. molitor transcriptome, in addition to establishing a fundamental resource for further research on functional genomics, has allowed the discovery of a large group of immune genes that might provide a meaningful framework to better understand the immune response in this species and other beetles. The DGE profiling data provides comprehensive T. molitor immune gene expression information at the transcriptional level following parasitization, and sheds valuable light on the molecular

  18. Transcriptomic immune response of Tenebrio molitor pupae to parasitization by Scleroderma guani.

    Science.gov (United States)

    Zhu, Jia-Ying; Yang, Pu; Zhang, Zhong; Wu, Guo-Xing; Yang, Bin

    2013-01-01

    Host and parasitoid interaction is one of the most fascinating relationships of insects, which is currently receiving an increasing interest. Understanding the mechanisms evolved by the parasitoids to evade or suppress the host immune system is important for dissecting this interaction, while it was still poorly known. In order to gain insight into the immune response of Tenebrio molitor to parasitization by Scleroderma guani, the transcriptome of T. molitor pupae was sequenced with focus on immune-related gene, and the non-parasitized and parasitized T. molitor pupae were analyzed by digital gene expression (DGE) analysis with special emphasis on parasitoid-induced immune-related genes using Illumina sequencing. In a single run, 264,698 raw reads were obtained. De novo assembly generated 71,514 unigenes with mean length of 424 bp. Of those unigenes, 37,373 (52.26%) showed similarity to the known proteins in the NCBI nr database. Via analysis of the transcriptome data in depth, 430 unigenes related to immunity were identified. DGE analysis revealed that parasitization by S. guani had considerable impacts on the transcriptome profile of T. molitor pupae, as indicated by the significant up- or down-regulation of 3,431 parasitism-responsive transcripts. The expression of a total of 74 unigenes involved in immune response of T. molitor was significantly altered after parasitization. obtained T. molitor transcriptome, in addition to establishing a fundamental resource for further research on functional genomics, has allowed the discovery of a large group of immune genes that might provide a meaningful framework to better understand the immune response in this species and other beetles. The DGE profiling data provides comprehensive T. molitor immune gene expression information at the transcriptional level following parasitization, and sheds valuable light on the molecular understanding of the host-parasitoid interaction.

  19. Heritability of hsp70 expression in the beetle Tenebrio molitor: Ontogenetic and environmental effects.

    Science.gov (United States)

    Lardies, Marco A; Arias, María Belén; Poupin, María Josefina; Bacigalupe, Leonardo D

    2014-08-01

    Ectotherms constitute the vast majority of terrestrial biodiversity and are especially likely to be vulnerable to climate warming because their basic physiological functions such as locomotion, growth, and reproduction are strongly influenced by environmental temperature. An integrated view about the effects of global warming will be reached not just establishing how the increase in mean temperature impacts the natural populations but also establishing the effects of the increase in temperature variance. One of the molecular responses that are activated in a cell under a temperature stress is the heat shock protein response (HSP). Some studies that have detected consistent differences among thermal treatments and ontogenetic stages in HSP70 expression have assumed that these differences had a genetic basis and consequently expression would be heritable. We tested for changes in quantitative genetic parameters of HSP70 expression in a half-sib design where individuals of the beetle Tenebrio molitor were maintained in constant and varying thermal environments. We estimated heritability of HSP70 expression using a linear mixed modelling approach in different ontogenetic stages. Expression levels of HSP70 were consistently higher in the variable environment and heritability estimates were low to moderate. The results imply that within each ontogenetic stage additive genetic variance was higher in the variable environment and in adults compared with constant environment and larvae stage, respectively. We found that almost all the genetic correlations across ontogenetic stages and environment were positive. These suggest that directional selection for higher levels of expression in one environment will result in higher expression levels of HSP70 on the other environment for the same ontogenetic stage. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Effects of dietary Tenebrio molitor meal inclusion in free-range chickens.

    Science.gov (United States)

    Biasato, I; De Marco, M; Rotolo, L; Renna, M; Lussiana, C; Dabbou, S; Capucchio, M T; Biasibetti, E; Costa, P; Gai, F; Pozzo, L; Dezzutto, D; Bergagna, S; Martínez, S; Tarantola, M; Gasco, L; Schiavone, A

    2016-12-01

    Insects are currently being considered as a novel protein source for animal feeds, because they contain a large amount of protein. The larvae of Tenebrio molitor (TM) have been shown to be an acceptable protein source for broiler chickens in terms of growth performance, but till now, no data on histological or intestinal morphometric features have been reported. This study has had the aim of evaluating the effects of dietary TM inclusion on the performance, welfare, intestinal morphology and histological features of free-range chickens. A total of 140 medium-growing hybrid female chickens were free-range reared and randomly allotted to two dietary treatments: (i) a control group and (ii) a TM group, in which TM meal was included at 75 g/kg. Each group consisted of five pens as replicates, with 14 chicks per pen. Growth performance, haematological and serum parameters and welfare indicators were evaluated, and the animals were slaughtered at the age of 97 days. Two birds per pen (10 birds/treatment) were submitted to histological (liver, spleen, thymus, bursa of Fabricius, kidney, heart, glandular stomach and gut) and morphometric (duodenum, jejunum and ileum) investigations. The inclusion of TM did not affect the growth performance, haematological or serum parameters. The morphometric and histological features were not significantly affected either, thus suggesting no influence on nutrient metabolization, performance or animal health. Glandular stomach alterations (chronic flogosis with epithelial squamous metaplasia) were considered paraphysiological in relation to free-range farming. The observed chronic intestinal flogosis, with concomitant activation of the lymphoid tissue, was probably due to previous parasitic infections, which are very frequently detected in free-range chickens. In conclusion, the findings of this study show that yellow mealworm inclusion does not affect the welfare, productive performances or morphological features of free-range chickens

  1. Purification and characterization of tenecin 4, a new anti-Gram-negative bacterial peptide, from the beetle Tenebrio molitor.

    Science.gov (United States)

    Chae, Jun-Ho; Kurokawa, Kenji; So, Young-In; Hwang, Hyun Ok; Kim, Min-Su; Park, Ji-Won; Jo, Yong-Hun; Lee, Yong Seok; Lee, Bok Luel

    2012-03-01

    The biochemical characterization of novel antimicrobial peptides (AMPs) and the determination of ligand molecules that induce AMP production are essential for understanding the host innate immune response in insects. Here, we purified a new 14-kDa AMP, named tenecin 4, from the larval hemolymph of the beetle Tenebrio molitor. Tenecin 4 contains 14% glycine residues and has moderate similarities both to the C-terminal region of Drosophila attacin and to silk-moth gloverin proteins. Purified tenecin 4 showed bactericidal activity against Gram-negative Escherichia coli but not against Gram-positive Bacillus subtilis or the fungus Candida albicans. Tenecin 4 production was induced by Toll cascade-activating ligands, such as β-1,3-glucan, lysine-type peptidoglycan and active Spätzle, and by the probable Imd pathway-activating ligand monomeric meso-diaminopimelic acid-type peptidoglycan. Taken together, these data show that tenecin 4 is a defense protein against Gram-negative pathogens and is induced by multiple ligands in Tenebrio larvae. Copyright © 2011 Elsevier Ltd. All rights reserved.

  2. Role of allatostatin-like factors from the brain of Tenebrio molitor females.

    Science.gov (United States)

    Wasielewski, O; Skonieczna, M; Kodrík, D

    2009-08-01

    The effect of brain extract from females of freshly emerged Tenebrio molitor on ovary, oocyte development, total protein content of hemolymph, and ovary was studied in 4-day-old adult mealworm females. Injections of extracts of 2-brain equivalents into intact (unligatured) Tenebrio females did not affect ovarian and oocyte development. Injections of ligated females, however, with 2-brain equivalents on day 1 and 2 after adult emergence strongly inhibited ovarian growth and oocyte development. At day 4, ligated and injected females did not develop their ovaries and pre-vitellogenic oocytes were not found. The changes in ovarian development correlated with an increase in the concentration of soluble proteins in the hemolymph as compared with the saline-injected controls. Additionally, a strong reduction of total protein content in ovarian tissue was observed. Reverse phase HPLC separation of a methanolic brain extract of T. molitor females showed that fraction 5 has a similar retention time to synthetic cockroach allatostatin. Fraction 5 was eluted at 12.88 min, which was closest to the internal standard Dippu-AST I, which eluted at 12.77 min. An ELISA of fraction 5 from the methanolic brain extract using antibodies against allatostatins Grybi-AST A1 and Grybi-AST B1 from cricket Gryllus bimaculatus showed that fraction 5 cross-reacted with Grybi-AST A1 antibodies. The cross-reactivity was similar to the synthetic allatostatin from D. punctata, which was used as a positive control. These observations demonstrate a possible role for allatostatin-like brain factor(s) in regulating the reproductive cycle of Tenebrio molitor.

  3. Endogenous egg immune defenses in the yellow mealworm beetle (Tenebrio molitor).

    Science.gov (United States)

    Jacobs, Chris G C; Gallagher, Joe D; Evison, Sophie E F; Heckel, David G; Vilcinskas, Andreas; Vogel, Heiko

    2017-05-01

    In order to survive microbe encounters, insects rely on both physical barriers as well as local and systemic immune responses. Most research focusses on adult or larval defenses however, whereas insect eggs are also in need of protection. Lately, the defense of eggs against microbes has received an increasing amount of attention, be it through endogenous egg defenses, trans-generational immune priming (TGIP) or parental investment. Here we studied the endogenous immune response in eggs and adults of Tenebrio molitor. We show that many immune genes are induced in both adults and eggs. Furthermore, we show that eggs reach comparable levels of immune gene expression as adults. These findings show that the eggs of Tenebrio are capable of an impressive endogenous immune response, and indicate that such inducible egg defenses are likely common in insects. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Endocrine disruption of sexual selection by an estrogenic herbicide in the mealworm beetle (Tenebrio molitor).

    Science.gov (United States)

    McCallum, Malcolm L; Matlock, Makensey; Treas, Justin; Safi, Barroq; Sanson, Wendy; McCallum, Jamie L

    2013-12-01

    The role that endocrine disruption could play in sexual selection remains relatively untested, and although estrogens occur in insects, little information exists about their biological role in insect reproduction. Atrazine is a commonly applied herbicide that mimics estrogen in vertebrates. Tenebrio molitor were raised from egg to adult under a gradation of environmentally relevant atrazine exposures and a non-treated control. Atrazine was delivered in the drinking water ad libitum. Female T. molitor were provided with a choice between unrelated males raised under three levels of atrazine exposures. Female preference for males demonstrated a non-monotonic inverted U-shaped response to atrazine exposure. There was no significant difference between the control and the high exposure to atrazine. Excluding the control, female preference increased as exposure concentration increased. These results have important repercussions for nonlethal effects of endocrine disruption on populations, their capacity to interfere with sexual selection, and the role of estrogen in pheromone communication among insects.

  5. A tapeworm molecule manipulates vitellogenin expression in the beetle Tenebrio molitor

    Science.gov (United States)

    Warr, E.; Meredith, J. M.; Nimmo, D. D.; Basu, S.; Hurd, H.; Eggleston, P.

    2006-01-01

    Metacestodes of Hymenolepis diminuta secrete a molecule that decreases vitellogenin (Vg) synthesis in the beetle host, Tenebrio molitor. The 5608 bp T. molitor Vg cDNA represents a single-copy gene encoding a single open reading frame of 1821 amino acids with a predicted molecular mass of 206 kDa. Northern blot analysis revealed detectable levels of transcripts only in adult females. In vivo, Vg mRNA abundance was significantly higher in fat bodies from infected females compared with control females at all but the earliest time point. In vitro, Vg mRNA abundance was significantly increased in fat bodies incubated with live stage I–II parasites. The apparent conflict between increased Vg mRNA abundance and decreased Vg protein in fat bodies from infected females is discussed. PMID:16907836

  6. The Silencing of a 14-3-3ɛ Homolog in Tenebrio molitor Leads to Increased Antimicrobial Activity in Hemocyte and Reduces Larval Survivability.

    Science.gov (United States)

    Seo, Gi Won; Jo, Yong Hun; Seong, Jeong Hwan; Park, Ki Beom; Patnaik, Bharat Bhusan; Tindwa, Hamisi; Kim, Sun-Am; Lee, Yong Seok; Kim, Yu Jung; Han, Yeon Soo

    2016-08-20

    The 14-3-3 family of phosphorylated serine-binding proteins acts as signaling molecules in biological processes such as metabolism, division, differentiation, autophagy, and apoptosis. Herein, we report the requirement of 14-3-3ɛ isoform from Tenebrio molitor (Tm14-3-3ɛ) in the hemocyte antimicrobial activity. The Tm14-3-3ɛ transcript is 771 nucleotides in length and encodes a polypeptide of 256 amino acid residues. The protein has the typical 14-3-3 domain, the nuclear export signal (NES) sequence, and the peptide binding residues. The Tm14-3-3ɛ transcript shows a significant three-fold expression in the hemocyte of T. molitor larvae when infected with Escherichia coli Tm14-3-3ɛ silenced larvae show significantly lower survival rates when infected with E. coli. Under Tm14-3-3ɛ silenced condition, a strong antimicrobial activity is elicited in the hemocyte of the host inoculated with E. coli. This suggests impaired secretion of antimicrobial peptides (AMP) into the hemolymph. Furthermore, a reduction in AMP secretion under Tm14-3-3ɛ silenced condition would be responsible for loss in the capacity to kill bacteria and might explain the reduced survivability of the larvae upon E. coli challenge. This shows that Tm14-3-3ɛ is required to maintain innate immunity in T. molitor by enabling antimicrobial secretion into the hemolymph and explains the functional specialization of the isoform.

  7. Molecular cloning and characterization of autophagy-related gene TmATG8 in Listeria-invaded hemocytes of Tenebrio molitor.

    Science.gov (United States)

    Tindwa, Hamisi; Jo, Yong Hun; Patnaik, Bharat Bhusan; Lee, Yong Seok; Kang, Sang Sun; Han, Yeon Soo

    2015-07-01

    Macroautophagy (hereinafter called autophagy) is a highly regulated process used by eukaryotic cells to digest portions of the cytoplasm that remodels and recycles nutrients and disposes of unwanted cytoplasmic constituents. Currently 36 autophagy-related genes (ATG) and their homologs have been characterized in yeast and higher eukaryotes, including insects. In the present study, we identified and functionally characterized the immune function of an ATG8 homolog in a coleopteran insect, Tenebrio molitor (TmATG8). The cDNA of TmATG8 comprises of an ORF of 363 bp that encodes a protein of 120 amino acid residues. TmATG8 transcripts are detected in all the developmental stages analyzed. TmAtg8 protein contains a highly conserved C-terminal glycine residue (Gly116) and shows high amino acid sequence identity (98%) to its Tribolium castaneum homolog, TcAtg8. Loss of function of TmATG8 by RNAi led to a significant increase in the mortality rates of T. molitor larvae against Listeria monocytogenes. Unlike dsEGFP-treated control larvae, TmATG8-silenced larvae failed to turn-on autophagy in hemocytes after injection with L. monocytogenes. These data suggest that TmATG8 play a role in mediating autophagy-based clearance of Listeria in T. molitor. Copyright © 2015 Elsevier Ltd. All rights reserved.

  8. The Silencing of a 14-3-3ɛ Homolog in Tenebrio molitor Leads to Increased Antimicrobial Activity in Hemocyte and Reduces Larval Survivability

    Directory of Open Access Journals (Sweden)

    Gi Won Seo

    2016-08-01

    Full Text Available The 14-3-3 family of phosphorylated serine-binding proteins acts as signaling molecules in biological processes such as metabolism, division, differentiation, autophagy, and apoptosis. Herein, we report the requirement of 14-3-3ɛ isoform from Tenebrio molitor (Tm14-3-3ɛ in the hemocyte antimicrobial activity. The Tm14-3-3ɛ transcript is 771 nucleotides in length and encodes a polypeptide of 256 amino acid residues. The protein has the typical 14-3-3 domain, the nuclear export signal (NES sequence, and the peptide binding residues. The Tm14-3-3ɛ transcript shows a significant three-fold expression in the hemocyte of T. molitor larvae when infected with Escherichia coli Tm14-3-3ɛ silenced larvae show significantly lower survival rates when infected with E. coli. Under Tm14-3-3ɛ silenced condition, a strong antimicrobial activity is elicited in the hemocyte of the host inoculated with E. coli. This suggests impaired secretion of antimicrobial peptides (AMP into the hemolymph. Furthermore, a reduction in AMP secretion under Tm14-3-3ɛ silenced condition would be responsible for loss in the capacity to kill bacteria and might explain the reduced survivability of the larvae upon E. coli challenge. This shows that Tm14-3-3ɛ is required to maintain innate immunity in T. molitor by enabling antimicrobial secretion into the hemolymph and explains the functional specialization of the isoform.

  9. Immune function responds to selection for cuticular colour in Tenebrio molitor

    DEFF Research Database (Denmark)

    Armitage, Sophie Alice Octavia; Siva-Jothy, M. T.

    2005-01-01

    Cuticular colour in the mealworm beetle (Tenebrio molitor) is a quantitative trait, varying from tan to black. Population level variation in cuticular colour has been linked to pathogen resistance in this species and in several other insects: darker individuals are more resistant to pathogens...... individuals. Cuticular colour is dependent upon melanin production, which requires the enzyme PO that is present in its inactive form inside haemocytes. Thus, the observed correlated response to selection upon cuticular colour and immune variables probably results from these traits' shared dependence...

  10. Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.

    Science.gov (United States)

    Furuya, K; Schegg, K M; Wang, H; King, D S; Schooley, D A

    1995-01-01

    A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amino acid sequence reveals that this peptide is a member of the family of sauvagine/corticotropin-releasing factor/urotensin I-related insect diuretic hormones. The C-terminal sequence of this peptide is quite different from other members of this family, which have a hydrophobic C terminus (isoleucinamide or valinamide). When aligned comparably, T. molitor diuretic hormone has a more hydrophilic C terminus, leucylasparagine (free acid). In contrast to all other known diuretic hormones of this family, this peptide has exceptionally low stimulatory activity on cAMP production in Malpighian tubules of Manduca sexta. However, at nanomolar concentrations it stimulates cAMP production in Malpighian tubules of T. molitor. Diuretic hormones of this family have been isolated previously from Lepidoptera, Orthoptera, Dictyoptera, and Diptera. This appears to be the first diuretic hormone isolated from a coleopteran insect. Images Fig. 1 Fig. 2 PMID:8618894

  11. Reproduction of Trichospilus diatraeae in Diatraea saccharalis after three generations in Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Daniele Fabiana Glaeser

    2014-06-01

    Full Text Available The successive rearing of parasitoids in factitious hosts may affect its biological quality. Trichospilus diatraeae Cherian & Margabandhu, 1942 (Hymenoptera: Eulophidae has been studied for the biological control of sugarcane borer [Diatraea saccharalis (Fabricius, 1794 (Lepidoptera: Crambidae]. This study aimed to evaluate whether the rearing of T. diatraeae for three generations in the factitious host Tenebrio molitor Linnaeus, 1758 (Coleoptera: Tenebrionidae affects its reproductive performance, when subsequently reared in the natural host pupae D. saccharalis. Two groups of T. diatraeae were reared separately for three generations: one in pupae of T. molitor and the other in pupae of D. saccharalis. Subsequently, 20 pupae of D. saccharalis were exposed, for 72 hours, to the parasitism of T. diatraeae females reared earlier in pupae of T. molitor or D. saccharalis. The successive rearing of T. diatraeae in the factitious host did not affect the number of pupae parasitized and the number of pupae in which the emergence of parasitoids occurred in the natural host D. saccharalis, and increased the longevity of females and the sex ratio of T. diatraeae. The progeny, duration of developmental cycle (egg to adult, width of head capsule of males and females and longevity of males of T. diatraeae were similar on both treatments. T. diatraeae can be reared in the factitious host T. molitor for three generations without compromising its reproductive performance, when subsequently reared in the natural host D. saccharalis.

  12. The Effect of Chemical Composition and Bioactivity of Several Essential Oils on Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Wang, Xuegui; Hao, Qiang; Chen, Yiqu; Jiang, Surong; Yang, Qunfang; Li, Qing

    2015-01-01

    The major chemical components of four essential oils (EOs) extracted from dry leaves of Citrus limonum, Cymbopogon citratus, Litsea cubeba, and Muristica fragrans were analyzed with gas chromatograph-mass spectrometer and their fumigant, contact, and repellent activities against 10th instar and adults of Tenebrio molitor were also assayed. The results indicated that the major constituents of C. limonum and Cy. citrates were D-limonene (38.22%) and 3,7-dimethyl-6-octenal (26.21%), while which of L. cubeba and M. fragrans were (E)-3, 7-dimethyl-2, 6-octadienal (49.78%) and (E)-cinnamaldehyde (79.31%), respectively. Contact activities of L. cubeba and C. limonum with LC50 values of 21.2 and 13.9 µg/cm(2) at 48 h and repellence activities (>89.0% repellence indexes) (P molitor compared with the control. The mainly active ingredients of L. cubeba and C. limonum, including D-limonene and β-pinene, were demonstrated to coinhibit the actives of AChE and enhance the toxicities on 10th instar of T. molitor. These results indicate that the EOs of L. cubeba and C. limonum could have great potential as botanical insecticides against T. molitor. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  13. Degradation and excretion of the Fusarium toxin deoxynivalenol by an edible insect, the Yellow mealworm (Tenebrio molitor L.)

    NARCIS (Netherlands)

    Broekhoven, van S.; Mota Gutierrez, J.; Rijk, de T.C.; Nijs, de W.C.M.; Loon, van J.J.A.

    2017-01-01

    Insects could provide an alternative and more sustainable source of animal protein compared to conventional livestock. Yellow mealworms (Tenebrio molitor L.) can be grown on diets composed of organic by-products. However, these diets could be contaminated with mycotoxins. Thus far, little is

  14. Developmental plasticity in Tenebrio molitor (Coleoptera: Tenebrionidae): Analysis of Instar Variation in Number and Development Time under Different Diets

    Science.gov (United States)

    The variation in instar number and the pattern of sequential instar development time of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied under 4 different diet regimes. Addition of dietary supplements consisting of dry potato or a mix of dry potato and dry egg whites significantly reduced...

  15. Extracting Tenebrio molitor protein while preventing browning: effect of pH and NaCl on protein yield

    NARCIS (Netherlands)

    Yi, L.; Boekel, van T.; Lakemond, C.M.M.

    2017-01-01

    The potential of insects as an alternative protein source for food applications was investigated by studying the effect of pH and NaCl on extraction yield of water-soluble proteins from Tenebrio molitor, while preventing browning due to polyphenol oxidation. Minimum protein solubility (29.6%) was at

  16. Podisus distinctus (Heteroptera: Pentatomidae) females are lighter feeding on Tenebrio molitor (Coleoptera: Tenebrionidae) pupae subjected to ventral nerve cord transection

    Science.gov (United States)

    The movement observed in the Tenebrio molitor L., 1758 (Coleoptera: Tenebrionidae) pupae can be a type of defense strategy. This makes it significant to study the development and reproduction of the predatory stinkbugs Asopinae with the immobilized pupae of this prey. The aim was to evaluate the per...

  17. Identification of candidate chemosensory genes in the antennal transcriptome of Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Liu, Su; Rao, Xiang-Jun; Li, Mao-Ye; Feng, Ming-Feng; He, Meng-Zhu; Li, Shi-Guang

    2015-03-01

    We present the first antennal transcriptome sequencing information for the yellow mealworm beetle, Tenebrio molitor (Coleoptera: Tenebrionidae). Analysis of the transcriptome dataset obtained 52,216,616 clean reads, from which 35,363 unigenes were assembled. Of these, 18,820 unigenes showed significant similarity (E-value <10(-5)) to known proteins in the NCBI non-redundant protein database. Gene ontology (GO) and Cluster of Orthologous Groups (COG) analyses were used for functional classification of these unigenes. We identified 19 putative odorant-binding protein (OBP) genes, 12 chemosensory protein (CSP) genes, 20 olfactory receptor (OR) genes, 6 ionotropic receptor (IR) genes and 2 sensory neuron membrane protein (SNMP) genes. BLASTX best hit results indicated that these chemosensory genes were most identical to their respective orthologs from Tribolium castaneum. Phylogenetic analyses also revealed that the T. molitor OBPs and CSPs are closely related to those of T. castaneum. Real-time quantitative PCR assays showed that eight TmolOBP genes were antennae-specific. Of these, TmolOBP5, TmolOBP7 and TmolOBP16 were found to be predominantly expressed in male antennae, while TmolOBP17 was expressed mainly in the legs of males. Several other genes were identified that were neither tissue-specific nor sex-specific. These results establish a firm foundation for future studies of the chemosensory genes in T. molitor. Copyright © 2015 Elsevier Inc. All rights reserved.

  18. [Effects of venom from Sclerodermus sichuanensis Xiao on pupa of Tenebrio molitor].

    Science.gov (United States)

    Zhuo, Zhi-Hang; Yang, Wei; Qin, Huan; Yang, Chun-Ping; Yang, Hua; Xu, Dan-Ping

    2013-11-01

    To explore the regulatory mechanisms of parasitism of Sclerodermus sichuanensis on Tenebrio molitor, the methods of natural parasitism and venom injection were adopted to investigate the effects of the venom from S. sichuanensis on the pupa of T. molitor in the parasitic process. Under venom injection, the paralytic degree of the pupa had a positive correlation with the concentration of injected venom, and the number of recovered pupa had a negative correlation with the injected venom concentration. The T. molitor pupa was in slight and reversible paralysis when injected with 0.01 VRE (venom reservoir equivalent) of venom, and in non-reversible and complete paralysis when 0.2 VRE was injected. The pupa died massively and appeared a wide range of melanization when injected with soil bacterial suspension alone, but the melanization delayed and the mortality declined significantly when the mixed liquor of bacterium and venom was injected. The bacteriostasis of the venom on Staphylococcus aureus was significantly stronger than that on Escherichia coli. Within a definite range of temperature, the paralytic activity decreased significantly with increasing temperature, the bacteriostasis on S. aureus increased significantly, while that on E. coli was opposite. This study showed that the venom from S. sichuanensis had the effects of paralysis, bacteriostasis, inhibiting exuviations, and delaying melanization.

  19. Elemental concentration in mealworm beetle (Tenebrio molitor L.) during metamorphosis.

    Science.gov (United States)

    Simon, Edina; Baranyai, Edina; Braun, Mihály; Fábián, István; Tóthmérész, Béla

    2013-07-01

    Mealworm beetles have been used in numerous experiments as bioindicators. The aim of our experiment was to study the elemental composition in three larvae, pupae and first and second generation adult stages during their life cycle. We selected 180 larvae from a genetically similar population and put them in three groups, in two boxes (60 larvae in each box). Larvae were fed with mashed potato made of the same quality and quantity of potato powder. Then, we selected 10 individuals from each stage to the elemental analysis, using the ICP-OES method. The following elements were analysed in the studied stages: Ca, Cu, Fe, K, Mg, Mn, Na, P, S, Sr and Zn. The results of principal component analysis demonstrated that based on elemental composition, different stages were separated with each other, but in the cases of the three larvae stages, high overlap was found. The results of the GLM ANOVA showed significant differences between the different stages of metamorphosis-based elemental composition. Our results show that the calcium and magnesium were found in a relatively high concentration, while the iron and zinc may be essential elements during the metamorphosis. Our results also show that in insect, the concentration of sodium was higher than in the pupa which may cause by hemolymph. We also demonstrated that the metamorphosis has an effect on the concentration of elements. Our study shows that in the different stages of insects, there are significant changes in the elemental composition of different stages of insects during their metamorphosis.

  20. Evidence for a Phe-Gly-Leu-amide-like allatostatin in the beetle Tenebrio molitor.

    Science.gov (United States)

    Elliott, Karen L; Chan, Kuen Kuen; Stay, Barbara

    2010-03-01

    The allatostatins (ASTs) with Phe-Gly-Leu-amide C-terminal sequence are multifunctional neuropeptides discovered as inhibitors of juvenile hormone (JH) synthesis by corpora allata (CA) of cockroaches. Although these ASTs inhibit JH synthesis only in cockroaches, crickets, termites and locusts, isolation of peptides or of cDNA/genomic DNA or analysis of genomes indicates their occurrence in many orders of insects with the exception of coleopterans. The gene for these ASTs has not been found in the genome of the red flour beetle Tribolium castaneum (Family Tenebrionidae). Yet, in view of widespread occurrence of these peptides in insects, crustaceans and nematodes, they would be expected to occur in beetles. This study provides evidence for the presence of FGLa-like ASTs in the tenebrionid beetle, Tenebrio molitor, and scarabid beetle, Popillia japonica. Extract of brain from both beetles inhibited JH synthesis by cockroach CA dose dependently and reversibly. 20 brain equivalents of T. molitor and P. japonica extracts inhibited JH synthesis 64+/-5 and 65+/-0.6% respectively. Antibody against cockroach allatostatin (Diploptera punctata AST-7) used in an enzyme-linked immunosorbent assay reacted with brain extract of these beetles. Antibody against D. punctata AST-5 localized FGLa-like ASTs in the brain and subesophageal ganglion of T. molitor and P. japonica. In addition, pretreatment of T. molitor brain extract with anti-D. punctata AST-5 reduced the inhibition of JH synthesis and pretreatment of anti-D. punctata AST-5 with D. punctata AST-5 diminished the immunoreactivity of the antibody. Thus we predict that FGLa-like allatostatins will be found in beetles. (c) 2009 Elsevier Inc. All rights reserved.

  1. Tenebrio molitor meal in rainbow trout (Oncorhynchus mykiss diets: effects on animal performance, nutrient digestibility and chemical composition of fillets

    Directory of Open Access Journals (Sweden)

    Marco Belforti

    2015-12-01

    Full Text Available This study evaluated the effects of diets containing Tenebrio molitor (TM larvae meal on growth performances, somatic indexes, nutrient digestibility, dorsal muscle proximate and fatty acid (FA compositions of rainbow trout. Three hundred sixty fish were randomly divided into three groups with four replicates each. The groups were fed diets differing in TM inclusion: 0% (TM0, 25% (TM25 and 50% (TM50 as fed weight basis. Weight gain was not affected by treatment. Feeding rate was significantly higher in TM0 than TM50. Feed conversion ratio was significantly higher in TM0 than TM25 and TM50, while an opposite trend was observed for protein efficiency ratio and specific growth rate. The survival rate was significantly lower in TM0 than TM25 and TM50. The apparent digestibility of protein was significantly lower in the TM50 group than the other groups, while the apparent digestibility of dry matter, organic matter and lipids was unaffected by treatment. If compared to control, the protein and lipid contents of fillets were respectively increased and decreased following TM inclusion in the diet. The Σn3/Σn6 FA ratio of fish dorsal muscle was linearly (TM0>TM25>TM50 reduced by TM inclusion in the diet. Results suggested that TM could be used during the growing phase in trout farming; however, additional studies on specific feeding strategies and diet formulations are needed to limit its negative effects on the lipid fraction of fillets.

  2. Action of amorphous diatomaceous earth against different stages of the stored product pests Tribolium confusum, Tenebrio molitor, Sitophilus granarius and Plodia interpunctella.

    Science.gov (United States)

    Mewis; Ulrichs

    2001-04-01

    Environmental and human health problems associated with the use of synthetic pesticides have prompted the demand for non-polluting, biologically specific insecticides. The current study tested the use and action of diatomaceous earth against several stored product pests. Fossil Shield(R) applied to wooden plates was lethal to adult Tenebrio molitor and Tribolium confusum, but larvae of the mealworm were unaffected. Beetles died within 14 days exposure in the absence of food to a dose of 2 and 4 g/m(2), but mortality was reduced in those fed grain bran. Fossil Shield(R) was lethal to first instar larvae of Plodia interpunctella, but not lethal to older larval stages. Two-week old larvae of T. confusum were more sensitive to diatomaceous earth than P. interpunctella at the same age. Contact with diatomaceous earth caused adult Sitophilus granarius, T. molitor and T. confusum to lose weight and reduced their water content, suggesting disruption of "the water barrier". Death of stored product insects treated with diatomaceous earth decreased with increased r.h., due to reduced transpiration through the cuticle. High r.h. delays, or above 60% can prevent, the drying action of diatomaceous earth.

  3. TmCactin plays an important role in Gram-negative and -positive bacterial infection by regulating expression of 7 AMP genes in Tenebrio molitor

    Science.gov (United States)

    Jo, Yong Hun; Jung Kim, Yu; Beom Park, Ki; Hwan Seong, Jeong; Gon Kim, Soo; Park, Soyi; Young Noh, Mi; Seok Lee, Yong; Soo Han, Yeon

    2017-01-01

    Cactin was originally identified as an interactor of the Drosophila IκB factor Cactus and shown to play a role in controlling embryonic polarity and regulating the NF-κB signaling pathway. While subsequent studies have identified the roles for Cactin in the mammalian immune response, the immune function of Cactin in insects has not been described yet. Here, we identified a Cactin gene from the mealworm beetle, Tenebrio molitor (TmCactin) and characterized its functional role in innate immunity. TmCactin was highly expressed in prepupa to last instar stages, and its expression was high in the integument and Malpighian tubules of last instar larvae and adults. TmCactin was induced in larvae after infection with different pathogens and detectable within 3 hours of infection. The highest levels of TmCactin expression were detected at 9 hours post infection. TmCactin RNAi significantly decreased the survival rates of larvae after challenge with Escherichia coli and Staphylococcus aureus, but had no significant effect after challenge with Candida albicans. Furthermore, TmCactin RNAi significantly reduced the expression of seven antimicrobial peptide genes (AMPs) after bacterial challenge. Our results suggest that TmCactin may serve as an important regulator of innate immunity, mediating AMP responses against both Gram-positive and Gram-negative bacteria in T. molitor. PMID:28418029

  4. Depletion of autophagy-related genes ATG3 and ATG5 in Tenebrio molitor leads to decreased survivability against an intracellular pathogen, Listeria monocytogenes.

    Science.gov (United States)

    Tindwa, Hamisi; Jo, Yong Hun; Patnaik, Bharat Bhusan; Noh, Mi Young; Kim, Dong Hyun; Kim, Iksoo; Han, Yeon Soo; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung

    2015-01-01

    Macroautophagy (autophagy) is an evolutionarily conserved catabolic process involved in physiological and developmental processes including cell survival, death, and innate immunity. Homologues of most of 36 originally discovered autophagy-related (ATG) genes in yeast have been characterized in higher eukaryotes including insects. In this study, the homologues of ATG3 (TmATG3) and ATG5 (TmATG5) were isolated from the coleopteran beetle, Tenebrio molitor by expressed sequence tag and RNAseq approaches. The cDNA of TmATG3 and TmATG5 comprise open-reading frame sizes of 963 and 792 bp encoding polypeptides of 320 and 263 amino acid residues, respectively. TmATG3 and TmATG5 mRNA are expressed in all developmental stages, and mainly in fat body and hemocytes of larvae. TmATG3 and TmATG5 showed an overall sequence identity of 58-95% to other insect Atg proteins. There exist clear one-to-one orthologs of TmATG3 and TmATG5 in Tribolium and that they clustered together in the gene tree. Depletion of TmATG3 and TmATG5 by RNA interference led to a significant reduction in survival ability of T. molitor larvae against an intracellular pathogen, Listeria monocytogenes. Six days post-Listeria challenge, the survival rate in the dsEGFP-injected (where EGFP is enhanced green fluorescent protein) control larvae was significantly higher (55%) compared to 4 and 3% for TmATG3 and TmATG5 double-stranded RNA injected larvae, respectively. These data suggested that TmATG3 and TmATG5 may play putative role in mediating autophagy-based clearance of Listeria in T. molitor model. © 2014 Wiley Periodicals, Inc.

  5. Effects of weak electromagnetic irradiation on various types of behavior in the mealworm Tenebrio molitor.

    Science.gov (United States)

    Sheiman, I M; Kreshchenko, N D

    2010-10-01

    The effects of weak electromagnetic irradiation on simple forms of behavior were studied using adult Tenebrio molitor mealworms. The beetles' motor behavior was studied in conditions of different motivations, i.e., positive (food) and negative (avoidance of light), in otherwise identical experimental conditions. The beetles had to navigate a defined space to reach their target - potato or cover from light. Experiments consisted of one trial per day for five days. Target attainment time was measured in groups of beetles. Behavior in both cases developed as follows: an initial orientation reaction appeared and was followed by adaptation to the apparatus. Exposure to weak electromagnetic irradiation led to increases in the response time at the initial stages of the experiments. The effects of irradiation were seasonal in nature and differed in the two types of behavior.

  6. [Modulating effect of weak combined magnetic fields on duration of mealworm beetle Tenebrio molitor metamorphosis stage].

    Science.gov (United States)

    Novikov, V V; Sheĭman, I M; Iablokova, E V; Fesenko, E E

    2014-01-01

    It is shown that an exposure of pupae of the mealworm beetle Tenebrio molitor to the combined static (42 μT) and very weak alternating (250 nT) magnetic fields exerts different influence, depending on the frequency of the alternating magnetic field, on duration of metamorphosis processes in these insects. For instance, an exposure of pupae to weak combined magnetic fields, adjusted to the frequency of ion cyclotron resonance for glutaminic acid (4,4 Hz), stimulates metamorphosis process--a transitional stage from pupae to imago lasts shorter. An inhibiting effect was observed when adjusted to the frequency of ion cyclotron resonance for Ca2 (32,2 Hz). At some frequencies this effect is not seen. For instance, an exposure at a frequency of ion cyclotron resonance for K+ (16,5 Hz) exerts no noticeable effect on the duration of the pupal metamorphosis stage.

  7. Previous encapsulation response enhances within individual protection against fungal parasite in the mealworm beetle Tenebrio molitor.

    Science.gov (United States)

    Krams, Indrikis; Daukste, Janina; Kivleniece, Inese; Krama, Tatjana; Rantala, Markus J

    2013-12-01

    Immune defenses of insects show either broad reactions or specificity and durability of induced protection against attacking parasites and pathogens. In this study, we tested whether encapsulation response against nylon monofilament increases between two attempts of activation of immune system in mealworm beetles Tenebrio molitor, and whether previous exposure to nylon monofilament may also increase protection against an entomopathogenic fungus. We found that survival of beetles subjected to immune activation by nylon implant and subsequent fungal exposure a week later was significantly higher than survival of beetles which had been subjected to fungal infection only. This result suggests that previous immune activation by the nylon implant may be considered as broad spectrum "immune priming" which helps to fight not only the same intruder but also other parasites. © 2012 Institute of Zoology, Chinese Academy of Sciences.

  8. Sustainable farming of the mealworm Tenebrio molitor for the production of food and feed.

    Science.gov (United States)

    Grau, Thorben; Vilcinskas, Andreas; Joop, Gerrit

    2017-09-26

    The farming of edible insects is an alternative strategy for the production of protein-rich food and feed with a low ecological footprint. The industrial production of insect-derived protein is more cost-effective and energy-efficient than livestock farming or aquaculture. The mealworm Tenebrio molitor is economically among the most important species used for the large-scale conversion of plant biomass into protein. Here, we review the mass rearing of this species and its conversion into food and feed, focusing on challenges such as the contamination of food/feed products with bacteria from the insect gut and the risk of rapidly spreading pathogens and parasites. We propose solutions to prevent the outbreak of infections among farmed insects without reliance on antibiotics. Transgenerational immune priming and probiotic bacteria may provide alternative strategies for sustainable insect farming.

  9. [Influence of weak electromagnetic field on different forms of behavior in grain beetle, Tenebrio molitor].

    Science.gov (United States)

    Sheĭman, I M; Kreshchenko, N D

    2009-01-01

    The influence of weak electromagnetic radiation on simple forms of behavior was studied on the model of the motor behavior of the imago grain beetle (Tenebrio molitor). Positive (feeding) and negative (illumination) motivations were created in the same experimental conditions. Beetles in a Petri dish were put to the starting point of a special container. The goal (a peace of potato or a box protected from light) was in the other fixed point of the container. Time of the goal reaching by groups of beetles was recorded in one daily trial in the course of five consecutive days. Under conditions of both motivations, behavioral phases such as orienting reaction and environmental adaptation were observed. Exposure to weak electromagnetic radiation resulted in an increase in the reaction time at the initial stage of the experiment. The effect was of a seasonal character and varied depending on the behavioral form.

  10. Distribution and sequence homogeneity of an abundant satellite DNA in the beetle, Tenebrio molitor.

    Science.gov (United States)

    Davis, C A; Wyatt, G R

    1989-01-01

    The mealworm beetle, Tenebrio molitor, contains an unusually abundant and homogeneous satellite DNA which constitutes up to 60% of its genome. The satellite DNA is shown to be present in all of the chromosomes by in situ hybridization. 18 dimers of the repeat unit were cloned and sequenced. The consensus sequence is 142 nt long and lacks any internal repeat structure. Monomers of the sequence are very similar, showing on average a 2% divergence from the calculated consensus. Variant nucleotides are scattered randomly throughout the sequence although some variants are more common than others. Neighboring repeat units are no more alike than randomly chosen ones. The results suggest that some mechanism, perhaps gene conversion, is acting to maintain the homogeneity of the satellite DNA despite its abundance and distribution on all of the chromosomes. Images PMID:2762148

  11. Intracellular survival of Staphylococcus aureus during persistent infection in the insect Tenebrio molitor.

    Science.gov (United States)

    McGonigle, John E; Purves, Joanne; Rolff, Jens

    2016-06-01

    Survival of bacteria within host cells and tissues presents a challenge to the immune systems of higher organisms. Escape from phagocytic immune cells compounds this issue, as immune cells become potential vehicles for pathogen dissemination. However, the duration of persistence within phagocytes and its contribution to pathogen load has yet to be determined. We investigate the immunological significance of intracellular persistence within the insect model Tenebrio molitor, assessing the extent, duration and location of bacterial recovery during a persistent infection. Relative abundance of Staphylococcus aureus in both intracellular and extracellular fractions was determined over 21 days, and live S. aureus were successfully recovered from both the hemolymph and within phagocytic immune cells across the entire time course. The proportion of bacteria recovered from within phagocytes also increased over time. Our results show that to accurately estimate pathogen load it is vital to account for bacteria persisting within immune cells. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Is there a relationship between insect metabolic rate and mortality of mealworms Tenebrio molitor L. after insecticide exposure?

    Directory of Open Access Journals (Sweden)

    Justyna MALISZEWSKA

    2016-09-01

    Full Text Available Pesticides are known to affect insects metabolic rate and CO2 release patterns. In the presented paper metabolic rate and mortality of mealworms Tenebrio molitor L. exposed to four different insecticides was evaluated, to find out whether there is a relationship between mealworms sensitivity to pesticides and their metabolic rate. Tenebrio molitor mortality was determined after intoxication with pyrethroid, oxadiazine, neonicotinoid and organophosphate. Metabolic rate before and after intoxication with insecticides was also determined. The highest CO2 production and mortality rate was observed after mealworms exposition to neonicotinoid insecticide. The results suggest that high CO2 release after intoxication is adequate to the intensity of the non-specific action of the xenobiotic (e.g. hyperactivity of neuromuscular system, rather than the intensity of detoxification processes, and it is correlated with mealworms mortality.

  13. HEAT INDUCIBLE EXPRESSION OF ANTIFREEZE PROTEIN GENES FROM THE BEETLES Tenebrio molitor AND Microdera punctipennis.

    Science.gov (United States)

    Li, Jieqiong; Ma, Wenjing; Ma, Ji

    2016-01-01

    Antifreeze proteins (AFPs) play important roles in protecting poikilothermic organisms from cold damage. The expression of AFP genes (afps) is induced by low temperature. However, it is reported that heat can influence the expression of afps in the desert beetle Microdera punctipennis. To further detect whether heat also induce the expression of afps in other insects, and to determine the expression profiling of insect afps at different temperatures. The expression of antifreeze protein genes in the two beetles, Microdera punctipennis and Tenebrio molitor that have quite different living environment, under different temperatures were studied by using real-time quantitative PCR. Mild low temperatures (5~15 degree C), high temperature (38~47 degree C for M. punctipennis, or 37~42 degree C for T. molitor) and temperature difference (10~30 degree C) all stimulated strongly to the expression of AFP genes (Mpafps) in M. punctipennis which lives in the wild filed in desert. The mRNA level of Mpafps after M. punctipennis were exposed to these temperatures for 1h~5h was at least 30-fold of the control at 25 degree C. For T. molitor which is breeding in door with wheat bran all these temperatures stimulated significantly to the expression of Tmafps, while the extent and degree of the temperature stimulation on Tmafps expression were much lower than on Mpafps. After T. molitor were exposed to 5 degree C and 15 degree C for 1h~5h, the mRNA level of Tmafps was over 6-fold and 45-fold of the control at 25 degree C. High temperature (37~42 degree C) for 1h~3h treatments increased Tmafps mRNA level 4.8-fold of the control. Temperature difference of 10 degree C was effective in stimulating Tmafps expression. The expression of insect antifreeze protein genes both in M. punctipennis and T. molitor was induced by heat, suggesting that this phenomenon may be common in insects; the extent and degree of the influence differ in species that have different living conditions. The heat

  14. Inbreeding affects sexual signalling in males but not females of Tenebrio molitor.

    Science.gov (United States)

    Pölkki, Mari; Krams, Indrikis; Kangassalo, Katariina; Rantala, Markus J

    2012-06-23

    In many species of animals, individuals advertise their quality with sexual signals to obtain mates. Chemical signals such as volatile pheromones are species specific, and their primary purpose is to influence mate choice by carrying information about the phenotypic and genetic quality of the sender. The deleterious effects of consanguineous mating on individual quality are generally known, whereas the effect of inbreeding on sexual signalling is poorly understood. Here, we tested whether inbreeding reduces the attractiveness of sexual signalling in the mealworm beetle, Tenebrio molitor, by testing the preferences for odours of inbred and outbred (control) individuals of the opposite sex. Females were more attracted to the odours produced by outbred males than the odours produced by inbred males, suggesting that inbreeding reduces the attractiveness of male sexual signalling. However, we did not find any difference between the attractiveness of inbred and outbred female odours, which may indicate that the quality of females is either irrelevant for T. molitor males or quality is not revealed through female odours.

  15. Cloning and expression of a novel antifreeze protein AFP72 from the beetle Tenebrio molitor.

    Science.gov (United States)

    Yan, Qing-Hua; Yang, Li; Wang, Qing; Zhang, Hui-Rong; Shao, Qiang

    2012-01-01

    A novel antifreeze protein AFP72 cDNA (GenBbank accession No. AY929389) was obtained by RT-PCR from Tenebrio molitor. The 216 bp fragment encodes a protein of 72 amino acid residues. Sequence analysis revealed that the cDNA displays a high degree of homology with T. molitor antifreeze proteins, ranging up to 90.78%. Recombinant plasmids pMAL-p2X-afp72 and pMAL-c2X-afp72 were transferred into E. coil TBI to induce a MBP fusion protein by IPTG. The target fusion protein was released from the periplasm and cytoplasm by the cold osmotic shock procedure and sonication respectively. The content of the fusion protein came up to 38.9 and 41.5% of the total dissolved protein, respectively. The fusion protein was purified through an amylose affinity column, and incised by factor Xa. Molecular sieve chromatography was used to achieve a high state of purity of the target protein. The purified target protein displayed a single band in SDS-PAGE. The fusion protein was shown to increase resistance to low temperatures in bacteria. This finding could help in further investigations of the properties and function of antifreeze proteins.

  16. Trade-off between cellular immunity and life span in mealworm beetles Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Indrikis KRAMS, Janīna DAUKŠTE, Inese KIVLENIECE, Ants KAASIK, Tatjana KRAMA, Todd M. REEBERG, Markus J. RANTALA

    2013-06-01

    Full Text Available Encapsulation is a nonspecific, cellular response through which insects defend themselves against multicellular pathogens. During this immune reaction, haemocytes recognize an object as foreign and cause other haemocytes to aggregate and form a capsule around the object, often consisting of melanized cells. The process of melanisation is accompanied by the formation of potentially toxic reactive oxygen species, which can kill not only pathogens but also host cells. In this study we tested whether the encapsulation response is costly in mealworm beetles Tenebrio molitor. We found a negative relationship between the duration of implantation via a nylon monofilament and remaining life span. We also found a negative relationship between the strength of immune response and remaining life span, suggesting that cellular immunity is costly in T. molitor, and that there is a trade-off between immune response and remaining life span. However, this relationship disappeared at 31-32 hours of implantation at 25 ± 2℃. As the disappearance of a relationship between duration of implantation and lifespan coincided with the highest values of encapsulation response, we concluded that the beetles stopped investment in the production of melanotic cells, as the implant, a synthetic parasite, was fully isolated from the host’s tissues [Current Zoology 59 (3: 340–346, 2013].

  17. Self-selection of two diet components by Tennebrio molitor (Coleoptera: Tenebrionidae) larvae and its impact on fitness

    Science.gov (United States)

    We studied the ability of Tenebrio molitor L. (Coleoptera: Tenebrionidae) to self-select optimal ratios of two dietary components to approach nutritional balance and maximum fitness. Life table analysis was used to determine the fitness of T. molitor developing in diet mixtures comprised of four dif...

  18. Cloning, expression analysis, and RNA interference study of a HORMA domain containing autophagy-related gene 13 (ATG13) from the coleopteran beetle, Tenebrio molitor

    Science.gov (United States)

    Lee, Jung Hee; Jo, Yong Hun; Patnaik, Bharat Bhusan; Park, Ki Beom; Tindwa, Hamisi; Seo, Gi Won; Chandrasekar, Raman; Lee, Yong Seok; Han, Yeon Soo

    2015-01-01

    Autophagy is a process that is necessary during starvation, as it replenishes metabolic precursors by eliminating damaged organelles. Autophagy is mediated by more than 35 autophagy-related (Atg) proteins that participate in the nucleation, elongation, and curving of the autophagosome membrane. In a pursuit to address the role of autophagy during development and immune resistance of the mealworm beetle, Tenebrio molitor, we screened ATG gene sequences from the whole-larva transcriptome database. We identified a homolog of ATG13 gene in T. molitor (designated as TmATG13) that comprises a cDNA of 1176 bp open reading frame (ORF) encoding a protein of 391 amino acids. Analyses of the structure-specific features of TmAtg13 showed an intrinsically disordered middle and C-terminal region that was rich in regulatory phosphorylation sites. The N-terminal Atg13 domain had a HORMA (Hop1, Rev7, and Mad2) fold containing amino acid residues conserved across the Atg13 insect orthologs. A quantitative reverse-transcription-polymerase chain reaction analysis revealed that TmATG13 was expressed ubiquitously during all developmental stages of the insect. TmATG13 mRNA expression was high in the fat body and gut of the larval and adult stages of the insect. The TmATG13 transcripts were expressed at a high level until 6 days of ovarian development, followed by a significant decline. Silencing of ATG13 transcripts in T. molitor larvae showed a reduced survivability of 39 and 38% in response to Escherichia coli and Staphylococcus aureus infection. Furthermore, the role of TmAtg13 in initiating autophagy as a part of the host cell autophagic complex of the host cells against the intracellular pathogen Listeria monocytogenes is currently under study and will be critical to unfold the structure-function relationships. PMID:26136688

  19. Recognition, survival and persistence of Staphylococcus aureus in the model host Tenebrio molitor.

    Science.gov (United States)

    Dorling, Jack; Moraes, Caroline; Rolff, Jens

    2015-02-01

    The degree of specificity of any given immune response to a parasite is governed by the complexity and variation of interactions between host and pathogen derived molecules. Here, we assess the extent to which recognition and immuno-resistance of cell wall mutants of the pathogen Staphylococcus aureus may contribute to establishment and maintenance of persistent infection in the model insect host, Tenebrio molitor. The cell surface of S. aureus is decorated with various molecules, including glycopolymers such as wall teichoic acid (WTA). WTA is covalently bound to peptidoglycan (PGN) and its absence has been associated with increased recognition of PGN by host receptors (PGRPs). WTA is also further modified by other molecules such as D-alanine (D-alanylation). Both the level of WTA expression and its D-alanylation were found to be important in the mediation of the host-parasite interaction in this model system. Specifically, WTA itself was seen to influence immune recognition, while D-alanylation of WTA was found to increase immuno-resistance and was associated with prolonged persistence of S. aureus in T. molitor. These results implicate WTA and its D-alanylation as important factors in the establishment and maintenance of persistent infection, affecting different critical junctions in the immune response; through potential evasion of recognition by PGRPs and resistance to humoral immune effectors during prolonged exposure to the immune system. This highlights a mechanism by which specificity in this host-parasite interaction may arise. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Inducible defenses stay up late: temporal patterns of immune gene expression in Tenebrio molitor.

    Science.gov (United States)

    Johnston, Paul R; Makarova, Olga; Rolff, Jens

    2013-12-06

    The course of microbial infection in insects is shaped by a two-stage process of immune defense. Constitutive defenses, such as engulfment and melanization, act immediately and are followed by inducible defenses, archetypically the production of antimicrobial peptides, which eliminate or suppress the remaining microbes. By applying RNAseq across a 7-day time course, we sought to characterize the long-lasting immune response to bacterial challenge in the mealworm beetle Tenebrio molitor, a model for the biochemistry of insect immunity and persistent bacterial infection. By annotating a hybrid de novo assembly of RNAseq data, we were able to identify putative orthologs for the majority of components of the conserved insect immune system. Compared with Tribolium castaneum, the most closely related species with a reference genome sequence and a manually curated immune system annotation, the T. molitor immune gene count was lower, with lineage-specific expansions of genes encoding serine proteases and their countervailing inhibitors accounting for the majority of the deficit. Quantitative mapping of RNAseq reads to the reference assembly showed that expression of genes with predicted functions in cellular immunity, wound healing, melanization, and the production of reactive oxygen species was transiently induced immediately after immune challenge. In contrast, expression of genes encoding antimicrobial peptides or components of the Toll signaling pathway and iron sequestration response remained elevated for at least 7 days. Numerous genes involved in metabolism and nutrient storage were repressed, indicating a possible cost of immune induction. Strikingly, the expression of almost all antibacterial peptides followed the same pattern of long-lasting induction, regardless of their spectra of activity, signaling possible interactive roles in vivo. Copyright © 2014 Johnston et al.

  1. Melanization and Pathogenicity in the Insect, Tenebrio molitor, and the Crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3

    Science.gov (United States)

    Noonin, Chadanat; Jiravanichpaisal, Pikul; Söderhäll, Irene; Merino, Susana; Tomás, Juan M.; Söderhäll, Kenneth

    2010-01-01

    Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS), bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core) is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT) containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the proPO system

  2. Melanization and pathogenicity in the insect, Tenebrio molitor, and the crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3.

    Directory of Open Access Journals (Sweden)

    Chadanat Noonin

    Full Text Available Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS, bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish and Tenebrio molitor larvae (mealworm. The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the

  3. Melanization and pathogenicity in the insect, Tenebrio molitor, and the crustacean, Pacifastacus leniusculus, by Aeromonas hydrophila AH-3.

    Science.gov (United States)

    Noonin, Chadanat; Jiravanichpaisal, Pikul; Söderhäll, Irene; Merino, Susana; Tomás, Juan M; Söderhäll, Kenneth

    2010-12-29

    Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS), bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core) is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT) containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the proPO system

  4. Genomic organization, sequence characterization and expression analysis of Tenebrio molitor apolipophorin-III in response to an intracellular pathogen, Listeria monocytogenes.

    Science.gov (United States)

    Noh, Ju Young; Patnaik, Bharat Bhusan; Tindwa, Hamisi; Seo, Gi Won; Kim, Dong Hyun; Patnaik, Hongray Howrelia; Jo, Yong Hun; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung; Han, Yeon Soo

    2014-01-25

    Apolipophorin III (apoLp-III) is a well-known hemolymph protein having a functional role in lipid transport and immune response of insects. We cloned full-length cDNA encoding putative apoLp-III from larvae of the coleopteran beetle, Tenebrio molitor (TmapoLp-III), by identification of clones corresponding to the partial sequence of TmapoLp-III, subsequently followed with full length sequencing by a clone-by-clone primer walking method. The complete cDNA consists of 890 nucleotides, including an ORF encoding 196 amino acid residues. Excluding a putative signal peptide of the first 20 amino acid residues, the 176-residue mature apoLp-III has a calculated molecular mass of 19,146Da. Genomic sequence analysis with respect to its cDNA showed that TmapoLp-III was organized into four exons interrupted by three introns. Several immune-related transcription factor binding sites were discovered in the putative 5'-flanking region. BLAST and phylogenetic analyses reveal that TmapoLp-III has high sequence identity (88%) with Tribolium castaneum apoLp-III but shares little sequence homologies (molitor. Copyright © 2013 Elsevier B.V. All rights reserved.

  5. Transformation of Beauveria bassiana to produce EGFP in Tenebrio molitor for use as animal feed additives.

    Science.gov (United States)

    Kim, Jae Su; Choi, Jae Young; Lee, Se Jin; Lee, Ju Hyun; Fu, Zhenli; Skinner, Margaret; Parker, Bruce L; Je, Yeon Ho

    2013-07-01

    Efforts are underway to develop more effective and safer animal feed additives. Entomopathogenic fungi can be considered practical expression platforms of functional genes within insects which have been used as animal feed additives. In this work, as a model, the enhanced green fluorescent protein (egfp) gene was expressed in yellow mealworms, Tenebrio molitor by highly infective Beauveria bassiana ERL1170. Among seven test isolates, ERL1170 treatment showed 57.1% and 98.3% mortality of mealworms 2 and 5 days after infection, respectively. The fungal transformation vector, pABeG containing the egfp gene, was inserted into the genomic DNA of ERL1170 using the restriction enzyme-mediated integration method. This resulted in the generation of the transformant, Bb-egfp#3, which showed the highest level of fluorescence. Bb-egfp#3-treated mealworms gradually turned dark brown, and in 7-days mealworm sections showed a strong fluorescence. This did not occur in the wild-type strain. This work suggests that further valuable proteins can be efficiently produced in this mealworm-based fungal expression platform, thereby increasing the value of mealworms in the animal feed additive industry. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.

  6. Isolation of proteolytic bacteria from mealworm (Tenebrio molitor) exoskeletons to produce chitinous material.

    Science.gov (United States)

    da Silva, Fernanda Kerche Paes; Brück, Dieter W; Brück, Wolfram M

    2017-09-15

    The use of insects as a source of protein is becoming an important factor for feeding an increasing population. After protein extraction for food use, the insect exoskeleton may offer the possibility for the production of added value products. Here, the aim was to isolate bacteria from the surface of farmed mealworms (Tenebrio molitor Linnaeus, 1758) for the production of chitinous material from insect exoskeletons using microbial fermentation. Isolates were screened for proteases and acid production that may aid deproteination and demineralisation of insects through fermentation to produce chitin. Selected isolates were used single-step (isolated bacteria only) or two-step fermentations with Lactobacillus plantarum (DSM 20174). Two-step fermentations with isolates from mealworm exoskeletons resulted in a demineralisation of 97.9 and 98.5% from deproteinated mealworm fractions. Attenuated total reflectance-Fourier- transform infrared spectroscopy analysis showed that crude chitin was produced. However, further optimisation is needed before the process can be upscaled. This is, to our knowledge, the first report using microbial fermentation for the extraction of chitin from insects. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  7. Hydration behavior at the ice-binding surface of the Tenebrio molitor antifreeze protein.

    Science.gov (United States)

    Midya, Uday Sankar; Bandyopadhyay, Sanjoy

    2014-05-08

    Molecular dynamics (MD) simulations have been carried out at two different temperatures (300 and 220 K) to study the conformational rigidity of the hyperactive Tenebrio molitor antifreeze protein (TmAFP) in aqueous medium and the structural arrangements of water molecules hydrating its surface. It is found that irrespective of the temperature the ice-binding surface (IBS) of the protein is relatively more rigid than its nonice-binding surface (NIBS). The presence of a set of regularly arranged internally bound water molecules is found to play an important role in maintaining the flat rigid nature of the IBS. Importantly, the calculations reveal that the strategically located hydroxyl oxygens of the threonine (Thr) residues in the IBS influence the arrangements of five sets of ordered waters around it on two parallel planes that closely resemble the basal plane of ice. As a result, these waters can register well with the ice basal plane, thereby allowing the IBS to preferentially bind at the ice interface and inhibit its growth. This provides a possible molecular reason behind the ice-binding activity of TmAFP at the basal plane of ice.

  8. Quantity estimation based on numerical cues in the mealworm beetle (Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Pau eCarazo

    2012-11-01

    Full Text Available In this study, we used a biologically relevant experimental procedure to ask whether mealworm beetles (Tenebrio molitor are spontaneously capable of assessing quantities based on numerical cues. Like other insect species, mealworm beetles adjust their reproductive behaviour (i.e. investment in mate guarding according to the perceived risk of sperm competition (i.e. probability that a female will mate with another male. To test whether males have the ability to estimate numerosity based on numerical cues, we staged matings between virgin females and virgin males in which we varied the number of rival males the experimental male had access to immediately preceding mating as a cue to sperm competition risk (from 1 to 4. Rival males were presented sequentially, and we controlled for continuous cues by ensuring that males in all treatments were exposed to the same amount of male-male contact. Males exhibited a marked increase in the time they devoted to mate guarding in response to an increase in the number of different rival males they were exposed to. Since males could not rely on continuous cues we conclude that they kept a running tally of the number of individuals they encountered serially, which meets the requirements of the basic ordinality and cardinality principles of proto-counting. Our results thus offer good evidence of ‘true’ numerosity estimation or quantity estimation and, along with recent studies in honey-bees, suggest that vertebrates and invertebrates share similar core systems of non-verbal numerical representation.

  9. Effects of inbreeding on potential and realized immune responses in Tenebrio molitor.

    Science.gov (United States)

    Rantala, Markus J; Viitaniemi, Heidi; Roff, Derek A

    2011-06-01

    Although numerous studies on vertebrates suggest that inbreeding reduces their resistance against parasites and pathogens, studies in insects have found contradictory evidence. In this study we tested the effect of 1 generation of brother-sister mating (inbreeding) on potential and realized immune responses and other life-history traits in Tenebrio molitor. We found that inbreeding reduced adult mass, pre-adult survival and increased development time, suggesting that inbreeding reduced the condition of the adults and thus potentially made them more susceptible to physiological stress. However, we found no significant effect of inbreeding on the potential immune response (encapsulation response), but inbreeding reduced the realized immune response (resistance against the entomopathogenic fungi, Beauveria bassiana). There was a significant family effect on encapsulation response, but no family effect on the resistance against the entomopathogenic fungi. Given that this latter trait showed significant inbreeding depression and that the sample size for the family-effect analysis was small it is likely that the lack of a significant family effect is due to reduced statistical power, rather than the lack of a heritable basis to the trait. Our study highlights the importance of using pathogens and parasites in immunoecological studies.

  10. Parasitization by Scleroderma guani influences protein expression in Tenebrio molitor pupae.

    Science.gov (United States)

    Zhu, Jia-Ying; Wu, Guo-Xing; Ze, Sang-Zi; Stanley, David W; Yang, Bin

    2014-07-01

    Ectoparasitoid wasps deposit their eggs onto the surface and inject venom into their hosts. Venoms are chemically complex and they exert substantial impact on hosts, including permanent or temporary paralysis and developmental arrest. These visible venom effects are due to changes in expression of genes encoding physiologically relevant proteins. While the influence of parasitization on gene expression in several lepidopterans has been reported, the molecular details of parasitoid/beetle relationships remain mostly unknown. This shortcoming led us to pose the hypothesis that envenomation by the ectoparasitic ant-like bethylid wasp Scleroderma guani leads to changes in protein expression in the yellow mealworm beetle Tenebrio molitor. We tested our hypothesis by comparing the proteomes of non-parasitized and parasitized host pupae using iTRAQ-based proteomics. We identified 41 proteins that were differentially expressed (32↑- and 9↓-regulated) in parasitized pupae. We assigned these proteins to functional categories, including immunity, stress and detoxification, energy metabolism, development, cytoskeleton, signaling and others. We recorded parallel changes in mRNA levels and protein abundance in 14 selected proteins following parasitization. Our findings support our hypothesis by documenting changes in protein expression in parasitized hosts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  11. The role of side chain conformational flexibility in surface recognition by Tenebrio molitor antifreeze protein

    Science.gov (United States)

    Daley, Margaret E.; Sykes, Brian D.

    2003-01-01

    Two-dimensional nuclear magnetic resonance spectroscopy was used to investigate the flexibility of the threonine side chains in the β-helical Tenebrio molitor antifreeze protein (TmAFP) at low temperatures. From measurement of the 3Jαβ 1H-1H scalar coupling constants, the χ1 angles and preferred rotamer populations can be calculated. It was determined that the threonines on the ice-binding face of the protein adopt a preferred rotameric conformation at near freezing temperatures, whereas the threonines not on the ice-binding face sample many rotameric states. This suggests that TmAFP maintains a preformed ice-binding conformation in solution, wherein the rigid array of threonines that form the AFP-ice interface matches the ice crystal lattice. A key factor in binding to the ice surface and inhibition of ice crystal growth appears to be the close surface-to-surface complementarity between the AFP and crystalline ice, and the lack of an entropic penalty associated with freezing out motions in a flexible ligand. PMID:12824479

  12. Interaction of Tenebrio Molitor Antifreeze Protein with Ice Crystal: Insights from Molecular Dynamics Simulations.

    Science.gov (United States)

    Ramya, L; Ramakrishnan, Vigneshwar

    2016-07-01

    Antifreeze proteins (AFP) observed in cold-adapting organisms bind to ice crystals and prevent further ice growth. However, the molecular mechanism of AFP-ice binding and AFP-inhibited ice growth remains unclear. Here we report the interaction of the insect antifreeze protein (Tenebrio molitor, TmAFP) with ice crystal by molecular dynamics simulation studies. Two sets of simulations were carried out at 263 K by placing the protein near the primary prism plane (PP) and basal plane (BL) of the ice crystal. To delineate the effect of temperatures, both the PP and BL simulations were carried out at 253 K as well. The analyses revealed that the protein interacts strongly with the ice crystal in BL simulation than in PP simulation both at 263 K and 253 K. Further, it was observed that the interactions are primarily mediated through the interface waters. We also observed that as the temperature decreases, the interaction between the protein and the ice increases which can be attributed to the decreased flexibility and the increased structuring of the protein at low temperature. In essence, our study has shed light on the interaction mechanism between the TmAFP antifreeze protein and the ice crystal. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Observation of two-dimensional yttrium oxide nanoparticles in mealworm beetles (Tenebrio molitor).

    Science.gov (United States)

    Chen, Yunyun; Sanchez, Carlos; Yue, Yuan; González, Jorge M; Parkinson, Dilworth Y; Liang, Hong

    2016-09-01

    Nanomaterials are being used in medicine, manufacturing and consumer products, but their effects on organisms and the environment are not well understood because of the difficulty in detecting them. Here dual-energy X-ray K-edge subtraction was used to track two-dimensional yttrium oxide nanoparticles (which can be found in such household objects as color televisions) in adult mealworms (Tenebrio molitor). The insects ingested nanoparticle-infused feed for different time periods, up to 24 h, and the nanoparticles could then be identified at several locations in the insects' head, thorax and abdomen, mostly within the digestive tract. In time, all particles were excreted.

  14. [Effect of weak combined magnetic fields on the metamorphosis of the meal-worm beetle Tenebrio molitor].

    Science.gov (United States)

    Ermakov, A M; Lednev, V V

    2010-01-01

    The effects of weak combined magnetic fields adjusted to the parametric resonance for Ca2+ and K+ and extremely weak alternating magnetic field on the metamorphosis of the meal-worm beetle Tenebrio molitor have been studied. It was shown that the exposure of pupas of insects to all above-indicated types of fields stimulates the metamorphosis. However, after the exposure to weak combined magnetic fields adjusted to the parametric resonance for Ca2+ and K+, the number of insects with anomalies increases, which is not observed by the action of the weak alternating magnetic field.

  15. Propriedade inseticida dos óleos essenciais de Piper hispidinervum C. DC.; Piper aduncum L. e Tanaecium nocturnum (Barb. Rodr. Bur. & K. Shum sobre Tenebrio molitor L., 1758 Insecticidal properties of essential oils of Piper hispidinervum C. DC.; Piper aduncum L. and Tanaecium nocturnum (Barb. Rodr. Bur. & K. Shum against Tenebrio molitor L., 1758

    Directory of Open Access Journals (Sweden)

    Murilo Fazolin

    2007-02-01

    Full Text Available Óleos essenciais das piperáceas Piper aduncum L., Piper hispidinervum C. DC. e da bignoniácea Tanaecium nocturnum (Barb. Rodr. Bur. & K. Shum foram avaliados para o controle de larvas de Tenebrio molitor L., 1758. Para a avaliação do efeito por contato em superfície contaminada, foram utilizados papéis-filtro impregnados com diferentes quantidades dos óleos essenciais. Para a avaliação do efeito tópico foram aplicados 5 mL de soluções com diferentes concentrações dos óleos sobre larvas de quinto instar do inseto. A taxa de mortalidade foi a variável utilizada para avaliar os experimentos. Todos os óleos essenciais apresentaram efeito inseticida sobre larvas de T. molitor, sendo que as respostas variaram em função da concentração utilizada, assim como do método de exposição do inseto. A toxicidade dos óleos essenciais foi elevada apresentando os seguintes valores de CL50: 0,045; 0,033 e 1,515 mL de óleo cm-2 para exposição por contato (papel filtro aos óleos de P. hispidinervum,P. aduncum e T. nocturnum, respectivamente. Para a aplicação tópica, os valores da DL50 foram de: 0,000025; 0,009 e 0,000015 mL de óleo mg de inseto -1 para os óleos essenciais de P. hispidinervum,P. aduncum e T. nocturnum, respectivamente. Resultados promissores para o emprego desses óleos essenciais como inseticidas foram obtidos utilizando-se concentrações acima de 3,0% (v v-1 para P. hispidinervum e 2,5% (v v-1 para P. aduncum e T. nocturnum.Essential oils from Piper aduncum L., Piper hispidinervum C. DC. (Piperaceae and Tanaecium nocturnum (Barb. Rodr. Bur.& K. Shum (Bignoniaceae were tested against Tenebrio molitor L., 1758 larvaes. Filter paper with different amounts of oils were employed for contact toxicity effects study. For topical effect study, aliquots of 5 mL of oils at different concentrations were applied on larvaes of the fifth instar. Mortality rate was used to evaluate the assays. All essential oils possessed

  16. Geometric analysis of nutrient balancing in the mealworm beetle, Tenebrio molitor L. (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Rho, Myung Suk; Lee, Kwang Pum

    2014-12-01

    Geometric analysis of the nutritional regulatory responses was performed on an omnivorous mealworm beetle, Tenebrio molitor L. (Coleoptera: Tenebrionidae) to test whether this beetle had the capacity to balance the intake of protein and carbohydrate. We also identified the pattern of ingestive trade-off employed when the insect was forced to balance the costs of over- and under-ingesting macronutrients. When allowed to mix their diet from two nutritionally imbalanced but complementary foods (protein-biased food: p35:c7 or p28:c5.6; carbohydrate-biased food: p7:c35 or p5.6:c28), beetles of both sexes actively regulated their intake of protein and carbohydrate to a ratio of 1:1. When confined to one of seven nutritionally imbalanced foods (p0:c42, p7:c35, p14:c28, p21:c21, p28:c14, p35:c7 or p42:c0), beetles over-ingested the excessive nutrient from these foods to such an extent that all the points of protein-carbohydrate intake aligned linearly in the nutrient space, a pattern that is characteristic of generalist feeders and omnivores. Under the restricted feeding conditions, males ate more nutrients but were less efficient at retaining their body lipids than females. Body lipid content was higher on carbohydrate-rich foods and was positively correlated with starvation resistance. Our results are consistent with the prediction based on the nutritional heterogeneity hypothesis, which links the nutritional regulatory responses of insects to their diet breadth and feeding ecology. Copyright © 2014. Published by Elsevier Ltd.

  17. Occurrence of transferable antibiotic resistances in commercialized ready-to-eat mealworms (Tenebrio molitor L.).

    Science.gov (United States)

    Osimani, Andrea; Cardinali, Federica; Aquilanti, Lucia; Garofalo, Cristiana; Roncolini, Andrea; Milanović, Vesna; Pasquini, Marina; Tavoletti, Stefano; Clementi, Francesca

    2017-12-18

    The present study aimed to assess the occurrence of transferable determinants conferring resistance to tetracyclines, macrolide-lincosamide-streptogramin B, vancomycin, beta-lactams, and aminoglycosides in 40 samples of commercialized edible mealworms (Tenebrio molitor L.) purchased from European Union (EU) and non-EU producers. A high prevalence of tet(K) was observed in all of the samples assayed, with percentages of PCR-based positivity that ranged from 80% (samples from Thailand) to 100% (samples from the Netherlands, Belgium and France). For macrolides, erm(B) prevailed, being detected in 57.5% of the samples assayed, whereas erm(A) and erm(C) were detected with lower frequencies. Genes for resistance to vancomycin were only detected in samples produced in France and Belgium, with 90% and 10% of the samples being positive for vanA, respectively. Beta-lactamase genes were found with low occurrence, whereas the gene aac-aph, conferring high resistance to aminoglycosides, was found in 40% of the samples produced in the Netherlands and Belgium and 20% of the samples produced in Thailand. The results of Principal Coordinate Analysis and Principal Component Analysis depicted a clean separation of the samples collected from the four producers based on the distribution of the 12 AR determinants considered. Given the growing interest on the use of mealworms as a novel protein source, AR detection frequencies found in the present study suggest further investigation into the use of antibiotics during rearing of this insect species and more extensive studies focused on the factors that can affect the diffusion of transferable ARs in the production chain. Until such studies are completed, prudent use of antibiotics during rearing of edible insects is recommended. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. A study of the female produced sex pheromone of Tenebrio molitor (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    Mangat, Jaswinder

    Mating behaviour in the yellow mealworm beetle, Tenebrio molitor , is mediated by several pheromones, including the female-produced 4-methylnonanol (4-MNol). Mating causes a decline in the titre of 4-MNol. The overall goal of this study was to determine the biochemical mechanism(s) responsible for this decline: i.e., whether the decline was due to an inhibition of pheromone biosynthesis and/or a stimulation of pheromone degradation; whether the decline was caused by the physical effect of mating or was due to the transfer of a factor from the male; and to conduct a preliminary investigation of the regulatory and signal transduction mechanisms involved in the regulation of 4-MNol production. In vitro radioassays for 4-MNol biosynthesis and degradation were developed and used to compare the levels of 4-MNol biosynthesis and degradation in virgin and mated females. Mating caused an inhibition of 4-MNol biosynthesis within 2 hours, but did not affect the rate of pheromone degradation. Decapitation of virgin females caused an inhibition of pheromone biosynthesis and did not prevent the inhibitory effect of mating. The inhibitory effect of mating was mimicked in females that were artificially inseminated with male reproductive tract homogenates (MRTH), but not in females similarly "inseminated" with water, saline, or air. Furthermore, 4-MNol biosynthesis could be inhibited in vitro by the addition of MRTH. These findings indicate that the male transferred one or more pheromonostatic factor(s) to the female during copulation that acted directly on the pheromone-producing tissue (the ovaries). In order to investigate the biochemical basis for the inhibition of pheromone biosynthesis after mating, the role of calcium was determined by modulating the level of calcium (using a calcium chelator, an ionophore, and calcium). However, due to the precipitation of calcium with the phosphate present in the buffer solution, we were unable to determine the role of calcium in the

  19. TmSR-C, scavenger receptor class C, plays a pivotal role in antifungal and antibacterial immunity in the coleopteran insect Tenebrio molitor.

    Science.gov (United States)

    Kim, Soo Gon; Jo, Yong Hun; Seong, Jeong Hwan; Park, Ki Beom; Noh, Mi Young; Cho, Jun Ho; Ko, Hye Jin; Kim, Chang Eun; Tindwa, Hamisi; Patnaik, Bharat Bhusan; Bang, In Seok; Lee, Yong Seok; Han, Yeon Soo

    2017-10-01

    Scavenger receptors (SRs) constitute a family of membrane-bound receptors that bind to multiple ligands. The SR family of proteins is involved in removing cellular debris, oxidized low-density lipoproteins, and pathogens. Specifically, class C scavenger receptors (SR-C) have also been reported to be involved in phagocytosis of gram-positive and -negative bacteria in Drosophila and viruses in shrimp. However, reports are unavailable regarding the role of SR-C in antifungal immune mechanisms in insects. In this study, a full-length Tenebrio molitor SR-C (TmSR-C) sequence was obtained by 5'- and 3'-Rapid amplification of cDNA ends-polymerase chain reaction (RACE-PCR). The TmSR-C full-length cDNA comprised 1671 bp with 5'- and 3'-untranslated regions of 23- and 107-bp, respectively. TmSR-C encodes a putative protein of 556 amino acid residues that is constitutively expressed in all tissues of late instar larvae and 2-day-old adults, with the highest transcript levels observed in hemocytes of larvae and adults. TmSR-C mRNA showed a 2.5-fold and 3-fold increase at 24 and 6 h after infection with Candida albicans and β-glucan, respectively. Immunoassay with TmSR-C polyclonal antibody showed induction of the putative protein in the cytosols of hemocytes at 3 h after inoculation of C. albicans. RNA interference (RNAi)-based gene silencing and phagocytosis assays were used to understand the role of TmSR-C in antifungal immunity. Silencing of TmSR-C transcripts reduced the survivability of late instar larvae at 2 days post-inoculation of C. albicans, Escherichia coli, or Staphylococcus aureus. Furthermore, in TmSR-C-silenced larvae, there was a decline in the rate of microorganism phagocytosis. Taken together, results of this study suggest that TmSR-C plays a pivotal role in phagocytosing not only fungi but also gram-negative and -positive bacteria in T. molitor. Copyright © 2017. Published by Elsevier Ltd.

  20. Tobacco plants transformed with the bean. alpha. ai gene express an inhibitor of insect. alpha. -amylase in their seeds. [Nicotiana tabacum; Tenebrio molitor

    Energy Technology Data Exchange (ETDEWEB)

    Altabella, T.; Chrispeels, M.J. (Univ. of California, San Diego, La Jolla (USA))

    1990-06-01

    Bean (Phaseolus vulgaris L.) seeds contain a putative plant defense protein that inhibits insect and mammalian but not plant {alpha}-amylases. We recently presented strong circumstantial evidence that this {alpha}-amylase inhibitor ({alpha}Al) is encoded by an already-identified lectin gene whose product is referred to as lectin-like-protein (LLP). We have now made a chimeric gene consisting of the coding sequence of the lectin gene that encodes LLP and the 5{prime} and 3{prime} flanking sequences of the lectin gene that encodes phytohemagglutinin-L. When this chimeric gene was expressed in transgenic tobacco (Nicotiana tabacum), we observed in the seeds a series of polypeptides (M{sub r} 10,000-18,000) that cross-react with antibodies to the bean {alpha}-amylase inhibitor. Most of these polypeptides bind to a pig pancreas {alpha}-amylase affinity column. An extract of the seeds of the transformed tobacco plants inhibits pig pancreas {alpha}-amylase activity as well as the {alpha}-amylase present in the midgut of Tenebrio molitor. We suggest that introduction of this lectin gene (to be called {alpha}ai) into other leguminous plants may be a strategy to protect the seeds from the seed-eating larvae of Coleoptera.

  1. Identification, molecular cloning and expression analysis of a HORMA domain containing Autophagy-related gene 13 (ATG13 from the coleopteran beetle, Tenebrio molitor

    Directory of Open Access Journals (Sweden)

    Jung Hee eLee

    2015-06-01

    Full Text Available Autophagy is a process that is necessary during starvation as it replenishes metabolic precursors by eliminating damaged organelles. Autophagy is mediated by more than 35 autophagy-related (Atg proteins that manifest in the nucleation, elongation, and curving of autophagosome membrane. We isolated a homolog of an ATG13 gene from the transcriptome database of the larva of the mealworm beetle, Tenebrio molitor (designated as TmATG13. The sequence analysis showed that TmATG13 cDNA comprises of 1,176 bp open reading frame that encodes a protein of 391 amino acids. Analyses of the structure-specific features of TmAtg13 showed an intrinsically disordered middle and C-terminal region, rich in regulatory phosphorylation sites. The N-terminal Atg13 domain show a HORMA (Hop1, Rev7, and Mad2 fold containing conserved amino acid residues across the Atg13 orthologs in insects. qRT-PCR revealed that TmATG13 was expressed ubiquitously in all the developmental stages of insect. TmATG13 mRNA expression was high in fat body and gut of the larval and adult stages of the insect. During ovary development and maturation, the TmATG13 transcripts showed high expression until six days of development, followed by a significant decline. The prospective functions mediated by TmAtg13 during autophagy will be clarified by further studies in the near future.

  2. A physiologically-oriented transcriptomic analysis of the midgut of Tenebrio molitor.

    Science.gov (United States)

    Moreira, Nathalia R; Cardoso, Christiane; Dias, Renata O; Ferreira, Clelia; Terra, Walter R

    2017-05-01

    Physiological data showed that T. molitor midgut is buffered at pH 5.6 at the two anterior thirds and at 7.9 at the posterior third. Furthermore, water is absorbed and secreted at the anterior and posterior midgut, respectively, driving a midgut counter flux of fluid. To look for the molecular mechanisms underlying these phenomena and nutrient absorption as well, a transcriptomic approach was used. For this, 11 types of transporters were chosen from the midgut transcriptome obtained by pyrosequencing (Roche 454). After annotation with the aid of databanks and manual curation, the sequences were validated by RT-PCR. The expression level of each gene at anterior, middle and posterior midgut and carcass (larva less midgut) was evaluated by RNA-seq taking into account reference sequences based on 454 contigs and reads obtained by Illumina sequencing. The data showed that sugar and amino acid uniporters and symporters are expressed along the whole midgut. In the anterior midgut are found transporters for NH3 and NH4+ that with a chloride channel may be responsible for acidifying the lumen. At the posterior midgut, bicarbonate-Cl- antiporter with bicarbonate supplied by carbonic anhydrase may alkalinize the lumen. Water absorption caused mainly by an anterior Na+-K+-2Cl- symporter and water secretion caused by a posterior K+-Cl- may drive the midgut counter flux. Transporters that complement the action of those described were also found. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. ‘Trans-generational immune priming’: specific enhancement of the antimicrobial immune response in the mealworm beetle, Tenebrio molitor

    Science.gov (United States)

    Moret, Yannick

    2006-01-01

    Encounters with parasites and pathogens are often unpredictable in time. However, experience of an infection may provide the host with reliable cues about the future risk of infection for the host itself or for its progeny. If the parental environment predicts the quality of the progeny's environment, then parents may further enhance their net reproductive success by differentially providing their offspring with phenotypes to cope with potential hazards such as pathogen infection. Here, I test for the occurrence of such an adaptive transgenerational phenotypic plasticity in the mealworm beetle, Tenebrio molitor. A pathogenic environment was mimicked by injection of bacterial lipopolysaccharides for two generations of insects. I found that parental challenge enhanced offspring immunity through the inducible production of antimicrobial peptides in the haemolymph. PMID:16777729

  4. A behavioral study of the beetle Tenebrio molitor infected with cysticercoids of the rat tapeworm Hymenolepis diminuta

    Science.gov (United States)

    Sheiman, I. M.; Shkutin, M. F.; Terenina, N. B.; Gustafsson, M. K. S.

    2006-06-01

    The host-parasite relationship, Tenebrio molitor- Hymenolepis diminuta, was analyzed. The learning behavior of infected and uninfected (control) beetles in a T-maze was compared. The infected beetles moved much slower in the T-maze than the controls. The infected beetles reached the same level of learning as the controls. However, they needed more trials than the controls. The effect of the infection was already distinct after the first week and even higher after the second week. This indicates that the initial phase of infection caused stress in the beetles. Longer infection did not worsen their ability to learn. Thus, the parasites clearly changed the behavior of their intermediate host and probably made them more susceptible to their final host, the rat.

  5. Identification and expression analysis of a novel R-type lectin from the coleopteran beetle, Tenebrio molitor.

    Science.gov (United States)

    Kim, Dong Hyun; Patnaik, Bharat Bhusan; Seo, Gi Won; Kang, Seong Min; Lee, Yong Seok; Lee, Bok Luel; Han, Yeon Soo

    2013-11-01

    We have identified novel ricin-type (R-type) lectin by sequencing of random clones from cDNA library of the coleopteran beetle, Tenebrio molitor. The cDNA sequence is comprised of 495 bp encoding a protein of 164 amino acid residues and shows 49% identity with galectin of Tribolium castaneum. Bioinformatics analysis shows that the amino acid residues from 35 to 162 belong to ricin-type beta-trefoil structure. The transcript was significantly upregulated after early hours of injection with peptidoglycans derived from Gram (+) and Gram (-) bacteria, beta-1, 3 glucan from fungi and an intracellular pathogen, Listeria monocytogenes suggesting putative function in innate immunity. Copyright © 2013 Elsevier Inc. All rights reserved.

  6. Infection increases the value of nuptial gifts, and hence male reproductive success, in the Hymenolepis diminuta-Tenebrio molitor association.

    Science.gov (United States)

    Hurd, Hilary; Ardin, Richard

    2003-01-01

    During copulation, male insects pass accessory gland components to the female with the spermatophore. These gifts can affect female reproductive behaviour, ovulation and oviposition. Here, we show that female mealworm beetles, Tenebrio molitor, mated with males infected with metacestodes of the rat tapeworm, Hymenolepis diminuta, produced significantly more offspring than those mated with uninfected males. There is a significant positive relationship between parasite intensity in the male and reproductive output in the female. Infection results in a significant increase in bean-shaped accessory gland (BAG) size. We suggest that infected males pass superior nuptial gifts to females and discuss the confounding effects of infection in male and female beetles upon overall fitness costs of infection for the host and the likelihood that the parasite is manipulating host investment in reproduction. PMID:14667373

  7. [Polyadenylated RNA and mRNA export factors in extrachromosomal nuclear domains of vitellogenic oocytes of the insect Tenebrio molitor].

    Science.gov (United States)

    Bogoliubov, D S; Kiselev, A M; Shabel'nikov, S V; Parfenov, V N

    2012-01-01

    The nucleus ofvitellogenic oocytes of the yellow mealworm, Tenebrio molitor, contains a karyosphere that consists of the condensed chromatin embedded in an extrachromosomal fibrogranular material. Numerous nuclear bodies located freely in the nucleoplasm are also observed. Amongst these bodies, counterparts of nuclear speckles (= interchromatin granule clusters, IGCs) can be identified by the presence of the marker protein SC35. Microinjections of fluorescently tagged methyloligoribonucleotide probes 2'-O-Me(U)22, complementary to poly(A) tails of RNAs, revealed poly(A)+ RNA in the vast majority of IGCs. We found that all T. molitor oocyte IGCs contain heterogeneous ribonucleoprotein (hnRNP) core protein Al that localizes to IGCs in an RNA-dependent manner. The extrachromosomal material of the karyosphere and a part of nucleoplasmic IGCs also contain the adapter protein Aly that is known to provide a link between pre-mRNA splicing and mRNA export. The essential mRNA export factor/receptor NXF1 was observed to colocalize with Aly. In nucleoplasmic IGCs, NXF1 was found to localize in an RNA-dependent manner whereas it is RNA-independently located in the extrachromosomal material of the karyosphere. We believe our data suggest on a role of the nucleoplasmic IGCs in mRNA biogenesis and retention in a road to nuclear export.

  8. The natural insect peptide Neb-colloostatin induces ovarian atresia and apoptosis in the mealworm Tenebrio molitor.

    Science.gov (United States)

    Czarniewska, Elżbieta; Rosiński, Grzegorz; Gabała, Elżbieta; Kuczer, Mariola

    2014-01-30

    The injection of Neb-colloostatin into T. molitor females causes gonadoinhibitory effects on ovarian development. This peptide inhibits intercellular space formation (patency) in follicular epithelium and results in slowed vitellogenesis, delayed ovulation, reduced number of eggs laid and presumably cell death in the terminal follicles. However, as does the form of cell death in the terminal follicle, the mode of action of Neb-colloostatin remains unknown. We tested Neb-colloostatin for a sterilizing effect on females of Tenebrio molitor. We report that injection of nanomolar doses of Neb-colloostatin induce ovarian follicle atresia in 4-day old females during their first gonadotropic cycle. Light microscope observations revealed morphological changes in the ovary: after Neb-colloostatin injection the terminal oocytes are significantly smaller and elicit massive follicle resorption, but the control terminal follicles possess translucent ooplasm in oocytes at different stages of vitellogenesis. A patency is visible in follicular epithelium of the control vitellogenic oocytes, whereas peptide injection inhibits intercellular space formation and, in consequence, inhibits vitellogenesis. Confocal and electron microscope examination showed that peptide injection causes changes in the morphology indicating death of follicular cells. We observed F-actin cytoskeleton disorganization, induction of caspase activity, changes in chromatin organization and autophagic vacuole formation. Moreover, the apical cytoplasm of follicular cells is filled with numerous free ribosomes, probably indicating a higher demand for protein biosynthesis, especially in preparation for autophagic vacuole formation. On the other hand, the process of polyribosomes formation is inhibited, indicating the contributing effect of this hormone. Neb-colloostatin induces atresia in the mealworm ovary. Degeneration of T. molitor follicles includes changes in morphology and viability of follicular cells, and

  9. The effect of a static magnetic field on the morphometric characteristics of neurosecretory neurons and corpora allata in the pupae of yellow mealworm Tenebrio molitor (Tenebrionidae).

    Science.gov (United States)

    Peric-Mataruga, Vesna; Prolic, Zlatko; Nenadovic, Vera; Vlahovic, Milena; Mrdakovic, Marija

    2008-02-01

    The morphometric characteristics of A1 and A2 protocerebral neurosecretory neurons (cell and nuclei size, number of nucleoli in the nuclei); corpora allata size, nuclei size, cell number, were investigated in the pupae of yellow mealworm, Tenebrio molitor (L.), exposed to a strong static magnetic field of 320 mT maximum induction (10,000 times higher than the Earth's). The experimental groups of Tenebrio molitor pupae were: A control group exposed only to natural magnetic field and sacrificed at the eighth day of pupal development (C); and pupae kept in a strong static magnetic field for eight days and then sacrificed (MF). Serial brain cross-sections were stained using the Alcian Blue Floxin technique. All the parameters were analyzed and measurements were performed using an image processing and analysis system (Leica, Cambridge, UK) linked to a Leica DMLB light microscope (program is QWin - Leica's Quantimet Windows-based image analysis tool kit). The values of morphometric parameters of neurosecretory neurons and corpora allata were significantly increased after exposure of the pupae to the strong magnetic field. The strong magnetic field influence characteristics of protocerebral neurosecretory neurons and corpora allata in the late Tenebrio molitor pupae.

  10. Active subsite properties, subsite residues and targeting to lysosomes or midgut lumen of cathepsins L from the beetle Tenebrio molitor.

    Science.gov (United States)

    Damasceno, Ticiane F; Dias, Renata O; de Oliveira, Juliana R; Salinas, Roberto K; Juliano, Maria A; Ferreira, Clelia; Terra, Walter R

    2017-10-01

    Cathepsins L are the major digestive peptidases in the beetle Tenebrio molitor. Two digestive cathepsins L (TmCAL2 and TmCAL3) from it had their 3D structures solved. The aim of this paper was to study in details TmCAL3 specificity and properties and relate them to its 3D structure. Recombinant TmCAL3 was assayed with 64 oligopeptides with different amino acid replacements in positions P2, P1, P1' and P2'. Results showed that TmCAL3 S2 specificity differs from the human enzyme and that its specificities also explain why on autoactivation two propeptide residues remain in the enzyme. Data on free energy of binding and of activation showed that S1 and S2' are mainly involved in substrate binding, S1' acts in substrate binding and catalysis, whereas S2 is implied mainly in catalysis. Enzyme subsite residues were identified by docking with the same oligopeptide used for kinetics. The subsite hydrophobicities were calculated from the efficiency of hydrolysis of different amino acid replacements in the peptide and from docking data. The results were closer for S1 and S2' than for S1' and S2, indicating that the residue subsites that were more involved in transition state binding are different from those binding the substrate seen in docking. Besides TmCAL1-3, there are nine other cathepsins L, most of them more expressed at midgut. They are supposed to be directed to lysosomes by a Drosophila-like Lerp receptor and/or motifs in their prodomains. The mannose 6-phosphate lysosomal sorting machinery is absent from T. molitor transcriptome. Cathepsin L direction to midgut contents seems to depend on overexpression. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Female Choice Reveals Terminal Investment in Male Mealworm Beetles, Tenebrio molitor, after a Repeated Activation of the Immune System

    Science.gov (United States)

    Krams, I; Daukšte, J; Kivleniece, I; Krama, T; Rantala, MJ; Ramey, G; Šauša, L

    2011-01-01

    Increasing evidence suggests that secondary sexual traits reflect immunocompetence of males in many animal species. This study experimentally investigated whether a parasite-like immunological challenge via a nylon implant affects sexual attractiveness of males in Tenebrio molitor L. (Coleoptera: Tenebrionidae) Although a single immunological challenge significantly reduced sexual attractiveness and locomotor activity of males, it had no adverse effect on their survival. A second immune challenge of the same males increased their attractiveness. However, it was found that the repeated challenge significantly reduced locomotor activity of males and caused higher mortality. This result indicates terminal investment on sexual signaling, which is supposedly based on a trade-off between pheromone production and energy expenditures needed for such activities as recovery of immune system and locomotor activity. When the third implantation was carried out in the same group of males, melanization of nylon implants was found to be lower in more attractive than in less attractive males. This suggests that males that became sexually attractive after the second immune challenge did not invest in recovery of their immune system. PMID:21864151

  12. Increasing the calcium content of mealworms (Tenebrio molitor) to improve their nutritional value for bone mineralization of growing chicks.

    Science.gov (United States)

    Klasing, K C; Thacker, P; Lopez, M A; Calvert, C C

    2000-12-01

    The purpose of these studies was to determine the husbandry variables that optimize the Ca content of mealworms (Tenebrio molitor) and to determine the bioavailability of this Ca for bone mineralization in chicks that consume the mealworms. To determine the optimal level of Ca in the substrates used in short-term (mealworms and to determine the length of time that mealworms should be exposed to high-Ca substrates, mealworms were placed in either a wheat bran or a chicken starter substrate supplemented with 0, 4, 8, or 12% Ca from CaCO3. The mealworms were harvested after 0.5, 1, 2, 3, 4, 7, or 14 days. The Ca content of the mealworms was greatest with the use of chicken starter and increased linearly with the Ca content of the substrate. In general, the Ca content of the mealworms increased during the first 24 hr and decreased after > or = 1 wk, especially at the higher levels of Ca supplementation. The chicken starter also resulted in higher levels of vitamin D in mealworms. Mealworms held in wheat bran with 8% Ca were fed to growing chicks. Ca bioavailability was calculated from the chicks' bone ash. The Ca in these mealworms was 76% as bioavailable as the Ca in oyster shell.

  13. Reducing sugar-producing bacteria from guts of Tenebrio molitor Linnaeus (yellow mealworm) for lignocellulosic waste minimization.

    Science.gov (United States)

    Qi, Wei; Chen, Chia-Lung; Wang, Jing-Yuan

    2011-01-01

    The guts of Tenebrio Molitor Linnaeus (yellow mealworm) were used as inocula to isolate reducing sugar-producing bacteria during bioconversion of lignocellulose to reducing sugars in this study. Three carbon sources, i.e., carboxymethyl cellulose (CMC), filter paper (FP), and lignocellulosic waste (LIG), were specifically selected; and two types of culturing media (M1 and M2) were used. After 6 months of sequential cultivation, lignocellulose (i.e., polysaccharides) degradation of enrichments M1-CMC (47.5%), M1-FP (73.3%), M1-LIG (70.4%), M2-CMC (55.7%), M2-FP (73.1%) and M2-LIG (71.7%) was achieved, respectively, with incubation for 48 h. Furthermore, seven bacterial strains were successfully isolated corresponding to most of the major bands detected by denaturing gradient gel electrophoresis analysis. The maximum reducing sugars yield by the combination of Agromyces sp. C42 and Stenotrophomonas sp. A10b was 56.7 mg g·LIG(-1) of 48 h, which is approximate 2-5 times higher than the original enrichments and individual microbial strains. These findings suggest that bioconversion by microorganisms from mealworm guts has great application potential for lignocellulose hydrolysis.

  14. Crystallization and preliminary X-ray crystallographic analysis of a highly specific serpin from the beetle Tenebrio molitor

    Science.gov (United States)

    Park, Sun Hee; Piao, Shunfu; Kwon, Hyun-Mi; Kim, Eun-Hye; Lee, Bok Luel; Ha, Nam-Chul

    2010-01-01

    The Toll signalling pathway, which is crucial for innate immunity, is transduced in insect haemolymph via a proteolytic cascade consisting of three serine proteases. The proteolytic cascade is downregulated by a specific serine protease inhibitor (serpin). Recently, the serpin SPN48 was found to show an unusual specific reactivity towards the terminal serine protease, Spätzle-processing enzyme, in the beetle Tenebrio molitor. In this study, the mature form of SPN48 was overexpressed in Escherichia coli and purified. The purified SPN48 protein was crystallized using 14% polyethylene glycol 8000 and 0.1 M 2-(N-morpho­lino)ethanesulfonic acid pH 6.0 as the precipitant. The crystals diffracted X-rays to 2.1 Å resolution and were suitable for structure determination. The crystals belonged to space group P21. The crystal structure will provide information regarding how SPN48 achieves its unusual specificity for its target protease. PMID:20124722

  15. Density-dependent prophylaxis in the mealworm beetle Tenebrio molitor L. (Coleoptera: Tenebrionidae): cuticular melanization is an indicator of investment in immunity.

    Science.gov (United States)

    Barnes, A I; Siva-Jothy, M T

    2000-01-01

    If there are costs involved with the maintenance of pathogen resistance, then higher investment in this trait is expected when the risk of pathogenesis is high. One situation in which the risk of pathogenesis is elevated is at increased conspecific density. This paper reports the results of a study of density-dependent polyphenism in pathogen resistance and immune function in the mealworm beetle Tenebrio molitor. Beetles reared at high larval densities showed lower mortality when exposed to a generalist entomopathogenic fungus and a higher degree of cuticular melanization than those reared solitarily. The degree of cuticular melanization was a strong indicator of resistance, with darker beetles being more resistant than lighter ones regardless of rearing density. No differences were found between rearing densities in the levels of phenoloxidase, an enzyme key to the insect immune response. The results show that pathogen resistance is phenotypically plastic in T. molitor, suggesting that the maintenance of this trait is costly. PMID:10687824

  16. Identification of Bacillus thuringiensis Cry3Aa toxin domain II loop 1 as the binding site of Tenebrio molitor cadherin repeat CR12.

    Science.gov (United States)

    Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Amaro, Itzel; Ortíz, Ernesto; Becerril, Baltazar; Ibarra, Jorge E; Bravo, Alejandra; Soberón, Mario

    2015-04-01

    Bacillus thuringiensis Cry toxins exert their toxic effect by specific recognition of larval midgut proteins leading to oligomerization of the toxin, membrane insertion and pore formation. The exposed domain II loop regions of Cry toxins have been shown to be involved in receptor binding. Insect cadherins have shown to be functionally involved in toxin binding facilitating toxin oligomerization. Here, we isolated a VHH (VHHA5) antibody by phage display that binds Cry3Aa loop 1 and competed with the binding of Cry3Aa to Tenebrio molitor brush border membranes. VHHA5 also competed with the binding of Cry3Aa to a cadherin fragment (CR12) that was previously shown to be involved in binding and toxicity of Cry3Aa, indicating that Cry3Aa binds CR12 through domain II loop 1. Moreover, we show that a loop 1 mutant, previously characterized to have increased toxicity to T. molitor, displayed a correlative enhanced binding affinity to T. molitor CR12 and to VHHA5. These results show that Cry3Aa domain II loop 1 is a binding site of CR12 T. molitor cadherin. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Insect midgut α-mannosidases from family 38 and 47 with emphasis on those of Tenebrio molitor.

    Science.gov (United States)

    Moreira, Nathalia R; Cardoso, Christiane; Ribeiro, Alberto F; Ferreira, Clelia; Terra, Walter R

    2015-12-01

    α-Mannosidases are enzymes which remove non-reducing terminal residues from glycoconjugates. Data on both GH47 and GH38 (Golgi and lysosomal) enzymes are available. Data on insect midgut α-mannosidases acting in digestion are preliminary and do not include enzyme sequences. Tenebrio molitor midgut α-mannosidases were separated by chromatography into two activity peaks: a major (Man1) and a minor (Man2). An antibody generated against a synthetic peptide corresponding to a sequence of α-mannosidase fragment recognizes Man2 but not Man1. That fragment was later found to correspond to TmMan2 (GenBank access KP892646), showing that the cDNA coding for Man2 is actually TmMan2. TmMan2 codes for a mature α-mannosidase with 107.5 kDa. Purified Man2 originates after SDS-PAGE one band of about 72 kDa and another of 51 kDa, which sums 123 kDa, in agreement with gel filtration (123 kDa) data. These results suggest that Man2 is processed into peptides that remain noncovalently linked within the functional enzyme. The physical and kinetical properties of purified Man1 and Man2 are similar. They have a molecular mass of 123 kDa (gel filtration), pH optimum (5.6) and response to inhibitors like swainsonine (Man1 Ki, 68 nM; Man2 Ki, 63 nM) and deoxymannojirimycin (Man1 Ki, 0.12 mM; Man2 Ki, 0.15 mM). Their substrate specificities are a little different as Man2 hydrolyzes α-1,3 and α-1,6 bonds better than α-1,2, whereas the contrary is true for Man1. Thus, they pertain to Class II (GH38 α-mannosidases), that are catabolic α-mannosidases similar to lysosomal α-mannosidase. However, Man2, in contrast to true lysosomal α-mannosidase, is secreted (immunocytolocalization data) into the midgut contents. There, Man2 may participate in digestion of fungal cell walls, known to have α-mannosides in their outermost layer. The amount of family 38 α-mannosidase sequences found in the transcriptome (454 pyrosequencing) of the midgut of 9 insects pertaining to 5 orders is

  18. Active site characterization and molecular cloning of Tenebrio molitor midgut trehalase and comments on their insect homologs.

    Science.gov (United States)

    Gomez, Ana; Cardoso, Christiane; Genta, Fernando A; Terra, Walter R; Ferreira, Clélia

    2013-08-01

    The soluble midgut trehalase from Tenebrio molitor (TmTre1) was purified after several chromatographic steps, resulting in an enzyme with 58 kDa and pH optimum 5.3 (ionizing active groups in the free enzyme: pK(e1) = 3.8 ± 0.2 pK(e2) = 7.4 ± 0.2). The purified enzyme corresponds to the deduced amino acid sequence of a cloned cDNA (TmTre1-cDNA), because a single cDNA coding a soluble trehalase was found in the T. molitor midgut transcriptome. Furthermore, the mass of the protein predicted to be coded by TmTre1-cDNA agrees with that of the purified enzyme. TmTre1 has the essential catalytic groups Asp 315 and Glu 513 and the essential Arg residues R164, R217, R282. Carbodiimide inactivation of the purified enzyme at different pH values reveals an essential carboxyl group with pKa = 3.5 ± 0.3. Phenylglyoxal modified a single Arg residue with pKa = 7.5 ± 0.2, as observed in the soluble trehalase from Spodoptera frugiperda (SfTre1). Diethylpyrocarbonate modified a His residue that resulted in a less active enzyme with pK(e1) changed to 4.8 ± 0.2. In TmTre1 the modified His residue (putatively His 336) is more exposed than the His modified in SfTre1 (putatively His 210) and that affects the ionization of an Arg residue. The architecture of the active site of TmTre1 and SfTre1 is different, as shown by multiple inhibition analysis, the meaning of which demands further research. Trehalase sequences obtained from midgut transcriptomes (pyrosequencing and Illumina data) from 8 insects pertaining to 5 different orders were used in a cladogram, together with other representative sequences. The data suggest that the trehalase gene went duplication and divergence prior to the separation of the paraneopteran and holometabolan orders and that the soluble trehalase derived from the membrane-bound one by losing the C-terminal transmembrane loop. Copyright © 2013 Elsevier Ltd. All rights reserved.

  19. Balanced intake of protein and carbohydrate maximizes lifetime reproductive success in the mealworm beetle, Tenebrio molitor (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Rho, Myung Suk; Lee, Kwang Pum

    2016-01-01

    Recent developments in insect gerontological and nutritional research have suggested that the dietary protein:carbohydrate (P:C) balance is a critical determinant of lifespan and reproduction in many insects. However, most studies investigating this important role of dietary P:C balance have been conducted using dipteran and orthopteran species. In this study, we used the mealworm beetles, Tenebrio molitor L. (Coleoptera: Tenebrionidae), to test the effects of dietary P:C balance on lifespan and reproduction. Regardless of their reproductive status, both male and female beetles had the shortest lifespan at the protein-biased ratio of P:C 5:1. Mean lifespan was the longest at P:C 1:1 for males and at both P:C 1:1 and 1:5 for females. Mating significantly curtailed the lifespan of both males and females, indicating the survival cost of mating. Age-specific egg laying was significantly higher at P:C 1:1 than at the two imbalanced P:C ratios (1:5 or 5:1) at any given age throughout their lives, resulting in the highest lifetime reproductive success at P:C 1:1. When given a choice, beetles actively regulated their intake of protein and carbohydrate to a slightly carbohydrate-biased ratio (P:C 1:1.54-1:1.64 for males and P:C 1:1.3-1:1.36 for females). The self-selected P:C ratio was significantly higher for females than males, reflecting a higher protein requirement for egg production. Collectively, our results add to a growing body of evidence suggesting the key role played by dietary macronutrient balance in shaping lifespan and reproduction in insects. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. [Expression optimization and characterization of Tenebrio molitor antimicrobiol peptides TmAMP1m in Escherichia coli].

    Science.gov (United States)

    Alimu, Reyihanguli; Mao, Xinfang; Liu, Zhongyuan

    2013-06-01

    To improve the expression level of tmAMP1m gene from Tenebrio molitor in Escherichia coli, we studied the effects of expression level and activity of the fusion protein HIS-TmAMP1m by conditions, such as culture temperature, inducing time and the final concentration of inductor Isopropyl beta-D-thiogalactopyranoside (IPTG). We analyzed the optimum expression conditions by Tricine-SDS-PAGE electrophoresis, meanwhile, detected its antibacterial activity by using agarose cavity diffusion method. The results suggest that when inducing the recombinant plasmid with a final IPTG concentration of 0.1 mmol/L at 37 degrees C for 4 h, there was the highest expression level of fusion protein HIS-TmAMP1m in Escherichia coli. Under these conditions, the expression of fusion protein accounted for 40% of the total cell lysate with the best antibacterial activity. We purified the fusion protein HIS-TmAMPlm with nickel-nitrilotriacetic acid (Ni-NTA) metal-affinity chromatography matrices. Western blotting analysis indicates that the His monoclonal antibody could be specifically bound to fusion protein HIS-TmAMPlm. After expression by inducing, the fusion protein could inhibit the growth of host cell transformed by pET30a-tmAMP1m. The fusion protein HIS-TmAMP1m had better stability and remained higher antibacterial activities when incubated at 100 degrees C for 10 h, repeated freeze thawing at -20 degrees C, dissolved in strong acid and alkali, or treated by organic solvents and protease. Moreover, the minimum inhibitory concentration results demonstrated that the fusion protein HIS-TmAMP1m has a good antibacterial activity against Staphylococcus aureus, Staphylococcus sp., Corynebacterium glutamicum, Bacillus thuringiensis, Corynebacterium sp. This study laid the foundation to promote the application of insect antimicrobial peptides and further research.

  1. The effects of acclimation and rates of temperature change on critical thermal limits in Tenebrio molitor (Tenebrionidae) and Cyrtobagous salviniae (Curculionidae).

    Science.gov (United States)

    Allen, Jessica L; Clusella-Trullas, Susana; Chown, Steven L

    2012-05-01

    Critical thermal limits provide an indication of the range of temperatures across which organisms may survive, and the extent of the lability of these limits offers insights into the likely impacts of changing thermal environments on such survival. However, investigations of these limits may be affected by the circumstances under which trials are undertaken. Only a few studies have examined these effects, and typically not for beetles. This group has also not been considered in the context of the time courses of acclimation and its reversal, both of which are important for estimating the responses of species to transient temperature changes. Here we therefore examine the effects of rate of temperature change on critical thermal maxima (CT(max)) and minima (CT(min)), as well as the time course of the acclimation response and its reversal in two beetle species, Tenebrio molitor and Cyrtobagous salviniae. Increasing rates of temperature change had opposite effects on T. molitor and C. salviniae. In T. molitor, faster rates of change reduced both CT(max) (c. 2°C) and CT(min) (c. 3°C), while in C. salviniae faster rates of change increased both CT(max) (c. 6°C) and CT(min) (c. 4°C). CT(max) in T. molitor showed little response to acclimation, while the response to acclimation of CT(min) was most pronounced following exposure to 35°C (from 25°C) and was complete within 24 h. The time course of acclimation of CT(max) in C. salviniae was 2 days when exposed to 36°C (from c. 26°C), while that of CT(min) was less than 3 days when exposed to 18°C. In T. molitor, the time course of reacclimation to 25°C after treatments at 15°C and 35°C at 75% RH was longer than the time course of acclimation, and varied from 3-6 days for CT(max) and 6 days for CT(min). In C. salviniae, little change in CT(max) and CT(min) (molitor and C. salviniae may be restricted in their ability to respond to transient temperature changes at short-time scales, and instead may have to rely on

  2. Genetic and phenotypic relationships between immune defense, melanism and life-history traits at different temperatures and sexes in Tenebrio molitor.

    Science.gov (United States)

    Prokkola, J; Roff, D; Kärkkäinen, T; Krams, I; Rantala, M J

    2013-08-01

    Insect cuticle melanism is linked to a number of life-history traits, and a positive relationship is hypothesized between melanism and the strength of immune defense. In this study, the phenotypic and genetic relationships between cuticular melanization, innate immune defense, individual development time and body size were studied in the mealworm beetle (Tenebrio molitor) using three different temperatures with a half-sib breeding design. Both innate immune defense and cuticle darkness were higher in females than males, and a positive correlation between the traits was found at the lowest temperature. The effect of temperature on all the measured traits was strong, with encapsulation ability and development time decreasing and cuticle darkness increasing with a rise in temperature, and body size showing a curved response. The analysis showed a highly integrated system sensitive to environmental change involving physiological, morphological and life-history traits.

  3. Sex differences in frass production and weight change in Tenebrio molitor (Coleoptera) infected with cysticercoids of the tapeworm Hymenolepis diminuta (Cestoda).

    Science.gov (United States)

    Shea, John F

    2005-11-11

    In their intermediate host, parasites alter aspects of host physiology including waste production and body weight. Further, this alteration may differ between female and male hosts. To study this, a beetle (Tenebrio molitor)-tapeworm (Hymenolepis diminuta) system was used. Infected and uninfected male and female beetles were individually housed in vials without food. Each beetle's weight change and frass production were measured over 24 h periods at 3, 7, 12 and 16 days post-infection. Treatment (infection) had no effect on weight change, but males lost more weight than females. Further, infected females produced more frass than control females. Males on the day of infection had a higher food intake than females. These results suggest that males will be more exposed to infection than females and could explain why males had a higher median cysticercoid infection level.

  4. Pengaruh pemberian pakan berupa campuran pelet ikan, ulat tepung (Tenebrio molitor, dan ganggang merah (Gracilaria foliifera terhadap pertumbuhan dan kelulushidupan ikan sidat (Anguilla bicolor

    Directory of Open Access Journals (Sweden)

    MUHAMMAD A. AZIZ HENDITAMA

    2015-05-01

    Full Text Available Henditama MAA, Harini M, Budiharjo A. 2015. The effect of giving mixtured feed of fish pellet, mealworm (Tenebrio molitor and red algae (Gracilaria foliifera to the growth and survival rate of eel (Anguilla bicolor. Bioteknologi 12: 22-28. High demand of eels (Anguilla bicolor in the world has not followed by the capability of domestic production. The purpose of this research are to determine the effect and the precise composition of the feed mixture in the form of fish pellets, mealworms (Tenebrio molitor, red algae (Gracilaria foliifera to the growth and survival rate of eels. This research used completely randomized design with four variations of mixtured feed in the form of fish pellet, mealworms, and red algae specifically P1 (100% ; 0% ; 0%, P2 (75% ; 20% ; 5%, P3 (50% ; 45% ; 5%, P4 (25% ; 70% ; 5%. This research also has been done in 90 days with feeding in twice a day. The data of growth, survival rate, and water quality was collected once a week. The data result has been analized by ANOVA. The data result showed that have a real different to continue to the next analysis of DMRT with test level 5% to locate the differences between treatments. The eels growth after feeding a mixture feed in the form of fish pellets, mealworms, and red alga, specifically: P1 (K 26.3167 gram; P2 20.3167 gram; P3 28.2500 gram; and P4 22.0000 gram. The eels survival rate, specifically P1 (K 26.67%; P2 33.33%; P3 30%; dan P4 26.67%. Furthemore, the exact composition that give the best effect of growth and survival rate to eels is 50% fish pellets, 45% mealworms and 5% red alga.

  5. Chemical composition and fumigant effect of essentialoil of Lippia sidoides Cham. and monoterpenes against Tenebrio molitor (L. (coleoptera: tenebrionidae Composição química e efeito fumigante do óleo essencial de Lippia sidoides Cham. e monoterpenos sobre Tenebrio molitor (L. (Coleoptera: Tenebrionidae

    Directory of Open Access Journals (Sweden)

    Rafaela Karin Lima

    2011-08-01

    Full Text Available The chemical composition of Lippia sidoides essential oils obtained by hydrodistillation was characterized and quantified by GC/MS and their insecticidal activity by fumigation test was assayed against Tenebrio molitor. Moreover, the toxicity of monoterpenes carvacrol, 1,8-cineol and thymol were also evaluated when applied alone or in binary (1:1 or tertiary (1:1:1 mixture. The essential oil of L. sidoides has as major constituents carvacrol (31.68%, ρ-cymene (19.58%, 1,8-cineole (9.26% and ϒ-terpinene (9.21%, from a 21 compounds identified, being 92.53% of total. Both compounds have insecticidal activity against T. molitor, being the degree of toxicity of carvacrol > 1,8-cineole > L. sidoides essential oil > thymol, and its respectively LC50 at 24h were 5.53; 5.71; 8.04 and 14.71 µL/L air. When the different mixture of carvacrol, 1,8-cineole and thymol was assayed against T. molitor, the synergism among them was observed. For the mixture of carvacrol:1,8-cineole LC50 was 5.34 µL/L air; carvacrol:thymol 7.67 µL/L air; 1,8-cineole:thymol 7.51 µL/L air and carvacrol:1,8-cineole:thymol 6.34 µL/L air. Mainly, the monoterpene thymol had a synergic effect, which increased the toxicity of carvacrol and 1,8-cineole, both in binary mixture like carvacrol:thymol and 1,8-cineole:thymol.A composição química do óleo essencial de Lippia sidoides obtido por hidrodestilação foi caracterizada e quantificada por GC/MS, bem como sua atividade inseticida por teste de fumigação foi avaliada sobre Tenebrio molitor. Além disso, a toxicidade dos monoterpenos carvacrol, 1,8-cineol e timol, também foi avaliada quando esses compostos foram aplicados isoladamente, ou em misturas binárias (1:1, ou terciárias (1:1:1. O óleo essencial de L. sidoides tem como principais constituintes o carvacrol (31,68%, ρ-cimeno (19,58%, 1,8-cineol (9,26% e ϒ-terpineno (9,21%, em 21 compostos identificados, sendo 92,53% do total. Ambos os compostos possuem atividade

  6. Efficacy of condensed tannins against larval Hymenolepis diminuta (Cestoda) in vitro and in the intermediate host Tenebrio molitor (Coleoptera) in vivo.

    Science.gov (United States)

    Dhakal, Suraj; Meyling, Nicolai V; Williams, Andrew R; Mueller-Harvey, Irene; Fryganas, Christos; Kapel, Christian M O; Fredensborg, Brian L

    2015-01-15

    Natural anti-parasitic compounds in plants such as condensed tannins (CT) have anthelmintic properties against a range of gastrointestinal nematodes, but for other helminths such effects are unexplored. The aim of this study was to assess the effects of CT from three different plant extracts in a model system employing the rat tapeworm, Hymenolepis diminuta, in its intermediate host, Tenebrio molitor. An in vitro study examined infectivity of H. diminuta cysticercoids (excystation success) isolated from infected beetles exposed to different concentrations of CT extracts from pine bark (PB) (Pinus sps), hazelnut pericarp (HN) (Corylus avellana) or white clover flowers (WC) (Trifolium repens), in comparison with the anthelmintic drug praziquantel (positive control). In the in vitro study, praziquantel and CT from all three plant extracts had dose-dependent inhibitory effects on cysticercoid excystation. The HN extract was most effective at inhibiting excystation, followed by PB and WC. An in vivo study was carried out on infected beetles (measured as cysticercoid establishment) fed different doses of PB, HN and praziquantel. There was a highly significant inhibitory effect of HN on cysticercoid development (p=0.0002). Overall, CT showed a promising anti-cestodal effect against the metacestode stage of H. diminuta. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Involvement of phenoloxidase in browning during grinding of Tenebrio molitor larvae

    NARCIS (Netherlands)

    Janssen, Renske H.; Lakemond, Catriona M.M.; Fogliano, Vincenzo; Renzone, Giovanni; Scaloni, Andrea; Vincken, Jean-Paul

    2017-01-01

    Insects are investigated as alternative protein source to meet the increasing demand for proteins in the future. Enzymatic browning occurring during grinding of insect and subsequent extraction of proteins can influence the proteins’ properties, but it is unclear which enzymes are responsible for

  8. Development of real-time PCR tests for the detection of Tenebrio molitor in food and feed.

    Science.gov (United States)

    Debode, Frédéric; Marien, Aline; Gérard, Amaury; Francis, Frédéric; Fumière, Olivier; Berben, Gilbert

    2017-08-01

    Insects are rich in proteins and could be an alternative source of proteins to feed animals and humans. Numerous companies have started the production of insects for feed purposes. In Europe, these processed animal proteins are not yet authorised by legislation as many questions still need to be answered concerning this 'novel food'. Authorisations will be possible when methods of authentication of the products are available. In this study we propose real-time PCR methods for the specific detection of the mealworm (Tenebriomolitor), one of the most widely used insects for food and feed production. Two PCR assays are proposed: the first based on the wingless gene and the second based on the cadherin gene. The PCR tests amplify fragments of 87 bp. These qualitative methods were tested according to several performance criteria. The specificity was tested on 34 insect species' DNA, but also on non-insect species including crustacean, mammals, birds and plants. The limit of detection was determined and was below 20 copies for the two PCR tests. The applicability of the tests was demonstrated by the analysis of real-life processed samples containing T. molitor.

  9. Aflatoxin B1 Tolerance and Accumulation in Black Soldier Fly Larvae (Hermetia illucens) and Yellow Mealworms (Tenebrio molitor)

    NARCIS (Netherlands)

    Bosch, G.; Fels, van der Ine; Rijk, de T.C.; Oonincx, D.G.A.B.

    2017-01-01

    Crops contaminated with fungal mycotoxins such as aflatoxin B1 (AFB1) are often downgraded or removed from the food chain. This study aimed to evaluate the tolerance and accumulation of AFB1 in two insect species to determine whether they could be used to retain condemned mycotoxin contaminated

  10. Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin

    National Research Council Canada - National Science Library

    Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis

    2012-01-01

    Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests...

  11. Transcriptome Profiling of the Intoxication Response of Tenebrio molitor Larvae to Bacillus thuringiensis Cry3Aa Protoxin: e34624

    National Research Council Canada - National Science Library

    Brenda Oppert; Scot E Dowd; Pascal Bouffard; Lewyn Li; Ana Conesa; Marcé D Lorenzen; Michelle Toutges; Jeremy Marshall; Diana L Huestis; Jeff Fabrick; Cris Oppert; Juan Luis Jurat-Fuentes

    2012-01-01

      Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests...

  12. Tenebrio molitor Gram-negative-binding protein 3 (TmGNBP3) is essential for inducing downstream antifungal Tenecin 1 gene expression against infection with Beauveria bassiana JEF-007.

    Science.gov (United States)

    Yang, Yi-Ting; Lee, Mi Rong; Lee, Se Jin; Kim, Sihyeon; Nai, Yu-Shin; Kim, Jae Su

    2017-05-23

    The Toll signaling pathway is responsible for defense against both Gram-positive bacteria and fungi. Gram-negative binding protein 3 (GNBP3) has a strong affinity for the fungal cell wall component, β-1,3-glucan, which can activate the prophenoloxidase (proPO) cascade and induce the Toll signaling pathway. Myeloid differentiation factor 88 (MyD88) is an intracellular adaptor protein involved in the Toll signaling pathway. In this study, we monitored the response of 5 key genes (TmGNBP3, TmMyD88, and Tenecin 1, 2, and 3) in the Toll pathway of the mealworm Tenebrio molitor immune system against the fungus Beauveria bassiana JEF-007 using RT-PCR. TmGNBP3, Tenecin 1, and Tenecin 2 were significantly upregulated after fungal infection. To better understand the roles of the Toll signaling pathway in the mealworm immune system, TmGNBP3 and TmMyD88 were knocked down by RNAi silencing. Target gene expression levels decreased at 2 d postknockdown and were dramatically reduced at 6 d post-dsRNA injection. Therefore, mealworms were compromised by B. bassiana JEF-007 at 6 d post-dsRNA injection. Silencing of TmMyD88 and TmGNBP3 resulted in reduced resistance of the host to fungal infection. Particularly, reducing TmGNBP3 levels obviously downregulated Tenecin 1 and Tenecin 2 expression levels, whereas silencing TmMyD88 expression resulted in decreased Tenecin 2 expression. These results indicate that TmGNBP3 is essential to induce downstream antifungal peptide Tenecin 1 expression against B. bassiana JEF-007. © 2017 Institute of Zoology, Chinese Academy of Sciences.

  13. Tabelas de fertilidade e de esperança de vida de Tynacantha marginata Dallas (Heteroptera, Pentatomidae, Asopinae alimentado com larvas de Tenebrio molitor L. (Coleoptera, Tenebrionidae e folhas de Eucalyptus urophylla S.T. Blake Life and fecundity tables of the predator Tynacantha marginata Dallas (Heteroptera, Pentatomidae reared with Tenebrio molitor L. larvae (Coleoptera, Tenebrionidae and Eucalyptus urophylla S.T. Blake leaves

    Directory of Open Access Journals (Sweden)

    Luciano Andrade Moreira

    1995-01-01

    Full Text Available The objective of this research was to study the effect of feeding on Eucalyptus leaves on the life and fecundity tables of Tynacantha marginata Dallas, 1851 (Heteroptera: Pentatomidae. Higher mortality of this predator occurred during second week of life, when the nymphs were starting second instar. The fecundity table showed that the nymphal period of T. marginata lasted four weeks, with viability of 57,9% and total longevity of 21 weeks. Egg oviposition period took 10 weeks. The population parameters (R0, rm and λ showed a 50.69 times populational increase after one generation.

  14. Tenebrio beetles use magnetic inclination compass

    Science.gov (United States)

    Vácha, Martin; Drštková, Dana; Půžová, Tereza

    2008-08-01

    Animals that guide directions of their locomotion or their migration routes by the lines of the geomagnetic field use either polarity or inclination compasses to determine the field polarity (the north or south direction). Distinguishing the two compass types is a guideline for estimation of the molecular principle of reception and has been achieved for a number of animal groups, with the exception of insects. A standard diagnostic method to distinguish a compass type is based on reversing the vertical component of the geomagnetic field, which leads to the opposite reactions of animals with two different compass types. In the present study, adults of the mealworm beetle Tenebrio molitor were tested by means of a two-step laboratory test of magnetoreception. Beetles that were initially trained to memorize the magnetic position of the light source preferred, during the subsequent test, this same direction, pursuant geomagnetic cues only. In the following step, the vertical component was reversed between the training and the test. The beetles significantly turned their preferred direction by 180°. Our results brought until then unknown original findings that insects, represented here by the T. molitor species, use—in contrast to another previously researched Arthropod, spiny lobster—the inclination compass.

  15. Development and reproduction of Podisus distinctus (Heteroptera: Pentatomidae fed on larva of Bombyx mori (Lepidoptera: Bombycidae

    Directory of Open Access Journals (Sweden)

    M. C. Lacerda

    Full Text Available Biological control has been reducing the use of chemical products against insect pests, specially predatory Pentatomidae. Species of this group can present high variations in their life cycle as a result of their diet. Thus, the objective of this research was to study nymph development and reproduction of Podisus distinctus (Stäl, 1860 (Heteroptera: Pentatomidae fed on Bombyx mori L., 1758 (Lepidoptera: Bombycidae larvae (T1, compared to those fed on Tenebrio molitor L., 1758 (Coleoptera: Tenebrionidae (T2 and Musca domestica L., 1758 (Diptera: Muscidae larvae (T3 at a temperature of 25 ± 0.5ºC, relative humidity of 70 ± 2%, and photophase of 12 h. Predators fed on B. mori showed duration of the nymph phase (18.68 ± 1.02 similar to those fed on T. molitor (18.32 ± 1.49. Pre-oviposition and oviposition periods and number of egg masses, besides eggs and nymphs per female, were higher with B. mori (5.83 ± 2.02; 15.00 ± 7.40; 8.42 ± 1.84; 296.69 ± 154.75; and 228.55 ± 141.04, respectively while longevity of males and females of P. distinctus was 25.76 ± 16.15 and 35.00 ± 16.15 days with T. molitor, and 20.57 ± 13.60 and 23.46 ± 12.35 days with B. mori, respectively.

  16. Functional analysis of C1 family cysteine peptidases in the larval gut of Тenebrio molitor and Tribolium castaneum.

    Science.gov (United States)

    Martynov, Alexander G; Elpidina, Elena N; Perkin, Lindsey; Oppert, Brenda

    2015-02-14

    Larvae of the tenebrionids Tenebrio molitor and Tribolium castaneum have highly compartmentalized guts, with primarily cysteine peptidases in the acidic anterior midgut that contribute to the early stages of protein digestion. High throughput sequencing was used to quantify and characterize transcripts encoding cysteine peptidases from the C1 papain family in the gut of tenebrionid larvae. For T. castaneum, 25 genes and one questionable pseudogene encoding cysteine peptidases were identified, including 11 cathepsin L or L-like, 11 cathepsin B or B-like, and one each F, K, and O. The majority of transcript expression was from two cathepsin L genes on chromosome 10 (LOC659441 and LOC659502). For cathepsin B, the major expression was from genes on chromosome 3 (LOC663145 and LOC663117). Some transcripts were expressed at lower levels or not at all in the larval gut, including cathepsins F, K, and O. For T. molitor, there were 29 predicted cysteine peptidase genes, including 14 cathepsin L or L-like, 13 cathepsin B or B-like, and one each cathepsin O and F. One cathepsin L and one cathepsin B were also highly expressed, orthologous to those in T. castaneum. Peptidases lacking conservation in active site residues were identified in both insects, and sequence analysis of orthologs indicated that changes in these residues occurred prior to evolutionary divergence. Sequences from both insects have a high degree of variability in the substrate binding regions, consistent with the ability of these enzymes to degrade a variety of cereal seed storage proteins and inhibitors. Predicted cathepsin B peptidases from both insects included some with a shortened occluding loop without active site residues in the middle, apparently lacking exopeptidase activity and unique to tenebrionid insects. Docking of specific substrates with models of T. molitor cysteine peptidases indicated that some insect cathepsins B and L bind substrates with affinities similar to human cathepsin L, while

  17. Proteome response of Tribolium castaneum larvae to Bacillus thuringiensis toxin producing strains.

    Directory of Open Access Journals (Sweden)

    Estefanía Contreras

    Full Text Available Susceptibility of Tribolium castaneum (Tc larvae was determined against spore-crystal mixtures of five coleopteran specific and one lepidopteran specific Bacillus thuringiensis Cry toxin producing strains and those containing the structurally unrelated Cry3Ba and Cry23Aa/Cry37Aa proteins were found toxic (LC(50 values 13.53 and 6.30 µg spore-crystal mixture/µL flour disc, respectively. Using iTRAQ combined with LC-MS/MS allowed the discovery of seven novel differentially expressed proteins in early response of Tc larvae to the two active spore-crystal mixtures. Proteins showing a statistically significant change in treated larvae compared to non-intoxicated larvae fell into two major categories; up-regulated proteins were involved in host defense (odorant binding protein C12, apolipophorin-III and chemosensory protein 18 and down-regulated proteins were linked to metabolic pathways affecting larval metabolism and development (pyruvate dehydrogenase Eα subunit, cuticular protein, ribosomal protein L13a and apolipoprotein LI-II. Among increased proteins, Odorant binding protein C12 showed the highest change, 4-fold increase in both toxin treatments. The protein displayed amino acid sequence and structural homology to Tenebrio molitor 12 kDa hemolymph protein b precursor, a non-olfactory odorant binding protein. Analysis of mRNA expression and mortality assays in Odorant binding protein C12 silenced larvae were consistent with a general immune defense function of non-olfactory odorant binding proteins. Regarding down-regulated proteins, at the transcriptional level, pyruvate dehydrogenase and cuticular genes were decreased in Tc larvae exposed to the Cry3Ba producing strain compared to the Cry23Aa/Cry37Aa producing strain, which may contribute to the developmental arrest that we observed with larvae fed the Cry3Ba producing strain. Results demonstrated a distinct host transcriptional regulation depending upon the Cry toxin treatment. Knowledge

  18. Proteome response of Tribolium castaneum larvae to Bacillus thuringiensis toxin producing strains.

    Science.gov (United States)

    Contreras, Estefanía; Rausell, Carolina; Real, M Dolores

    2013-01-01

    Susceptibility of Tribolium castaneum (Tc) larvae was determined against spore-crystal mixtures of five coleopteran specific and one lepidopteran specific Bacillus thuringiensis Cry toxin producing strains and those containing the structurally unrelated Cry3Ba and Cry23Aa/Cry37Aa proteins were found toxic (LC(50) values 13.53 and 6.30 µg spore-crystal mixture/µL flour disc, respectively). Using iTRAQ combined with LC-MS/MS allowed the discovery of seven novel differentially expressed proteins in early response of Tc larvae to the two active spore-crystal mixtures. Proteins showing a statistically significant change in treated larvae compared to non-intoxicated larvae fell into two major categories; up-regulated proteins were involved in host defense (odorant binding protein C12, apolipophorin-III and chemosensory protein 18) and down-regulated proteins were linked to metabolic pathways affecting larval metabolism and development (pyruvate dehydrogenase Eα subunit, cuticular protein, ribosomal protein L13a and apolipoprotein LI-II). Among increased proteins, Odorant binding protein C12 showed the highest change, 4-fold increase in both toxin treatments. The protein displayed amino acid sequence and structural homology to Tenebrio molitor 12 kDa hemolymph protein b precursor, a non-olfactory odorant binding protein. Analysis of mRNA expression and mortality assays in Odorant binding protein C12 silenced larvae were consistent with a general immune defense function of non-olfactory odorant binding proteins. Regarding down-regulated proteins, at the transcriptional level, pyruvate dehydrogenase and cuticular genes were decreased in Tc larvae exposed to the Cry3Ba producing strain compared to the Cry23Aa/Cry37Aa producing strain, which may contribute to the developmental arrest that we observed with larvae fed the Cry3Ba producing strain. Results demonstrated a distinct host transcriptional regulation depending upon the Cry toxin treatment. Knowledge on how insects

  19. Optimization of Replacing Pork Meat with Yellow Worm (Tenebrio molitor L.) for Frankfurters

    Science.gov (United States)

    Paik, Hyun-Dong

    2017-01-01

    The effects of replacing pork meat with yellow mealworms on the physicochemical properties and sensory characteristics of frankfurters were investigated in this study. The control (50% pork ham), T1 (45% pork ham + 5% yellow mealworm), T2 (40% pork ham + 10% yellow mealworm), T3 (35% pork ham + 15% yellow mealworm), T4 (30% pork ham + 20% yellow mealworm), T5 (25% pork ham + 25% yellow mealworm), and T6 (20% pork ham + 30% yellow mealworm) were prepared, replacing lean pork meat with yellow mealworm. The moisture content, lightness, sarcoplasmic protein solubility, hardness, gumminess, chewiness, and apparent viscosity of frankfurters with yellow mealworm were lower than those of the control (pmealworm were higher than those of the control (pmealworm concentrations (pmealworm concentrations had lower color, flavor, off-flavor, and juiciness scores. The overall acceptability was not significantly different in the control, T1, and T2 (p>0.05). Thus, the results of this study showed that replacing lean pork meat with up to 10% yellow mealworm successfully maintained the quality of frankfurters at a level similar to that of the regular control frankfurters. PMID:29147084

  20. Uptake of cadmium, lead and arsenic by Tenebrio molitor and Hermetia illucens from contaminated substrates

    NARCIS (Netherlands)

    Fels, van der Ine; Camenzuli, L.; Lee, Van Der M.K.; Oonincx, D.G.A.B.

    2016-01-01

    Insects have potential as a novel source of protein in feed and food production in Europe, provided they can be used safely. To date, limited information is available on the safety of insects, and toxic elements are one of the potential hazards of concern. Therefore, we aimed to investigate the

  1. Parasitization by Schleroderma guani influences protein expression in Tenebrio molitor pupae

    Science.gov (United States)

    Ectoparasitoid wasps deposit their eggs on the surface and inject venom into the host. Venoms are chemically complex and they exert substantial impact on hosts, including permanent or temporary paralysis and developmental arrest. These visible venom effects emerge from changes in expression of genes...

  2. Supplementation of Dried Mealworm ( larva on Growth Performance, Nutrient Digestibility and Blood Profiles in Weaning Pigs

    Directory of Open Access Journals (Sweden)

    X. H. Jin

    2016-07-01

    Full Text Available This experiment was conducted to investigate the effects of dried mealworm (Tenebrio molitor larva on growth performance, nutrient digestibility and blood profiles in weaning pigs. A total of 120 weaning pigs (28±3 days and 8.04±0.08 kg of body weight were allotted to one of five treatments, based on sex and body weight, in 6 replicates with 4 pigs per pen by a randomized complete block design. Supplementation level of dried mealworm was 0%, 1.5%, 3.0%, 4.5%, or 6.0% in experimental diet as treatment. Two phase feeding programs (phase I from 0 day to 14 day, phase II from 14 day to 35 day were used in this experiment. All animals were allowed to access diet and water ad libitum. During phase I, increasing level of dried mealworm in diet linearly improved the body weight (p<0.01, average daily gain (ADG (p<0.01 and average daily feed intake (ADFI (p<0.01. During phase II, ADG also tended to increase linearly when pigs were fed higher level of dried mealworm (p = 0.08. In addition, increasing level of dried mealworm improved the ADG (p<0.01, ADFI (p<0.05 and tended to increase gain to feed ratio (p = 0.07 during the whole experimental period. As dried mealworm level was increased, nitrogen retention and digestibility of dry matter as well as crude protein were linearly increased (p = 0.05. In the results of blood profiles, decrease of blood urea nitrogen (linear, p = 0.05 and increase of insulin-like growth factor (linear, p = 0.03 were observed as dried mealworm was increased in diet during phase II. However, there were no significant differences in immunoglobulin A (IgA and IgG concentration by addition of dried mealworm in the growth trial. Consequently, supplementation of dried mealworm up to 6% in weaning pigs’ diet improves growth performance and nutrient digestibility without any detrimental effect on immune responses.

  3. Lysozymes in the animal kingdom

    Indian Academy of Sciences (India)

    Prakash

    a stronger and faster melanin synthesis in Tenebrio molitor larvae injected with partially digested peptidoglycan than in larvae injected with untreated peptidoglycan. Activation of the proPO pathway eventually leads to production of melanin and subsequent deposition of this brown–black pigment at the site of the damaged ...

  4. Use of Tenebrio molitor (Coleoptera: Tenebrionidae) powder to enhance artificial diet formulations for Coleomegilla maculata (Coleoptera: Coccinellidae)

    Science.gov (United States)

    The predatory lady beetle Coleomegilla maculata has potential to control several arthropod pests on crop plants in greenhouses and high tunnels. However, an effective artificial diet is needed in order to mass produce C. maculata in sufficient quantities for augmentative releases. The objectives of ...

  5. Microwave-induced developmental defects in the common mealworm (Tenebrio molitor). A decade of research. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Olsen, R.G.

    1981-12-09

    Microwave-induced developmental effects in insects have been studied at several laboratories during the past decade. Results of the initial experiments were interpreted to show a 'nonthermal' microwave effect, but as more studies were conducted by various investigators, a predominantly thermal effect appeared to be the best explanation. This report presents the results of a comprehensive series of insect irradiation experiments including a rigorous statistical analysis of the data. Statistical analysis shows no microwave-induced effects for exposure of up to 4 hours at dose rates of 63 watts/kilogram. Irradiation at higher intensities (102-126 W/kg) did produce statistically significant effects when applied over a 2-4 hour period.

  6. ISOLATION OF JUVENILE HORMONES ESTERASE AND ITS PARTIAL CDNA CLONE FROM THE BEETLE, TENEBRIO MOLITOR. (R825433)

    Science.gov (United States)

    Juvenile hormone esterase (JHE) plays an essential role in insect development. It is partially responsible for the clearance of juvenile hormone (JH) which regulates various aspects of insect development and reproduction. Because of its role in regulating JH titer, this enzyme...

  7. Visceral larva migrans

    Science.gov (United States)

    Parasite infection - visceral larva migrans; VLM; Toxocariasis; Ocular larva migrans; Larva migrans visceralis ... Saunders; 2016:chap 39. Nash TE. Visceral larvae migrans and other uncommon helminth infections. In: Bennett JE, ...

  8. Effects of formulation and process conditions on microstructure, texture and digestibility of extruded insect-riched snacks

    NARCIS (Netherlands)

    Azzollini, D.; Derossi, A.; Fogliano, V.; Lakemond, C.M.M.; Severini, C.

    2018-01-01

    Extruded cereals made of wheat flour and grinded Yellow mealworm larvae (Tenebrio molitor) were produced to investigate the effect of insect inclusion (0%, 10%, 20%) and processing conditions (barrel temperature and screw speed) on their nutritional content, microstructure, texture and

  9. In vitro digestibility and fermentability of selected insects for dog foods

    NARCIS (Netherlands)

    Bosch, G.; Vervoort, J.J.M.; Hendriks, W.H.

    2016-01-01

    Insects are considered as a sustainable protein source for future pet foods. Here we aimed to evaluate the protein quality of larvae of the black soldier fly (Hermetia illucens, BSF), housefly (Musca domestica, HF) and yellow mealworm (Tenebrio molitor, YMW) and to evaluate the fermentation

  10. In vitro digestibility and fermentability of selected insects for dog foods

    NARCIS (Netherlands)

    Bosch, Guido; Vervoort, J. J M; Hendriks, W. H.

    2016-01-01

    Insects are considered as a sustainable protein source for future pet foods. Here we aimed to evaluate the protein quality of larvae of the black soldier fly (Hermetia illucens, BSF), housefly (Musca domestica, HF) and yellow mealworm (Tenebrio molitor, YMW) and to evaluate the fermentation

  11. Increased toxicity of Bacillus thuringiensis Cry3Aa against Crioceris quatuordecimpunctata, Phaedon brassicae and Colaphellus bowringi by a Tenebrio molitor cadherin fragment

    Science.gov (United States)

    BACKGROUND: Biopesticides containing Cry insecticidal proteins from the bacterium Bacillus thuringiensis (Bt) are effective against many lepidopteran pests, but there is a lack of Bt-based pesticides to efficiently control important coleopteran pests. Based on the reported increase of Bt toxin olig...

  12. Larvae for layers

    DEFF Research Database (Denmark)

    Bjerrum, Lotte; Fischer, Christian Holst; Nordentoft, Steen

    2013-01-01

    Companies and researchers are in close collaboration developing a container- based system for cultivating fly larvae at organic poultry farms. In a one week process, manure will be converted to compost and the live larvae will be harvested and used for feeding laying hens. The larvae are expected...... to have a beneficial effect on the growth performance, intestinal health and on animal behavior in flocks....

  13. Aspects of the breeding biology of the Chinspot Batis Batis molitor in ...

    African Journals Online (AJOL)

    Some aspects of the breeding ecology of the Chinspot Batis (Batis molitor) were studied in Mlawula Nature Reserve, northeastern Swaziland. Nests were predominantly built in thorny bushes or trees. Eggs were laid between 20 September and 2 January. However there was a definite peak in November, during which the ...

  14. ISOLASI NEMATODA PATOGEN SERANGGA STEINERNEMA DAN HETERORHABDITIS

    Directory of Open Access Journals (Sweden)

    Chaerani, Y. Suryadi, T.P. Priyatno, D. Koswanudin1, U. Rahmat , Sujatmo, Yusuf, dan C.T. Griffin.

    2012-02-01

    Full Text Available Isolation of Entomopathogenic Nematodes Steinernema and Heterorhabditis. Entomopathogenic nematodes from the genus Steinernema and Heterorhabditis (Rhabditida: Steinernematidae and Heterorhabditidae are promising biological control agent of insect pests. Indigenous nematodes have been isolated and collected for the use in local biological control program of important insect pests. The nematodes were isolated using soil baiting method with insect larvae. Laboratory tests have shown that the mealworm larvae Tenebrio molitor (Coleoptera: Tenebrionidae served as a good alternative to the standard insect bait, the greater wax moth larvae Galleria mellonella (Lepidoptera: Galleriidae for isolation and maintenance of nematodes. Both nematodes were successfully isolated using T. molitor larvae from 13% soil samples (26 out of a total of 207 collected from 14 locations in West and Central Java and Lampung provinces in the period of 1993 until 2006. Heterorhabditis (9% was more prevalent than Steinernema (4%. Both nematodes were successfully propagated on mealworm larvae.

  15. USAFSAM Review and Analysis of Radiofrequency Radiation Bioeffects Literature: Second Report.

    Science.gov (United States)

    1982-05-01

    Rosenbaum, and W. F. Pickard THE RELATION OF TERATOGENESIS IN TENEBRIO MOLITOR TO THE INCIDENCE OF LOW-LEVEL MICROWAVES IEEE Trans. Microwave Theory...Teratogenic and developmental abnormalities; ’N VIVO; TENEBRIO MOLITOR (DARKLING BEETLE) Effect type: Abnormalities in emergent adult beetles due to RFR...early pupae of the mealworm beetle, Tenebrio molitor . Each pupa was inserted in a waveguide and irradiated therein at waveguide powers of 80 mW for

  16. Perreyia flavipes larvae toxicity

    Directory of Open Access Journals (Sweden)

    Djeison L. Raymundo

    2012-08-01

    Full Text Available Fresh or thawed Perreyia flavipes larvae were ground and mixed with water and orally ad ministered to sheep. At 5mg/kg, neither clinical nor enzymatic changes were observed. Unique do ses of 7.5 and 10mg/kg induced characteristic clinical signs of Perreyia sp. larvae poisoning, increased GGT and AST values, and decreased glycemic curves. However, doses of 5, 10, and 15mg/kg repeated at 30 or 15 days intervals caused no disease and mild disease followed by death, respectively. These fin dings indicate that these animals probably developed some degree of tolerance to the toxins in P. flavipes larvae. Ultrastru ctural examination of liver revealed proliferation of the smooth endoplasmic reticulum in the hepatocytes, which may be associated with an increased ability to metabolize toxins and could consequently lead to the tolerance observed in the present study. Further investigations may elucidate whether such tolerance effects could be applied as a control measure for P. flavipes poioning or other hepatotoxic diseases. In addition, clinicopathological findings were discussed.

  17. Berbagai Cara Pengendalian Larva Nyamuk

    Directory of Open Access Journals (Sweden)

    Nungki Hapsari Suryaningtyas

    2017-02-01

    Full Text Available Tindakan pencegahan dengan memberantas sarang nyamuk dan membunuh larva serta nyamuk dewasa terus digalakkan. Stadium pradewasa atau larva dapat dikontrol secara biologi maupun kimiawi.1 Berikut adalah beberapa cara pengendalian larva nyamuk.Pengendalian secara biologi Beberapa organisme yang efektif untuk mengendalikan larva secara biologi diantaranya adalah Ikan (larvavivorous fish,Aplocheilus panchax (ikan kepala timah, Ctenops vittatus (ikan cupang,Oreochromis (Tilapia mossambicus (ikan nila dan Cyprinus carpio (ikan tombro, larva nyamuk dari genus Toxorhynchites, Capung (Dragonflies/Labellula . Kelompok Udang (Cyclopoid copepods Jenis Copepoda yang tersebar sebagai plankton dan bentos ini bersifat predator yang efektif untuk mengendalikan stadium pradewasa nyamuk instar satu dan instar dua. Pada suatu penelitian di Polynesia Perancis terbukti bahwa M. aspericornis pengaruhnya tidak konsisten terhadap larva Ae. aegypti yang ditemukan berada di tangki air, drum dan sumur yang tertutup. Keadaan tersebut tampaknya bergantung pada tersedianya mikrofauna di tempat perkembangbiakannya yang dibutuhkan untuk pertumbuhan Copepoda tersebut

  18. Simulación de un Robot Hexápodo Bioinspirado en el Tenebrio

    Directory of Open Access Journals (Sweden)

    Juan Pablo Rodríguez-Calderón

    2015-06-01

    Full Text Available Los insectos son base fundamental en el estudio de la robótica reactiva ya que estos poseen características biológicas y motrices que son de interés para ser implementadas en robots bioinspirados, teniendo en cuenta el desempeño de éstos en diferentes áreas. Por otra parte los animales hexápodos poseen omnidireccionalidad y estabilidad, debido a la formación del trípode de apoyo, el cual se crea en sus patas al dar un paso, lo cual les permite sobrepasar diferentes obstáculos con facilidad y velocidad constante. En este proyecto se implementa el sistema locomotor del insecto Tenebrio debido a la facilidad con que se pueden apreciar sus movimientos. Se analiza el desplazamiento de las patas del insecto en diferentes trayectorias, vistas y terreno plano, posteriormente se encontraron los parámetros, ecuaciones y restricciones que limitan los diferentes eslabones de cada una de las patas del Tenebrio, esto se realizó por medio de un análisis de imágenes. Finalmente la información recogida se implementa en la plataforma MATLAB para determinar las características de movimiento, estabilidad y desplazamiento.

  19. Cutaneous larva migrans

    Directory of Open Access Journals (Sweden)

    Aleksandra Wieczorek

    2016-09-01

    Full Text Available Introduction . Cutaneous larva migrans (CLM is a tropical zoonosis, caused by parasites, usually Ancylostoma braziliense. Humans are an accidental host. Polish patients with CLM are usually tourists visiting tropical and subtropical countries. The first symptoms do not always appear as creeping eruptions, which complicates the diagnosis. Objective. To present the case of a man with CLM after returning from Thailand to Poland and associated diagnostic difficulties. Case report. We present a case of a 28-year-old man who returned to Poland from Thailand. The first symptoms appeared as disseminated pruritic papules. No improvement after treatment with corticosteroids and antihistamines was observed. The diagnosis was established after the appearance of serpentine erythemas and improvement after albendazole therapy. Conclusions. In the case of returnees from exotic countries suffering from raised, pruritic rashes, and no improvement after treatment with corticosteroids and antihistamines, parasitic etiology should be considered.

  20. Larval cannibalism and pupal defense against cannibalism in two species of tenebrionid beetles.

    Science.gov (United States)

    Ichikawa, Toshio; Kurauchi, Toshiaki

    2009-08-01

    Cannibalism of pupae by larvae has been documented In many species of Insects, but the features of larval cannibalism and pupal defensive mechanisms against larval cannibalism have been largely Ignored. Pupae of tenebrionld beetles rotate their abdominal segments in a circular motion in response to the tactile stimulation of appendages, including legs, antennae, maxillary pulps, and wings. When the pupal abdominal rotation responses of Tenebrio molitor and Zophobas atratus were completely blocked by transecting the ventral nerve cord (VNC) of the pupae, the appendages of the paralytic pupae became initial, major targets for attack by larval cannibals. The majority of 20 paralytic pupae was cannibalized by 100 larvae within 6 h, and almost all the pupae were killed within 2-3 days. In contrast, only a few pupae of Z. atratus and several pupae of T. molitor were cannibalized when the VNC was Intact. The abdominal rotation response of the pupae thus functions as an effective defense against larval cannibalism.

  1. The Effect of Tenebrio obscurus on Elementary Preservice Teachers' Content Knowledge, Attitudes, and Self-efficacy

    Science.gov (United States)

    Weinburgh, Molly

    2007-12-01

    This study explores the extent to which an activity used in an elementary science methods course affected the preservice teachers’ content knowledge, attitudes, and self-efficacy. The participants were 172 students enrolled in five sections of elementary science methods. Students participated in a 9-week investigation on life cycles using mealworms ( Tenebrio obscurus). Multiple data sources indicate that most of the students had limited prior content knowledge about mealworms, expressed neutral attitudes toward mealworms upon first exposure to them, and were uncomfortable with the idea of having to teach with and about them. At the end of 9 weeks, content knowledge on mealworms had greatly improved. The preservice teachers’ attitudes about mealworms and their self-efficacy about using mealworms with children had also improved.

  2. Desiccation resistance of Chironomid larvae

    Directory of Open Access Journals (Sweden)

    Jan Frouz

    2015-07-01

    Full Text Available Resistance to desiccation in larvae of eight species of aquatic, semiaquatic and terrestrial chironomids (Pseudodiamesa branickii, Macropelopia sp., Prodiamesa olivacea, Micropsectra sp., Chironomus riparius, Chironomus dorsalis, Metriocnemus martini and Camptocladius stercorarius was studied. The larvae were desiccated in exicator at constant conditions (15 °C, 80% RH and changes in moisture and body water content was recorded. The LD-50 for loss of body water was calculated. The lowest resistance to loss of body water was found in larvae from subfamilies Tanypodinae and Diamesinae Macropelopia sp. and P. branickii. They survived loss of 49.7 and 56.6% of original water content (presented values are LD-50. On the other hand the highest resistance to water loss was found in C. dorsalis. M. martini and C. stercorarius. The larvae of these species may survive loss of 67.4, 76.6 and 84.2% of original water content. Nevertheless the survival time under experimental conditions depends more closely on larval size than on lethal level of water loss. The smaller larvae desiccated faster and perished sooner than large ones despite they tolerate higher loss of body water.

  3. USAFSAM (USAF School of Aerospace Medicine) Review and Analysis of Radiofrequency Radiation Bioeffects Literature: Third Report.

    Science.gov (United States)

    1984-03-01

    Rosenbaum, and W.F. Pickard THE RELATION OF TERATOGENESIS IN TENEBRIO MOLITOR TO THE INCIDENCE OF LOW-LEVEL MICROWAVES IEEE Trans. ictowave Theory and Tech...TERATOGENESIS IN TENEBRIO MOLITOR TO THE INCIDENCE OF LOW-LEVEL MICROWAVES IEEE Trans. Microwave Theory and Tech., Vol. 23, No. II, pp. 929-931 (1975) (11...RFR EVOKED-POTENTIAL STRESS EXPOSURE-SYSTEM TENEBRIO GUINEA-PIG TERATOGENIC HAMSTER THERMOREGULATION HAPLOTYPE THRESHOLD HFMATOLOGY TRACER HISTOLOGY

  4. USAFSAM (USAF School of Aerospace Medicine) Review and Analysis of Radiofrequency Radiation Bioeffects Literature: Fourth Report.

    Science.gov (United States)

    1984-05-01

    TENEBRIO MOLITOR TO THE INCIDENCE OF LOW-LEVEL MICROWAVES IEEE Trans. Microwave Theory and Tech., Vol. 23, No. 11, pp. 929-931 (1975) (II-44) 57 McRee...OF TERATOGENESIS IN TENEBRIO MOLITOR TO THE INCIDENCE OF LOW-LEVEL MICROWAVES IEEE Trans. Microwave Theory and Tech., Vol. 23, No. 11, pp. 929-931...EKG RAT EMBRYO RECTAL ENDOCRINOLOGIC REPEATED-ACQUISITION ENVIRONMENTAL REVIEW EPIDEMIOLOGIC RFR ESTRUS STRESS EVOKED-POTENTIAL TENEBRIO EXPOSURE

  5. THE ALLEGED OCCURRENCE OF ADRENALIN IN THE MEALWORM

    Science.gov (United States)

    Gregerman, Robert I.; Wald, George

    1952-01-01

    Wense has reported the isolation of crystalline adrenalin from larvae of the beetle Tenebrio molitor. An attempt to repeat his procedures failed to yield any evidence of adrenalin. Analysis of mealworm extracts by paper chromatography and colorimetric means also yielded no indication of adrenalin, though adrenalin added to mealworms can be detected by these procedures in amounts less than 1 mg. per 100 gm. Mealworm extracts reveal on the paper chromatogram the presence of two other orthodiphenols, neither of which appears to be dopa but which may be 3,4-dihydroxyphenyllactic acid and 3,4-dihydroxyphenylacetic acid, compounds recently isolated elsewhere from this organism. PMID:14898031

  6. The alleged occurrence of adrenalin in the mealworm.

    Science.gov (United States)

    GREGERMAN, R I; WALD, G

    1952-01-01

    Wense has reported the isolation of crystalline adrenalin from larvae of the beetle Tenebrio molitor. An attempt to repeat his procedures failed to yield any evidence of adrenalin. Analysis of mealworm extracts by paper chromatography and colorimetric means also yielded no indication of adrenalin, though adrenalin added to mealworms can be detected by these procedures in amounts less than 1 mg. per 100 gm. Mealworm extracts reveal on the paper chromatogram the presence of two other orthodiphenols, neither of which appears to be dopa but which may be 3,4-dihydroxyphenyllactic acid and 3,4-dihydroxyphenylacetic acid, compounds recently isolated elsewhere from this organism.

  7. Workbook on the Identification of Mosquito Larvae.

    Science.gov (United States)

    Pratt, Harry D.; And Others

    This self-instructional booklet is designed to enable public health workers identify larvae of some important North American mosquito species. The morphological features of larvae of the various genera and species are illustrated in a programed booklet, which also contains illustrated taxonomic keys to the larvae of 11 North American genera and to…

  8. Efeitos da temperatura e da defesa da presa no consumo pelo predador Supputius cincticeps (Stäl (Heteroptera:Pentatomidae Effects of temperature and of the prey defense on the consumption by the predator Supputius cincticeps (Stäl (Heteroptera:Pentatomidae

    Directory of Open Access Journals (Sweden)

    Francisco Roberto de Azevedo

    1999-02-01

    Full Text Available A pesquisa objetivou determinar se a temperatura e a defesa da presa afetam o consumo e a utilização de larvas de Tenebrio molitor L. por ninfas de Supputius cincticeps (Stäl. Quantificaram-se em cada um dos ínstares do predador Supputius cincticeps os consumos bruto e diário das larvas de T. molitor com e sem defesa, ganho de peso total e ganho de peso diário pelo predador. Foram determinados os efeitos da defesa da presa e da temperatura ambiente no consumo de alimento pelas ninfas de 2º, 3º, 4º e 5º ínstares de S. cincticeps. A pesquisa foi conduzida na Unidade de Controle Biológico da Embrapa-Centro Nacional de Pesquisa de Algodão, em Campina Grande, PB, a 20, 25, e 30ºC, 60±10% UR e fotofase de 14 horas. Os resultados mostraram que o consumo bruto de larvas de T. molitor pelo S. cincticeps depende do ínstar do predador e da temperatura, do ínstar do predador e da defesa da presa, e da temperatura e defesa da presa; o consumo diário de S. cincticeps depende do ínstar do predador e da temperatura, e do ínstar do predador e da defesa da presa, e o ganho de peso de S. cincticeps depende do seu ínstar, da temperatura e da defesa apresentada pelas larvas de T. molitor. O tamanho das larvas de T. molitor funciona como defesa ao ataque de S. cincticeps.The objective of the research was to determine if the temperature and pray defense affect the consumption and utilization of Tenebrio molitor L. larvae by nymphs of Supputius cincticeps (Stäl. The gross and daily consumptions of T. molitor larvae with and without defense by the predator Supputius cincticeps, and the gross and daily weight gains of the predator were quantified. Effects of the prey defense and temperature on the food consumption by the 2nd, 3rd, 4th and 5th instar nimphs of S. cincticeps were determined. The research was carried out in the Biological Control Unit of the Embrapa-Centro Nacional de Pesquisa de Algodão, at Campina Grande, PB, Brazil, at 20, 25, and

  9. Draft Supplement to Final Environmental Statement on Continental United States (CONUS) Over-the-Horizon Backscatter (OTH-B) Radar System, Penobscot, Washington, Somerset Counties, Maine.

    Science.gov (United States)

    1981-08-01

    development of eggs of birds and the pupae of the darkling beetle, Tenebrio molitor , have also been performed with RFR. Although the term uiually refers... Tenebrio Molitor ," Radio Sci., Vol. 14, No. 6S, pp. 165-171 (1979). Greene, F. M., "Development of Magnetic Near-Field Probes," U.S. Department of...Liu, L. M., F. J. Rosenbaum, and W. F. Pickard, "The Relation of Teratogenesis in Tenebrio Molitor to the Incidence of Low-Level Microwaves," IEEE

  10. A novel 43-kDa protein as a negative regulatory component of phenoloxidase-induced melanin synthesis.

    Science.gov (United States)

    Zhao, Mingyi; Söderhäll, Irene; Park, Ji Won; Ma, Young Gerl; Osaki, Tsukusa; Ha, Nam-Chul; Wu, Chun Fu; Söderhäll, Kenneth; Lee, Bok Luel

    2005-07-01

    The melanization reaction induced by activated phenoloxidase in arthropods is important in the multiple host defense innate immune reactions, leading to the sequestration and killing of invading microorganisms. This reaction ought to be tightly controlled because excessive formation of quinones and systemic hypermelanization are deleterious to the hosts, suggesting that a negative regulator(s) of melanin synthesis may exist in hemolymph. Here, we report the purification and cloning of a cDNA of a novel 43-kDa protein, from the meal-worm Tenebrio molitor, which functions as a melanization-inhibiting protein (MIP). The deduced amino acid sequence of 352 residues has no homology to known sequences in protein data bases. When the concentration of the 43-kDa protein was examined by Western blot analysis in a melanin-induced hemolymph prepared by injection of Candida albicans into T. molitor larvae, the 43-kDa protein specifically decreased in the melanin-induced hemolymph compared with control hemolymph. Recombinant MIP expressed in a baculovirus system had an inhibitory effect on melanin synthesis in vitro. RNA interference using a synthetic 445-mer double-stranded RNA of MIP injected into Tenebrio larvae showed that melanin synthesis was markedly induced. These results suggest that this 43-kDa MIP inhibits the formation of melanin and thus is a modulator of the melanization reaction to prevent the insect from excessive melanin synthesis in places where it should be inappropriate.

  11. Coral larvae move toward reef sounds

    NARCIS (Netherlands)

    Vermeij, M.J.A.; Marhaver, K.L.; Huijbers, C.M.; Nagelkerken, I.; Simpson, S.D.

    2010-01-01

    Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm) that influence settlement success are difficult to

  12. [Cutaneous larva migrans in travelers].

    Science.gov (United States)

    Rubio, S; Ruiz, L; Gascón, J; Corachán, M

    1992-02-15

    Fifteen cases of cutaneous larva migrans (CLM) diagnosed in transcontinental travellers over a period of 4 years in the Department of Tropical Medicine in Hospital Clinic i Provincial of Barcelona were reviewed. The frequency of this disease as an imported pathology is on the increase and is related to the greater mobility of travellers today. Tourism is the main motive of the traveller and the geographic origin of the cases is cosmopolitan. The use of open footwear in 14 of the 15 patients is pointed out. The single lesion on the foot was the most frequent site. Thiabendazole was effective in 14 patients as was albendazole used in one patient. The secondary effects of thiabendazole, principally gastrointestinal disorders, headache, and dizziness are underlined.

  13. Paenibacillus larvae enolase as a virulence factor in honeybee larvae infection.

    Science.gov (United States)

    Antúnez, Karina; Anido, Matilde; Arredondo, Daniela; Evans, Jay D; Zunino, Pablo

    2011-01-10

    Paenibacillus larvae is a gram-positive spore-forming bacteria, causative agent of American Foulbrood (AFB), a severe disease affecting larvae of the honeybee Apis mellifera. In an attempt to detect potential virulence factors secreted by P. larvae, we identified an enolase among different secreted proteins. Although this protein is a cytosolic enzyme involved in glycolytic pathways, it has been related to virulence. The aim of the present work was to evaluate its role during the infection of honeybee larvae. Toxicity assays showed that enolase was highly toxic and immunogenic to honeybee larvae. Its production was detected inside P. larvae vegetative cells, on the surface of P. larvae spores and secreted to the external growth medium. P. larvae enolase production was also confirmed in vivo, during the infection of honeybee larvae. This protein was able to hydrolyze milk proteins as described for P. larvae, suggesting that could be involved in larval degradation, maybe through the plasmin(ogen) system. These results suggest that P. larvae enolase may have a role in virulence and could contribute to a general insight about insect-pathogen interaction mechanisms. Copyright © 2010 Elsevier B.V. All rights reserved.

  14. Feeding for larvae of catfish Pangasionodon sp. larvae in different ages

    Directory of Open Access Journals (Sweden)

    Muhammad Agus Suprayudi

    2015-05-01

    Full Text Available ABSTRACT Sludge worm (Tubifex sp. as natural feed on catfish (Pangasionodon sp. larvae rearing is available in limited amount especially during rainy season. It becomes a constraint factor for larvae rearing sector. This research was conducted to evaluate the appropriate initial age of catfish larvae to get artificial feed as sludge worm replacement. Evaluation was conducted on the growth and survival of catfish larvae in 14 days of culture. There were four treatments of feeding in triplicates i.e. larvae were given natural feed without artificial feed, given artificial feed started from d3, d6, and d9 with three replications. The results showed that larvae fed on artificial feed on d3 had the lowest growth compared to the other treatments, whereas the survival was not significantly different (P>0.05 among the treatments. As a conclusion, artificial feed could be used to replace natural feed for catfish larvae started at the age of nine days. Keywords: sludge worm, catfish larvae, artificial feed  ABSTRAK Cacing sutra (Tubifex sp. tersedia dalam jumlah terbatas terutama pada musim penghujan sebagai pakan alami dalam usaha pembenihan ikan patin (Pangasionodon sp.. Ini menjadi kendala dalam usaha pembenihan. Penelitian ini dilakukan untuk mengevaluasi umur larva ikan patin yang tepat untuk mulai diberi pakan buatan menggantikan cacing sutra. Evaluasi dilakukan pada pertumbuhan dan kelangsungan hidup larva ikan patin umur 14 hari. Selama pemeliharaan, larva diberi pakan dengan empat perlakuan; pemberian pakan alami tanpa pakan buatan, pemberian pakan buatan mulai d3, d6, dan d9 dengan tiga ulangan untuk masing-masing perlakuan. Hasil penelitian menunjukkan bahwa perlakuan pemberian pakan buatan mulai d3 memiliki pertumbuhan panjang yang terkecil dibandingkan perlakuan lain, sedangkan tingkat kelangsungan hidup larva tidak berbeda nyata (P>0,05 antarperlakuan. Berdasarkan hasil penelitian, dapat disimpulkan bahwa pakan buatan dapat digunakan

  15. Directional flow sensing by passively stable larvae.

    Science.gov (United States)

    Fuchs, Heidi L; Christman, Adam J; Gerbi, Gregory P; Hunter, Elias J; Diez, F Javier

    2015-09-01

    Mollusk larvae have a stable, velum-up orientation that may influence how they sense and react to hydrodynamic signals applied in different directions. Directional sensing abilities and responses could affect how a larva interacts with anisotropic fluid motions, including those in feeding currents and in boundary layers encountered during settlement. Oyster larvae (Crassostrea virginica) were exposed to simple shear in a Couette device and to solid-body rotation in a single rotating cylinder. Both devices were operated in two different orientations, one with the axis of rotation parallel to the gravity vector, and one with the axis perpendicular. Larvae and flow were observed simultaneously with near-infrared particle-image velocimetry, and behavior was quantified as a response to strain rate, vorticity and centripetal acceleration. Only flows rotating about a horizontal axis elicited the diving response observed previously for oyster larvae in turbulence. The results provide strong evidence that the turbulence-sensing mechanism relies on gravity-detecting organs (statocysts) rather than mechanosensors (cilia). Flow sensing with statocysts sets oyster larvae apart from zooplankters such as copepods and protists that use external mechanosensors in sensing spatial velocity gradients generated by prey or predators. Sensing flow-induced changes in orientation, rather than flow deformation, would enable more efficient control of vertical movements. Statocysts provide larvae with a mechanism of maintaining their upward swimming when rotated by vortices and initiating dives toward the seabed in response to the strong turbulence associated with adult habitats. © 2015. Published by The Company of Biologists Ltd.

  16. Mealworms for Food: A Water Footprint Perspective

    National Research Council Canada - National Science Library

    Miglietta, Pier; De Leo, Federica; Ruberti, Marcello; Massari, Stefania

    2015-01-01

    ... (Tenebrio molitor and Zophobas morio mealworms), because they are already commercially produced even in Western countries, and for this reason it is possible to find specific data in literature about their diets...

  17. Bioanalogues oj juvenile hormones and intestines mycoflora of some insects

    Directory of Open Access Journals (Sweden)

    Andrzej Nespiak

    2014-08-01

    Full Text Available The subject of this paper is the influence of JH bioanalogues on the mycoflora of intestines of three species of inscets: Dysdereus cinaulams, Pyrrhocoris apterus and Tenebrio molitor. The results are presented in tables.

  18. Mechanical properties of the beetle elytron, a biological composite material

    Science.gov (United States)

    We determined the relationship between composition and mechanical properties of elytral (modified forewing) cuticle of the beetles Tribolium castaneum and Tenebrio molitor. Elytra of both species have similar mechanical properties at comparable stages of maturation (tanning). Shortly after adult ecl...

  19. CalCOFI Larvae Counts Positive Tows

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for eggs captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  20. Rearing Chrysoperla externa Larvae on Artificial Diets.

    Science.gov (United States)

    Bezerra, C E S; Amaral, B B; Souza, B

    2017-02-01

    We tested three artificial diets for rearing larvae of Chrysoperla externa (Hagen) (Neuroptera: Chrysopidae), aiming at reducing the production costs of this predator. Two of the diets come from studies with other species of lacewings, and the third is a modification described in this paper. All diets were based on animal protein and were supplied to 2nd and 3rd instar larvae, whereas 1st instar larvae received eggs of Anagasta kuehniella (Zeller) (Lepidoptera: Pyralidae). We evaluated the preimaginal duration and survival, adult size, longevity and fecundity, egg hatchability, and predatory capacity of larvae produced. The performance of the diets was followed for seven generations. The diet we describe showed to be the best among the artificial diets tested. Our results show that C. externa can be successfully reared on artificial diets during second and third instars, reducing in 90% the dependency on eggs of A. kuehniella.

  1. Extreme morphologies of mantis shrimp larvae

    DEFF Research Database (Denmark)

    Haug, Carolin; Ahyong, Shane T.; Wiethase, Joris H.

    2016-01-01

    Larvae of stomatopods (mantis shrimps) are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages), alima and erichthus (the latt er two representing later larval stages). These categories, however, do not refl ect the existing morphological...... diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoological Museum, University of Copenhagen and were collected during the Danish Dana Expedition round the world...... 1928–30. These new larval types all represent erichthus-type larvae, especially diff ering in their shield morphologies. Th e shield morphology ranges from almost spherical to rather disc-like, with sometimes extremely elongated spines, but only a general systematic assignment of the larvae...

  2. Activity of R(+ limonene against Anisakis larvae

    Directory of Open Access Journals (Sweden)

    Filippo Giarratana

    2015-12-01

    Full Text Available The aim of this work is to evaluate the activity of R(+ limonene of against Anisakidae larvae. Its effectiveness was tested in vitro. The results obtained showing a significant activity of the compound against Anisakis larvae, suggesting further investigation on its potential use in the industrial marinating process. In this regard, the use of R(+ limonene in seafood products could be interesting, also due the sensory attributes resulting from its use and its relatively safe status.

  3. Coral larvae move toward reef sounds.

    Directory of Open Access Journals (Sweden)

    Mark J A Vermeij

    Full Text Available Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm that influence settlement success are difficult to observe in situ and are therefore largely unknown. Here, we show that coral larvae respond to acoustic cues that may facilitate detection of habitat from large distances and from upcurrent of preferred settlement locations. Using in situ choice chambers, we found that settling coral larvae were attracted to reef sounds, produced mainly by fish and crustaceans, which we broadcast underwater using loudspeakers. Our discovery that coral larvae can detect and respond to sound is the first description of an auditory response in the invertebrate phylum Cnidaria, which includes jellyfish, anemones, and hydroids as well as corals. If, like settlement-stage reef fish and crustaceans, coral larvae use reef noise as a cue for orientation, the alleviation of noise pollution in the marine environment may gain further urgency.

  4. Extreme morphologies of mantis shrimp larvae

    Directory of Open Access Journals (Sweden)

    Carolin Haug

    Full Text Available ABSTRACT Larvae of stomatopods (mantis shrimps are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages, alima and erichthus (the latter two representing later larval stages. These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoological Museum, University of Copenhagen and were collected during the Danish Dana Expedition round the world 1928-30. These new larval types all represent erichthus-type larvae, especially differing in their shield morphologies. The shield morphology ranges from almost spherical to rather disc-like, with sometimes extremely elongated spines, but only a general systematic assignment of the larvae was possible. Further investigations of these larvae are crucial to understand their life habits and ecological impact, especially as stomatopod and other crustacean larvae might have a much more important position in the marine ecosystems than their corresponding adults.

  5. Predatory activity of Rhantus sikkimensis and larvae of Toxorhynchites splendens on mosquito larvae in Darjeeling, India.

    Science.gov (United States)

    Aditya, Gautam; Ash, Anirban; Saha, Goutam K

    2006-06-01

    Predation potential of the dytiscid beetle, Rhantus sikkimensis Regimbart 1899 and the larvae of Toxorhynchites splendens Wiedemann 1819 occurring along with the larval stages of the mosquitoes in the annual lentic water bodies of Darjeeling was evaluated using the larvae of Culex quinquefasciatus Say 1823 as preys, in the laboratory under simulated natural conditions. Field collected R. sikkimensis and larvae of Tx. splendens were offered IV instar larvae of Cx. quinquefasciatus to observe the rate of predation, at varying prey and predator densities. Based on the data obtained on the predation for a period of three consecutive days, two indices of predation, predatory impact (PI) and clearance rate (CR) values were estimated, and compared between the predator species. The rate of predation of IV instar Cx. quinquefasciatus larvae by R. sikkimensis ranged between 21.56 and 86.89 larvae per day, depending on the prey and predator densities. The PI value remained between 18.67 and 35.33 larvae/day depending on prey densities, while the CR ranged between 2.21 and 2.23 larvae litres/day/predator. Compared to these, the Tx. splendens larvae consumed the prey larvae at the rate of 0.67 to 34.22 larvae per day, depending on the prey and predator densities. The PI value ranged between 7.67 and 11.33 larvae/day, and the CR value ranged between 1.41 and 1.76 larvae litres/day/predator. The rate of predation, CR values and PI values of R. sikkimensis and Tx. splendens varied significantly. Both the predators R. sikkimensis and larvae of Tx. splendens can consume a good number of mosquito larvae, though the rate of consumption between the two predators vary owing to the difference in the life history traits and features. It can be assumed that these predators play an important role in larval population regulation of mosquitoes and thereby impart an effect on species composition and interactions in the aquatic insect communities of Darjeeling Hills, India.

  6. Postembryonic development of Loxosceles intermedia Mello-Leitão, 1934, L. laeta (Nicolet, 1849 and L. gaucho Gertsch, 1967 (Araneae; Sicariidae breeding under conditions of monospecific diet

    Directory of Open Access Journals (Sweden)

    Emanuel Marques da Silva

    2005-05-01

    Full Text Available The influence of monospecific feeding on the post-embryonic development of L. intermedia, L. laeta and L. gaucho was evaluated. Two hundred and ten spiderlings were individualized in containers (120 ml, 105 being fed with Tenebrio molitor larvae and 105 with Pycnoscelus surinamensis nymphs. In the three species, the number of molts varied according to the diet. The number of spiders that reached maturity was lower in L. gaucho. In L. intermedia, the duration of the post-embryonic period was greater when larvae are fed. Mortality was higher in the second instar in the three species, the highest frequency being registered for L. gaucho. The data provided evidence that monospecific feeding influenced the post-embryonic development of the studied species. This influence might intensified by specific characteristics such as origin, habits and habitats.

  7. Duração do período ninfal e sobrevivência do predador Podisus connexivus Bergroth (Hemiptera, Pentatomidae, em três presas alternativas Ninfal period duration and survival of the predator Podisus connexivus Bergroth (Hemiptera, Pentatomidae, in three alternative preys

    Directory of Open Access Journals (Sweden)

    José Cola Zanuncio

    1993-01-01

    Full Text Available Longevity and survival of the predator Podisus connexivus (Hemiptera: Pentatomidae were studied in three alternative preys: T1 - Bombyx mori (Lepidoptera, Bombycidae catterpilars; T2 - Musca domestica (Diptera, Muscidae larva and T3 - Tenebrio molitor (Coleoptera, Tenebrionidae larva. Longevity and survival were: 22,1±0,6 days and 54,3±5,3%; 25,2±1,3 days and 56,0±4,9% and 22,0±0,8 days and 34,6±8,6%, for treatments T1, T2 and T3, respectively. Comparing to other researches, a lower survival was found. This is probably because a F2 generation from field material, was used. Since the insect was not well adapted to the laboratory conditions this could have led to lower survival.

  8. Chironomidae bloodworms larvae as aquatic amphibian food.

    Science.gov (United States)

    Fard, Mojdeh Sharifian; Pasmans, Frank; Adriaensen, Connie; Laing, Gijs Du; Janssens, Geert Paul Jules; Martel, An

    2014-01-01

    Different species of chironomids larvae (Diptera: Chironomidae) so-called bloodworms are widely distributed in the sediments of all types of freshwater habitats and considered as an important food source for amphibians. In our study, three species of Chironomidae (Baeotendipes noctivagus, Benthalia dissidens, and Chironomus riparius) were identified in 23 samples of larvae from Belgium, Poland, Russia, and Ukraine provided by a distributor in Belgium. We evaluated the suitability of these samples as amphibian food based on four different aspects: the likelihood of amphibian pathogens spreading, risk of heavy metal accumulation in amphibians, nutritive value, and risk of spreading of zoonotic bacteria (Salmonella, Campylobacter, and ESBL producing Enterobacteriaceae). We found neither zoonotic bacteria nor the amphibian pathogens Ranavirus and Batrachochytrium dendrobatidis in these samples. Our data showed that among the five heavy metals tested (Hg, Cu, Cd, Pb, and Zn), the excess level of Pb in two samples and low content of Zn in four samples implicated potential risk of Pb accumulation and Zn inadequacy. Proximate nutritional analysis revealed that, chironomidae larvae are consistently high in protein but more variable in lipid content. Accordingly, variations in the lipid: protein ratio can affect the amount and pathway of energy supply to the amphibians. Our study indicated although environmentally-collected chironomids larvae may not be vectors of specific pathogens, they can be associated with nutritional imbalances and may also result in Pb bioaccumulation and Zn inadequacy in amphibians. Chironomidae larvae may thus not be recommended as single diet item for amphibians. © 2014 Wiley Periodicals, Inc.

  9. Odor-taste learning in Drosophila larvae.

    Science.gov (United States)

    Widmann, Annekathrin; Eichler, Katharina; Selcho, Mareike; Thum, Andreas S; Pauls, Dennis

    2017-08-18

    The Drosophila larva is an attractive model system to study fundamental questions in the field of neuroscience. Like the adult fly, the larva offers a seemingly unlimited genetic toolbox, which allows one to visualize, silence or activate neurons down to the single cell level. This, combined with its simplicity in terms of cell numbers, offers a useful system to study the neuronal correlates of complex processes including associative odor-taste learning and memory formation. Here, we summarize the current knowledge about odor-taste learning and memory at the behavioral level and integrate the recent progress on the larval connectome to shed light on the sub-circuits that allow Drosophila larvae to integrate present sensory input in the context of past experience and to elicit an appropriate behavioral response. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Insects in the Classroom: A Study of Animal Behavior

    Science.gov (United States)

    Miller, Jon S.

    2004-01-01

    These activities allow students to investigate behavioral responses of the large Milkweed bug, "Oncopeltus fasciatus," and the mealworm, "Tenebrio molitor" or "Tenebrio obscurus," to external stimuli of light, color, and temperature. During the activities, students formulate hypotheses to research questions presented. They also observe insects for…

  11. Bibliography of Scientific Publications 1977-1991.

    Science.gov (United States)

    1992-06-01

    Air Force Base, TX, 1981, pp. 149-154. (AD A107 357) Olsen, R.G., Microwave-induced Developmental Defects in the Common Mealwonn ( Tenebrio molitor )-A...and Olsen, R.G., ’Developmental Effects of Microwaves on Tenebrio : Influences of Culturing Protocol and of Carrier Frequency." Radio Science, Vol. 14

  12. Bibliography of Scientific Publications 1978-1990,

    Science.gov (United States)

    1991-09-01

    1981, pp. 149-154. (AD A107 357) Olsen, R.G., Microwave-induced Developmental Defects in the Common Mealwormt ( Tenebrio molitor )--A Decade of... Tenebrio : Influences of Culturing Protocol and of Carrier Frequency." Radio Science, Vol. 14, No. 6S, pp. 181-186, 1979. Robertson, R.M., Greene, J.W

  13. Bibliography of Scientific Publications 1975-1993,

    Science.gov (United States)

    1994-03-01

    A107 357) Olsen, R.G., Microwave-induced Developmental Defects in the Common Mealworm ( Tenebrio molitor )--A Decade of Research, NAMRL-1283, Naval...W.F. and Olsen, R.G., "Developmental Effects of Microwaves on Tenebrio : Influences of Culturing Protocol and of Carrier Frequency." Radio Science, Vol

  14. Suppressing bullfrog larvae with carbon dioxide

    Science.gov (United States)

    Gross, Jackson A.; Ray, Andrew; Sepulveda, Adam J.; Watten, Barnaby J.; Densmore, Christine L.; Layhee, Megan J.; Mark Abbey-Lambert,; ,

    2014-01-01

    Current management strategies for the control and suppression of the American Bullfrog (Lithobates catesbeianus = Rana catesbeiana Shaw) and other invasive amphibians have had minimal effect on their abundance and distribution. This study evaluates the effects of carbon dioxide (CO2) on pre- and prometamorphic Bullfrog larvae. Bullfrogs are a model organism for evaluating potential suppression agents because they are a successful invader worldwide. From experimental trials we estimated that the 24-h 50% and 99% lethal concentration (LC50 and LC99) values for Bullfrog larvae were 371 and 549 mg CO2/L, respectively. Overall, larvae that succumbed to experimental conditions had a lower body condition index than those that survived. We also documented sublethal changes in blood chemistry during prolonged exposure to elevated CO2. Specifically, blood pH decreased by more than 0.5 pH units after 9 h of exposure and both blood partial pressure of CO2 (pCO2) and blood glucose increased. These findings suggest that CO2 treatments can be lethal to Bullfrog larvae under controlled laboratory conditions. We believe this work represents the necessary foundation for further consideration of CO2 as a potential suppression agent for one of the most harmful invaders to freshwater ecosystems.

  15. Evolution of foraging behavior in Drosophilid larvae

    Science.gov (United States)

    Rivera-Alba, Marta; Kabra, Mayank; Branson, Kristin; Mirth, Christen

    2015-03-01

    Drosophilids, like other insects, go through a larval phase before metamorphosing into adults. Larvae increase their body weight by several orders of magnitude in a few days. We therefore hypothesized that foraging behavior is under strong evolutionary pressure to best fit the larval environment. To test our hypothesis we used a multidisciplinary approach to analyze foraging behavior across species and larval stages. First, we recorded several videos of larvae foraging for each of 47 Drosophilid species. Then, using a supervised machine learning approach, we automatically annotated the video collection for the foraging sub-behaviors, including crawling, turning, head casting or burrowing. We also computed over 100 features to describe the posture and dynamics of each animal in each video frame. From these data, we fit models to the behavior of each species. The models each had the same parametric form, but differed in the exact parameters. By simulating larva behavior in virtual arenas we can infer which properties of the environments are better for each species. Comparisons between these inferred environments and the actual environments where these animals live will give us a deeper understanding about the evolution of foraging behavior in Drosophilid larvae.

  16. (Herklotsichthys quadrimaculatus) Larvae on Sofala Bank ...

    African Journals Online (AJOL)

    Faculdade de Ciências da Universidade de Lisboa, Campo Grande,. 1749-016 Lisboa, Portugal. * Present address: Departamento de Biologia and CESAM – Centro de Estudos do Ambiente e do Mar, Universidade de Aveiro, Campus de Santiago, 3810-193 Aveiro, Portugal. Keywords: fish larvae, diel vertical migration, ...

  17. CalCOFI Larvae Counts, Scientific Names C to CE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  18. CalCOFI Larvae Counts, Scientific Names EV to GN

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  19. PEMELIHARAAN LARVA KEPITING BAKAU, Scylla olivacea DENGAN PENAMBAHAN BIOFLOK

    Directory of Open Access Journals (Sweden)

    Gunarto Gunarto

    2014-06-01

    Full Text Available Abstrak lengkap dapat dilihat pada Full PDF   Tujuan penelitian ini adalah untuk mengetahui efek penambahan bioflok pada pemeliharaan larva kepiting bakau Scylla olivacea terutaman pada sintasan dan perkembangan larva hingga mencapai stadia krablet.

  20. Decapod larvae from the nearshore waters of Karwar

    Digital Repository Service at National Institute of Oceanography (India)

    Nair, V.R.; Paulinose, V.T.

    Abundance of decapod larvae at three stations in Binge Bay, Karwar has been reported based on surface collections taken during the period October 1975 to September 1976. The larvae were very common in the Bay and the postmonsoon months sustained...

  1. CalCOFI Larvae Counts, Scientific Names SJ to ST

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  2. Bothid larvae (Pleuronectiformes-Pisces) of the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, C.B.L.

    the Indian Ocean, their regional, seasonal as well as diurnal variations. Engyprosopon grandisquamis dominated contributing to 23.2% of the total larvae. Numerically the incidence of bothid larvae suggested a uniform pattern of distribution during the two...

  3. CalCOFI Larvae Counts, Scientific Names CP to DE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  4. CalCOFI Larvae Counts, Scientific Names HB to HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  5. CalCOFI Larvae Counts, Scientific Names SU to TE

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  6. CalCOFI Larvae Counts, Scientific Names PP to PZ

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  7. CalCOFI Larvae Counts, Scientific Names SD to SI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  8. CalCOFI Larvae Counts, Scientific Names TF to U

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  9. CalCOFI Larvae Counts, Scientific Names PL to PO

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  10. CalCOFI Larvae Counts, Scientific Names OM to OX

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  11. CalCOFI Larvae Counts, Scientific Names HJ to ID

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  12. CalCOFI Larvae Counts, Scientific Names OY to PI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...

  13. ISOLASI BACILLUS THURINGIENSIS DARI LARVA DAN PENGUJIAN PATOGENISITASNYA TERHADAP LARVA NYAMUK VEKTOR

    Directory of Open Access Journals (Sweden)

    Blondine Ch. P.

    2012-09-01

    Full Text Available A study to evaluate pathogenic organisms as cause of mosquito larvae death was conducted at Wonokerto and Pabelan villages, Salatiga Luar Kota subdistrict, Semarang regency in Central Java from May 1991 through December 1991. Bacterial isolation from dead larvae showed that 31 B. thuringicnsis isolates were obtained from 31 larvae samples collected from 2 location e.g Wonokerto village (3 samples, Pabelan village (28 samples. Nineteen isolates (61,3% showed a pathogenicity of more than 50% to third toward instar larvae of Aedes aegypti and Culex quinquefasciatus respectively 24 hours after exposure. This study shows the possible use of B. thuringiensis for biologic control of mosquitoes which can act as vectors for human diseases.

  14. Lagrangian Observations and Modeling of Marine Larvae

    Science.gov (United States)

    Paris, Claire B.; Irisson, Jean-Olivier

    2017-04-01

    Just within the past two decades, studies on the early-life history stages of marine organisms have led to new paradigms in population dynamics. Unlike passive plant seeds that are transported by the wind or by animals, marine larvae have motor and sensory capabilities. As a result, marine larvae have a tremendous capacity to actively influence their dispersal. This is continuously revealed as we develop new techniques to observe larvae in their natural environment and begin to understand their ability to detect cues throughout ontogeny, process the information, and use it to ride ocean currents and navigate their way back home, or to a place like home. We present innovative in situ and numerical modeling approaches developed to understand the underlying mechanisms of larval transport in the ocean. We describe a novel concept of a Lagrangian platform, the Drifting In Situ Chamber (DISC), designed to observe and quantify complex larval behaviors and their interactions with the pelagic environment. We give a brief history of larval ecology research with the DISC, showing that swimming is directional in most species, guided by cues as diverse as the position of the sun or the underwater soundscape, and even that (unlike humans!) larvae orient better and swim faster when moving as a group. The observed Lagrangian behavior of individual larvae are directly implemented in the Connectivity Modeling System (CMS), an open source Lagrangian tracking application. Simulations help demonstrate the impact that larval behavior has compared to passive Lagrangian trajectories. These methodologies are already the base of exciting findings and are promising tools for documenting and simulating the behavior of other small pelagic organisms, forecasting their migration in a changing ocean.

  15. An Introduction to the Identification of Chironomid Larvae.

    Science.gov (United States)

    Mason, William T., Jr.

    This publication is an introductory guide to the identification of Chironomid (Midge) larvae. The larvae of these small flies are an important link in the food chain between algae and microinvertebrates. As a family, the larvae exhibit a wide range of tolerance to environmental factors such as amounts and types of pollutants. Much of this…

  16. Does vertical migratory behaviour retain fish larvae onshore in ...

    African Journals Online (AJOL)

    Model outputs showed coarse-scale horizontal distribution patterns of larvae by age/size class that are similar to field observations for early, small larvae but not for large larvae and pre-recruits. ... Keywords: anchovy; individual-based model; larval vertical migration; recruitment; southern Benguela; transport; upwelling

  17. Lethal infection thresholds of Paenibacillus larvae for honeybee drone and worker larvae (Apis mellifera).

    Science.gov (United States)

    Behrens, Dieter; Forsgren, Eva; Fries, Ingemar; Moritz, Robin F A

    2010-10-01

    We compared the mortality of honeybee (Apis mellifera) drone and worker larvae from a single queen under controlled in vitro conditions following infection with Paenibacillus larvae, a bacterium causing the brood disease American Foulbrood (AFB). We also determined absolute P. larvae cell numbers and lethal titres in deceased individuals of both sexes up to 8 days post infection using quantitative real-time PCR (qPCR). Our results show that in drones the onset of infection induced mortality is delayed by 1 day, the cumulative mortality is reduced by 10% and P. larvae cell numbers are higher than in worker larvae. Since differences in bacterial cell titres between sexes can be explained by differences in body size, larval size appears to be a key parameter for a lethal threshold in AFB tolerance. Both means and variances for lethal thresholds are similar for drone and worker larvae suggesting that drone resistance phenotypes resemble those of related workers. © 2010 Society for Applied Microbiology and Blackwell Publishing Ltd.

  18. Larva migrans visceral: relato de caso Visceral larva migrans: case report

    Directory of Open Access Journals (Sweden)

    Alexandre Bortoli Machado

    2003-04-01

    Full Text Available Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs from the environment originating from roundworms which commonly infect dogs and cats, Toxocara canis and Toxocara cati. The larvae penetrate the gut wall and migrate through the tissues causing disorders consequent to an inflammatory immune response¹. The authors describe a clinical case of visceral larva migrans with an unusual clinical presentation and also its clinical aspects, diagnosis and treatment are reviewed.

  19. Food Value of Mealworm Grown on Acrocomia aculeata Pulp Flour.

    Directory of Open Access Journals (Sweden)

    Ariana Vieira Alves

    Full Text Available Insects have played an important role as human food throughout history, especially in Africa, Asia and Latin America. A good example of edible insects is the mealworm, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae, which are eaten in Africa, Asia, the Americas and Australia. This species is easily bred in captivity, requiring simple management. The bocaiuva (Acrocomia aculeata (Jacq. Lodd is an abundant palm tree found in the Brazilian Cerrado, providing fruits with high nutritional value. The aim of this work was to determine the chemical composition of T. molitor grown in different artificial diets with bocaiuva pulp flour. The nutritional composition, fatty acid composition, antioxidant activity, trypsin activity and anti-nutritional factors of larvae were analyzed. The results showed that mealworms grown on artificial diet with bocaiuva are a good source of protein (44.83% and lipid (40.45%, with significant levels of unsaturated fatty acids (65.99%, antioxidant activity (4.5 μM Trolox/g of oil extracted from larvae and absence of anti-nutritional factors. This study indicates a new source of biomass for growing mealworms and shows that it is possible to breed mealworms in artificial diet with bocaiuva flour without compromising the nutritional quality of the larvae.

  20. Food Value of Mealworm Grown on Acrocomia aculeata Pulp Flour

    Science.gov (United States)

    Alves, Ariana Vieira; Sanjinez-Argandoña, Eliana Janet; Linzmeier, Adelita Maria; Cardoso, Claudia Andrea Lima; Macedo, Maria Lígia Rodrigues

    2016-01-01

    Insects have played an important role as human food throughout history, especially in Africa, Asia and Latin America. A good example of edible insects is the mealworm, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae), which are eaten in Africa, Asia, the Americas and Australia. This species is easily bred in captivity, requiring simple management. The bocaiuva (Acrocomia aculeata (Jacq.) Lodd) is an abundant palm tree found in the Brazilian Cerrado, providing fruits with high nutritional value. The aim of this work was to determine the chemical composition of T. molitor grown in different artificial diets with bocaiuva pulp flour. The nutritional composition, fatty acid composition, antioxidant activity, trypsin activity and anti-nutritional factors of larvae were analyzed. The results showed that mealworms grown on artificial diet with bocaiuva are a good source of protein (44.83%) and lipid (40.45%), with significant levels of unsaturated fatty acids (65.99%), antioxidant activity (4.5 μM Trolox/g of oil extracted from larvae) and absence of anti-nutritional factors. This study indicates a new source of biomass for growing mealworms and shows that it is possible to breed mealworms in artificial diet with bocaiuva flour without compromising the nutritional quality of the larvae. PMID:26974840

  1. Caracterização de novos isolados de Bacillus thuringiensis para o controle de importantes insetos-praga da agricultura

    Directory of Open Access Journals (Sweden)

    Emeline Boni Campanini

    2012-01-01

    Full Text Available A bactéria Bacillus thuringiensis Berliner produz um corpo de inclusão paraesporal (cristal de natureza proteica, formado durante a esporulação, que atua de forma eficiente no controle de insetos-praga de culturas economicamente importantes. Esse cristal é constituído de proteínas Cry, que são codificadas pelos genes cry; um isolado pode ser caracterizado pelo conteúdo de genes cry que apresenta. Visando caracterizar novos isolados no combate de insetos-praga pertencentes às ordens Lepidoptera e Coleoptera, 76 isolados bacterianos foram analisados molecularmente e tiveram seu potencial de controle avaliado por meio de bioensaios com larvas de Spodoptera frugiperda (J.E. Smith, Sphenophorus levis Vaurie e Tenebrio molitor Linnaeus. As análises moleculares indicaram 11 isolados (14,5% da coleção, contendo genes lepidóptero-específicos e 17 (22,37% com genes coleóptero-específicos. As análises de patogenicidade revelaram dois isolados com alto potencial de controle para lagartas de S. frugiperda, um para larvas de S. levis e seis prejudiciais ao desenvolvimento das larvas de T. molitor. Esses isolados de B. thuringiensis podem ser promissores no controle biológico das referidas pragas.

  2. The Impact of Proposed Radio Frequency Radiation Standards on Military Operations.

    Science.gov (United States)

    1985-03-01

    Teratogenesis in Tenebrio Molitor to the Incidence of Low-Level Microwaves," IEEE Trans. Microwave The- ory and Tech., 23(11):929-931, 1975. 47. Green, D.R...F.J. Rosenbaum, and W.F. Pickard, "Intensity of Microwave Irradia- tion and the Teratogenic Response of Tenebrio molitor ," Radio Sol., Vol. 14, No. 6S...pp. 181-185 (1979). 48. Pickard, W.F., and R.G. Olsen, "Developmental Effects of MIcrowaves on Tenebrio ; Influences of Culturing Protocol and of

  3. Nutritional condition and vertical distribution of Baltic cod larvae

    DEFF Research Database (Denmark)

    Grønkjær, P.; Clemmesen, C.; St. John, Michael

    1997-01-01

    aged 2-25 days (median 10 days) ranged from 0.4 to 6.2, corresponding to levels exhibited by starving and fast growing larvae in laboratory calibration studies (starvation, protein growth rate, G(pi)=-12.2% day(-1); fast-growing larvae, G(pi)=14.1% day(-1)) respectively. Seventy per cent of the field...... caught larvae had RNA/DNA ratios between the mean values found for starving and fed laboratory larvae. Only larvae aged 8-11 days had higher mean RNA/DNA ratios above 45 m than below (t-test, P...

  4. Larva of Palaemnema brasiliensis Machado (Odonata: Platystictidae), from Amazonas, Brazil.

    Science.gov (United States)

    Neiss, Ulisses Gaspar; Hamada, Neusa

    2016-02-09

    The larva of Palaemnema brasiliensis Machado, 2009 is described and illustrated based on last-instar larvae and exuviae of reared larvae collected in a blackwater stream in Barcelos and Presidente Figueiredo municipalities, Amazonas state, Brazil. The larva of P. brasiliensis can be distinguished from the two South American species of the genus with described larvae (P. clementia Selys and P. mutans Calvert), mainly by presence of a single obtuse cusp on the labial palp, the presence and configuration of setae in the caudal lamellae, and the proportional length of terminal filaments of the caudal lamellae. The family is recorded here for the first time in Brazilian state of Amazonas.

  5. Predatory cannibalism in Drosophila melanogaster larvae.

    Science.gov (United States)

    Vijendravarma, Roshan K; Narasimha, Sunitha; Kawecki, Tadeusz J

    2013-01-01

    Hunting live prey is risky and thought to require specialized adaptations. Therefore, observations of predatory cannibalism in otherwise non-carnivorous animals raise questions about its function, adaptive significance and evolutionary potential. Here we document predatory cannibalism on larger conspecifics in Drosophila melanogaster larvae and address its evolutionary significance. We found that under crowded laboratory conditions younger larvae regularly attack and consume 'wandering-stage' conspecifics, forming aggregations mediated by chemical cues from the attacked victim. Nutrition gained this way can be significant: an exclusively cannibalistic diet was sufficient for normal development from eggs to fertile adults. Cannibalistic diet also induced plasticity of larval mouth parts. Finally, during 118 generations of experimental evolution, replicated populations maintained under larval malnutrition evolved enhanced propensity towards cannibalism. These results suggest that, at least under laboratory conditions, predation on conspecifics in Drosophila is a functional, adaptive behaviour, which can rapidly evolve in response to nutritional conditions.

  6. POLA PEMANGSAAN LARVA IKAN KAKAP MERAH, Lutjanus sebae

    Directory of Open Access Journals (Sweden)

    Regina Melianawati

    2016-11-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui pola pemangsaan dari larva ikan kakap merah, L. sebae umur 5 dan 10 hari yang dipelihara dengan kondisi pencahayaan alami. Pengambilan sampel dilakukan setiap satu jam pada masing-masing umur tersebut. Hasil pengamatan menunjukkan bahwa secara alami pola pemangsaan larva L. sebae tergantung pada kondisi pencahayaan, di mana aktivitas pemangsaan berlangsung secara maksimal pada saat tersedia pencahayaan dengan intensitas yang mencukupi untuk larva menangkap mangsanya. Intensitas cahaya minimal yang diperlukan oleh larva L. sebae untuk melakukan pemangsaan berada pada kisaran 400—600 lux. Maksimal pemangsaan satu larva pada umur 5 dan 10 hari adalah 6,2 dan 25,3 individu rotifer. Lama waktu pencernaan larva umur 5 dan 10 hari adalah 4 dan 5 jam, sedangkan laju cerna larva pada masing-masing umur tersebut adalah 1,50 dan 2,76 individu rotifer per jam. The aim of this research was to get the information about the feeding pattern of emperor snapper L. sebae larvae at 5 and 10 days olds reared under natural light intensity. Larvae samples were taken every hour from each age. The result showed that naturally, feeding pattern of emperor snapper larvae depend on the light intensity condition, feeding activity would be done when the light intensity was enough available for supporting larvae to feed. Minimum light intensity that needed by the larvae for feeding activity was range between 400—600 lux. Maximum feeding per larvae at 5 and 10 days olds were 6.2 and 25.3 individual rotifers. Digestion time of larvae at those ages was 4 and 5 hours, while digestion rate were 1.50 and 2.76 individual rotifers per hour.

  7. Caffeine taste signaling in Drosophila larvae

    Directory of Open Access Journals (Sweden)

    Anthi A Apostolopoulou

    2016-08-01

    Full Text Available The Drosophila larva has a simple peripheral nervous system with a comparably small number of sensory neurons located externally at the head or internally along the pharynx to assess its chemical environment. It is assumed that larval taste coding occurs mainly via external organs (the dorsal, terminal and ventral organ. However, the contribution of the internal pharyngeal sensory organs has not been explored. Here we find that larvae require a single pharyngeal gustatory receptor neuron pair called D1, which is located in the dorsal pharyngeal sensilla, in order to avoid caffeine and to associate an odor with caffeine punishment. In contrast, caffeine-driven reduction in feeding in non-choice situations does not require D1. Hence, this work provides data on taste coding via different receptor neurons, depending on the behavioral context. Furthermore, we show that the larval pharyngeal system is involved in bitter tasting. Using ectopic expressions, we show that the caffeine receptor in neuron D1 requires the function of at least four receptor genes: the putative coreceptors Gr33a, Gr66a, the putative caffeine-specific receptor Gr93a, and yet unknown additional molecular component(s. This suggests that larval taste perception is more complex than previously assumed already at the sensory level. Taste information from different sensory organs located outside at the head or inside along the pharynx of the larva is assembled to trigger taste guided behaviours.

  8. Drosophila larvae: Thermal ecology in changing environments

    Science.gov (United States)

    Wang, George

    Temperature affects almost all aspects of life. Although much work has been done to assess the impact of temperature on organismal performance, relatively little is known about how organisms behaviorally regulate temperature, how these behaviors effect population fitness, or how changing climate may interact with these behaviors. I explore these questions with the model system Drosophila larvae. Larvae are small, with a low thermal mass and limited capacity for physiological thermoregulation. Mortality is generally high in larvae, with large potential impacts on population growth rate. Thus behavioral thermoregulation in larvae should be of critical selective importance. I present a review of the current knowledge of Drosophila thermal preference. I describe quantifiable thermoregulatory behaviors ( TMV and TW) unique to larvae. I show interspecific variation of these behaviors in Drosophila melanogaster and several close relatives, and intraspecific variation between populations collected from different environments. I also investigate these behaviors in two mutant lines, ssa and biz, to investigate the genetic basis of these behaviors. I show that larval thermoregulatory systems are independent of those of adults. Further these thermoregulatory behaviors differ between two sister species, D. yakuba and D. santomea. Although these two species readily hybridize in laboratory conditions, very few hybrids are observed in the field. The surprising result that hybrids of D. yakuba and D. santomea seem to inherit TMV from D. yakuba suggests a novel extrinsic isolation mechanism between the two species. I explore how fitness is the result of the interaction between genetics and the environment. I utilize Monte Carlo simulation to show how non-linear norms of reaction generate variation in populations even in the absence of behavior or epigenetic evolutionary mechanisms. Finally I investigate the global distribution of temperatures in which these organisms exist using

  9. The Identification of Congeners and Aliens by Drosophila Larvae.

    Directory of Open Access Journals (Sweden)

    Francisco Del Pino

    Full Text Available We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b, Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles.

  10. Fate of pharmaceuticals and pesticides in fly larvae composting.

    Science.gov (United States)

    Lalander, C; Senecal, J; Gros Calvo, M; Ahrens, L; Josefsson, S; Wiberg, K; Vinnerås, B

    2016-09-15

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (<10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

  11. Learning and memory in zebrafish larvae

    Science.gov (United States)

    Roberts, Adam C.; Bill, Brent R.; Glanzman, David L.

    2013-01-01

    Larval zebrafish possess several experimental advantages for investigating the molecular and neural bases of learning and memory. Despite this, neuroscientists have only recently begun to use these animals to study memory. However, in a relatively short period of time a number of forms of learning have been described in zebrafish larvae, and significant progress has been made toward their understanding. Here we provide a comprehensive review of this progress; we also describe several promising new experimental technologies currently being used in larval zebrafish that are likely to contribute major insights into the processes that underlie learning and memory. PMID:23935566

  12. Reproduction: widespread cloning in echinoderm larvae.

    Science.gov (United States)

    Eaves, Alexandra A; Palmer, A Richard

    2003-09-11

    Asexual reproduction by free-living invertebrate larvae is a rare and enigmatic phenomenon and, although it is known to occur in sea stars and brittle stars, it has not been detected in other echinoderms despite more than a century of intensive study. Here we describe spontaneous larval cloning in three species from two more echinoderm classes: a sea cucumber (Holothuroidea), a sand dollar and a sea urchin (Echinoidea). Larval cloning may therefore be an ancient ability of echinoderms and possibly of deutero-stomes - the group that includes echinoderms, acorn worms, sea squirts and vertebrates.

  13. Recovery of Toxocara canis larvae from mouse tissue

    Directory of Open Access Journals (Sweden)

    Cáris Maroni Nunes

    1997-02-01

    Full Text Available Two techniques, peptic digestion and homogenization, were tested for the recovering of Toxocara canis larvae from mice tissue. Twenty mice were fed 1.000 embryonated eggs, and after 44-46 hours the animals were euthanised and liver and lungs were evaluated for the presence of larvae. Recovery rate from liver was greater than from lungs. Homogenization technique resulted in better percentage of larvae recovered, regardless of the organ evaluated.

  14. Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae?

    Directory of Open Access Journals (Sweden)

    Rafael Braga da Silva

    Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.

  15. Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress

    Science.gov (United States)

    2014-01-01

    Background Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. Results M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. Conclusions MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress. PMID:24383424

  16. Findings of Entomopathogenic Nematodes (Rhabditida, Steinernematidae in Nature Reserves in Ukraine

    Directory of Open Access Journals (Sweden)

    Yakovlev Ye. B.

    2014-07-01

    Full Text Available Findings of Entomopathogenic Nematodes (Rhabditida, Steinernematidae in Nature Reserves in-Ukraine. Yakovlev, Ye. B., Kharchenko, V. A., Mráček, Z. — Five strains of Steinernema Travassos, 1927 were isolated by live baiting method with last instar larvae of Tenebrio molitor Linnaeus, 1758 from the reserves of some central and southern oblasts of Ukraine and the Crimean AR. Entomopathogenic nematodes were recovered from 5 of 196 (2.6 % soil samples collected in 2010. Isolated nematodes were identified using a combination of molecular (ITS1-5.8S-ITS2 rDNA gene sequencing and morphological techniques. Four of the isolated strains were recognized as S. feltiae (Filipjev, 1934, one as S. arenarium (Artyukhovsky, 1967.

  17. Polypepide synthesis in response to 20-hydroxyecdysone, with particular reference to calcium-binding proteins, in the epidermis of a larval insect

    Energy Technology Data Exchange (ETDEWEB)

    Ouellette, Y.

    1988-01-01

    Epidermal cells respond to 20-hydroxyecdysone (20HE) by altering their morphology, rate of proliferation and level of cell-to-cell communication. To study changes in polypeptide synthesis induced by 20HE, epidermal polypeptides from the midinstar larvae of the mealworm Tenebrio molitor were separated by one- and two-dimensional polyacrylamide gel electrophoresis. {sup 35}S-methionine-labelled polypeptides were extracted from cells incubated either in the absence or presence of 2{mu}g/ml 20HE for 14-16 h in vitro. Cells incubated with the hormone incorporated 28% more label into polypeptides. Over 250 polypeptides were detected in total cell lysates by this technique. Polypeptides that showed altered rates of synthesis in response to 20HE treatment were identified and characterized.

  18. Biofilms and Marine Invertebrate Larvae: What Bacteria Produce That Larvae Use to Choose Settlement Sites

    Science.gov (United States)

    Hadfield, Michael G.

    2011-01-01

    Communities of microorganisms form thin coats across solid surfaces in the sea. Larvae of many marine invertebrates use biofilm components as cues to appropriate settlement sites. Research on the tube-dwelling polychaete worm Hydroides elegans, a globally common member of biofouling communities, is described to exemplify approaches to understanding biofilm bacteria as a source of settlement cues and larvae as bearers of receptors for bacterial cues. The association of species of the bacterial genus Pseudoalteromonas with larval settlement in many phyla is described, and the question of whether cues are soluble or surface-bound is reviewed, concluding that most evidence points to surface-bound cues. Seemingly contradictory data for stimulation of barnacle settlement are discussed; possibly both explanations are true. Paleontological evidence reveals a relationship between metazoans and biofilms very early in metazoan evolution, and thus the receptors for bacterial cues of invertebrate larvae are very old and possibly unique. Finally, despite more than 60 years of intense investigation, we still know very little about either the bacterial ligands that stimulate larval settlement or the cellular basis of their detection by larvae.

  19. Effect of gut bacterial isolates from Apis mellifera jemenitica on Paenibacillus larvae infected bee larvae

    Directory of Open Access Journals (Sweden)

    Ahmad Al-Ghamdi

    2018-02-01

    Full Text Available The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1, Proteus mirabilis (T2, Bacillus licheniformis (T3, Lactobacillus kunkeei (T4, Bacillus subtilis (T5, Enterobacter kobei (T6, and Morganella morganii (T7 on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet and positive control (normal diet spiked with P. larvae spores. Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%, whereas T4 group showed the lowest mortality (56.67%. Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%. Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.

  20. Toxicity of phenol on Macrobrachium rosenbergii (de Man) eggs, larvae, and post-larvae

    Energy Technology Data Exchange (ETDEWEB)

    Law, A.T.; Yeo, M.E. [Universiti Kolej Terengganu (UPM), Darul Iman (Malaysia)

    1997-03-01

    Literature on the toxicities of phenol on aquatic organisms is very limited. USEPA reported that the acute and chronic toxicities of phenol to freshwater aquatic life occur at concentrations as low as 10.2 mg/L and 2.56 mg/L, respectively. While for the saltwater aquatic life the acute toxicity occurs at concentrations as low as 5.8 mg/L. No data are available for the chronic toxicity of phenol to saltwater aquatic life. Sublethal concentrations of phenol have significant effects on the physiological and histological processes of the aquatic organisms: such as gill necrosis; destruction of erythrocyte cells; inhibition of sexual activities; suppression on growth and reduction of resistance to diseases. Macrobrachium rosenbergii(de Man) is the sole freshwater prawn cultured in Malaysia. Occasionally, the hatcheries are unable to produce the post-larvae because of undefined pollutants present in the water supplies. It has been observed that the use of cracked fiberglass tanks for larvae rearing is correlated with high mortality. This high mortality is probably due to the toxicity of the phenolic compounds which are leached out from the fiber glass tank into the water. This study was undertaken to evaluate the toxicity of phenol on eggs, larvae and post-larvae of M. rosenbergii and to set the water quality criteria of phenol for the said species. 16 refs., 3 tabs.

  1. Distribution and abundance of Pleuronectiformes larvae off Southeastern Brazil

    National Research Council Canada - National Science Library

    Garbini, Camilla Nunes; Zani-Teixeira, Maria de Lourdes; Ohkawara, Márcio Hidekazu; Katsuragawa, Mario

    2014-01-01

    The objective of this study was the description of the composition, abundance and density in horizontal and vertical distribution of Pleuronectiformes larvae on the southeastern Brazilian continental shelf...

  2. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.

    Directory of Open Access Journals (Sweden)

    Wendy Kloezen

    Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.

  3. A Madurella mycetomatis Grain Model in Galleria mellonella Larvae

    Science.gov (United States)

    Kloezen, Wendy; van Helvert-van Poppel, Marilyn; Fahal, Ahmed H.; van de Sande, Wendy W. J.

    2015-01-01

    Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future. PMID:26173126

  4. Imaging of cutaneous larva migrans by optical coherence tomography.

    Science.gov (United States)

    Morsy, Hanan; Mogensen, Mette; Thomsen, Jakob; Thrane, Lars; Andersen, Peter E; Jemec, Gregor B E

    2007-07-01

    Cutaneous larva migrans is a parasitic skin eruption caused by migration of larvae of various nematodes. Diagnosis of cutaneous larva migrans is currently based on the clinical signs of the creeping eruption. We are investigating a new diagnostic technology called optical coherence tomography (OCT) , which is potentially able to visualize structures in the skin with an 8 microm resolution. This technology could therefore potentially allow rapid, non-invasive, in vivo diagnosis of infestations. Clinical cases of cutaneous larva migrans (n=3) were studied. All patients had a characteristic itching, serpinginous eruption typical of cutaneous larva migrans. The parasites were acquired on beach holidays in Thailand and Malaysia. All skin lesions were imaged by an OCT system developed at Risoe National Laboratory, Denmark. Two out of three patients showed a round to oval structure (diameter 0.3-0.5mm) in the epidermis, Thus distinct OCT morphology in skin areas affected by cutaneous larva migrans was demonstrated. The larvae were not visualized in any of the patients. This study demonstrates that OCT a novel optical imaging technology, can image the larva tunnel in the skin with adequate spatial resolution, but not the larvae itself. OCT has a potential in imaging of skin infestations.

  5. Fate of pharmaceuticals and pesticides in fly larvae composting

    Energy Technology Data Exchange (ETDEWEB)

    Lalander, C., E-mail: cecilia.lalander@slu.se [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Senecal, J.; Gros Calvo, M. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Ahrens, L.; Josefsson, S.; Wiberg, K. [Department of Aquatic Sciences and Assessment, Swedish University of Agricultural Sciences (Sweden); Vinnerås, B. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden)

    2016-09-15

    A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.

  6. Reindeer warble fly larvae found in red deer

    Directory of Open Access Journals (Sweden)

    A. C. Nilssen

    1988-06-01

    Full Text Available Seven third instar larvae of the reindeer warble fly (Hypoderma (=Oedemagena tarandi were found in a 2-3 year old male red deer {Cervus elaphus shot on 14 November 1985 at Todalen, western Norway. This it, the first report of H. tarandi from red deer. In reindeer third instar larvae are found from February to June, and the unusual date of this record indicates a delayed development of the larvae due to abnormal host reactions. Warble fly larvae, probably H. tarandi, are also reported from moose {Alces alces in northern Norway.

  7. Reindeer warble fly larvae found in red deer

    OpenAIRE

    Nilssen, A C; Gjershaug, J.O.

    1988-01-01

    Seven third instar larvae of the reindeer warble fly (Hypoderma (=Oedemagena) tarandi) were found in a 2-3 year old male red deer {Cervus elaphus) shot on 14 November 1985 at Todalen, western Norway. This it, the first report of H. tarandi from red deer. In reindeer third instar larvae are found from February to June, and the unusual date of this record indicates a delayed development of the larvae due to abnormal host reactions. Warble fly larvae, probably H. tarandi, are also reported from ...

  8. Copepod predation on Anopheles quadrimaculatus larvae in rice fields.

    Science.gov (United States)

    Marten, G G; Nguyen, M; Ngo, G

    2000-06-01

    Cyclopoid copepods and mosquito larvae were surveyed in southwestern Louisiana rice fields. Almost every rice field had a natural population of Mesocyclops ruttneri, Acanthocylops vernalis, or Macrocyclops albidus. Judging from the abundance of pupae, 29% of the fields were responsible for virtually all Anopheles quadrimaculatus production, apparently because larval mortality suppressed production in the other fields. Mesocyclops ruttneri had the strongest negative association of naturally occurring copepod populations with An. quadrimaculatus larvae, though a few fields with M. ruttneri had substantial Anopheles production. Macrocyclops albidus, M. ruttneri, Mesocyclops edax, and Mesocyclops longisetus were introduced to experimental rice field plots. It took two months for the introduced copepods to build up their numbers; Anopheles larvae then disappeared from all treated plots while larvae continued to be present in the adjacent control field. Copepods were observed to kill the following number of first instar An. quadrimaculatus larvae in the laboratory: Mesocyclops ruttneri (36 larvae/day), Macrocyclops albidus (23 larvae/day), Mesocyclops longisetus (24 larvae/day), and Acanthocyclops vernalis (15 larvae/day). It is concluded that introducing select species of copepods and encouraging their populations offer possibilities for contributing to Anopheles control in rice fields.

  9. Experimental Infection of Sheep using Infective Larvae (L3 ...

    African Journals Online (AJOL)

    Experimental Infection of Sheep using Infective Larvae (L3) harvested from the Faeces of Naturally Infected Swayne's Hartebeest ( Alcelaphus buselaphus swaynei ) at Senkele Swayne's Hartebeest Sanctuary, Ethiopia.

  10. PERKEMBANGAN ENZIM PENCERNAAN LARVA IKAN PATIN, Pangasius hypophthalmus sp.

    Directory of Open Access Journals (Sweden)

    Irzal Effendi

    2003-05-01

    Full Text Available Development of digestive enzymes; protease, lipase and amylase were observed in patin catfish, Pangasius hypophthalmus, larvae.  The 1 day old larvae (day after hatching, with 3,37-3,97 mm length and 0,62-0,79 mg weight, were reared in aquarium 60x50x40 cm with stocking  density of 20 fish/l.  Larvae were fed  Artemia dan tubificid worms 2-8 dan 7-15 days after hatching (dAH,  respectively (schedule I;  2-6 and  5-15 dAH (schedule II; and 2-4 and 5-15 dAH (schedule III.  Chlorella was ready to eat by larvae at the entirely rearing.  For enzyme assay, larvae were sampled from each aquarium at stages of 1, 2, 3, 5, 7, 10 and 15 dAH.    Protease and lipase activity were detected in digestive tract of  1 dAH larvae.   Digestive enzymes development have a similar pattern in larvae for all feeding schedules.  Protease activity  decreased with the increasing of age until 3 dAH, then increased  until the larvae reached 7 dAH, and sharply decreased until 10 dAH and then slowly decreased thereafter. Lipase activity tended to increase slowly with age up to 3 dAH, and increased sharply until 5 dAH, and then decreased sharply until 7 dAH  before decreased again up to the end of rearing.  Amylase activity in larvae increased slowly with the increasing of age up to 5 dAH, then increased sharply until 7 dAH, and decreased thereafter.  In dimly lighted larvae, amylase activity decreased before increased up to 12 d AH, then decreased thereafter.  The amount of food organisms in larval gut, body weight and length, and survival rate of larvae were also measured and discussed.Key Words:  Digestive enzymes, development, larvae, patin catfish, Pangasius hypophthalmus ABSTRAKPenelitian ini bertujuan untuk mengetahui perkembangan enzim protease, lipase dan amilase saluran pencernaan larva ikan patin akibat perubahan skedul pemberian pakan.  Larva ikan patin (panjang 3,77–3,97 mm dan bobot 0,62-0,79 mg berumur 1 hari dipelihara di akuarium 60x

  11. Dual effects of Metarhizium spp. and Clonostachys rosea against an insect and a seed-borne pathogen in wheat.

    Science.gov (United States)

    Keyser, Chad A; Jensen, Birgit; Meyling, Nicolai V

    2016-03-01

    Crops are often prone to both insect herbivory and disease, which necessitate multiple control measures. Ideally, an efficacious biological control agent must adequately control the target organism and not be inhibited by other biological control agents when applied simultaneously. Wheat seeds infected with the plant pathogen Fusarium culmorum were treated with Metarhizium brunneum or M. flavoviride and Clonostachys rosea individually and in combination, with the expectation to control both root-feeding insects and the pathogen. Emerging roots were evaluated for disease and then placed with Tenebrio molitor larvae, which were monitored for infection. Plant disease symptoms were nearly absent for seeds treated with C. rosea, both individually and in combination with Metarhizium spp. Furthermore, roots grown from seeds treated with Metarhizium spp. caused significant levels of fungal infection in larvae when used individually or combined with C. rosea. However, cotreated seeds showed reduced virulence towards T. molitor when compared with treatments using Metarhizium spp. only. This study clearly shows that seed treatments with both the entomopathogenic fungus M. brunneum and the mycoparasitic fungus C. rosea can protect plant roots from insects and disease. The dual-treatment approach to biological control presented here is consistent with the ideals of IPM strategies. © 2015 Society of Chemical Industry.

  12. Fish larvae from the Gulf of California

    Directory of Open Access Journals (Sweden)

    Gerardo Aceves-Medina

    2003-03-01

    Full Text Available Taxonomic composition of fish larvae was analysed from 464 plankton samples obtained during 10 oceanographic surveys in the Gulf of California between 1984 and 1988. We identified 283 taxa: 173 species, 57 genera, and 53 families. Tropical and subtropical species predominated except during the winter, when temperate-subarctic species were dominant. The most abundant species were the mesopelagic Benthosema panamense, Triphoturus mexicanus and Vinciguerria lucetia, but the coastal pelagic species Engraulis mordax, Opisthonema spp., Sardinops caeruleus and Scomber japonicus were also prominent. The taxonomic composition of the ichthyoplankton shows the seasonality of the Gulf as well as environmental changes that occurred between the 1984-1987 warm period and the 1956-1957 cool period previously reported. The presence of E. mordax larvae as one of the most abundant species in the Gulf provides evidence of the reproduction of this species two years before the development of the northern anchovy fishery and the decline of the sardine fishery in the Gulf of California.

  13. A Model of Drosophila Larva Chemotaxis.

    Directory of Open Access Journals (Sweden)

    Alex Davies

    2015-11-01

    Full Text Available Detailed observations of larval Drosophila chemotaxis have characterised the relationship between the odour gradient and the runs, head casts and turns made by the animal. We use a computational model to test whether hypothesised sensorimotor control mechanisms are sufficient to account for larval behaviour. The model combines three mechanisms based on simple transformations of the recent history of odour intensity at the head location. The first is an increased probability of terminating runs in response to gradually decreasing concentration, the second an increased probability of terminating head casts in response to rapidly increasing concentration, and the third a biasing of run directions up concentration gradients through modulation of small head casts. We show that this model can be tuned to produce behavioural statistics comparable to those reported for the larva, and that this tuning results in similar chemotaxis performance to the larva. We demonstrate that each mechanism can enable odour approach but the combination of mechanisms is most effective, and investigate how these low-level control mechanisms relate to behavioural measures such as the preference indices used to investigate larval learning behaviour in group assays.

  14. A Model of Drosophila Larva Chemotaxis

    Science.gov (United States)

    Davies, Alex; Louis, Matthieu; Webb, Barbara

    2015-01-01

    Detailed observations of larval Drosophila chemotaxis have characterised the relationship between the odour gradient and the runs, head casts and turns made by the animal. We use a computational model to test whether hypothesised sensorimotor control mechanisms are sufficient to account for larval behaviour. The model combines three mechanisms based on simple transformations of the recent history of odour intensity at the head location. The first is an increased probability of terminating runs in response to gradually decreasing concentration, the second an increased probability of terminating head casts in response to rapidly increasing concentration, and the third a biasing of run directions up concentration gradients through modulation of small head casts. We show that this model can be tuned to produce behavioural statistics comparable to those reported for the larva, and that this tuning results in similar chemotaxis performance to the larva. We demonstrate that each mechanism can enable odour approach but the combination of mechanisms is most effective, and investigate how these low-level control mechanisms relate to behavioural measures such as the preference indices used to investigate larval learning behaviour in group assays. PMID:26600460

  15. Morphology of female reproductive tract of the predator Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae fed on different diets

    Directory of Open Access Journals (Sweden)

    Walkymário de Paulo Lemos

    2005-01-01

    Full Text Available The morphology of the reproductive tract of Podisus nigrispinus (Dallas females fed with Alabama argillacea (Hübner larvae, artificial diet, Tenebrio molitor L. larvae or Musca domestica L. larvae were studied. The reproductive tract of females of this species presented yellow coloration and independent of the diet, each ovary had seven ovarioles joined through terminal filaments and forming a bunch shape structure. The histological data revealed that the ovary of P. nigrispinus was of meroistic telotrophic type, with each individual ovariole divided in a terminal filament, a tropharium (trophic chamber, a vitellarium, and a pedicel. The prey type affected the development and morphometry of these structures. Females of P. nigrispinus fed with 3rd or 5th instar larvae of cotton leafworm (A. argillacea presented developed ovaries with ovarioles showing a great number of oocytes in advanced stages of development. Females fed with artificial diet presented atrophic ovaries and ovarioles practically without oocytes. Females fed with T. molitor or M. domestica showed ovaries in intermediary stage of development. The central ovariole was longer in females fed with 5th instar larvae of cotton leafworm and shorter in those fed with artificial diet. Most developed oocytes were observed in ovaries of females fed with 5th or 3rd instar larvae of cotton leafworm, and the majority of atrophic oocytes were found in females fed with artificial diet.Este estudo apresenta a morfologia do sistema reprodutor feminino de Podisus nigrispinus (Dallas alimentado com larvas de Alabama argillacea (Hübner, Musca domestica L. e de Tenebrio molitor L. ou dieta artificial. As gônadas internas desse predador apresentaram coloração amarelada e, independente da dieta, cada ovário apresentou sete ovaríolos unidos pelos filamentos terminais em uma estrutura em forma de cacho. A análise histológica revelou que o ovário de P. nigrispinus é do tipo meroístico telotr

  16. Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae?

    Directory of Open Access Journals (Sweden)

    Rafael Braga da Silva

    2012-06-01

    Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae? O percevejo Supputius cincticeps (Stål (Hemiptera, Pentatomidae é um predador encontrado em várias regiões brasileiras, que possui atributos desejáveis como agente de controle natural ou em

  17. Efektivitas Bacillus thuringiensis dalam Pengendalian Larva Nyamuk Anopheles sp.

    Directory of Open Access Journals (Sweden)

    Citra Inneke Wibowo

    2017-08-01

    Full Text Available Nyamuk Anopheles sp adalah vektor penyakit malaria. Pengendalian vektor penyakit malaria dapat dilakukan secara biologis yaitu dengan menggunakan Bacillus thuringiensis. Tujuan penelitian adalah untuk mengetahui efektivitas konsentrasi Bacillus thuringiensis dalam pengendalian larva nyamuk Anopheles sp.Penelitian ini dilakukan secara eksperimental menggunakan Rancangan Acak Lengkap Faktorial (RAL Faktorial yang terdiri atas dua faktor yaitu konsentrasi Bacillus thuringiensis dan stadia larva Anopheles dengan pengulangan tiga kali.Perlakuan yang dicobakan adalahkonsentrasi Bacillus thuringiensis (A yang terdiri atas 5 taraf:A0: konsentrasi B.thuringiensis 0 CFU.mL-1, A1: konsentrasi B.thuringiensis 102 CFU.mL-1, A2: konsentrasi B.thuringiensis 104 CFU.mL-1, A3: konsentrasi B.thuringiensis 106CFU.mL-1, A4: konsentrasi B.thuringiensis 108CFU.mL-1. Perlakuan tahapan instar larva Anopheles sp. (B adalah sebagai berikut:B1: stadia larva instar I, B2: stadia larva instar II, B3: stadia larva instar III, B4: stadia larva instar IVsehingga terdapat 60 satuan percobaan. Hasil penelitian  menunjukkan konsentrasi B. thuringiensis isolat CK dan IPB CC yang paling berpengaruh dalam pengendalian larva Anopheles sp adalah 108 CFU.mL-1 . Instar larva yang paling peka terhadap B. thuringiensis isolat IPB CC adalah instar I dan II sedangkan instar yang peka terhadap isolat CK adalah instar II, Perlakuan konsentrasi isolat B. thuringiensis dan tingkat instar larva yang paling baik dalam pengendalian larva Anopheles sp. adalah 108 CFU.mL-1, dan instar I dan II.

  18. Observations on the seasonal dynamics of Caddisfly larvae ...

    African Journals Online (AJOL)

    The Trichoptera fauna in the water body consisted of two genera, Cheumatopsyche and Amphipsyche, which closely associated with the moss, Fontinalis (Bryophyta). The density of larvae increased with the occurrence and bloom of moss. The changes in density of larvae are discussed with reference to the resources ...

  19. Odour avoidance learning in the larva of Drosophila melanogaster

    Indian Academy of Sciences (India)

    Prakash

    Aceves-Pina and Quinn also described aversive learning with electric shock in normal and mutant larvae and Tully ... Drosophila larvae can be trained to avoid odours associated with electric shock. We describe here, an improved method of ..... The key observation is that the half lives of STM and LTM do not change during ...

  20. Selenium impacts on razorback sucker, Colorado: Colorado River: III. Larvae

    Science.gov (United States)

    Hamilton, S.J.; Holley, K.M.; Buhl, K.J.; Bullard, F.A.

    2005-01-01

    Razorback sucker (Xyrauchen texanus) larvae from adults exposed to selenium at three sites near Grand Junction, Colorado, for 9 months were used in a 30-day waterborne and dietary selenium study. Selenium concentrations in water averaged brine shrimp, 5.6 ??g/g in zooplankton from Horsethief east wetland, 20 ??g/g in zooplankton from Adobe Creek, and 39 ??g/g in zooplankton from North Pond. The lowest survival occurred in larvae fed zooplankton rather than brine shrimp. Survival of larvae at Adobe Creek and North Pond was lower in site water than in reference water. Survival of brood stock larvae was higher than Horsethief larvae even though they received the same water and dietary treatments. Arsenic concentrations in brine shrimp may have resulted in an antagonistic interaction with selenium and reduced adverse effects in larvae. Deformities in larvae from North Pond were similar to those reported for selenium-induced teratogenic deformities in other fish species. Selenium concentrations of ???4.6 ??g/g in food resulted in rapid mortality of larvae from Horsethief, Adobe Creek, and North Pond, and suggested that selenium toxicity in the Colorado River could limit recovery of this endangered fish.

  1. Cytological basis of photoresponsive behavior in a sponge larva.

    Science.gov (United States)

    Leys, S P; Degnan, B M

    2001-12-01

    Ontogenetic changes in the photoresponse of larvae from the demosponge Reneira sp. were studied by analyzing the swimming paths of individual larvae exposed to diffuse white light. Larvae swam upward upon release from the adult, but were negatively phototactic until at least 12 hours after release. The larval photoreceptors are presumed to be a posterior ring of columnar monociliated epithelial cells that possess 120-microm-long cilia and pigment-filled protrusions. A sudden increase in light intensity caused these cilia to become rigidly straight. If the light intensity remained high, the cilia gradually bent over the pigmented vesicles in the adjacent cytoplasm, and thus covered one entire pole of the larva. The response was reversed upon a sudden decrease in light intensity. The ciliated cells were sensitive to changes in light intensity in larvae of all ages. This response is similar to the shadow response in tunicate larvae or the shading of the photoreceptor in Euglena and is postulated to allow the larvae to steer away from brighter light to darker areas, such as under coral rubble-the preferred site of the adult sponge on the reef flat. In the absence of a coordinating system in cellular sponges, the spatial organization and autonomous behavior of the pigmented posterior cells control the rapid responses to light shown by these larvae.

  2. Cutaneous larva migrans: a bad souvenir from the vacation.

    Science.gov (United States)

    Criado, Paulo Ricardo; Belda, Walter; Vasconcellos, Cidia; Silva, Cristiana Silveira

    2012-06-15

    Cutaneous larva migrans (CLM) is a common endemic disease in tropical and subtropical countries. This condition is caused by skin-penetrating larvae of nematodes, mainly of the hookworm Ancylostoma braziliense and other nematodes of the family Ancylostomidae. We report three cases of CLM acquired during vacations in different regions of Brazil.

  3. Occurrence of digenean larvae in freshwater snails in the Ruvu ...

    African Journals Online (AJOL)

    Occurrence of digenean larvae in freshwater snails in the Ruvu basin, Tanzania. G Nkwengulila, ESP Kigadye. Abstract. A survey was carried out on digenean larvae infecting freshwater snails in five habitats in Dar es Salaam, Ruvu and Morogoro. 9424 snails belonging to 12 species from five families were examined for ...

  4. Nutritional condition of fish larvae in South African estuaries: an ...

    African Journals Online (AJOL)

    It is concluded that the individual RNA/DNA ratio can provide a reliable, sensitive and cost-effective method to assess the immediate effects of environmental changes on the nutritional condition of estuarine fish larvae. Keywords: estuarine ecology, Gilchristella aestuaria larvae, lipid content, protein content, RNA/DNA ratio, ...

  5. Shrinkage Rates In Newly Hatched Larvae Of Macrobrachium ...

    African Journals Online (AJOL)

    The effect of formalin/sea-water solution (2% and 4% formalin conc. buffered with borax) on the total lengths of preserved samples of newly hatched Macrobrachium vollenhovenii larvae was investigated. The influence of an aesthesia on larvae in 2% and 4% formal in was also studied to determine the combine influence of ...

  6. Temporal dynamics of Chaoborus larvae (Diptera : Chaoboridae) in ...

    African Journals Online (AJOL)

    Chaoborus larvae are voracious predators of zooplankton able to change their specific composition and size structure. Thus they appear as competitors of fish. They also represent food for planktophage fish. The temporal dynamics of Chaoborus larvae was studied (from january to october 1997) in the fishery of Bakro ...

  7. Survival and growth of Clarias gariepinus larvae fed with freshwater ...

    African Journals Online (AJOL)

    Survival and growth performance of Clarias gariepinus larvae fed with freshwater zooplankton was compared to those fed with Artémia salina. Clarias gariepinus larvae at the end of yolk sac resorption with 2.8 ± 0.1 mg initial weight were fed ad libitum to live zooplankton for 08 days in concrete basins (without water ...

  8. Larvicidal effects of lemon peels on mosquito larvae | ANYANWU ...

    African Journals Online (AJOL)

    Methanol extract of the dry peels of the common edible plant, Citrus limon (family, Rutaceae), was obtained using a Soxhlet extractor and its larviciding effect evaluated against the larvae of two household mosquitoes: Aedes aegypti and Culex quinquefasciatus. Each batch of larvae (20-30) were treated with 3.90, 15.63, ...

  9. Activity of Bacillis thuringiensis toxins against cocoa pod borer larvae

    NARCIS (Netherlands)

    Santoso, D.; Chaidamsari, T.; Wiryadiputra, S.; Maagd, de R.A.

    2004-01-01

    Twelve Cry proteins from Bacillus thuringiensis Berliner were tested in bioassays on cacao plantations in Indonesia for activity against the larvae of cocoa pod borer (Conopomorpha cramerella (Snellen)), an insect pest of the cacao tree. Through the damage caused by their feeding, the larvae of

  10. Habitat selection by marine larvae in changing chemical environments.

    Science.gov (United States)

    Lecchini, D; Dixson, D L; Lecellier, G; Roux, N; Frédérich, B; Besson, M; Tanaka, Y; Banaigs, B; Nakamura, Y

    2017-01-15

    The replenishment and persistence of marine species is contingent on dispersing larvae locating suitable habitat and surviving to a reproductive stage. Pelagic larvae rely on environmental cues to make behavioural decisions with chemical information being important for habitat selection at settlement. We explored the sensory world of crustaceans and fishes focusing on the impact anthropogenic alterations (ocean acidification, red soil, pesticide) have on conspecific chemical signals used by larvae for habitat selection. Crustacean (Stenopus hispidus) and fish (Chromis viridis) larvae recognized their conspecifics via chemical signals under control conditions. In the presence of acidified water, red soil or pesticide, the ability of larvae to chemically recognize conspecific cues was altered. Our study highlights that recruitment potential on coral reefs may decrease due to anthropogenic stressors. If so, populations of fishes and crustaceans will continue their rapid decline; larval recruitment will not replace and sustain the adult populations on degraded reefs. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Freshly squeezed: anaphylaxis caused by drone larvae juice.

    Science.gov (United States)

    Stoevesandt, J; Trautmann, A

    2017-11-30

    Drone larvae are mostly considered a by-product of beekeeping, but have recently been advo-cated as a high-protein source of food. There are as yet no data concerning their allergenic po-tential. We report on a 29-year old bee keeper who experienced an anaphylactic reaction following the consumption of a freshly prepared beverage from raw drone larvae. Larvae-specific sensitization was confirmed by prick-to-prick and basophil activation testing. Bee stings and classical bee products including honey and royal jelly were tolerated. This is the hitherto first report on IgE-mediated allergy to drone larvae. We suggest that a certain awareness towards the allergenicity of bee larvae is required.

  12. External Ophthalmomyiasis Caused by Lucilia sericata (Diptera: Challiphoride Larva

    Directory of Open Access Journals (Sweden)

    Roghayeh NOROUZI

    2017-09-01

    Full Text Available Myiasis is an animal or human pathogenic condition initiated by parasitic dipterous fly larvae feeding in the host’s necrotic or living tissue. Here we report a case of external ophthalmomyiasis caused by Lucilia sericata in a 78-yr-old with a vascular tumor of the retina and surgery history, from Bijar City of Kurdistan Province, Iran in 2015. Associated symptoms included right eye pain with mucoid ocular discharge, headache, sensing the presence of a foreign body in the eye and itching. Examination revealed a L. sericata Larva in his right eye. Infestation of ocular tissue by fly larvae (ophthalmomyiasis progresses after retinal surgery and can destroy orbital tissues within days, especially in patient with poor hygienic conditions. Treatment consists of removal of the larvae and surgical debridement. Following removal of larva, the symptoms completely resolved within a few hours and remained asymptomatic several weeks later.

  13. External Ophthalmomyiasis Caused by Lucilia sericata (Diptera: Challiphoride) Larva.

    Science.gov (United States)

    Norouzi, Roghayeh; Manochehri, Arman; Zarrin, Saman

    2017-01-01

    Myiasis is an animal or human pathogenic condition initiated by parasitic dipterous fly larvae feeding in the host's necrotic or living tissue. Here we report a case of external ophthalmomyiasis caused by Lucilia sericata in a 78-yr-old with a vascular tumor of the retina and surgery history, from Bijar City of Kurdistan Province, Iran in 2015. Associated symptoms included right eye pain with mucoid ocular discharge, headache, sensing the presence of a foreign body in the eye and itching. Examination revealed a L. sericata Larva in his right eye. Infestation of ocular tissue by fly larvae (ophthalmomyiasis) progresses after retinal surgery and can destroy orbital tissues within days, especially in patient with poor hygienic conditions. Treatment consists of removal of the larvae and surgical debridement. Following removal of larva, the symptoms completely resolved within a few hours and remained asymptomatic several weeks later.

  14. Description and key to larvae of Curculio spp. of eastern United States and Canada (coleoptera: Curculionidae)

    Science.gov (United States)

    Lester P. Gibson

    1985-01-01

    A general description of Curculio larvae is given. Ke y characters are presented to separate 15 of the 16 described species of eastern North America. A brief key for separating Curculio larvae from Conotrachelus and lepidopterous larvae is presented.

  15. Neuromechanics of crawling in D. melanogaster larvae

    Science.gov (United States)

    Pehlevan, Cengiz; Paoletti, Paolo; Mahadevan, L.

    2015-03-01

    Nervous system, body and environment interact in non-trivial ways to generate locomotion and thence behavior in an organism. Here we present a minimal integrative mathematical model to describe the simple behavior of forward crawling in Drosophila larvae. Our model couples the excitation-inhibition circuits in the nervous system to force production in the muscles and body movement in a frictional environment, which in turn leads to a proprioceptive signal that feeds back to the nervous system. Our results explain the basic observed phenomenology of crawling with or without proprioception, and elucidate the stabilizing role of proprioception in crawling with respect to external and internal perturbations. Our integrated approach allows us to make testable predictions on the effect of changing body-environment interactions on crawling, and serves as a substrate for the development of hierarchical models linking cellular processes to behavior.

  16. The other gastropod larvae: larval morphogenesis in a marine neritimorph.

    Science.gov (United States)

    Page, Louise R; Ferguson, Samuel J

    2013-04-01

    Two of the three major gastropod clades with feeding larvae are sister groups and larval morphogenesis for members of these clades, the Caenogastropoda and Heterobranchia, has been well studied. The third clade, the Neritimorpha, has an unstable phylogenetic position and little is known about development of their planktotrophic larvae. Information about larval morphology of neritimorphs and resolution of their controversial phylogenetic placement is critically important for understanding evolution of larval feeding within the Gastropoda. We describe larval morphogenesis to metamorphic competence for laboratory-reared larvae of Nerita melanotragus (Smith, 1884) (Neritimorpha: Neritidae). Preliminary observations suggest that prehatch larvae are capable of delayed hatching, possibly by entering a diapause state. Our description of larval morphogenesis, as based on tissue sections for light and transmission electron microscopy, scanning electron microscopy, three-dimensional-reconstructions of sectioned tissue, and labeling of muscles with fluorphore-tagged phalloidin, revealed four features that are unprecedented among both feeding and nonfeeding gastropod larvae. Larvae of N. melanotragus have muscles on the left and right side that both meet current criteria of a larval retractor muscle; shell-anchored muscles with oblique striations that project inside the visceral nerve loop to insert mainly on the velar lobes. They also have left and right digestive glands of similar size and a left and right hypobranchial gland. A larval "heart" is absent, but water circulation through the mantle cavity may be facilitated by large circular orifices, lined by patches of motile cilia, leading in and out of the mantle cavity. Comparison of larval traits among all three groups of gastropods with feeding larvae indicates that larvae of N. melanotragus have many unique characteristics, but they show more similarities to caenogastropod than to heterobranch larvae. These results are a

  17. Iodine nutrition and toxicity in Atlantic cod (Gadus morhua) larvae

    Science.gov (United States)

    Penglase, S; Harboe, T; Sæle, Ø; Helland, S; Nordgreen, A

    2013-01-01

    Copepods as feed promote better growth and development in marine fish larvae than rotifers. However, unlike rotifers, copepods contain several minerals such as iodine (I), at potentially toxic levels. Iodine is an essential trace element and both under and over supply of I can inhibit the production of the I containing thyroid hormones. It is unknown whether marine fish larvae require copepod levels of I or if mechanisms are present that prevent I toxicity. In this study, larval Atlantic cod (Gadus morhua) were fed rotifers enriched to intermediate (26 mg I kg-1 dry weight; MI group) or copepod (129 mg I kg-1 DW; HI group) I levels and compared to cod larvae fed control rotifers (0.6 mg I kg-1 DW). Larval I concentrations were increased by 3 (MI) and 7 (HI) fold compared to controls during the rotifer feeding period. No differences in growth were observed, but the HI diet increased thyroid follicle colloid to epithelium ratios, and affected the essential element concentrations of larvae compared to the other groups. The thyroid follicle morphology in the HI larvae is typical of colloid goitre, a condition resulting from excessive I intake, even though whole body I levels were below those found previously in copepod fed cod larvae. This is the first observation of dietary induced I toxicity in fish, and suggests I toxicity may be determined to a greater extent by bioavailability and nutrient interactions than by total body I concentrations in fish larvae. Rotifers with 0.6 mg I kg-1 DW appeared sufficient to prevent gross signs of I deficiency in cod larvae reared with continuous water exchange, while modelling of cod larvae versus rotifer I levels suggests that optimum I levels in rotifers for cod larvae is 3.5 mg I kg-1 DW. PMID:23638355

  18. Iodine nutrition and toxicity in Atlantic cod (Gadus morhua larvae

    Directory of Open Access Journals (Sweden)

    S Penglase

    2013-02-01

    Full Text Available Copepods as feed promote better growth and development in marine fish larvae than rotifers. However, unlike rotifers, copepods contain several minerals such as iodine (I, at potentially toxic levels. Iodine is an essential trace element and both under and over supply of I can inhibit the production of the I containing thyroid hormones. It is unknown whether marine fish larvae require copepod levels of I or if mechanisms are present that prevent I toxicity. In this study, larval Atlantic cod (Gadus morhua were fed rotifers enriched to intermediate (26 mg I kg-1 dry weight; MI group or copepod (129 mg I kg-1 DW; HI group I levels and compared to cod larvae fed control rotifers (0.6 mg I kg-1 DW. Larval I concentrations were increased by 3 (MI and 7 (HI fold compared to controls during the rotifer feeding period. No differences in growth were observed, but the HI diet increased thyroid follicle colloid to epithelium ratios, and affected the essential element concentrations of larvae compared to the other groups. The thyroid follicle morphology in the HI larvae is typical of colloid goitre, a condition resulting from excessive I intake, even though whole body I levels were below those found previously in copepod fed cod larvae. This is the first observation of dietary induced I toxicity in fish, and suggests I toxicity may be determined to a greater extent by bioavailability and nutrient interactions than by total body I concentrations in fish larvae. Rotifers with 0.6 mg I kg-1 DW appeared sufficient to prevent gross signs of I deficiency in cod larvae reared with continuous water exchange, while modelling of cod larvae versus rotifer I levels suggests that optimum I levels in rotifers for cod larvae is 3.5 mg I kg-1 DW.

  19. Iodine nutrition and toxicity in Atlantic cod (Gadus morhua) larvae.

    Science.gov (United States)

    Penglase, S; Harboe, T; Sæle, O; Helland, S; Nordgreen, A; Hamre, K

    2013-01-01

    Copepods as feed promote better growth and development in marine fish larvae than rotifers. However, unlike rotifers, copepods contain several minerals such as iodine (I), at potentially toxic levels. Iodine is an essential trace element and both under and over supply of I can inhibit the production of the I containing thyroid hormones. It is unknown whether marine fish larvae require copepod levels of I or if mechanisms are present that prevent I toxicity. In this study, larval Atlantic cod (Gadus morhua) were fed rotifers enriched to intermediate (26 mg I kg(-1) dry weight; MI group) or copepod (129 mg I kg(-1) DW; HI group) I levels and compared to cod larvae fed control rotifers (0.6 mg I kg(-1) DW). Larval I concentrations were increased by 3 (MI) and 7 (HI) fold compared to controls during the rotifer feeding period. No differences in growth were observed, but the HI diet increased thyroid follicle colloid to epithelium ratios, and affected the essential element concentrations of larvae compared to the other groups. The thyroid follicle morphology in the HI larvae is typical of colloid goitre, a condition resulting from excessive I intake, even though whole body I levels were below those found previously in copepod fed cod larvae. This is the first observation of dietary induced I toxicity in fish, and suggests I toxicity may be determined to a greater extent by bioavailability and nutrient interactions than by total body I concentrations in fish larvae. Rotifers with 0.6 mg I kg(-1) DW appeared sufficient to prevent gross signs of I deficiency in cod larvae reared with continuous water exchange, while modelling of cod larvae versus rotifer I levels suggests that optimum I levels in rotifers for cod larvae is 3.5 mg I kg(-1) DW.

  20. Interplay between behavioural thermoregulation and immune response in mealworms.

    Science.gov (United States)

    Catalán, Tamara P; Niemeyer, Hermann M; Kalergis, Alexis M; Bozinovic, Francisco

    2012-11-01

    Since the preferential body temperature should positively correlate with physiological performance, behavioural fever should enhance an organism's immune response under an immune challenge. Here we have studied the preferential body temperature (T(p)) and its consequences on immune response performance after an immune challenge in larvae of Tenebrio molitor. We evaluated T(p) and immune responses of larvae following a challenge with various concentrations of lipopolysaccharide (LPS), and we studied the correlation between T(p) and two immune traits, namely antibacterial and phenoloxidase (PO) activities. Larvae that were immune challenged with higher LPS concentrations (C(50) and C(100)) preferred in average, warmer temperatures than did larvae challenged with lower concentrations (C(0) and C(25)). T(p) of C(25)-C(100) (challenged)-mealworms was 2.3°C higher than of C(0) (control) larvae. At lower LPS concentration immune challenge (C(0) and C(25)) antibacterial activity correlated positively with T(p), but at C(50) and C(100) correlation was lose. PO activity was higher at higher LPS concentration, but its magnitude of response did not correlate with T(p) Our data suggest that behavioural fever may have a positive effect on host performance by enhancing antibacterial response under a low pathogen load situation. Copyright © 2012 Elsevier Ltd. All rights reserved.

  1. Larvas migrans ganglionar: Presentación de un caso

    Directory of Open Access Journals (Sweden)

    María del Carmen Luis Álvarez

    2003-04-01

    Full Text Available Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. Se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.Visceral larvae migrans caused by the infestation with larvae of toxocara canis or cati are more frequent among children under 10. The case of an 8-year-old boy who was diagnosed ganglionar larva migrans is presented. Comments are made on some etioepidemiological aspects of the disease, as well as on his clinical picture and evolution. Emphasis is made on the hygienic and sanitary measures of control and manipulation of stools from pegs as dogs and cats. Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.

  2. Structure and occurrence of cyphonautes larvae (Bryozoa, Ectoprocta)

    DEFF Research Database (Denmark)

    Nielsen, Claus; Worsaae, Katrine

    2010-01-01

    of fewer fibers. The H. malayensis larva lacks the anterior and posterior intervalve cilia. Its pyriform organ is unciliated with only a small central depression. The adhesive epithelium is not invaginated as an adhesive sac and lacks the large muscles interpreted as adhesive sac muscles in the M...... configuration of muscles, nerves, and cilia of the two larvae are identical. However, the larva of H. malayensis is much smaller than that of M. membranacea, which may explain most of the differences observed. Although all major nerves and muscle strands are present in H. malayensis, they are generally composed...

  3. MORPHOLOGICAL DEVELOPMENT OF Napoleon WRASSE, Cheilinus undulatus LARVAE

    Directory of Open Access Journals (Sweden)

    Jhon Harianto Hutapea

    2006-12-01

    Full Text Available To improve the survival rate, napoleon wrasse larval rearing trial was conducted at Research Institute for Mariculture, Gondol-Bali in 2003. The trial aims at assessing initial feed for larvae, food habit, and morphological development from early larval stage to juvenile. The results showed that chicken egg yolk could be applied as initial feed and followed by rotifer, Artemia and mysid (Mesophodopsis sp.. Three swimming behavior of larvae were observed, drifting, free swimming and hiding on the substrate as larvae develop. Digestive system development, simple tube like, transition stage and coiled where digestive system could be distinguished between stomach, intestine and rectum.

  4. REARING CARP LARVAE (Cyprinus carpio) IN CLOSED RECIRCULATORY SYSTEM (RAS)

    OpenAIRE

    Anđelko Opačak; Jurica Jug Dujaković; Siniša Ozimec; Ivan Stević; Dinko Jelkić; Roman Safner

    2012-01-01

    Postembryonic rearing of carp larvae in closed recirculatory system was conducted in 2009 at the fish farm Ribnjak LLC, Donji Miholjac, Croatia. The research was conducted in two test groups (A and B with three iterations in each) with a control group (C). Test group A (3 tanks x 250 l) consisted of 150 000 larvae (density of 200 larvae•l-1), test group B (3 tanks x 500 l) consisted of 600 000 larvae (density of 400 larvae•l-1), and the control group (C) was a mud fish pond T-6 which was stoc...

  5. Accelerated larvae development of Ascaris lumbricoides eggs with ultraviolet radiation

    Energy Technology Data Exchange (ETDEWEB)

    Aladawi, M.A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)]. E-mail: Scientific@aec.org.sy; Albarodi, H. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Hammoudeh, A. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Shamma, M. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic); Sharabi, N. [Syrian Atomic Energy Commission, Radiation Technology Department, P.O. Box 6091, Damascus (Syrian Arab Republic)

    2006-01-15

    In order to investigate the effect of UV radiation on the development of Ascaris lumbricoides larvae, eggs were exposed to increasing UV doses. Filtered wastewater from the secondary effluent taken from the Damascus wastewater treatment plant (DWTP) was used as irradiation and incubation medium. The progressive and accelerated embryonation stages were microscopically observed and the percentages of completely developed larvae were determined weekly. Results indicated that the UV radiation accelerated the development of larvae with increasing UV dose. Preliminary information about the relationship between the UV radiation dose and rate of embryonation is also presented.

  6. Foraging strategy switching in an antlion larva.

    Science.gov (United States)

    Tsao, Yu-Jen; Okuyama, Toshinori

    2012-09-01

    Antlion larvae are typically considered as trap-building predators, but some species of antlions always forage without using pits or only sometimes use pits to capture prey; they can ambush prey without pits. This study examined a species that switches its strategy between pit-trapping and ambushing and asked the mechanism behind the switching behaviour. A dynamic optimization model incorporating tradeoffs between the two strategies was built. The tradeoffs were prey capture success and predation risk (both are higher when pit-trapping). The model predicted that antlions should use the trap-building strategy when their energy status is low and should use the ambush strategy when their energy status is high. These predictions as well as an assumption (i.e., predation risk associated with pit-trapping is higher than that associated with ambushing) of the model were empirically confirmed. The results suggest that antlions flexibly switch between pit-trapping and ambushing to maximize their fitness by balancing the costs and benefits of the two strategies. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. The Study of the Microbes Degraded Polystyrene

    Directory of Open Access Journals (Sweden)

    Zhi-Long Tang

    2017-01-01

    Full Text Available Under the observation that Tenebrio molitor and Zophobas morio could eat polystyrene (PS, we setup the platform to screen the gut microbes of these two worms. To take advantage of that Tenebrio molitor and Zophobas morio can eat and digest polystyrene as its diet, we analyzed these special microbes with PS plate and PS turbidity system with time courses. There were two strains TM1 and ZM1 which isolated from Tenebrio molitor and Zophobas morio, and were identified by 16S rDNA sequencing. The results showed that TM1 and ZM1 were cocci-like and short rod shape Gram-negative bacteria under microscope. The PS plate and turbidity assay showed that TM1 and ZM1 could utilize polystyrene as their carbon sources. The further study of PS degraded enzyme and cloning warrants our attention that this platform will be an excellent tools to explore and solve this problem.

  8. Commercially important penaeid shrimp larvae in the estuaries of Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.

    Larval stages of the penaeid shrimps, Metapenaeus dobsoni (Miers), M. affinis (Milne - Edwards) and Penaeus merguiensis De Man were mostly distributed at the lower reaches of Mandovi and Zuari estuaries. While larvae of M. dobsoni and M. affinis...

  9. Spatial habitat for eel larva at Cimandiri estuary, West Java

    Science.gov (United States)

    Takarina, N. D.; Supriatna

    2017-07-01

    The estuarine ecosystem is known as suitable breeding sites for fishes because this particular habitat is receiving continuous organic matters from river ways and constant sunlight due to its depth that allows sunlight penetration. Cimandiri estuary is one of the estuaries located in the south of Java Island close to the Indian Ocean and known as a suitable habitat for eel larva that routinely collected by local people. Eel habitat has a relationship with the dynamic of space. This dynamic influenced by season, water flow, tide, bathymetry, salinity and dissolved oxygen (DO). The geographic information system is an approach in studying habitat dynamic, through modeling. Furthermore, the spatial model for eel larva habitat is required for land use planning that aimed to achieve sustainable eels larva rearing and conserve estuarine habitat as well. The aim of this research was to investigate dynamics on spatial habitat of eel larva at Cimandiri estuary, West Java.

  10. Preliminary notes on the decapod larvae of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Menon, M.K.; Menon, P.G.; Paulinose, V.T.

    The note presents some general facts regarding the distribution of some of the larger groups of decapod larvae in the Arabian Sea Their relative numbers and the families and subfamilies, so far as can be recognized, represented within each group...

  11. Ophthalmomyiasis caused by the reindeer warble fly larva.

    Science.gov (United States)

    Kearney, M S; Nilssen, A C; Lyslo, A; Syrdalen, P; Dannevig, L

    1991-04-01

    Two boys with ophthalmomyiasis caused by the first instar larva of the reindeer warble fly Hypoderma tarandi are reported. Both were 9 years old and came from the coast of northern Norway. One had ophthalmomyiasis interna posterior and one eye had been removed because of progressive pain and blindness. Histological examination showed the remains of a fly larva. The second boy had ophthalmomyiasis externa with a tumour in the upper eyelid, and histological examination showed a warble with a well preserved larva. Identification of the parasite in the histological material was based on the finding of cuticular spines and parts of the cephalopharyngeal skeleton identical with those of the first instar larva of H tarandi.

  12. Automated high-throughput behavioral analyses in zebrafish larvae.

    Science.gov (United States)

    Richendrfer, Holly; Créton, Robbert

    2013-07-04

    We have created a novel high-throughput imaging system for the analysis of behavior in 7-day-old zebrafish larvae in multi-lane plates. This system measures spontaneous behaviors and the response to an aversive stimulus, which is shown to the larvae via a PowerPoint presentation. The recorded images are analyzed with an ImageJ macro, which automatically splits the color channels, subtracts the background, and applies a threshold to identify individual larvae placement in the lanes. We can then import the coordinates into an Excel sheet to quantify swim speed, preference for edge or side of the lane, resting behavior, thigmotaxis, distance between larvae, and avoidance behavior. Subtle changes in behavior are easily detected using our system, making it useful for behavioral analyses after exposure to environmental toxicants or pharmaceuticals.

  13. Microbial interference with hatch and survival of European eel larvae

    DEFF Research Database (Denmark)

    Sørensen, Sune Riis; Lauesen; Tomkiewicz, Jonna

    Recent research has significantly improved our knowledge and capabilities in the field of in vitro production of yolk sac larvae from European eel (Anguilla anguilla). Female broodstock European eels are matured by weekly administration of pituitary extract and male eels with hCG (human chorionic...... gonadotropin), which afford gametes for in vitro fertilization studies. The maturing process may lead to mass hatchings of up to ½ million larvae of which some survive the entire yolk sac phase. However, the rearing of larvae suffers from high larval mortalities, and water quality might be a crucial factor...... for larval survival in rearing systems. By applying antibiotic treatment as a research tool, it was possible to determine the extent of microbial interference in the production of high numbers of good quality larvae. By controlling microbiota during egg and larval incubation, the egg hatching success...

  14. Fish larvae from the Canary region in autumn

    Directory of Open Access Journals (Sweden)

    J. M. Rodríguez

    2000-03-01

    Full Text Available In this paper, the taxonomic composition of the fish larvae community in the Canary region in autumn 1991 is presented. In total, 8699 larvae belonging to 58 fish families were studied. 176 taxonomic groups were identified, 149 at species level and the rest were identified at a higher level. The most numerous family and the one that presented the greatest number of species was Myctophidae. The most frequently caught species was Cyclothone braueri. The taxonomic composition (at family level of the fish larvae community, dominated by four mesopelagic families, was typical of oceanic regions of warm waters. The most remarkable feature of the fish larvae community was its high specific diversity.

  15. What do barnacle larvae feed on ? Implications in biofouling ecology

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.; Anil, A.C.

    .22µm filtered seawater. The number of defecated pellets by a larva after 12 hours of incubation at room temperature and the proportion of the larvae defecating was quantified. After the observations, pellets were preserved in Ethanol for Scanning... Electron Microscope (SEM) photography to find the signatures of food. Ethanol preserved samples were filtered on to 0.22 µm polycarbonate membrane filters, rinsed with deionised water to remove salt and ethanol and then air dried. Filters were...

  16. The use of fly larvae for organic waste treatment.

    Science.gov (United States)

    Čičková, Helena; Newton, G Larry; Lacy, R Curt; Kozánek, Milan

    2015-01-01

    The idea of using fly larvae for processing of organic waste was proposed almost 100 years ago. Since then, numerous laboratory studies have shown that several fly species are well suited for biodegradation of organic waste, with the house fly (Musca domestica L.) and the black soldier fly (Hermetia illucens L.) being the most extensively studied insects for this purpose. House fly larvae develop well in manure of animals fed a mixed diet, while black soldier fly larvae accept a greater variety of decaying organic matter. Blow fly and flesh fly maggots are better suited for biodegradation of meat processing waste. The larvae of these insects have been successfully used to reduce mass of animal manure, fecal sludge, municipal waste, food scrapes, restaurant and market waste, as well as plant residues left after oil extraction. Higher yields of larvae are produced on nutrient-rich wastes (meat processing waste, food waste) than on manure or plant residues. Larvae may be used as animal feed or for production of secondary products (biodiesel, biologically active substances). Waste residue becomes valuable fertilizer. During biodegradation the temperature of the substrate rises, pH changes from neutral to alkaline, ammonia release increases, and moisture decreases. Microbial load of some pathogens can be substantially reduced. Both larvae and digested residue may require further treatment to eliminate pathogens. Facilities utilizing natural fly populations, as well as pilot and full-scale plants with laboratory-reared fly populations have been shown to be effective and economically feasible. The major obstacles associated with the production of fly larvae from organic waste on an industrial scale seem to be technological aspects of scaling-up the production capacity, insufficient knowledge of fly biology necessary to produce large amounts of eggs, and current legislation. Technological innovations could greatly improve performance of the biodegradation facilities and

  17. Larval structure of Passalus gravelyiand sexual dimorphism in Passalid larvae

    Directory of Open Access Journals (Sweden)

    Ingrid Mattos

    2015-09-01

    Full Text Available The adults and larvae of Passalidae are subsocial insects commonly found in tropical forests, living in decaying wood gallery systems constructed by adults. Currently, few repots on the larvae of Neotropical Passalidae have been published and information is scarce. In this study, the Passalus (Pertinax gravelyiMoreira, 1922 larvae is described for the first time, based on ten larval specimens 1 (1° instar, 4 (2° instar, and 5 (3° instar associated with three adults collected from a single colony at the Parque Nacional do Itatiaia (Itatiaia, Rio de Janeiro, Brazil. The description was carried out based on electronic and digital photographs of diagnostic structures, with some details on the systematic of the species. The larvae of Passalus gravelyihas the general setal 'Pertinax' pattern and differed from others by 16 to 18 setae on the anal ring, the other larvae data from Brazilian species show the anal ring with 10 to 12 setae. A discussion on the presence of sexual dimorphism in 62 species of two and three instars of Passalidae larvae is provided for the first time. Besides, a description of the terminal ampullapresent as a cuticular structure found in the medial-ventral area of the 9th abdominal sternite in males is also given. The terminal ampullawas only observed in the Passalidae male larvae and was not visible in female larvae. The terminal ampullaare acknowledged now in males of 64 passalid species, that are taxonomically distributed in world tropical forests, at the Oriental and Australian subfamily Aulacocyclinae (Aulacocyclini & Ceracupini and the cosmotropical subfamily Passalinae (Solenocyclini, Macrolinini, Passalini, & Proculini.

  18. Characterization of secreted proteases of Paenibacillus larvae, potential virulence factors in honeybee larval infection

    Science.gov (United States)

    Paenibacillus larvae is the causative agent of American Foulbrood (AFB), the most severe bacterial disease that affects honeybee larvae. AFB causes a significant decrease in the honeybee population affecting the beekeeping industry and agricultural production. After infection of larvae, P. larvae se...

  19. Size-specific predation on marine invertebrate larvae.

    Science.gov (United States)

    Allen, Jonathan D

    2008-02-01

    Predation on planktonic larval stages is frequently a major source of mortality for the offspring of benthic marine invertebrates. Mortality rate likely varies with larval size and developmental stage, but few experiments have measured how these factors affect predation rates. I used experimental reductions in egg size to test how variation in larval size affects the likelihood of predation during planktonic development. Blastomeres of the sand dollar Dendraster excentricus were separated at the two-cell stage to produce half-sized zygotes. Larvae resulting from this manipulation were tested for their susceptibility to predation relative to whole-sized siblings at four ages. Individuals from each size class were simultaneously presented as prey items to five predators (crab zoeae, crab megalopae, chaetognaths, solitary tunicates, and postlarval fish) in the laboratory. Four predators consumed significantly more half-sized larvae than whole-sized larvae, but one predator type (postlarval fish) consumed more whole-sized larvae. Predators that consumed more half-sized larvae also preferentially consumed younger larvae. In contrast, postlarval fish showed no significant prey preference based on larval age. These results suggest that assumptions of constant mortality rates during development should be modified to account for the effects of larval size and age.

  20. Observations of the sound producing organs in achelate lobster larvae

    Directory of Open Access Journals (Sweden)

    John A. Fornshell

    2017-06-01

    Full Text Available The Achelata, lobsters lacking claws and having a phyllosoma larva, are divided into two families, the Palinuridae or spiny lobsters and the Scyllaridae or slipper lobsters. Within the Palinuridae adults of two groups were identified by Parker (1884, the Stridentesthat are capable of producing sounds, and the Silentesthat are not known to produce sounds. The Stridentes employ a file-like structure on the dorsal surface of the cephalon and a plectrum consisting of a series of ridges on the proximal segment of the second antenna to produce their sounds. All species of Achelata hatch as an unpigmented thin phyllosoma larva. The phyllosoma larva of the Stridentes have a presumptive file-like structure on the dorsal cephalon. A similar file-like structure is found on the cephalon of one species of Silentes, Palinurellus wienckki, and some but not all of the phyllosoma larvae of the Scyllaridae. No presumptive plectrum is found on the second antenna of any of the phyllosoma larvae. Presence of a presumptive file-like structure on phyllosoma larvae of Silentes and Scyllaridae suggests that the ability to produce sounds may have been lost secondarily in the Silentes and Scyllaridae.

  1. Abscisic acid enhances cold tolerance in honeybee larvae.

    Science.gov (United States)

    Ramirez, Leonor; Negri, Pedro; Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo

    2017-04-12

    The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee ( Apis mellifera ). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro -reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin , and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. © 2017 The Author(s).

  2. Guppies as predators of common mosquito larvae in Malaysia.

    Science.gov (United States)

    Saleeza, S N R; Norma-Rashid, Y; Sofian-Azirun, M

    2014-03-01

    Observation on predation activities of guppies (Poecilia reticulata) on the larvae of three species of mosquito, namely Aedes albopictus, Aedes aegypti, and Culex quinquefasciatus was carried out under laboratory conditions. Male and female guppies were used as predators for predation experiments on the 4th instars of mosquito larvae. The daily feeding rates comparing male and female guppies on mosquito larvae were different; the female guppies consumed more mosquito larvae than male guppies did. The daily feeding rates of female guppies were 121.3 for Ae. aegypti, 105.6 for Ae. albopictus, and 72.3 for Cx. quinquefasciatus. The daily feeding rates of male guppies were 98.6 for Ae. aegypti, 73.6 for Ae. albopictus, and 47.6 for Cx. quinquefasciatus. In terms of prey preference, there was greater preference towards mosquito larvae of Ae. aegypti, followed by Ae. albopictus, and the least preferred was Cx. quinquefasciatus. Male and female guppies consumed more mosquito larvae during lights on (day time) compared with lights off (night time). The water volume, prey species, number of fish predators available, prey densities, and prey's sex also influenced the predation activities.

  3. A fly larva (Syrphidae: Ocyptamus that preys on adult flies

    Directory of Open Access Journals (Sweden)

    Onanchi Ureña

    2010-12-01

    Full Text Available Predatory syrphid larvae feed on relatively immobile prey, but here we report the first case (as far as we are aware of obligatory predation on very mobile prey. Larvae of an undescribed species of Ocyptamus (Diptera: Syrphidae were found in whitefly (Hemiptera: Aleyrodidae aggregations on the undersides of citrus leaves. However, instead of preying on the whitefly nymphs (as would be expected, the larvae preyed on adult flies (Diptera that were attracted to the honeydew. In the laboratory, larvae captured significantly more flies on whitefly infested leaves than on washed leaves, and generally abandoned leaves that lacked whiteflies. Most cases of successful prey capture involved flies that probed the anterior part of the larva’s body with its proboscis (as if it were honeydew. The syrphid larva lashed out at the fly and entangled it in sticky oral secretion. The prey did not recover when they were removed from the larva, suggesting that this new predatory species also employs venom to subdue its prey. Although the larvae consumed some honeydew, they were unable to complete their development on this diet. Two parasitoids were reared from Ocyptamus puparia, Proaspicera sp. (Hymenoptera: Figitidae and Paracarotomus sp. (Hymenoptera: Pteromalidae, both of which are endoparasitic koinobionts. Rev. Biol. Trop. 58 (4: 1157-1163. Epub 2010 December 01.Las larvas depredadoras de Syrphidae se alimentan de presas relativamente inmóviles, pero aquí reportamos el primer caso (hasta ahora conocido de la depredación obligatoria en presas muy móviles. Se encontraron las larvas de una especie no descrita de Ocyptamus (Diptera: Syrphidae juntas con ninfas de mosca blanca (Hemiptera: Aleyrodidae en el envés de las hojas de cítricos. Sin embargo, en vez de alimentarse de las ninfas de mosca blanca (como debería esperarse, las larvas se alimentaron de moscas adultas (Diptera que fueron atraídas a las excreciones azucaradas de la mosca blanca. En el

  4. Loss of surface coat by Strongyloides ratti infective larvae during skin penetration: evidence using larvae radiolabelled with /sup 67/gallium

    Energy Technology Data Exchange (ETDEWEB)

    Grove, D.I.; Northern, C.; Warwick, A.; Lovegrove, F.T.

    1984-10-01

    The optimal conditions for labelling infective larvae of Strongyloides ratti with /sup 67/Ga citrate were determined. Radiolabelled larvae were injected s.c. into normal and previously infected rats. The distribution of radioactivity in these animals was compared with that in rats infected subcutaneously with a similar dose of free /sup 67/Ga by using a gamma camera linked to a computer system. Whereas free /sup 67/Ga was distributed throughout the body and excreted via the hepatobiliary system, the bulk of radioactivity in rats injected with radiolabelled larvae remained at the injection sites. Direct microscopical examination of these sites, however, revealed only minimal numbers of worms. When rats were infected percutaneously with radiolabelled larvae, it was found that most radioactivity remained at the surface, despite penetration of worms. When infective larvae were exposed to CO/sub 2/ in vitro and examined carefully by light microscopy, loss of an outer coat was observed. It was concluded that infective larvae lose an outer coat on skin penetration.

  5. Nutritional Potential of Selected Insect Species Reared on the Island of Sumatra.

    Science.gov (United States)

    Adámková, Anna; Mlček, Jiří; Kouřimská, Lenka; Borkovcová, Marie; Bušina, Tomáš; Adámek, Martin; Bednářová, Martina; Krajsa, Jan

    2017-05-12

    Inhabitants of the Indonesian island of Sumatra are faced with the problem of insufficient food supplies and the consequent risk of undernourishment and health issues. Edible insects as a traditional and readily available food source could be part of the solution. The nutritional value of insects depends on many factors, e.g., species, developmental stage, sex, diet, and climatic conditions. However, edible insects bred in Sumatra for human consumption have never before been assessed with regard to their nutritional value. Our study involved analyses of crude protein, chitin, fat and selected fatty acid contents of giant mealworm larvae ( Zophobas morio ), larvae of the common mealworm ( Tenebrio molitor) and nymphs of the field cricket ( Gryllus assimilis ). Crude protein content in the samples ranged from 46% to 56%. Highest (35%) and lowest (31%) amounts of fat were recorded in giant mealworm larvae and larvae of the common mealworm, respectively. Chitin amounts ranged from 6% to 13%. Based on these values, which are comparable to those known from other food insects reared in different regions of the world, the edible species bred in Sumatra could become food sources with a potential to help stave off hunger and undernourishment.

  6. Occurrence of Entomopathogenic Fungi from Agricultural and Natural Ecosystems in Saltillo, México, and their Virulence Towards Thrips and Whiteflies

    Science.gov (United States)

    Sánchez-Peña, Sergio R.; Lara, Jorge San-Juan; Medina, Raúl F.

    2011-01-01

    Entomopathogenic fungi were collected from soil in four adjacent habitats (oak forest, agricultural soil, pine reforestation and chaparral habitat) in Saltillo, México using the insect bait method with Tenebrio molitor (L.) (Coleoptera: Tenebrionidae) larvae as bait. Overall, of the larvae exposed to soil, 171 (20%) hosted Beauveria bassiana (Balsamo) Vuillemin (Hypocreales: Cordycipitaceae), 25 (3%) hosted Metarhizium anisopliae (Metschnikoff) Sorokin (Hypocreales: Clavicipitaceae) and 1 (0.1%) hosted lsaria (=Paecilomyces) sp. (Hypocreales: Cordycipitaceae). B. bassiana was significantly more frequent on larvae exposed to oak forest soil. M. anisopliae was significantly more frequent on larvae exposed to agricultural soil. From the infected bait insects, 93 isolates of B. bassiana and 24 isolates of M. anisopliae were obtained. Strains were tested for their infectivity against Cuban laurel thrips, Gynaikothrips uzeli Zimmerman (Thysanoptera: Phlaeothripidae) and the greenhouse whitefly, Trialeurodes vaporariorum (Westwood) (Hemiptera: Aleyrodidae). B. bassiana isolates caused the highest mortality on thrips (some causing 88% mortality after 6 days); both fungal species caused similarly high mortality levels against whiteflies (75%) after 6 days. Large amounts of germplasm of entomopathogenic fungi, fundamentally B. bassiana and M. anisopliae, exist in the habitats sampled; pathogenicity varied among strains, and some strains possessed significant virulence. Soils in these habitats are reservoirs of diverse strains with potential for use in biocontrol. PMID:21521145

  7. Interplay between thermal and immune ecology: effect of environmental temperature on insect immune response and energetic costs after an immune challenge.

    Science.gov (United States)

    Catalán, Tamara P; Wozniak, Aniela; Niemeyer, Hermann M; Kalergis, Alexis M; Bozinovic, Francisco

    2012-03-01

    Although the study of thermoregulation in insects has shown that infected animals tend to prefer higher temperatures than healthy individuals, the immune response and energetic consequences of this preference remain unknown. We examined the effect of environmental temperature and the energetic costs associated to the activation of the immune response of Tenebrio molitor larvae following a lipopolysaccharide (LPS) challenge. We measured the effect of temperature on immune parameters including phenoloxidase (PO) activity and antibacterial responses. Further as proximal and distal costs of the immune response we determined the standard metabolic rate (SMR) and the loss of body mass (m(b)), respectively. Immune response was stronger at 30°C than was at 10 or 20°C. While SMR at 10 and 20°C did not differ between immune treatments, at 30°C SMR of LPS-treated larvae was almost 25-60% higher than SMR of PBS-treated and naïve larvae. In addition, the loss in m(b) was 1.9 and 4.2 times higher in LPS-treated larvae than in PBS-treated and naïve controls. The immune responses exhibited a positive correlation with temperature and both, SMR and m(b) change, were sensitive to environmental temperature. These data suggest a significant effect of environmental temperature on the immune response and on the energetic costs of immunity. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera

    Directory of Open Access Journals (Sweden)

    Susana Trivinho-Strixino

    2012-09-01

    Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.

  9. Amostragem por larva-única na vigilância de Aedes aegypti Single-larva sampling for Aedes aegypti surveillance

    Directory of Open Access Journals (Sweden)

    José Eduardo Bracco

    1995-04-01

    Full Text Available Com a finalidade de testar a metodologia de amostragem por larva-única na vigilância entomológica do Aedes aegypti, foram pesquisados domicílios do Município de Araraquara, SP (Brasil. Nos criadouros que continham larvas de Aedes uma delas foi coletada. Como controle, após a coleta da larva-única, todas as larvas foram coletadas para identificação posterior. Esse processo foi repetido no laboratório. Dos 447 domicílios visitados, apenas 12 foram considerados positivos e 20 criadouros foram identificados; destes, 13 continham larvas de Aedes; 5, larvas de Aedes e Culex e 2, larvas de Culex. Os resultados mostram o reconhecimento correto, no campo, de todos os criadouros, evidenciando que o método poderia ser utilizado na vigilância entomológica de municípios sem infestação domiciliar ou infestados apenas com uma única espécie de Aedes.Buildings in Araraquara city, Southeastern Brazil, were searched during a year for the presence of Aedes larvae using single larva sampling in order to check the single-larva methodology. In those breeding places in wich Aedes larvae were found, one of them was collected. As a control, after the single larva had been collected, all the larvae from the breeding place were collected for later identification. This process was repeated in the laboratory. Of the 447 domiciles searched, 12 were considered positive and 20 breeding places were found. Of the breeding places, 13 contained Aedes larvae, 5 both Aedes and Culex larvae and 2 Culex larvae only. The results show that all the breeding places in the field were properly recognited showing the method may be used for Aedes surveillance in cities infested with one species only or without any domiciliary infestation.

  10. Opposed ciliary bands in the feeding larvae of sabellariid annelids.

    Science.gov (United States)

    Pernet, Bruno; Strathmann, Richard R

    2011-06-01

    The larvae of marine annelids capture food using an unusual diversity of suspension-feeding mechanisms. Many of the feeding mechanisms of larval annelids are poorly known despite the abundance and ecological significance of both larvae and adults of some annelid taxa. Here we show that larvae of two species of sabellariid annelids, Sabellaria cementarium and Phragmatopoma californica, bear prototrochal and metatrochal cilia that beat in opposition to each other. For larvae of S. cementarium, we provide evidence that these opposed bands of cilia are used to capture suspended particles. In video recordings, captured particles were overtaken by a prototrochal cilium and then moved with the cilium to the food groove, a band of cilia between the prototroch and metatroch. They were then transported by cilia of the food groove to the mouth. Lengths of the prototrochal cilia, lengths of the prototrochal ciliary band, size range of the particles captured, and estimated rates of clearance increased with larval age and body size. Confirmation of the presence of opposed bands in larvae of sabellariids extends their known occurrence in the annelids to members of 10 families. Opposed bands in these different taxa differ in the arrangements and spacing of prototrochal and metatrochal cilia, and in whether they are used in combination with other feeding mechanisms. Opposed bands appear to be particularly widespread among the larvae of sabellidan annelids (a clade that includes sabellariids, sabellids, and serpulids), even in some species whose larvae do not feed. A parsimony analysis suggests that opposed bands are ancestral in this clade of annelids.

  11. Unexpected high losses of Anopheles gambiae larvae due to rainfall.

    Directory of Open Access Journals (Sweden)

    Krijn P Paaijmans

    Full Text Available BACKGROUND: Immature stages of the malaria mosquito Anopheles gambiae experience high mortality, but its cause is poorly understood. Here we study the impact of rainfall, one of the abiotic factors to which the immatures are frequently exposed, on their mortality. METHODOLOGY/PRINCIPAL FINDINGS: We show that rainfall significantly affected larval mosquitoes by flushing them out of their aquatic habitat and killing them. Outdoor experiments under natural conditions in Kenya revealed that the additional nightly loss of larvae caused by rainfall was on average 17.5% for the youngest (L1 larvae and 4.8% for the oldest (L4 larvae; an additional 10.5% (increase from 0.9 to 11.4% of the L1 larvae and 3.3% (from 0.1 to 3.4% of the L4 larvae were flushed away and larval mortality increased by 6.9% (from 4.6 to 11.5% and 1.5% (from 4.1 to 5.6% for L1 and L4 larvae, respectively, compared to nights without rain. On rainy nights, 1.3% and 0.7% of L1 and L4 larvae, respectively, were lost due to ejection from the breeding site. CONCLUSIONS/SIGNIFICANCE: This study demonstrates that immature populations of malaria mosquitoes suffer high losses during rainfall events. As these populations are likely to experience several rain showers during their lifespan, rainfall will have a profound effect on the productivity of mosquito breeding sites and, as a result, on the transmission of malaria. These findings are discussed in the light of malaria risk and changing rainfall patterns in response to climate change.

  12. Descrição da larva de Diastatops obscura (Fabricius (Odonata, Libellulidae Description of the larva of Diastatops obscura (Fabricius (Odonata, Libellulidae

    Directory of Open Access Journals (Sweden)

    N.D. Santos

    1993-01-01

    Full Text Available The larva of Diastatops obscura (Fabricius, 1775 is described and figured based on exuviae of last instar of reared specimes collected on still waters in São João river, Silva Jardim (22º38' - 42º18', Rio de Janeiro, Brazil. The relationship among the larva of D. obscura and larvae of Celithemis are discussed.

  13. REARING CARP LARVAE (Cyprinus carpio IN CLOSED RECIRCULATORY SYSTEM (RAS

    Directory of Open Access Journals (Sweden)

    Anđelko Opačak

    2012-03-01

    Full Text Available Postembryonic rearing of carp larvae in closed recirculatory system was conducted in 2009 at the fish farm Ribnjak LLC, Donji Miholjac, Croatia. The research was conducted in two test groups (A and B with three iterations in each with a control group (C. Test group A (3 tanks x 250 l consisted of 150 000 larvae (density of 200 larvae•l-1, test group B (3 tanks x 500 l consisted of 600 000 larvae (density of 400 larvae•l-1, and the control group (C was a mud fish pond T-6 which was stocked by 800 000 larvae•ha-1 under standard production conditions. In this research, basic physical and chemical water parameters were controlled (temperature, oxygen, pH, total ammonia and nitrites. Initial measuring of carp larvae total length (TL was conducted prior to their placement into tanks (N=120. On the fourth, sixth, eighth and tenth day of research 20 larvae (N=140 were taken out of every tank as well as out of control group and measured. Feeding with live feed began on the third day after hatching (larval TL 6.00±0.36 mm. Ten minutes after feeding live feed to larvae for the first time, 20 larvae (N=120 were taken out of every tank and a high portion of larvae that accepted live feed (89.17±3.76% was determined by a magnifying glass. Feeding artificial feed began on the seventh day after the hatching. After ten minutes, a high portion of larvae who accepted artificial feed (96.67±2.58% was determined. Since the end of the research, the determined length increment (ITL per day was 0.41±0.04 mm, a very high survival rate was established (group A: 96%, group B: 93%. Feeding frequency was four times a day in five-hour intervals (at 06:00, 11:00,16:00 and 21:00 hours. The research was terminated after ten feeding days due to deteriorating condition of zoohygienic filter. The total of 3807 g of live feed and 1080 g of artificial feed was used.

  14. Chemical spying in coral reef fish larvae at recruitment.

    Science.gov (United States)

    Roux, Natacha; Brooker, Rohan M; Lecellier, Gaël; Berthe, Cécile; Frédérich, Bruno; Banaigs, Bernard; Lecchini, David

    2015-10-01

    When fish larvae recruit back to a reef, chemical cues are often used to find suitable habitat or to find juvenile or adult conspecifics. We tested if the chemical information used by larvae was intentionally produced by juvenile and adult conspecifics already on the reef (communication process) or whether the cues used result from normal biochemical processes with no active involvement by conspecifics ("spying" behavior by larvae). Conspecific chemical cues attracted the majority of larvae (four out of the seven species tested); although while some species were equally attracted to cues from adults and juveniles (Chromis viridis, Apogon novemfasciatus), two exhibited greater sensitivity to adult cues (Pomacentrus pavo, Dascyllus aruanus). Our results indicate also that spying cues are those most commonly used by settling fishes (C. viridis, P. pavo, A. novemfasciatus). Only one species (D. aruanus) preferred the odour of conspecifics that had had visual contact with larvae (communication). Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  15. Activity of Thymus vulgaris essential oil against Anisakis larvae.

    Science.gov (United States)

    Giarratana, F; Muscolino, D; Beninati, C; Giuffrida, A; Panebianco, A

    2014-07-01

    Anisakiasis is an important food-borne disease especially in countries with high fish consumption. The increase of cases of human disease and the virtual absence of effective treatments have prompted the research on new active compounds against Anisakis larvae. As well known, the disease is related to the consumption of raw or almost raw seafood products, but also marinated and/or salted fishery products, if the processing is insufficient to destroy nematode larvae can represent a risks for the consumers. In the light of the biocidal efficacy against different pathogens demonstrated for various essential oils, the aim of this work is to evaluate the effect of Thymus vulgaris essential oil (TEO) against anisakidae larvae. The TEO at 10% and 5% concentration in oil sunflower seeds, caused in vitro the death of all larvae within 14 h, with cuticle and intestinal wall damages. The results obtained showing a significant activity against Anisakis larvae, suggest further investigation on TEO as a larvicidal agent and on its potential use in the industrial marinating process. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. DNA barcoding: A molecular tool to identify Antarctic marine larvae

    Science.gov (United States)

    Webb, Karen E.; Barnes, David K. A.; Clark, Melody S.; Bowden, David A.

    2006-04-01

    To begin to understand overall patterns and processes influencing marine populations, communities and ecosystems, it is important to determine the timing, duration, mode and dispersal of larvae. However, few studies of the spatial and temporal variation in abundance of larvae have been undertaken at any locality, other than for a few commercially important species. In Antarctic seas the abundance and species-richness of marine larvae are key to a number of concepts (such as the validity of Thorson's rule and ecological versus evolutionary success of brooders compared to spawning species). Traditionally, marine larval identification (using microscopy), even to order level, is a time-consuming, labour-intensive and inexact process. Ontogenic changes during larval life make identification difficult and require high levels of expertise, and identification is generally confirmed only by laboratory spawning experiments. New molecular genetic methods enable faster direct identification of marine larvae to a higher resolution. Our preliminary results show that it is possible to identify larvae of Antarctic species using DNA barcoding techniques, but that the resolution is currently limited by the availability of comparative adult sequences in the DNA sequence databases.

  17. Microplastic ingestion in fish larvae in the western English Channel.

    Science.gov (United States)

    Steer, Madeleine; Cole, Matthew; Thompson, Richard C; Lindeque, Penelope K

    2017-07-01

    Microplastics have been documented in marine environments worldwide, where they pose a potential risk to biota. Environmental interactions between microplastics and lower trophic organisms are poorly understood. Coastal shelf seas are rich in productivity but also experience high levels of microplastic pollution. In these habitats, fish have an important ecological and economic role. In their early life stages, planktonic fish larvae are vulnerable to pollution, environmental stress and predation. Here we assess the occurrence of microplastic ingestion in wild fish larvae. Fish larvae and water samples were taken across three sites (10, 19 and 35 km from shore) in the western English Channel from April to June 2016. We identified 2.9% of fish larvae (n = 347) had ingested microplastics, of which 66% were blue fibres; ingested microfibers closely resembled those identified within water samples. With distance from the coast, larval fish density increased significantly (P microplastic concentrations (P microplastics and the incidence of ingestion in fish larvae. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Phylogenetics links monster larva to deep-sea shrimp.

    Science.gov (United States)

    Bracken-Grissom, Heather D; Felder, Darryl L; Vollmer, Nicole L; Martin, Joel W; Crandall, Keith A

    2012-10-01

    Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remarkably rare in nature and relatively inaccessible due to its changing habitats over the course of ontogeny. The mid-water marine species Cerataspis monstrosa (Gray 1828) is an armored crustacean larva whose adult identity has remained a mystery for over 180 years. Our phylogenetic analyses, based in part on recent collections from the Gulf of Mexico, provide definitive evidence that the rare, yet broadly distributed larva, C. monstrosa, is an early developmental stage of the globally distributed deepwater aristeid shrimp, Plesiopenaeus armatus. Divergence estimates and phylogenetic relationships across five genes confirm the larva and adult are the same species. Our work demonstrates the diagnostic power of molecular systematics in instances where larval rearing seldom succeeds and morphology and habitat are not indicative of identity. Larval-adult linkages not only aid in our understanding of biodiversity, they provide insights into the life history, distribution, and ecology of an organism.

  19. Image enhancement for tracking the translucent larvae of Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    Sukant Khurana

    Full Text Available Drosophila melanogaster larvae are model systems for studies of development, synaptic transmission, sensory physiology, locomotion, drug discovery, and learning and memory. A detailed behavioral understanding of larvae can advance all these fields of neuroscience. Automated tracking can expand fine-grained behavioral analysis, yet its full potential remains to be implemented for the larvae. All published methods are unable to track the larvae near high contrast objects, including the petri-dish edges encountered in many behavioral paradigms. To alleviate these issues, we enhanced the larval contrast to obtain complete tracks. Our method employed a dual approach of optical-contrast boosting and post-hoc image processing for contrast enhancement. We reared larvae on black food media to enhance their optical contrast through darkening of their digestive tracts. For image processing we performed Frame Averaging followed by Subtraction then Thresholding (FAST. This algorithm can remove all static objects from the movie, including petri-dish edges prior to processing by the image-tracking module. This dual approach for contrast enhancement also succeeded in overcoming fluctuations in illumination caused by the alternating current power source. Our tracking method yields complete tracks, including at the edges of the behavioral arena and is computationally fast, hence suitable for high-throughput fine-grained behavioral measurements.

  20. Lipid and fatty acid analysis of uninfected and granulosis virus-infected Plodia interpunctella larvae

    Science.gov (United States)

    Shastri-Bhalla, K.; Consigli, R. A.; Spooner, B. S. (Principal Investigator)

    1994-01-01

    A comparative study on the lipid and fatty acid composition of the uninfected and GV-infected Plodia interpunctella larvae was performed. Higher levels of free fatty acids were found in GV-infected larvae compared to those of the uninfected larvae, while the latter had more triacylglycerol compared to the former. The known identified phospholipids were fewer in the GV-infected larvae compared to those in the uninfected larvae. However, an unidentified phospholipid was found to be approximately two times higher in GV-infected larvae. The total lipid of both larvae had palmitic, oleic, and linoleic as the major fatty acids. The fatty acid composition of the GV-infected larval phospholipid differed considerably compared to that of the uninfected larvae, in that the ratio of unsaturated fatty acid to saturated fatty acid was 3.5 times less in the GV-infected larvae.

  1. Are larvae of demersal fishes plankton or nekton?

    Science.gov (United States)

    Leis, Jeffrey M

    2006-01-01

    A pelagic larval stage is found in nearly all demersal marine teleost fishes, and it is during this pelagic stage that the geographic scale of dispersal is determined. Marine biologists have long made a simplifying assumption that behaviour of larvae--with the possible exception of vertical distribution--has negligible influence on larval dispersal. Because advection by currents can take place over huge scales during a pelagic larval stage that typically lasts for several days to several weeks, this simplifying assumption leads to the conclusion that populations of marine demersal fishes operate over, and are connected over, similar huge scales. This conclusion has major implications for our perception of how marine fish populations operate and for our management of them. Recent (and some older) behavioural research-reviewed here-reveals that for a substantial portion of the pelagic larval stage of perciform fishes, the simplifying assumption is invalid. Near settlement, and for a considerable portion of the pelagic stage prior to that, larvae of many fish species are capable of swimming at speeds faster than mean ambient currents over long periods, travelling tens of kilometres. Only the smallest larvae of perciform fishes swim in an energetically costly viscous hydrodynamic environment (i.e., low Reynolds number). Vertical distribution is under strong behavioural control from the time of hatching, if not before, and can have a decisive, if indirect, influence on dispersal trajectories. Larvae of some species avoid currents by occupying the epibenthic boundary layer. Larvae are able to swim directionally in the pelagic environment, with some species apparently orientating relative to the sun and others to settlement sites. These abilities develop relatively early, and ontogenetic changes in orientation are seemingly common. Larvae of some species can use sound to navigate, and others can use odour to find settlement habitat, at least over small scales. Other

  2. A simple visual system without neurons in jellyfish larvae.

    Science.gov (United States)

    Nordström, Karin; Wallén, Rita; Seymour, Jamie; Nilsson, Dan

    2003-11-22

    Earlier detailed studies of cnidarian planula larvae have revealed a simple nervous system but no eyes or identifiable light sensing structures. Here, we describe the planula of a box jellyfish, Tripedalia cystophora, and report that these larvae have an extremely simple organization with no nervous system at all. Their only advanced feature is the presence of 10-15 pigment-cup ocelli, evenly spaced across the posterior half of the larval ectoderm. The ocelli are single cell structures containing a cup of screening pigment filled with presumably photosensory microvilli. These rhabdomeric photoreceptors have no neural connections to any other cells, but each has a well-developed motor-cilium, appearing to be the only means by which light can control the behaviour of the larva. The ocelli are thus self-contained sensory-motor entities, making a nervous system superfluous.

  3. CONTROLE DE LARVAS DE Diloboderus abderus COM INSETICIDAS EM TRIGO

    Directory of Open Access Journals (Sweden)

    Silva Mauro Tadeu Braga da

    2002-01-01

    Full Text Available A larva de Diloboderus abderus Sturm (Coleoptera: Melolonthidae é uma praga importante da cultura do trigo (Triticum aestivum L. em plantio direto na região Sul do Brasil. Este estudo teve como objetivo avaliar diferentes inseticidas aplicados nas sementes (fipronil e tiametoxam e via pulverização do solo (clorpirifós e lambdacialotrina para o controle dessa praga. A eficiência dos inseticidas foi determinada através do número de larvas vivas no solo aos 30, 60 e 90 dias após a emergência das plantas (DAE, da massa seca da parte aérea das plantas aos 90 DAE e da produção de grãos. Foram observadas correlações negativas significativas entre a dose dos inseticidas fipronil e tiametoxam e o número de larvas, e correlações positivas significativas entre estes inseticidas e a massa seca da parte aérea e a produtividade de grãos. Infestações de larvas nas testemunhas não tratadas reduziram a produtividade em relação às áreas tratadas com inseticidas. A produtividade incrementou à medida que aumentou a eficiência de controle do inseto pelos inseticidas. Concluiu-se que clorpirifós (960 e 1200g i.a./ha e lambdacialotrina a 25g i.a./ha (formulação CE, aplicados em pulverização do solo, são eficientes para reduzir a população de larvas de D. abderus, garantindo a produtividade de grãos. Sugerem-se novos testes com os inseticidas fipronil, tiametoxam e lambdacialotrina (formulação SC para determinar doses técnica e economicamente adequadas para o controle de larvas de D. abderus em trigo.

  4. Drosophila melanogaster larvae as a model for blast lung injury.

    Science.gov (United States)

    Bass, Cameron R; Meyerhoff, Kevin P; Damon, Andrew M; Bellizzi, Andrew M; Salzar, Robert S; Rafaels, Karin A

    2010-07-01

    Primary blast injuries, specifically lung injuries, resulting from blast overpressure exposures are a major source of mortality for victims of blast events. However, existing pulmonary injury criteria are inappropriate for common exposure environments. This study uses Drosophila melanogaster larvae to develop a simple phenomenological model for human pulmonary injury from primary blast exposure. Drosophila larvae were exposed to blast overpressures generated by a 5.1-cm internal diameter shock tube and their mortality was observed after the exposure. To establish mortality thresholds, a survival analysis was conducted using survival data and peak incident pressures. In addition, a histologic analysis was performed on the larvae to establish the mechanisms of blast injury. The results of the survival analysis suggest that blast overpressure for 50% Drosophila survival is greater than human threshold lung injury and is similar to human 50% survival levels, in the range of overpressure durations tested (1-5 ms). A "parallel" analysis of the Bass et al. 50% human survival curves indicates that 50% Drosophila survival is equivalent to a human injury resulting in a 69% chance of survival. Histologic analysis of the blast-exposed larvae failed to demonstrate damage to the dorsal trunk of the tracheal system; however, the presence of flocculent material in the larvae body cavities and tracheas suggests tissue damage. This study shows that D. melanogaster survival can be correlated with large animal injury models to approximate a human blast lung injury tolerance. Within the range of durations tested, Drosophila larvae may be used as a simple model for blast injury.

  5. Reorientation and Swimming Stability in Sea Urchin Larvae

    Science.gov (United States)

    Wheeler, J.; Chan, K. Y. K.; Anderson, E.; Helfrich, K. R.; Mullineaux, L. S.; Sengupta, A.; Stocker, R.

    2016-02-01

    Many benthic marine invertebrates have two-phase life histories, relying on planktonic larval stages for dispersal and exchange of individuals between adult populations. The dispersal of planktonic larvae is determined by two factors: passive advection by the ambient flow and active motility. By modifying dispersal and ultimately settlement, larval motility influences where and when individuals recruit into benthic communities. Despite its ecological relevance, our understanding of larval motility and behavior in the plankton remains limited, especially regarding the interactions of larval motility and ambient turbulence. As most larvae are smaller than the Kolmogorov scale, they experience ocean turbulence in part as a time-changing viscous torque produced by local fluid shear. This torque causes larval reorientation, impacting swimming direction and potentially dispersal at the macroscale. It is therefore paramount to understand the mechanisms of larval reorientation and the stability of larvae against reorientation. Here we report on the larval reorientation behavior of the sea urchins Arbacia punctulata and Heliocidaris crassispina. Both species have life histories characterized by ontogenetic changes to internal density structure and morphology, which we hypothesized to impact stability. To test this hypothesis, we performed "flip chamber" experiments, in which larvae swim freely in a small chamber that is intermittently inverted, mimicking the overturning experienced by larvae in turbulence. We investigated the role of larval age, body size, species, morphology (number of arms), and motility (live versus dead) on the reorientation dynamics. Our work contributes to a more mechanistic understanding of the role of hydrodynamics in the motility and transport of planktonic larvae.

  6. Infection of silkworm larvae by the entomopathogenic fungus Metarhizium anisopliae

    Directory of Open Access Journals (Sweden)

    Lucineia de Fátima Chasko Ribeiro

    Full Text Available ABSTRACT: The isolate E9 of Metarhizium anisopliae was used in commercial hybrids of Bombyx mori larvae to evaluate its biological effect. Symptomatological analyses showed typical signs of fungal infection. Histopathology revealed the presence of large numbers of hemocytes in the hemocoel, and on the sixth dpi the bodies of the insects appeared to be colonised by the fungus. The isolate E9 is pathogenic to larvae B. mori and; therefore, death of the insects was caused by the colonization of fungus in the epidermal and mesodermal tissues.

  7. Acanthocephala Larvae parasitizing Ameiva ameiva ameiva (Linnaeus, 1758) (Squamata: Teiidae).

    Science.gov (United States)

    Macedo, Lilian Cristina; Melo, Francisco Tiago de Vasconcelos; Ávila-Pires, Teresa Cristina Sauer; Giese, Elane Guerreiro; Santos, Jeannie Nascimento Dos

    2016-03-11

    Knowledge concerning the taxonomy and biology of species of Acanthocephala, helminth parasites of the helminth species of the phylum Acanthocephala, parasites of lizards in Brazilian Amazonia, is still insufficient, but reports of Acanthocephala in reptiles are becoming increasingly common in the literature. Cystacanth-stage Acanthocephalan larvae have been found in the visceral peritoneum during necropsy of Ameiva ameiva ameivalizards from the "Osvaldo Rodrigues da Cunha" Herpetology Collection of the Emílio Goeldi Museum, Belém, Pará, Brazil. The aim of this study was to present the morphological study of the Acanthocephala larvae found in A. ameiva ameiva lizard.

  8. Histomorphogenesis of cranial nerves in Huso huso larvae

    OpenAIRE

    Tavighi, Sherma; Saadatfar, Zohreh; Shojaei, Bahador; Behnam Rassouli, Morteza

    2016-01-01

    In this study the cranial nerves development of H. huso are explained from 1 to 54-days-old (1, 3, 6, 15, 21 and 54 days). Despite all the researches on fish brain, there are no study on nerves evolution on H. huso during their larvae life. For this research 40 samples of larvae H. huso were obtained (from each age, about six samples were selected). The specimens were maintained in fiberglass tank, then histological samples were taken from tissues and stained with hematoxylin and eosin for ge...

  9. First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera Primeiro registro de larvas de Chironomidae como presas de Temnocephala sp. (Platyhelminthes, Temnocephalidae, um ectosimbionte de larvas de Corydalidae (Maegaloptera

    Directory of Open Access Journals (Sweden)

    Susana Trivinho-Strixino

    2012-09-01

    Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.Primeiro registro de larvas de Chironomidae como presas de Temnocephala sp. (Platyhelminthes, Temnocephalidae, um ectosimbionte de larvas de Corydalidae (Maegaloptera. Este estudo constitui o primeiro registro de Temnocephala Blanchard (Platyhelminthes, Temnocephalidae, um ectosimbionte em larvas de Megaloptera, como um possível predador de larvas de Chironomidae. Vinte e oito larvas de Corydalidae (Corydalus e Protochauliodes foram examinadas sobre estereomicroscópio na busca por Temnocephala e larvas de Chironomidae, das quais cinco larvas de Megaloptera continham 24 Temnocephala sp. associadas. Além disso, oito Temnocephala possuíam em seu conteúdo estomacal larvas de Chironomidae, uma interação desconhecida anteriormente. A análise do conteúdo estomacal revelou Corynoneura como o quironomídeo mais abundante, e também algumas larvas de Larsia, Rheotanytarsus e Tanytarsus. Este estudo inclui Corydalus e Protochauliodes como hospedeiros de Temnocephala, os quais podem ser importantes

  10. Intraguild predation and cannibalism among larvae of detritivorous caddisflies in subalpine wetlands

    Science.gov (United States)

    Wissinger, S.A.; Sparks, G.B.; Rouse, G.L.; Brown, W.S.; Steltzer, Heidi

    1996-01-01

    Comparative data from subalpine wetlands in Colorado indicate that larvae of the limnephilid caddisflies, Asynarchus nigriculus and Limnephilus externus, are reciprocally abundant among habitats - Limnephilus larvae dominate in permanent waters, whereas Asynarchus larvae dominate in temporary basins. The purpose of this paper is to report on field and laboratory experiments that link this pattern of abundance to biotic interactions among larvae. In the first field experiment, growth and survival were compared in single and mixed species treatments in littoral enclosures. Larvae, which eat mainly vascular plant detritus, grew at similar rates among treatments in both temporary and permanent habitats suggesting that exploitative competition is not important under natural food levels and caddisfly densities. However, the survival of Limnephilus larvae was reduced in the presence of Asynarchus larvae. Subsequent behavioral studies in laboratory arenas revealed that Asynarchus larvae are extremely aggressive predators on Limnephilus larvae. In a second field experiment we manipulated the relative sizes of larvae and found that Limnephilus larvae were preyed on only when Asynarchus larvae had the same size advantage observed in natural populations. Our data suggest that the dominance of Asynarchus larvae in temporary habitats is due to asymmetric intraguild predation (IGP) facilitated by a phenological head start in development. These data do not explain the dominance of Limnephilus larvae in permanent basins, which we show elsewhere to be an indirect effect of salamander predation. Behavioral observations also revealed that Asynarchus larvae are cannibalistic. In contrast to the IGP on Limnephilus larvae, Asynarchus cannibalism occurs among same-sized larvae and often involves the mobbing of one victim by several conspecifics. In a third field experiment, we found that Asynarchus cannibalism was not density-dependent and occurred even at low larval densities. We

  11. Angiostrongylus cantonensis (Nematode: Metastrongiloidea: in vitro cultivation of infective third-stage larvae to fourth-stage larvae.

    Directory of Open Access Journals (Sweden)

    Rong-Jyh Lin

    Full Text Available The present study to attempt to cultivate Angiostrongylus cantonensis from third-stage larvae (AcL3 to fourth-stage larvae (AcL4 in vitro in defined complete culture medium that contained with Minimum Essential Medium Eagle (MEM, supplemented amino acid (AA, amine (AM, fatty acid (FA, carbohydrate (CA and 20% fetal calf serum (FCS was successful. When AcL3 were cultured in the defined complete culture medium at 37°C in a 5% CO2 atmosphere, the larvae began to develop to AcL4 after 30 days of cultivation, and were enclosed within the sheaths of the third molts of the life cycle. Under these conditions, the larvae developed uniformly and reached to the fourth-stage 36 days. The morphology of AcL3 develop to AcL4 were recording and analyzing. Then comparison of A. cantonensis larval morphology and development between in vitro cultivation in defined complete culture medium and in vivo cultivation in infective BALB/c mice. The larvae that had been cultivated in vitro were smaller than AcL4 of infective BALB/c mice. However the AcL3 that were cultured using defined incomplete culture medium (MEM plus 20% FCS with AA+AM, FA, CA, AA+AM+FA, FA+CA, CA+AA+AM or not did not adequately survive and develop. Accordingly, the inference is made that only the defined complete medium enable AcL3 develop to AcL4 in vitro. Some nematodes have been successfully cultured into mature worms but only a few researches have been made to cultivate A. cantonensis in vitro. The present study is the first to have succeeded in developing AcL3 to AcL4 by in vitro cultivation. Finally, the results of in vitro cultivation studies herein contribute to improving media for the effective development and growth of A. cantonensis. The gap in the A. cantonensis life cycle when the larvae are cultivated in vitro from third-stage larvae to fourth-stage larvae can thus be solved.

  12. Angiostrongylus cantonensis (Nematode: Metastrongiloidea): in vitro cultivation of infective third-stage larvae to fourth-stage larvae.

    Science.gov (United States)

    Lin, Rong-Jyh; He, Jie-Wen; Chung, Li-Yu; Lee, June-Der; Wang, Jiun-Jye; Yen, Chuan-Min

    2013-01-01

    The present study to attempt to cultivate Angiostrongylus cantonensis from third-stage larvae (AcL3) to fourth-stage larvae (AcL4) in vitro in defined complete culture medium that contained with Minimum Essential Medium Eagle (MEM), supplemented amino acid (AA), amine (AM), fatty acid (FA), carbohydrate (CA) and 20% fetal calf serum (FCS) was successful. When AcL3 were cultured in the defined complete culture medium at 37°C in a 5% CO2 atmosphere, the larvae began to develop to AcL4 after 30 days of cultivation, and were enclosed within the sheaths of the third molts of the life cycle. Under these conditions, the larvae developed uniformly and reached to the fourth-stage 36 days. The morphology of AcL3 develop to AcL4 were recording and analyzing. Then comparison of A. cantonensis larval morphology and development between in vitro cultivation in defined complete culture medium and in vivo cultivation in infective BALB/c mice. The larvae that had been cultivated in vitro were smaller than AcL4 of infective BALB/c mice. However the AcL3 that were cultured using defined incomplete culture medium (MEM plus 20% FCS with AA+AM, FA, CA, AA+AM+FA, FA+CA, CA+AA+AM or not) did not adequately survive and develop. Accordingly, the inference is made that only the defined complete medium enable AcL3 develop to AcL4 in vitro. Some nematodes have been successfully cultured into mature worms but only a few researches have been made to cultivate A. cantonensis in vitro. The present study is the first to have succeeded in developing AcL3 to AcL4 by in vitro cultivation. Finally, the results of in vitro cultivation studies herein contribute to improving media for the effective development and growth of A. cantonensis. The gap in the A. cantonensis life cycle when the larvae are cultivated in vitro from third-stage larvae to fourth-stage larvae can thus be solved.

  13. Roasted maggots (Dipteran larvae) as a dietary protein source for ...

    African Journals Online (AJOL)

    Roasted maggots (Dipteran larvae) as a dietary protein source for laboratory animals. ... African Journal of Applied Zoology and Environmental Biology ... One set were fed with the convectional feed (set G,) with Clarias fish as its protein portion while the other set (M) were fed with same diet with maggots from poultry wastes ...

  14. Growth and Survival of First Feeding Larvae of Clarias gariepinus ...

    African Journals Online (AJOL)

    The study was designed to evaluate the growth performance and survival of Clarias gariepinus larvae fed live Zooplankton (LZ), Frozen Zooplnakton (FZ), Dried Zooplankton (DZ) and a mixture of Live and Frozen Zooplankton (LFZ) as well as Live and Dried zooplankton (LDZ). The experiments were conducted in plastic ...

  15. Catching large herring larvae: Gear applicability and larval distribution

    DEFF Research Database (Denmark)

    Munk, Peter

    1988-01-01

    A series of night hauls were made both along a transect from the Danish coast to the Dogger Bank and at a fixed position in the southern North Sea. The aim was to evaluate the suitability of two midwater trawls (IKMT and MIK) for catching large herring larvae (20-40 mm), with special attention...

  16. Aluminium chloride-induced toxicity in zebrafish larvae.

    Science.gov (United States)

    Monaco, A; Grimaldi, M C; Ferrandino, I

    2017-05-01

    Embryos at shield stage and larvae at protruding mouth stage were exposed to different concentrations of aluminium chloride (AlCl3 ) for 72 h with the purpose to analyse their phenotype and lethality. After 24, 48 and 72 h of treatment, higher toxicity of the metal was observed on larvae with minimal lethal concentration of 0.25, 0.20 and 0.08 mm, respectively, while for embryos the corresponding values were 40, 25 and 16 mm. We observed pericardial oedema and alteration of heart rate in 50% of larvae after 48 h of exposure to 100 μm. In larvae exposed to the same concentration, there was also a neurological injury at the level of glial cells, with the number of glial fibrillary acidic protein-positive cells being significantly reduced. This study confirms the toxic nature of this metal and shows that aluminium could also interestingly represent a cardiotoxin in addition to its neurotoxic ability. © 2016 John Wiley & Sons Ltd.

  17. Susceptibility Of Mosquito Larvae To Conventional Insecticides In A ...

    African Journals Online (AJOL)

    The susceptibility of 4th instar larvae of Aedes aegypti and Culex quinquefasciatus to dieldrin, dichlovos and cypermethrin were evaluated in laboratory. Larval mortality was assessed 24 hour afterexposure. The result showed that the LD50 values for Aedes aegypti exposed to dieldrin, dichlovos and cypermethrin were 0.48 ...

  18. Ingestion of Nanoplastics and Microplastics by Pacific Oyster Larvae.

    Science.gov (United States)

    Cole, Matthew; Galloway, Tamara S

    2015-12-15

    Plastic debris is a prolific contaminant effecting freshwater and marine ecosystems across the globe. Of growing environmental concern are "microplastics"and "nanoplastics" encompassing tiny particles of plastic derived from manufacturing and macroplastic fragmentation. Pelagic zooplankton are susceptible to consuming microplastics, however the threat posed to larvae of commercially important bivalves is currently unknown. We exposed Pacific oyster (Crassostrea gigas) larvae (3-24 d.p.f.) to polystyrene particles spanning 70 nm-20 μm in size, including plastics with differing surface properties, and tested the impact of microplastics on larval feeding and growth. The frequency and magnitude of plastic ingestion over 24 h varied by larval age and size of polystyrene particle (ANOVA, P plastic, with aminated particles ingested and retained more frequently (ANOVA, P plastic consumption and plastic load per organism was identified (Spearmans, r = 0.95, P micro- and nanoplastics were readily ingested by oyster larvae, exposure to plastic concentrations exceeding those observed in the marine environment resulted in no measurable effects on the development or feeding capacity of the larvae over the duration of the study.

  19. Ingestion of microplastic has limited impact on a marine larva.

    Science.gov (United States)

    Kaposi, Katrina L; Mos, Benjamin; Kelaher, Brendan P; Dworjanyn, Symon A

    2014-01-01

    There is increasing concern about the impacts of microplastics (Microplastics may be mistaken for food items and ingested by a wide variety of organisms. While the effects of ingesting microplastic have been explored for some adult organisms, there is poor understanding of the effects of microplastic ingestion on marine larvae. Here, we investigated the ingestion of polyethylene microspheres by larvae of the sea urchin, Tripneustes gratilla. Ingestion rates scaled with the concentration of microspheres. Ingestion rates were, however, reduced by biological fouling of microplastic and in the presence of phytoplankton food. T. gratilla larvae were able to egest microspheres from their stomach within hours of ingestion. A microsphere concentration far exceeding those recorded in the marine environment had a small nondose dependent effect on larval growth, but there was no significant effect on survival. In contrast, environmentally realistic concentrations appeared to have little effect. Overall, these results suggest that current levels of microplastic pollution in the oceans only pose a limited threat to T. gratilla and other marine invertebrate larvae, but further research is required on a broad range of species, trophic levels, and polymer types.

  20. Acute Toxicity of Diazinon on Rotifers, Cyclops, Mosquito Larvae ...

    African Journals Online (AJOL)

    189.31pg/l tor rotifers, eyclops, mosquito larvae and fish respectively. The rotifers had the ... intermediate host or vector of some parasitic diseases. (Ukoli,l984). Diazinon .... Tropical Africa. John Wiley & Sons, Londod,. 464pp. Wade JW, Stirling HP (1999). Fertilization of ponds ll: Effects on plankton communitie, Journal of.

  1. Odour avoidance learning in the larva of Drosophila melanogaster

    Indian Academy of Sciences (India)

    2008-12-11

    Dec 11, 2008 ... Drosophila larvae can be trained to avoid odours associated with electric shock. We describe here, an improved method of aversive conditioning and a procedure for decomposing learning retention curve that enables us to do a quantitative analysis of memory phases, short term (STM), middle term (MTM) ...

  2. Description and ecology of larvae of Glossogobius callidus and ...

    African Journals Online (AJOL)

    This paper describes the morphology and ecology of the larvae and early juveniles of two common gobiids in warm temperate South African estuaries. The early developmental stages of Glossogobius callidus and Redigobius dewaali were collected during plankton surveys in seven permanently open and five intermittently ...

  3. Defensive enrolment in mantis shrimp larvae (Malacostraca: Stomatopoda)

    NARCIS (Netherlands)

    Haug, C.; Haug, J.T.

    2014-01-01

    We describe a possible new defensive behaviour of larval stages of mantis shrimps (Stomatopoda). Mantis shrimp larvae are rarely observed in nature, thus the study is based on postures of museum material and functional morphological aspects. Specimens described here are tightly enrolled, their pleon

  4. Context‐dependent chemical communication: Alarm pheromones of thrips larvae

    NARCIS (Netherlands)

    de Bruijn, P.J.A.

    2015-01-01

    Thrips have several advantages that make them particularly suitable for the study of the evolution of alarm signalling. When in danger, thrips larvae defend themselves by the excretion of ‘anal droplets’: a predator touched by such a droplet interrupts the attack and switches to cleaning. These

  5. The larvae of decapods and fishes of Amba estuary, Maharashtra

    Digital Repository Service at National Institute of Oceanography (India)

    Paulinose, V.T.; Devi, C.B.L.; Govindan, K.; Gajbhiye, S.N.; Nair, V.R.

    larvae to the total zooplankton population were 3.63 and 0.03 respectively. In the assessment of larval stocks environmental parameters and the presence of adult fish caught in the area were considered. The estuarine area supported fairly high fishery...

  6. Anaphe venata larva extract-induced purposeless chewing in rats ...

    African Journals Online (AJOL)

    Seasonal ataxia was reported in humans following the consumption of Anaphe venata larva as protein supplement in diet and altered motor function in rodents when the extract was administered intraperitoneally. In this study we investigated the effect of the crude aqueous and Phosphate Buffer Saline (PBS) extracts of this ...

  7. Bacteria and fungi isolated from housefly ( Musca domestica L.) larvae

    African Journals Online (AJOL)

    Housefly larvae were cultured on fresh fish and collected for the isolation and identification of microorganisms associated with them. The microbes were cultured from both the gut and body surface of the maggot on nutrient agar (for bacteria) and potato dextrose agar (for fungi) and incubated at about 37°C for 48 h before ...

  8. Larva migrans in the oral mucosa: report of two cases.

    Science.gov (United States)

    Damante, José Humberto; Chinellato, Luiz Eduardo Montenegro; Oliveira, Fernando Toledo de; Soares, Cleverson Teixeira; Fleury, Raul Negrão

    2011-01-01

    Cutaneous Larva migrans is a very common disease in tropical regions. In the oral mucosa, the infection occurs in the same way as in the skin, but it is rarer. This report describes two cases of Larva migrans in the oral mucosa. The first case was in a 27-year-old woman who presented an erythematous plaque located on the buccal mucosa, extending to a posterior direction, following a linear pattern, to other areas of the mouth. After incisional biopsy of the anterior-most portion of the lesion, morphological details obtained in multiple examined sections suggested Necator or Ancylostoma braziliense larvae as the cause of infection. The second case was in a 35-year-old male who presented a fusiform erythematous plaque in the palatal mucosa. This area was removed and submitted to microscopic examination under a presumptive diagnosis of "parasite migratory stomatitis". The histological characteristics were suggestive of a larva pathway. In both cases the lesion disappeared after biopsy and the patients were symptom-free.

  9. Effect of Root Extracts of Lantana camara (Verbenaceae) on Larvae ...

    African Journals Online (AJOL)

    Larvicidal activity of three solvent root (bark and wood) extracts of Lantana camara Linn. was investigated against first and fourth instars of Aedes aegypti larvae after 24 and 48 h post-treatment exposure to serial concentrations (0.1, 0.05, 0.01, 0.005, 0.001 %) of aqueous, ethanolic and acetone crude extracts. All extracts ...

  10. Temporal dynamics of Chaoborus larvae (Diptera : Chaoboridae) in ...

    African Journals Online (AJOL)

    Pinto-Coelho, 2007). Nauplii which are know to be the food of Chaoborus larvae at stages I and II, are the zooplankton most likely affected by thunderstorms. Finally, predation by fish (Yan et al., 1985; Wissel et al., 2003; Kouamelan et al.,. 2006) and decline in trophic ressources linked to major rainfalls may be responsible ...

  11. Overwintering physiology of the rice stem borer larvae, Chilo ...

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    2012-08-16

    Aug 16, 2012 ... this study, we determined the supercooling points (SCPs), the contents of amino acids and low- molecular weight ... drates play a role in insect survival at subzero tem- peratures. .... Dynamic changes of the contents of whole body glycerol in the rice stem borer larvae during overwintering. Values labeled ...

  12. In vitro Evaluation of Benzimidazole Carbamates on Cystic Larvae of ...

    African Journals Online (AJOL)

    In vitro Evaluation of Benzimidazole Carbamates on Cystic Larvae of Three Cestode Parasite Models. K D Mwambete, F Ponco-Gordo, C Cuesta-Bandera. Abstract. Benzimidazole carbamates are broad-spectrum anthelmintics which have limited solubility and hence poor absorption following oral administration.

  13. Biological control agent for mosquito larvae: Review on the killifish ...

    African Journals Online (AJOL)

    This review attempts to give an account on the recent advances on the killifish Aphanius dispar dispar as a biological control agent for mosquito larvae. Thirty six (36) articles of literature (scientific papers, technical and workshop reports) on this subject covering the period between 1980 and 2009 were reviewed.

  14. Bacteria of living and dead larvae of Porthetria dispar (L.)

    Science.gov (United States)

    John D. Podgwaite; Benjamin J. Cosenza

    1966-01-01

    A preliminary study of the bacteria associated with living and dead larvae of the gypsy moth (Porthetria dispar (L.)) was undertaken to determine what types of micro-organisms may be associated with disease in this insect. Specific objectives of this study were to enumerate the types of aerobic bacteria, and if possible to further elucidate the role...

  15. Microbial Quality of Roasted Larvae of the Palm Weevil ...

    African Journals Online (AJOL)

    The mean total viable bacterial and fungal counts were 6.24x104 and 4.1x104 cfu/g respectively. Although these larvae are rich sources of protein, their exposure to dust during hawking in motorized traffic is a major route of contamination with bacterial and fungal pathogens. Keyword: Rhyncophorus phoenicis, Microbial ...

  16. Metabolic alterations and molecular mechanism in silkworm larvae ...

    African Journals Online (AJOL)

    Metabolic alterations and molecular mechanism in silkworm larvae during viral infection: A review. ... African Journal of Biotechnology ... of sericulture largely and greatly depends on the metabolic modulations and molecular mechanism of silkworm, besides its genetic composition and immunological resistance. One of the ...

  17. Visceral larva migrans: migratory pattern of Toxocara canis in pigs

    DEFF Research Database (Denmark)

    Helwigh, Birgitte; Lind, Peter; Nansen, Peter

    1999-01-01

    recovered from the brain on days 14 and 21, with a maximum on day 14 p.i. No larvae were found in the eyes. Severe pathological changes were observed in the liver and lungs, especially on day 14 p.i.; also, development of granulomas was observed in the kidneys. Finally, a strong specific antibody response...

  18. Distribution of two post-larvae species of commercial prawns ...

    African Journals Online (AJOL)

    The white prawn, Fenneropenaeus indicus, and the tiger prawn, Penaeus monodon, are of great commercial importance, and they are extensively farmed along the eastern coast of India. Post-larvae of these species coexist in great abundance in estuaries along the Bay of Bengal. In this investigation, field distribution, ...

  19. Molecular characterization of Anisakis larvae from fish caught off Sardinia.

    Science.gov (United States)

    Meloni, Mauro; Angelucci, Giulia; Merella, Paolo; Siddi, Rita; Deiana, Carlo; Orrù, Germano; Salati, Fulvio

    2011-10-01

    Anisakis spp. larvae are parasitic, and potentially zoonotic, nematodes transmitted by marine fish and cephalopods, which are the main intermediate hosts of the third larval stage. The accidental consumption of infected raw or poorly cooked fish may cause gastroenteric diseases and allergies in humans. The aim of the present study was to use polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) to define the occurrence, species variability, and host preferences of Anisakis spp. larvae in fish caught off the coast of Sardinia. Necropsy was used on 285 samples; 552 Anisakis spp. L3 larvae were isolated from 87 fish that tested positive for this nematode. Anisakis pegreffii was most frequently encountered (90.6%), with a primary preference for Scomber scombrus, Zeus faber, and Trachurus mediterraneus. In contrast, the prevalence of Anisakis physeteris was only 1.3%. A hybrid genotype of Anisakis simplex sensu stricto and Anisakis pegreffii was also observed, which confirms the results of previous studies carried out in the western Mediterranean. Interestingly, no Anisakis simplex s.s. larvae were recovered. These results indicate that the diversity of Anisakis species is low in Sardinia waters, probably because of its geographic position.

  20. Transport and dispersal of fish eggs and larvae are important ...

    African Journals Online (AJOL)

    denise

    sume that fish with pelagic eggs and larvae will spawn in upwelling ... might be found in coastal indentations where wind- induced ... Field obser- ... Institute of Marine Research, P.O. Box 1870 Nordnes, N-5817 Bergen, Norway. ...... North America, 1946-71. .... plankton of the Southeast Atlantic (Benguela Current region).

  1. the occurrence of digenean larvae in freshwater snails at mbezi ...

    African Journals Online (AJOL)

    numbers and distribution (spatial and temporal) of snail hosts. Snails could be flushed out of their habitats, thus, affecting prevalence of digenean larvae (see. Jordan et al. 1980). Snail habitats could be obliterated by floods and increased velocity of water current might sweep away the infective stages (miracidia). 61 ...

  2. Growth and Survival of First Feeding Larvae of Clarias gariepinus ...

    African Journals Online (AJOL)

    The percentage increase in length by all the fish followed the same pattern above within a range of 55 – 63.63%. The average daily weight gain of 9.0mg by larvae fed on LZ is significantly higher (P < 0.05) than the weight gains on the rest feed treatments which were however not significantly different from one another.

  3. Gut fluorescence analysis of barnacle larvae: An approach to quantify the ingested food

    Digital Repository Service at National Institute of Oceanography (India)

    Gaonkar, C.A.; Anil, A.C.

    obtained during the pre-monsoon season indicated the ingestion of food sources other than autotrophs. Such differences observed in the feeding behaviour of larvae could be due to differential availability of food for the larvae during different seasons...

  4. Estimation of food limitation of bivalve larvae in coastal waters of north-western Europe

    DEFF Research Database (Denmark)

    Bos, O.G.; Hendriks, I.E.; Strasser, M.

    2006-01-01

    Marine invertebrate recruitment may be affected by food limitation during the pelagic larval life stages. In the present study, field data on abundance of bivalve larvae along with their prey (small phytoplankton) were examined to see whether they were consistent with predictions made...... degrees C indicated maintenance costs of a 200-mu m bivalve larva to be 1.9 x 10(-5) J larva(-1) d(-1), while the maximum assimilation rate, resulting in maximum growth, would amount to 6.2 x 10(-3) J larva(-1) d(-1). Calculation of potential assimilation rates of larvae in the field resulted in estimates...... between 10-5 and 10(-3) J larva(-1) d(-1). Maximum larval concentrations in the field occurred from May to September and ranged between 17 and 392 larvae dm(-3). Most larvae were able to cover their maintenance costs, but not to attain maximum growth rates. Between April and September, the potential...

  5. The method by which Cephenemyia trompe (Modeer larvae invade reindeer (Rangifer tarandus

    Directory of Open Access Journals (Sweden)

    John R. Anderson

    1990-09-01

    Full Text Available Laboratory electrostimulated C. trompe (Modeer females forcefully expelled (sprayed larvae for 5-20 cm. The watery spray consisted of about 20 tiny droplets containing two to several larvae. Crawling first-instar larvae exhibited negative geotactic and phototropic responses; they were subject to rapid desiccation and became immobile as the tiny droplets dried within a few seconds. When 5-50 larvae from dissectedfemales were dropped in physiological saline onto different areas of the muzzle of restrained reindeer, only larvae placed deep within the nostrils and on the lips crawled out-of-sight down the nostril passage or into the mouth. Drops of larvae placed elsewhere quickly desiccated and the larvae became immobile. Larvae deposited by wild females onto a COz-baited reindeer model with the muzzle, lips and nostrils coated with insect trapping adhesive all were stuck only along the dorsal lip below the philtrum. All experimental evidence supports a natural per os mode of invasion.

  6. Aedes aegypti survival in the presence of Toxorhynchites violaceus (Diptera: Culicidae) fourth instar larvae

    National Research Council Canada - National Science Library

    Albeny, Daniel S; Martins, Gustavo F; Andrade, Mateus R; Krüger, Rodrigo F; Vilela, Evaldo F

    2011-01-01

    ... of Toxorhynchites spp. larvae (FOCKS 2007). Toxorhynchites spp. larvae live in natural and artificial water containers and are predators of Culicidae, e.g. Aedes triseriatus (Say, 1823) and Aedes ...

  7. Development of Metarhizium anisopliae and Beauveria bassiana formulations for control of malaria mosquito larvae

    NARCIS (Netherlands)

    Bukhari, S.T.; Takken, W.; Koenraadt, C.J.M.

    2011-01-01

    Background The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana have demonstrated effectiveness against anopheline larvae in the laboratory. However, utilising these fungi for the control of anopheline larvae under field conditions, relies on development of effective means of

  8. Edible insects - species suitable for entomophagy under condition of Czech Republic

    Directory of Open Access Journals (Sweden)

    Martina Bednářová

    2013-01-01

    Full Text Available Since 2002, when the first lecture on entomophagy took place at Mendel University in Brno, till today, participants of these educational lectures were asked to fill questionnaires in order to evaluate interest in entomophagy in Czech Republic and pick suitable species. Analyses of nutritional value of selected species were also performed during this time. The questionnaire was divided into several parts - suitable species, sensory properties, difficulty of breeding and processing and respondents own attitude to the consumption of insect species. For the purpose of this study the questionnaire was evaluated using the semantic differential, so to create a comprehensive picture of each insect species. Based on evaluation of more than 5,000 questionnaires, certain developmental stages of seven species of insect were selected for further evaluation: Tenebrio molitor (TM larvae, Zophobas morio (ZM larvae, Gryllus assimillis (GA nymphs, Locusta migratoria (LM nymphs, Galleria mellonella (GM larvae, Bombyx mori (BM Pupa, Apis mellifera (AM bee brood, while cockroaches were completely excluded for use in entomophagy. Although they are easy to breed and are available all year-round, consumers showed relatively great disgust. For all of these species, basic nutritional values were analysed, as well as content of amino acids and fattty acids. All parameters were statistically evaluated using ANOVA-1. Each species appears to be suitable for entomophagy for a different reason. Generally speaking, AM, TM and GA were best accepted considering the sensory aspect, nutritional values are interesting especially in BM and GM and TM wins with simplicity of its breeding.

  9. Biodegradation and Mineralization of Polystyrene by Plastic-Eating Mealworms: Part 1. Chemical and Physical Characterization and Isotopic Tests.

    Science.gov (United States)

    Yang, Yu; Yang, Jun; Wu, Wei-Min; Zhao, Jiao; Song, Yiling; Gao, Longcheng; Yang, Ruifu; Jiang, Lei

    2015-10-20

    Polystyrene (PS) is generally considered to be durable and resistant to biodegradation. Mealworms (the larvae of Tenebrio molitor Linnaeus) from different sources chew and eat Styrofoam, a common PS product. The Styrofoam was efficiently degraded in the larval gut within a retention time of less than 24 h. Fed with Styrofoam as the sole diet, the larvae lived as well as those fed with a normal diet (bran) over a period of 1 month. The analysis of fecula egested from Styrofoam-feeding larvae, using gel permeation chromatography (GPC), solid-state (13)C cross-polarization/magic angle spinning nuclear magnetic resonance (CP/MAS NMR) spectroscopy, and thermogravimetric Fourier transform infrared (TG-FTIR) spectroscopy, substantiated that cleavage/depolymerization of long-chain PS molecules and the formation of depolymerized metabolites occurred in the larval gut. Within a 16 day test period, 47.7% of the ingested Styrofoam carbon was converted into CO2 and the residue (ca. 49.2%) was egested as fecula with a limited fraction incorporated into biomass (ca. 0.5%). Tests with α (13)C- or β (13)C-labeled PS confirmed that the (13)C-labeled PS was mineralized to (13)CO2 and incorporated into lipids. The discovery of the rapid biodegradation of PS in the larval gut reveals a new fate for plastic waste in the environment.

  10. GC-MS investigation of the chemical composition of honeybee drone and queen larvae homogenate

    OpenAIRE

    Isidorov Valery A.; Bakier Sławomir; Stocki Marcin

    2016-01-01

    Honeybee larva homogenate appears to be underrated and insufficiently explored but this homogenate is an exceptionally valuable honeybee product. Drone larva homogenate is very nutritional due to its high content of proteins, free amino acids, lipids, and carbohydrates. Moreover, the biological characteristics of honeybee larvae indicate the presence of chemical substances that may be pharmacologically active. In spite of the above, the chemical composition of honeybee larva has not gained as...

  11. Interacting Effects of Temperature and Photoperiod on Diapause in Larvae of Monochamus alternatus (Coleoptera : Cerambycidae)

    OpenAIRE

    Katsumi, TOGASHI; Ishikawa Forest Experiment Station:(Present address)Faculty of Integrated Arts and Sciences, Hiroshima University

    1995-01-01

    Fourth-instar, diapause and prediapause Monochamus alternatus larvae were collected from dead Pinus thunbergii trees and their developmental responses to laboratory conditions were investigated in early October. In continuous darkness, diapause was maintained at 25℃, but on incubation at 25℃ after chilling for 121-122 days at 10℃, prediapause larvae averted diapause and diapause larvae terminated diapause. Under a photoperiod of 16L-8D at 25℃, some prediapause larvae averted diapause, and dia...

  12. The potential for ontogenetic vertical migration by larvae of bathyal echinoderms

    OpenAIRE

    Young, Cm; Devin, Mg; Jaeckle, Wb; Ekaratne, Suk; George, Sb

    1996-01-01

    Planktotrophy is a relatively common developmental mode among bathyal and abyssal echinoderms, but the sources of food used by deep-sea planktotrophic larvae remain generally unknown. Very few deep-sea echinoderm larvae have been collected in plankton samples, so we do not know whether larvae migrate to the euphotic zone to feed or if they rely on bacteria or detritus at greater depths. We approached this question indirectly by investigating whether larvae of bathyal echinoids can tolerate th...

  13. Starvation-Induced Dietary Behaviour in Drosophila melanogaster Larvae and Adults

    OpenAIRE

    Muhammad Ahmad; Safee Ullah Chaudhary; Ahmed Jawaad Afzal; Muhammad Tariq

    2015-01-01

    Drosophila melanogaster larvae are classified as herbivores and known to feed on non-carnivorous diet under normal conditions. However, when nutritionally challenged these larvae exhibit cannibalistic behaviour by consuming a diet composed of larger conspecifics. Herein, we report that cannibalism in Drosophila larvae is confined not only to scavenging on conspecifics that are larger in size, but also on their eggs. Moreover, such cannibalistic larvae develop as normally as those grown on sta...

  14. A molt timer is involved in the metamorphic molt in Manduca sexta larvae

    OpenAIRE

    Suzuki, Yuichiro; Koyama, Takashi; Hiruma, Kiyoshi; Riddiford, Lynn M.; Truman, James W.

    2013-01-01

    Manduca sexta larvae are a model for growth control in insects, particularly for the demonstration of critical weight, a threshold weight that the larva must surpass before it can enter metamorphosis on a normal schedule, and the inhibitory action of juvenile hormone on this checkpoint. We examined the effects of nutrition on allatectomized (CAX) larvae that lack juvenile hormone to impose the critical weight checkpoint. Normal larvae respond to prolonged starvation at the start of the last l...

  15. Larval habitat diversity and ecology of anopheline larvae in Eritrea.

    Science.gov (United States)

    Shililu, Josephat; Ghebremeskel, Tewolde; Seulu, Fessahaye; Mengistu, Solomon; Fekadu, Helen; Zerom, Mehari; Ghebregziabiher, Asmelash; Sintasath, David; Bretas, Gustavo; Mbogo, Charles; Githure, John; Brantly, Eugene; Novak, Robert; Beier, John C

    2003-11-01

    Studies on the spatial distribution of anopheline mosquito larvae were conducted in 302 villages over two transmission seasons in Eritrea. Additional longitudinal studies were also conducted at eight villages over a 24-mo period to determine the seasonal variation in anopheline larval densities. Eight anopheline species were identified with Anopheles arabiensis predominating in most of the habitats. Other species collected included: An. cinereus, An. pretoriensis, An. d'thali, An. funestus, An. squamosus, An. adenensis, and An. demeilloni. An. arabiensis was found in five of the six aquatic habitats found positive for anopheline larvae during the survey. Anopheles larvae were sampled predominantly from stream edges and streambed pools, with samples from this habitat type representing 91.2% (n = 9481) of the total anopheline larval collection in the spatial distribution survey. Other important anopheline habitats included rain pools, ponds, dams, swamps, and drainage channels at communal water supply points. Anopheline larvae were abundant in habitats that were shallow, slow flowing and had clear water. The presence of vegetation, intensity of shade, and permanence of aquatic habitats were not significant determinants of larval distribution and abundance. Larval density was positively correlated with water temperature. Larval abundance increased during the wet season and decreased in the dry season but the timing of peak densities was variable among habitat types and zones. Anopheline larvae were collected all year round with the dry season larval production restricted mainly to artificial aquatic habitats such as drainage channels at communal water supply points. This study provides important information on seasonal patterns of anopheline larval production and larval habitat diversity on a countrywide scale that will be useful in guiding larval control operations in Eritrea.

  16. Nutrition and related ontogenetic aspects in larvae of the African catfish, Clarias gariepinus

    NARCIS (Netherlands)

    Verreth, J.

    1994-01-01


    The absence of adequate techniques for rearing fish larvae constitutes a bottleneck for sustainable aquacultural growth. Important constraints are the tiny size of the larvae, the dependance on live food organisms and the developmental stage of the fish larvae. The development

  17. Distribution and seasonal abundance of carangid larvae in the Arabian sea and Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Peter, K.J.; Balachandran, T.

    Carangid larvae were recorded from 8.8% of the International Indian Ocean Expedition (IIOE) stations in the Arabian Sea and 13.2% in the Bay of Bengal. Their total contribution was 1.1% of the total larvae collected. The highest number of larvae...

  18. Predaceous diving beetle, Dytiscus sharpi sharpi (Coleoptera: Dytiscidae) larvae avoid cannibalism by recognizing prey.

    Science.gov (United States)

    Inoda, Toshio

    2012-09-01

    Larvae of diving beetles such as the various Dytiscus species (Coleoptera: Dytiscidae) are carnivorous and usually prey on other aquatic animals. Cannibalism among larvae of Dytiscus sharpi sharpi (Wehncke) was observed to begin when they were starved for more than two days under artificial breeding conditions. However, the 2-day starved larvae did not show cannibalism in the presence of intact, motionless, frozen tadpoles, or frozen shrimps. The beetle larvae attacked and captured intact tadpoles faster (15 sec) than other motionless and frozen tadpoles (120 sec), indicating that prey movement was an important factor in stimulating feeding behavior in larvae. Prey density does not have an effect on larval cannibalism. In cases in which preys are present at lower densities than that of larvae, a group of beetle larvae frequently fed on single prey. This feeding behavior, therefore, provides direct evidence of self-other recognition at the species level. Using two traps in one aquarium that allows the larvae to detect only prey smell, one containing tadpoles and another empty, the beetle larvae were attracted to the trap with tadpoles at high frequency, but not to the empty trap. In another experiment, the beetle larvae were not attracted to the trap containing a beetle larva. These results suggest that the larvae of D. sharpi sharpi are capable of recognizing prey scent, which enables the promotion of foraging behavior and the prevention of cannibalism.

  19. Description of the larva of Triaenodes sp. McLachlan, 1865 ...

    African Journals Online (AJOL)

    ... particular species is at best conjectural. Efforts are ongoing to breed out adult from larva for proper association and determination of the species. Larvae were found in a slow-flowing forested stream, where they were associated with leaf litter accumulations. Keywords: Trichoptera, Leptoceridae, Triaenodes, larva, Nigeria, ...

  20. Dietary potentials of the edible larvae of Cirina forda (westwood) as ...

    African Journals Online (AJOL)

    An experiment was conducted to determine the performance of broiler chicks to the replacement of fishmeal with the larvae of Cirina forda. Three diets, namely Diet A (100% C. forda larvae and 0% Fish meal); Diet B (50% C. forda larvae and 50% Fish meal); and Diet C, which was the control (100% Fish meal and 0% C.

  1. Diet-induced developmental plasticity in life histories and energy metabolism in a beetle La dieta induce plasticidad del desarrollo en los rasgos de historia de vida y metabolismo energético en un escarabajo

    Directory of Open Access Journals (Sweden)

    SERGIO URREJOLA

    2011-12-01

    Full Text Available Adaptive phenotypic plasticity, has been recognized as an important strategy by which organisms maximize fitness in variable environments, which vary through development. A disassociation among stages should represent a null effect of the environment experienced during early ontogeny in the expression of adult traits. Food quality greatly influences survival, development and reproduction in many arthropod herbivores. We examined the effects of diet protein in physiological and life-history traits in the yellow mealworm beetle Tenebrio molitor through ontogeny. We established four experimental treatments: Low Protein (LP, Low Protein Control (LPC, High Protein (HP, and High Protein Control (HPC with recently eclosioned larvae each. Individuals were maintained on the same diet or transferred to the opposite diet for all pupae period and almost all adult period. Contrary to the expected, the duration of life-cycle, larval growth rate and body mass in T. molitor were similar in diet treatments. We found intra-individual trade-offs between environmental diet (rich or poor in protein content during larval phase and egg number. Larvae fed on a protein-deficient diet exhibited significantly higher respiratory rates than larvae fed on a rich protein diet. Compensatory feeding could act in T. molitor larvae indicating differences in metabolism but not in growth rate, body mass and life-cycle characteristics. Our results demonstrate the plasticity of reproductive and metabolic traits and life-cycle characteristics of T. molitor and how changes that occur in relation to diet can have profound effects on progeny and female fitness.La plasticidad fenotípica adaptativa ha sido reconocida como una estrategia importante por el cual los organismos maximizan su adecuación biológica en ambientes variables y la cual varía a lo largo del desarrollo. En los organismos la plasticidad fenotípica generalmente se refiere a como los diferentes tipos de rasgos pueden

  2. Software for pattern recognition of the larvae of Aedes aegypti and Aedes albopictus Programa de computador para reconhecimento da larva de Aedes aegypti e Aedes albopictus

    OpenAIRE

    São Thiago André Iwersen de; Kupek Emil; Ferreira Neto Joaquim Alves; São Thiago Paulo de Tarso

    2002-01-01

    Software for pattern recognition of the larvae of mosquitoes Aedes aegypti and Aedes albopictus, biological vectors of dengue and yellow fever, has been developed. Rapid field identification of larva using a digital camera linked to a laptop computer equipped with this software may greatly help prevention campaigns.Foi desenvolvido um programa de computador para reconhecimento da larva de Aedes aegypti e Aedes albopictus, vetores biológicos de dengue e febre amarela. O programa possibilita rá...

  3. KELIMPAHAN DAN SEBARAN LARVA UDANG PENAEID DI PERAIRAN PEMANGKAT DAN SEKITARNYA

    Directory of Open Access Journals (Sweden)

    Duranta Diandria Kembaren

    2016-05-01

    Full Text Available Penelitian tentang kelimpahan dan sebaran larva udang penaeid di perairan Pemangkat, Kalimantan Barat telah dilakukan pada bulan Mei, Juni, Agustus, Oktober dan Desember 2010. Larva udang ditangkap dengan menggunakan bongo net (larvae net. Berdasarkan hasil identifikasi diperoleh bahwa larva udang penaeid yang terdapat di perairan ini adalah genera Penaeus dan Metapenaeus dengan komposisi masing-masing secara berurutan sebesar 42% dan 58%. Kelimpahan larva udang penaeid ini dominan diperoleh pada bulan Oktober dan mencapai puncaknya pada bulan Desember, sehingga diduga puncak pemijahan udang penaeid di perairan ini terjadi pada bulan Nopember. Hasil sebaran larva udang penaeid menunjukkan bahwa kelimpahan larva udang penaeid paling dominan diperoleh di bagian utara muara sungai Sambas yang merupakan wilayah perairan Jawai. Berdasarkan hasil analisa statistik, diperoleh bahwa kelimpahan larva udang penaeid berkorelasi positif dengan kelimpahan fitoplankton, kecerahan, salinitas, dan pH, sedangkan dengan suhu dan oksigen terlarut berkorelasi negatif. A study on the distribution and abundance of penaeid larvae in Pemangkat waters, West Borneo was conducted on May, June, August, October, and December 2010. Larvae net (bongo net was used to collect the larvae. The result showed that the larvae was dominated by genera Penaeus and Metapenaeus, which the percentage of 42% and 58%, respectively. Penaeid larvae was in higher abundant in October and then reached its peak in December. Based on this result, the spawning peak season of Penaeid shrimps in Pemangkat waters was estimated in November. The distribution of Penaeid larvae was most abundant in the north side of the mouth of Sambas’s river (Jawai waters. The statistical analysis showed that the Penaeid larvae abundance has positive correlation to the phytoplankton abundance, light intensity, salinity, and pH, and has the negative correlation.to the temperature and dissolved oxygen.

  4. Studi Laju Umpan pada Proses Biokonversi Limbah Pengolahan Tuna menggunakan Larva Hermetia illucens

    Directory of Open Access Journals (Sweden)

    Arif Rahman Hakim

    2017-12-01

    Full Text Available Seiring dengan berkembangnya industri tuna, limbah pengolahan yang dihasilkan semakin meningkat. Namun demikian pemanfaatan limbah tersebut belum optimal. Biokonversi bahan organik limbah tuna menjadi biomassa larva sebagai bahan pakan diharapkan mampu mengatasi permasalahan tersebut. Biokonversi menggunakan larva Hermetia illucens atau Black Soldier Fly (BSF memiliki keunggulan dibandingkan proses konversi lain; di antaranya larva BSF mampu mengkonversi berbagai macam bahan organik, memiliki kandungan nutrisi tinggi serta bukan vektor penyakit. Tujuan penelitian ini ialah mempelajari laju umpan larva BSF dalam mengkonversi limbah tuna menjadi biomassa larva. Limbah tuna yang digunakan sebagai umpan larva BSF adalah kepala dan jeroan. Larva dipelihara selama 19 hari dengan pemberian umpan bervariasi (60, 80, 100 mg/larva/hari. Analisa dilakukan terhadap konsumsi umpan, indeks pengurangan limbah (waste reduction index/WRI, efisiensi konversi umpan tercerna (efficiency of conversion of digested-feed/ECD, tingkat kelulusan hidup (survival rates /SR, bobot larva, kandungan protein dan lemak larva. Hasil penelitian menunjukkan kepala dan jeroan tuna dapat digunakan sebagai pakan BSF, dengan nilai SR 41,33 – 98,33%. Laju umpan yang menghasilkan proses biokonversi paling optimum adalah umpan berupa kepala tuna sebesar 60 mg/larva/hari (K60. Nilai parameter pada perlakuan K60 adalah konsumsi umpan 77,09 %, WRI 4,06 % per hari, ECD 8,32 %, bobot larva 72,59 mg dan SR 98,33 %. Limbah berupa kepala tuna menghasilkan konsumsi umpan, WRI, ECD, bobot larva dan SR yang lebih tinggi dibandingkan limbah jeroan tuna. Penggunaan limbah kepala tuna dapat dimanfaatkan untuk mereduksi limbah sekaligus menghasilkan bahan pakan yang potensial. Kandungan larva BSF dengan umpan kepala tuna 60 mg/larva/hari meliputi protein 25,38 %, lemak 6,85 % dan air 62,81 %.

  5. Infestation of a bird and two cats by larvae of Plodia interpunctella (Lepidoptera: Pyralidae).

    Science.gov (United States)

    Pinckney, R D; Kanton, K; Foster, C N; Steinberg, H; Pellitteri, P

    2001-09-01

    The larvae of Plodia interpunctella (Hübner), commonly known as the Indian meal moth, often cause enormous losses in stored food supplies. We present three clinical case reports of accidental infestation by P. interpunctella larvae in two domestic cats and one parakeet. A larva gained entry into the avian host and subsequently migrated to the brain. It was alive, covered with "silk-like" fibers and confirmed to be a fourth instar. Plodia interpunctella larvae were excised with forceps from the subcutaneous tissues of the ear and neck of two cats in a different household. Previous reports of infestation by P. interpunctella larvae in vertebrates are unknown.

  6. Reduction of muscle larvae burden in rats experimentally infected with Trichinella spiralis

    Directory of Open Access Journals (Sweden)

    Machnicka-Rowinska B.

    2001-06-01

    Full Text Available In Wistar rats infected with 500 to 2,500 Trichinella spiralis larvae the muscle larvae intensity (larvae per gram-l.p.g. was measured from 20 to 180 day post infection (d.p.i. The l.p.g. increased to day 40-50 p.i. and decreased thereafter. The highest reduction took place between 6 0 and 120 d.p.i. with intermediate inoculum of T. spiralis larvae. The mechanism of the reduction of T. spiralis larvae in muscles is suggested to depend on pericapsular-intercapsular host cells infiltrations attracted by parasite antigens.

  7. MOLECULAR IDENTIFICATION OF Pseudoterranova azarasi LARVAE IN COD (Gadus sp. SOLD FOR HUMAN CONSUMPTION IN BRAZIL

    Directory of Open Access Journals (Sweden)

    Juliana MARIGO

    2015-12-01

    Full Text Available Anisakiasis and Pseudoterranovosis are human diseases caused by the ingestion of live Anisakidae larvae in raw, undercooked or lightly marinated fish. Larvae were collected from one salted cod sold for human consumption in a Sao Paulo market in 2013. One section of one brownish larva was used for molecular analyses. The partial COX2 gene sequence from the larva had a nucleotide identity of 99.8 % with Pseudoterranova azarasi, which belongs to the Pseudoterranova decipiens species complex. The risk of allergy when consuming dead larvae in salted fish is not well known and should be considered.

  8. Description of the larva of Gynacantha millardi Selys, 1891 (Odonata: Aeshnidae) from Chhattisgarh, India.

    Science.gov (United States)

    Dawn, Prosenjit; Chandra, Kailash

    2016-06-29

    The larva of Gynacantha millardi Selys is described here from female larvae and male and female exuviae collected from Chhattisgarh, India. Unlike other Gynacantha larvae known so far, G. millardi has 7 palpal setae almost equal in length; in other species, the palpal setae are of different lengths. The larvae lack a tooth on each side of the median cleft and have a distinct blunt tooth on the inner margin corner of each labial palp. The larvae were found in a semi-stagnant forest pool with enormous growth of aquatic vegetation.

  9. Comparative study of cultivation of feces in vermiculite or charcoal to obtain larvae of Strongyloides venezuelensis.

    Science.gov (United States)

    Ribeiro, Steveen Rios; Maia, Caroline Ohnesorge; Pereira, Fausto Edmundo Lima; Moreira, Narcisa Imaculada Brant

    2014-01-01

    We compared feces culturing in charcoal or vermiculite to obtain Strongyloides venezuelensis larvae. Feces (5 g) from infected rats was mixed with vermiculite (10 g) or coal (10 g) in plastic cups and incubated at 28°C for 48 h. Larvae were recovered using Baermann-Moraes method. Significantly higher number of positive larval cultures were recovered from vermiculite than from charcoal (15/17 and 4/17, respectively; p < 0.001; 990.6 ± 307.5 and 215 ± 78.1 larvae, p = 0.027). Vermiculite yields more larvae and provides cleaner pellets, improving larvae identification and facilitating their use for other purposes.

  10. Morphological and molecular characterization of Anisakis larvae (Nematoda: Anisakidae) in Beryx splendens from Japanese waters.

    Science.gov (United States)

    Murata, Rie; Suzuki, Jun; Sadamasu, Kenji; Kai, Akemi

    2011-06-01

    The third-stage (L3) larvae of Anisakis, which are the etiological agents of human anisakiasis, have been categorized morphologically into Anisakis Type I larvae and Anisakis Type II larvae. Genetic analysis has allowed easy identification of these larvae: Anisakis Type I larvae include the species Anisakis simplex sensu stricto, Anisakis pegreffii, Anisakis simplex C, Anisakis typica, Anisakis ziphidarum, and Anisakis nascettii, whereas Anisakis Type II larvae include the species Anisakis physeteris, Anisakis brevispiculata, and Anisakis paggiae. Since human consumption of raw fish and squid is common in Japan, we investigated Anisakis L3 larvae in 44 specimens of Beryx splendens from Japanese waters. A total of 730 Anisakis L3 larvae collected from B. splendens were divided morphologically into 4 types: Type I, Type II, and 2 other types that were similar to Anisakis Type III and Type IV described by Shiraki (1974). Anisakis Type II, Type III, and Type IV larvae all had a short ventriculus, but their tails were morphologically different. In addition, data from genetic analysis indicated that Anisakis Type II, Type III, and Type IV larvae could be identified as A. physeteris, A. brevispiculata, and A. paggiae, respectively. Therefore, A. physeteris, A. brevispiculata, and A. paggiae can be readily differentiated not only by genetic analysis but also by morphological characteristics of L3 larvae. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  11. Enhanced ammonia content in compost leachate processed by black soldier fly larvae.

    Science.gov (United States)

    Green, Terrence R; Popa, Radu

    2012-03-01

    Black soldier fly (BSF) larvae (Hermetia illucens), feeding on leachate from decaying vegetable and food scrap waste, increase ammonia (NH (4) (+) ) concentration five- to sixfold relative to leachate unprocessed by larvae. NH (4) (+) in larva-processed leachate reached levels as high as ∼100 mM. Most of this NH (4) (+) appears to have come from organic nitrogen within the frass produced by the larvae as they fed on leachate. In nitrate-enriched solutions, BSF larvae also facilitate dissimilatory nitrate reduction to ammonia. The markedly higher concentration of NH (4) (+) recovered in leachates processed with BSF larvae and concomitant diversion of nutrients into insect biomass (itself a valuable feedstock) indicate that the use of BSF larvae in processing leachate of decaying organic waste could be advantageous in offsetting capital and environmental costs incurred in composting.

  12. Microvascular system forming in skeletal muscle near trichinella larvae

    Energy Technology Data Exchange (ETDEWEB)

    Berzentsev, Y.A.; Oksov, I.V.

    1986-09-01

    The fine structure and dynamics of formation of the microcirculatory system about the larvae of the two Trichinella species, providing for the rapid entry of nutrient substances to the larvae, were investigated in the muscles of white mice. Hitological, hitochemical, autoradiographic, and electron-microscopic methods were used in the investigation. At a certain period of the experiment, the greatest quantity of RNA was found in the endotheliocyte cytoplasm, tritium-thymidine label was incorporated into the nuclei, and mitoses were visible. The transition to tissue parasitism was accompanied by a complication of the relationships with the host and the formation of a more complex independent microcirculatory system, which ensures a more intensive influx of blood.

  13. Development of a two photon microscope for tracking Drosophila larvae

    Science.gov (United States)

    Karagyozov, Doycho; Mihovilovic Skanata, Mirna; Gershow, Marc

    Current in vivo methods for measuring neural activity in Drosophila larva require immobilization of the animal. Although we can record neural signals while stimulating the sensory organs, we cannot read the behavioral output because we have prevented the animal from moving. Many research questions cannot be answered without observation of neural activity in behaving (freely-moving) animals. We incorporated a Tunable Acoustic Gradient (TAG) lens into a two-photon microscope to achieve a 70kHz axial scan rate, enabling volumetric imaging at tens of hertz. We then implemented a tracking algorithm based on a Kalman filter to maintain the neurons of interest in the field of view and in focus during the rapid three dimensional motion of a free larva. Preliminary results show successful tracking of a neuron moving at speeds reaching 500 μm/s. NIH Grant 1DP2EB022359 and NSF Grant PHY-1455015.

  14. EFFICACY OF THAI NEEM OIL AGAINST AEDES AEGYPTI (L.) LARVAE.

    Science.gov (United States)

    Silapanuntakul, Suthep; Keanjoom, Romnalin; Pandii, Wongdyan; Boonchuen, Supawadee; Sombatsiri, Kwanchai

    2016-05-01

    Trees with larvicidal activity may be found in Thailand. We conducted this study to evaluate the efficacy and length of efficacy of Thai neem (Azadirachta siamensis) oil emulsion and an alginate bead of Thai neem oil formulation against early fourth stage Aedes aegypti larvae using a dipping test. The Thai neem oil emulsion had significantly greater larvicidal activity than the alginate bead formulation at 12 to 60 hours post-exposure (p neem oil formulation resulted in 100% mortality among the early fourth stage Aedes aegypti larvae at 48 hours, while the alginate bead formulation resulted in 98% larval mortality at 84 hours and 100% mortality at 96 hours. The mean larval mortality using the Thai neem oil emulsion dropped to < 25% by 12 days and with the alginate beads dropped to < 25% by 15 days of exposure.

  15. Aquaculture and feeding ecology: Feeding behaviour in turbot larvae

    DEFF Research Database (Denmark)

    Bruno, Eleonora

    capture success. This thesis is part of a large international project aimed at improving the rearing techniques of high value fish species larvae fed with calanoid copepods, their natural prey, to achieve high levels of survival and quality. In fact, fish aquaculture is becoming increasingly important......The period of first feeding, characterized by the shift from internal (yolk-sac) to external food sources, is considered particularly critical for the survival of marine fish, but the underlying causes are still unknown. The larval stage, characterized by high mortality rates, is particularly...... challenging for larval rearing. After the start of exogenous feeding, another intense and likely critical period of change occurs in the early life stages of fish. This stage is the metamorphosis, during which the larvae transform organs and body morphology to become juveniles. Compared to other teleosts...

  16. Citrus Seed Oils Efficacy against Larvae ofAedes aegypti.

    Science.gov (United States)

    Bilal, Hazrat; Akram, Waseem; Hassan, Soaib Ali; Din, Sadrud

    2017-09-01

    Dengue fever is a serious public health issue in Pakistan for many years. Globally plants have been reported to contain compounds with insecticidal properties. These properties have been demonstrated more recently on the larval stages of mosquitoes. Therefore, Citrus cultivar seeds were evaluated for larvicidal potential against the primary dengue vector Aedes aegypti . Extraction of oil was done by a steam distillation method and oils were evaluated according to WHO guidelines for larvicides 2005 for evaluation of insecticidal properties of citrus seed extracts against mosquito larvae. Among the Citrus cultivar seed oil, rough lemon ( Citrus jambhiri ) had the lowest LC 50 value (200.79ppm), while musambi ( C. sinensis var musambi ) had the highest LC 50 value (457.30ppm) after 24 h of exposure. Citrus cultivars have some larvicidal potential but C. jambhiri had the greatest potential against A. aegypti larvae. Further small-scale field trials using the extracts of C. jambhiri will be conducted to determine operational feasibility.

  17. Bed bugs, leeches and hookworm larvae in the skin.

    Science.gov (United States)

    Heukelbach, Jorg; Hengge, Ulrich R

    2009-01-01

    Bed bugs, leeches, and hookworm-related cutaneous larva migrans are skin infestations that are usually considered of minor importance because they produce discomfort rather than cause or transmit disease. Bed bugs have been increasing tremendously in high-income countries in recent years, causing distress to affected individuals and economic loss. Infestation by land leeches causes mainly unpleasant skin reactions, whereas infestation by aquatic leeches may be more dangerous, leading to anemia and in severe cases, to death. Cutaneous larva migrans produces an intense pruritus that can be exasperating for the patient and cause sleep disturbance. An overview is given of these three infestations with a discussion of the causative agents, transmission, clinical manifestations, diagnosis, and treatment.

  18. Suscetibilidade de larvas de Culex quinquefasciatus a diferentes inseticidas

    Directory of Open Access Journals (Sweden)

    Stênio Nunes Alves

    2011-08-01

    Full Text Available INTRODUÇÃO: O presente estudo teve como objetivo avaliar a suscetibilidade de larvas de Culex quinquefasciatus a dois piretróides (Cipermetrina e Deltametrina, dois derivados da Avermectina (ivermectina e abamectina e a um organofosforado (Temefós. MÉTODOS: Larvas de 3º e 4º instares de C. quinquefasciatus foram expostas a diferentes concentrações destes (onze repetições seguindo o protocolo da Organização Mundial de Saúde. Uma hora após a exposição, as larvas foram lavadas em água desclorada, transferidas para recipientes plásticos contendo água sem cloro, alimentadas e observadas por períodos de 24h, até se transformarem em adultos. Para a determinação das concentrações letais, os valores foram submetidos à análise de regressão usando o modelo probit pelo programa Minitab 15. RESULTADOS: Diferenças entre as estimativas da CL50 e CL90 justificaram que a população de mosquitos testada apresenta heterogeneidade em resposta aos inseticidas, sendo a maior concentração utilizada para a CL50, a partir da análise de probit para o Temefós. Todos os inseticidas avaliados causaram mortalidade mais acentuada nas primeiras 24h exceto quando expostas à ivermectina. CONCLUSÕES: As larvas são suscetíveis a todos os inseticidas testados e há uma necessidade de um monitoramento dos inseticidas utilizados.

  19. Maya Index and Larva Density Aedes Aegypti Toward Dengue Infection

    Directory of Open Access Journals (Sweden)

    Sang G. Purnama

    2012-12-01

    Full Text Available South Denpasar District was of there as with the highest dengue cases in Bali province. The number of mosquito breeding places and larvae density become risk factor that influenced the spreading of mosquitoes. Maya index was an indicator to measure the amount of waterreservoirs can be breeding places for mosquitoes. Knowing the relationship between maya index and density of larvae and pupae of Ae.aegypti toward dengue infection in South Denpasar District. The study was observational analytic with case-control design. Data was collected through interviews and field observations to 150 respondents. The survey entomologist with indicators maya index, house index (HI, container index (CI, breteau index (BI and pupa index (PI to see the density of larvae and pupae in survey area. Dengue transmission risk was categorized mild, moderate and severe based on density figure. Water storage containers inspected in 1215 containers that as many as 675 containers in the case and 540 containers in control. Water reservoirs (TPA that the most larvae was tub (29.27%, dispenser (18.29%, container tirta (10.98%, wells (10.98%. Maya index status was lower in the case (24% smaller thancontrols (37.33%. Value of HI = 23.33; CI=10.69; BI=55; PI=15.33. Based on HI and CI indicator South Denpasar District means have moderate the risk of transmission spread of dengue disease. Based on the BI, have a high risk of transmission to the spread of dengue disease. Based on the maya index showed house cases have highest risk as breeding place compare than control house. House index, Breteau index, container index, pupa index and maya index have correlation with dengue infection. Kind of breeding place have the high risk is bath tub

  20. The larvae of some blowflies of medical and veterinary importance.

    Science.gov (United States)

    Erzinclioglu, Y Z

    1987-04-01

    Diagnostic features are described as a series of couplets that enable separation of the third instar larvae of the following pairs of closely related forms of blowflies of medical and veterinary importance: Chrysomya chloropyga (Wiedemann) and Ch.putoria (Wiedemann), Chrysomya albiceps (Wiedemann) and Ch.rufifacies (Macquart), Cochliomyia hominivorax (Coquerel) and Co.macellaria (Fabricius), Lucilia sericata (Mergen) and L. cuprina (Wiedemann), Calliphora augur (Fabricius) and C. stygia (Fabricius).

  1. Salinity tolerance of larvae of African catfish Clarias gariepinus ( ) X ...

    African Journals Online (AJOL)

    Fourteen and twenty one day larvae were exposed to abrupt stepwise change in salinity (2, 4, 6, 8, 10 and 12 ppt) for 96 hours to determine mortality, median lethal mortality, MLS and median lethal time, MLT. The fourteen day-old fry that were exposed to 0 – 6 ppt recorded 90%, 87.5% 77.5% and 10% survival at the end of ...

  2. Cockchafer larvae smell host root scents in soil.

    Directory of Open Access Journals (Sweden)

    Sonja Weissteiner

    Full Text Available In many insect species olfaction is a key sensory modality. However, examination of the chemical ecology of insects has focussed up to now on insects living above ground. Evidence for behavioral responses to chemical cues in the soil other than CO(2 is scarce and the role played by olfaction in the process of finding host roots below ground is not yet understood. The question of whether soil-dwelling beetle larvae can smell their host plant roots has been under debate, but proof is as yet lacking that olfactory perception of volatile compounds released by damaged host plants, as is known for insects living above ground, occurs. Here we show that soil-dwelling larvae of Melolontha hippocastani are well equipped for olfactory perception and respond electrophysiologically and behaviorally to volatiles released by damaged host-plant roots. An olfactory apparatus consisting of pore plates at the antennae and about 70 glomeruli as primary olfactory processing units indicates a highly developed olfactory system. Damage induced host plant volatiles released by oak roots such as eucalyptol and anisol are detected by larval antennae down to 5 ppbv in soil air and elicit directed movement of the larvae in natural soil towards the odor source. Our results demonstrate that plant-root volatiles are likely to be perceived by the larval olfactory system and to guide soil-dwelling white grubs through the dark below ground to their host plants. Thus, to find below-ground host plants cockchafer larvae employ mechanisms that are similar to those employed by the adult beetles flying above ground, despite strikingly different physicochemical conditions in the soil.

  3. Tropical dermatology: cutaneous larva migrans, gnathostomiasis, cutaneous amebiasis and trombiculiasis.

    Science.gov (United States)

    Eichelmann, Kristian; Tomecki, Kenneth J; Martínez, José Darío

    2014-09-01

    In today's world, many people can travel easily and quickly around the globe. Most travel travel-related illnesses include fever, diarrhea, and skin disease, which are relatively uncommon in returning travelers. We review four of the most common emerging infestations and skin infections in the Americas, which are important to the clinical dermatologist, focusing on the clinical presentation and treatment of cutaneous larva migrans, gnathostomiasis, cutaneous amebiasis, and trombiculiasis.

  4. Using black soldier fly larvae for processing organic leachates.

    Science.gov (United States)

    Popa, Radu; Green, Terrence R

    2012-04-01

    A large number of biodegradable byproducts including alcohols, soluble saccharides, volatile organic acids, and amines accumulate in the liquid fraction (leachate) produced as vegetal and food scrap waste decomposes. Untreated leachate, because it is rich in nutrients and organic byproducts, has a high chemical oxygen demand and is normally cleared of soluble organic byproducts by mineralization before its discharge into waterways. Mineralizing leachates using chemical and microbial biotechnologies is, however, a lengthy and costly process. We report here that the larvae of the black soldier fly Hermetia illucens (L.) (Diptera: Stratiomyidae), an insect rich in protein and lipids, and having significant commercial value, while feeding and growing off of compost leachate, lowers its chemical oxygen demand relative to that of leachate unexposed to larvae, neutralizes its acidity, and clears it of volatile organic acids, amines, and alcohols. These observations demonstrate that black soldier fly larvae could be used to help offset the cost and clean up of organic solutes in leachate waste streams while recycling carbon, nitrogen, and phosphate into usable and commercially valuable biomass.

  5. Macroevolutionary interplay between planktic larvae and benthic predators

    Science.gov (United States)

    Peterson, Kevin J.

    2005-12-01

    Many marine invertebrates have a complex life cycle in which the egg develops into an intermediate planktic larval form rather than developing directly to the benthic juvenile stage. Because of the evolutionary and ecological complexity of pelagic-benthic life cycles, the reasons behind the origin of larvae and their subsequent maintenance over geological time are not well understood. Using both a molecular clock and the fossil record, I show that the initial exploitation of the predator-free pelagic realm by lecithotrophic larvae was achieved independently multiple times by the end of the Early Cambrian, and that the convergent evolution of planktotrophy from lecithotrophic ancestors evolved between the latest Cambrian and Middle Ordovician at least four, and possibly as many as eight, times. Both the exploitation of the pelagic realm by nonfeeding larvae and the acquisition of planktotrophy correlate in time with novel modes of benthic predation, including the dramatic rise in the number and type of epifaunal suspension feeders in the Early Ordovician.

  6. Observations of cocooned Hydrobaenus (Diptera: Chironomidae) larvae in Lake Michigan

    Science.gov (United States)

    Tucker, Taaja R.; Hudson, Patrick L.; Riley, Stephen

    2016-01-01

    Larvae of the family Chironomidae have developed a variety of ways to tolerate environmental stress, including the formation of cocoons, which allows larvae to avoid unfavorable temperature conditions, drought, or competition with other chironomids. Summer cocoon formation by younger instars of the genus Hydrobaenus Fries allows persistence through increased temperatures and/or intermittent dry periods in arid regions or temporary habitats, but this behavior was not observed in the Great Lakes until the current study. Cocoon-aestivating Hydrobaenus sp. larvae were found in benthic grab samples collected in 2010–2013 near Sleeping Bear Dunes National Lakeshore in northern Lake Michigan with densities up to 7329/m2. The aestivating species was identified as Hydrobaenus johannseni (Sublette, 1967), and the associated chironomid community was typical for an oligotrophic nearshore system. Hydrobaenus cocoon formation in the Great Lakes was likely previously unnoticed due to the discrepancies between the genus' life history and typical benthos sampling procedures which has consequences for describing chironomid communities where Hydrobaenus is present.

  7. Riceland mosquito management practices for Anopheles quadrimaculatus larvae.

    Science.gov (United States)

    Allen, R A; Wilkes, W W; Lewis, C N; Meisch, M V

    2008-12-01

    Two separate but related studies were conducted regarding management of Anopheles quadrimaculatus larval populations in commercial rice fields near Cleveland, MS, in 2004. Study 1 was to evaluate the effectiveness of 2 treatments of aerially applied ultra-low volume applications of Bacillus thuringiensis var. israelensis (Bti) against An. quadrimaculatus larvae in dense, high-canopy mid- to late-season rice crop. Study 2 was to investigate the effect of preflood treatments of lambda-cyhalothrin (Karate), which is commonly used against rice water weevil (Lissorhoptrus oryzophilus), on An. quadrimaculatus larvae. Excellent initial, but short residual control (>99% control 1 day after treatment) was observed in the Bti-treated fields in both mid- and late-season rice. Little or no effect on mosquito larvae was observed in the lambda-cyhalothrin-treated fields. Results indicate that Bti can be effectively used by mosquito management personnel to control larval populations of An. quadrimaculatus in late-season rice fields; however, lambda-cyhalothrin did not effectively control larval An. quadrimaculatus when applied preflood to rice fields.

  8. Genetic constraints and sexual dimorphism in immune defense

    DEFF Research Database (Denmark)

    Rolff, Jens; Armitage, Sophie Alice Octavia; Coltman, David W.

    2005-01-01

    : a common genetic architecture constrains the response to selection on a trait subjected to sexually asymmetric selection pressures. Here we show that males and females of the mealworm beetle Tenebrio molitor differ in the quantitative genetic architecture of four traits related to immune defense...

  9. Terminal investment in multiple sexual signals

    DEFF Research Database (Denmark)

    Nielsen, Mattias Lange; Holman, Luke

    2012-01-01

    examples of such facultative terminal investment are known. 2. In the mealworm beetle, Tenebrio molitor, males"odours become more attractive to females following a life-threatening immune challenge. However, the pheromones involved are unknown, hindering further insight into the proximate mechanisms...

  10. Factitious foods to reduce production costs of beneficial insects

    Science.gov (United States)

    This article reports the use of factitious foods such as Tenebrio molitor pupa, E. kuehniella eggs, Ephestia eggs, and or Artemia franciscana eggs for the rearing of beneficial insect such as Podisus maculiventris, spined soldier bug and several ladybird predators belonging to the Coccinellidae fam...

  11. A Novel 43-kDa Protein as a Negative Regulatory Component of Phenoloxidase-induced Melanin Synthesis

    National Research Council Canada - National Science Library

    Mingyi Zhao; Irene Söderhäll; Ji Won Park; Young Gerl Ma; Tsukusa Osaki; Nam-Chul Ha; Chun Fu Wu; Kenneth Söderhäll; Bok Luel Lee

    2005-01-01

    ...(s) of melanin synthesis may exist in hemolymph. Here, we report the purification and cloning of a cDNA of a novel 43-kDa protein, from the meal-worm Tenebrio molitor , which functions as a melanization-inhibiting protein (MIP...

  12. Extraction and characterisation of protein fractions from five insect species

    NARCIS (Netherlands)

    Yi, L.; Lakemond, C.M.M.; Sagis, L.M.C.; Eisner-Schadler, V.R.; Huis, van A.; Boekel, van M.A.J.S.

    2013-01-01

    Tenebrio molitor, Zophobas morio, Alphitobius diaperinus, Acheta domesticus and Blaptica dubia were evaluated for their potential as a future protein source. Crude protein content ranged from 19% to 22% (Dumas analysis). Essential amino acid levels in all insect species were comparable with soybean

  13. Insect lipid profile: aqueous versus organic solvent-based extraction methods

    NARCIS (Netherlands)

    Tzompa Sosa, D.A.; Yi, L.; Valenberg, van H.J.F.; Boekel, van M.A.J.S.; Lakemond, C.M.M.

    2014-01-01

    In view of future expected industrial bio-fractionation of insects, we investigated the influence of extraction methods on chemical characteristics of insect lipids. Lipids from Tenebrio molitor, Alphitobius diaperinus, Acheta domesticus and Blaptica dubia, reared in the Netherlands, were extracted

  14. Low cost production of nematodes for biological control of insect pests

    Science.gov (United States)

    Entomopathogenic nematodes are produced in two ways: in artificial media using liquid or solid fermentation methods (in vitro) or by mass producing insect hosts to be artificially exposed to mass infection by nematodes (in vivo). The yellow mealworm (Tenebrio molitor) is a good host for in vivo nema...

  15. Optimization of a host diet for in vivo production of entomopathogenic nematodes

    Science.gov (United States)

    In previous studies, we developed an improved diet for Tenebrio molitor, a host that is used for in vivo nematode production, and we demonstrated that single insect diet components (e.g., lipids and proteins) can have a positive or negative impact on entomopathogenic nematode fitness and quality. I...

  16. Enzyme immunoassay measurements of ecdysteroids in the last ...

    African Journals Online (AJOL)

    CLICK CAMPUS

    2012-03-08

    Mar 8, 2012 ... Tenebrio molitor. (Insecta, Coleoptera). Gen. Comp. Endocrinol. 35: 436-444. Dhadialla TS, Ross R (2007). Bisacylhydrazines: novel chemistry for insect control. In: Modern crop protection compounds. Kramer W,. Schirmer U (eds), Wiley-VCH, Weinheim, Germany. pp. 773-796. Dhadialla TS, Retnakaran A ...

  17. Control of insects with fumigants at low temperatures: toxicity of mixtures of methyl bromide and acrylonitrile to three species of insects

    Energy Technology Data Exchange (ETDEWEB)

    Bond, E.J.; Buckland, C.T.

    1976-12-15

    Acrylonitrile can be mixed with methyl bromide to increase toxicity so that the quantity of methyl bromide required for control of Sitophilus granarius (L.), Tenebrio molitor L., and Tribolium confusum Jacquelin duval is reduced by one half. Mixtures of methyl bromide and acrylonitrile are considerably more effective at low temperatures than methyl bromide alone.

  18. Activité biologique d'un agoniste non stéroïdien de l'hormone de ...

    African Journals Online (AJOL)

    Tenebrio molitor. Phytoparasitica., Vol. 34 (2), 2006, p. 187-196. [12] H. Berghiche, G. Smagghe, S. Van. De Velde, N. Soltani, In vitro cultures of pupal integumental explants to bioassay insect growth regulators with ecdysteroid activity for ecdysteroid amounts and cuticle secretion. African Journal of. Agricultural Research.

  19. Mechanized Packing and Delivery System for Entomopathogenic Nematodes in Infected Mealworm Cadavers

    Science.gov (United States)

    This document describes a mechanized system to pack mealworm (Tenebrio molitor) cadavers infected with entomopathogenic nematodes between two sheets of masking tape. The document is also an operation manual for the machine and provides all the machine specifications, and wiring and pneumatic diagram...

  20. Development and functional morphology of the mouthparts and foregut in larvae and post-larvae of Macrobrachium jelskii (Decapoda: Palaemonidae).

    Science.gov (United States)

    Rocha, Cristina Pantoja; Souza, Adelson Silva de; Maciel, Murilo; Maciel, Cristiana R; Abrunhosa, Fernando Araújo

    2016-05-01

    The morphology of the mouthparts and foregut of the larvae and post-larvae of Macrobrachium jelskii was investigated to determine their functional roles in feeding, in order to understand the larval feeding behaviour and the changes that occur during its development. The mouthparts and foregut of the zoea I and II are morphologically similar, rudimentary and non-functional in feeding. Only in the final larval stage, zoea III, do the external mouthparts and foregut become structurally more complex and thus likely to play a potential role in feeding. Two behavioral trials (point of no return, point of reserve saturation) evaluated the resistance to starvation in zoea I, II, and III. The results indicate that they have sufficient nutritional reserves to permit them to complete metamorphosis without feeding. Overall, our results suggest that the zoea I and II of Macrobrachium jelskii engage in obligate lecithotrophy and zoea III in facultative lecithotrophy. Copyright © 2016 Elsevier Ltd. All rights reserved.