Enantiomerization and enantioselective bioaccumulation of metalaxyl in Tenebrio molitor larvae.
Gao, Yongxin; Wang, Huili; Qin, Fang; Xu, Peng; Lv, Xiaotian; Li, Jianzhong; Guo, Baoyuan
2014-02-01
The enantiomerization and enantioselective bioaccumulation of metalaxyl by a single dose of exposure to Tenebrio molitor larvae under laboratory condition were studied by high-performance liquid chromatography tandem mass spectroscopy (HPLC-MS/MS) based on a ChiralcelOD-3R [cellulosetris-tris-(3, 5-dichlorophenyl-carbamate)] column. Exposure of enantiopure R-metalaxyl and S-metalaxyl in Tenebrio molitor larvae exhibited significant enantiomerization, with formation of the R enantiomers from the S enantiomers, and vice versa, which might be attributed to the chiral pesticide catalyzed by a certain enzyme in Tenebrio molitor larvae. Enantiomerization was not observed in wheat bran during the period of 21 d. In addition, bioaccumulation of rac-metalaxyl in Tenebrio molitor larvae was enantioselective with a preferential accumulation of S-metalaxyl. These results showed that enantioselectivity was caused not only by actual degradation and metabolism but also by enantiomerization, which was an important process in the environmental fate and behavior of metalaxyl enantiomers. Copyright © 2013 Wiley Periodicals, Inc.
Enantioselective bioaccumulation of diniconazole in Tenebrio molitor larvae.
Liu, Chen; LV, Xiao Tian; Zhu, Wen Xue; QU, Hao Yang; Gao, Yong Xin; Guo, Bao Yuan; Wang, Hui Li
2013-12-01
The enantioselective bioaccumulation of diniconazole in Tenebrio molitor Linne larva was investigated with liquid chromatography tandem mass spectrometry based on the ChiralcelOD-3R[cellulose tri-(3,5-dimethylphenyl carbamate)] column. In this study we documented the effects of dietary supplementation with wheat bran contaminated by racemic diniconazole at two dose levels of 20 mg kg(-1) and 2 mg kg(-1) (dry weight) in Tenebrio molitor. The results showed that both doses of diniconazole were taken up by Tenebrio molitor rapidly in the first few days, the concentrations of R-enantiomer and S-enantiomer at high doses reached the highest level of 0.55 mg kg(-1) and 0.48 mg kg(-1) , respectively, on the 1(st) d, and the concentrations of them obtained a maxima of 0.129 mg kg(-1) and 0.128 mg kg(-1) at low dose, respectively, on the 3(rd) d, which means that the concentration of diniconazole was proportional to the time of achieving the highest accumulated level. It afterwards attained equilibrium after a sharp decline at both 20 mg kg(-1) and 2 mg kg(-1) of diniconazole. The determination results from the feces of Tenebrio molitor demonstrated that the extraction recovery (ER) values of the high dose group were higher than that of the low dose group and the values were all above 1; therefore, it could be inferred that enantiomerization existed in Tenebrio molitor. Additionally, the biota accumulation factor was used to evaluate the bioaccumulation of diniconazole enantiomers, showing that the bioaccumulation of diniconazole in Tenebrio molitor was enantioselective with preferential accumulation of S-enantiomer. © 2013 Wiley Periodicals, Inc.
Enantiomerization and stereoselectivity in bioaccumulation of furalaxyl in Tenebrio molitor larvae.
Yin, Jing; Gao, Yongxin; Zhu, Feilong; Hao, Weiyu; Xu, Qi; Wang, Huili; Guo, Baoyuan
2017-11-01
Furalaxyl is a chiral pesticide and widely used in modern agriculture as racemate mixture. The enantiomerization and enantioselecive bioaccumulation by a single dose of furalaxyl to Tenebrio molitor larvae under laboratory conditions were studied using a high-performance liquid chromatography tandem mass spectroscopy method based on a ChiralPAK IC column. Our results showed that a significant enantiomerization (interconversion between R-enantiomer and S-enantiomer) was observed in Tenebrio molitor larvae under R- or S-furalaxyl exposure. Though the two furalaxyl enantiomers exhibited low-capacity of bioaccumulation in Tenebrio molitor larvae, bioaccumulation of rac-furalaxyl was enantioselective with a preferential accumulation of S-furalaxyl at 10mg/kg dosage exposure. In addition, enantiomerization and enantioselective degradation of the two enantiomers was not observed in wheat bran. These results showed that enantioselectivtiy of furalaxyl enantiomers was an important process combined with degradation, metabolism and enatiomerization in organisms. Copyright © 2017 Elsevier Inc. All rights reserved.
Rapid bioassay to screen potential biopesticides in Tenebrio molitor larvae
A simplified assay was devised to evaluate the response of Tenebrio molitor larvae to potential insect control products. The assay incorporates punched disks of flattened whole-grain bread placed in 96-well plates, with treatments applied topically, and neonate larvae added to each well. To evalua...
Trealose e trealase em tenebrio molitor L Trehalose and Trehalase in Tenebrio molitor L
Directory of Open Access Journals (Sweden)
Cristina Piedras Lopes
1972-01-01
Full Text Available Foi estudada a concentração em trealose e a atividade em trealase do Tenebrio molitor L. durante as tres fases da metamorfose (larva, ninfa, imago. Verificou-se que na larva e no adulto os valores são mais elevados conforme a curva da fig. 3. A trealose foi expressa em mg/g de Tenebrio e a trealose por µg de glicose/mg proteina.Trehalose and trehalase were determined in the Tenebrio molitor L., using larva, pupa and imago. A total number of 895 animals was analyzed. A growth curve up to the end of the larval stage was established (Fig. 1 and compared with the normal one obtained by Fraenkel. It was shown that trehalose and trehalase are more concentrated in the larva and imago presenting a curve with two arms as depicted in the Fig. 3. Trehalase was expressed in mg/g of Tenebrio and trehalase in µg of glucose /mg proteín.
Lv, Xiaotian; Liu, Chen; Li, Yaobin; Gao, Yongxin; Wang, Huili; Li, Jianzhong; Guo, Baoyuan
2014-09-01
Stereoselectivity in bioaccumulation and excretion of stereoisomers of epoxiconazole by mealworm beetle (Tenebrio molitor) larvae through dietary exposure was investigated. Liquid chromatography tandem mass spectrometry (HPLC-MS/MS) method that use a ChiralcelOD-3R[cellulosetris-Tris-(3, 5-dichlorophenyl-carbamate)] chromatography column was applied to carry out chiral separation of the stereoisomers. Wheat bran was spiked with racemic epoxiconazole at two dose levels of 20mg/kg and 2mg/kg (dry weight) to feed T. molitor larvae. The results showed that both the doses of epoxiconazole were taken up by Tenebrio molitor larvae rapidly at the initial stages. There was a significant trend of stereoselective bioaccumulation in the larvae with a preferential accumulation of (-)-epoxiconazole in the 20mg/kg dose. The stereoselectivity in bioaccumulation in the 2mg/kg dosage was not obvious compared to the 20mg/kg group. Results of excretion indicated an active excretion is an important pathway for the larvae to eliminate epoxiconazole which was a passive transport process with non stereoselectivity. The faster elimination might be the reason for the low accumulation of epoxiconazole, as measured by bioaccumulation factor (BAF). Copyright © 2014 Elsevier Inc. All rights reserved.
Dipeptidyl peptidase 4 – an important digestive peptidase in Tenebrio molitor larvae
Dipeptidyl peptidase 4 (DPP 4) is a proline specific serine peptidase that plays an important role in different regulatory processes in mammals. In this report, we isolated and characterized a unique secreted digestive DPP 4 from the anterior midgut of a stored product pest, Tenebrio molitor larvae ...
[Effects of fermented cattle dung on the growth and development of Tenebrio molitor larvae].
Zeng, Xiang-Wei; Wang, Xia; Guo, Li-Yue; Zhan, Li-Jie; Bo, Wen-Jing; Li, Zhan; Wu, Guang-Lei; Jiang, Gao-Ming
2012-07-01
In order to make use of and industrialize the animal dung from large cattle farms, this paper explored the feasibility of using Tenebrio molitor to digest and utilize cattle dung. Cattle dung was mixed with the conventional feed (65% wheat bran, 30% corn flour, and 5% bean pulp) of T. molitor in definite proportions, and fermented with effective microorganisms (EM). The fermented products containing 60% and 80% of cattle dung (FD1 and FD2, respectively) were selected to feed T. molitor larvae, and the effects of the fermented products on the growth curve, death rate, pupation rate, and antioxidant system of the larvae were compared. Compared with CK (conventional deed), the FD1 made the developmental duration of the larvae prolonged by 10 days and the larvae's death rate upraised somewhat, but made the single larva's total food intake, average body mass, crude fat content, and ratio of unsaturated to saturated fat acids increased by 49%, 28%, 26%, and 32%, respectively (P molitor larvae had weak adaptability to FD2. Our findings suggested that using FD1 to feed the 3rd instar of T. molitor larvae would have good practical prospects in industrializing cattle dung.
A digestive prolyl carboxypeptidase in Tenebrio molitor larvae.
Goptar, Irina A; Shagin, Dmitry A; Shagina, Irina A; Mudrik, Elena S; Smirnova, Yulia A; Zhuzhikov, Dmitry P; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N
2013-06-01
Prolyl carboxypeptidase (PRCP) is a lysosomal proline specific serine peptidase that also plays a vital role in the regulation of physiological processes in mammals. In this report, we isolate and characterize the first PRCP in an insect. PRCP was purified from the anterior midgut of larvae of a stored product pest, Tenebrio molitor, using a three-step chromatography strategy, and it was determined that the purified enzyme was a dimer. The cDNA of PRCP was cloned and sequenced, and the predicted protein was identical to the proteomic sequences of the purified enzyme. The substrate specificity and kinetic parameters of the enzyme were determined. The T. molitor PRCP participates in the hydrolysis of the insect's major dietary proteins, gliadins, and is the first PRCP to be ascribed a digestive function. Our collective data suggest that the evolutionary enrichment of the digestive peptidase complex in insects with an area of acidic to neutral pH in the midgut is a result of the incorporation of lysosomal peptidases, including PRCP. Published by Elsevier Ltd.
Regulatory effects of Tenebrio molitor Linnaeus on immunological ...
African Journals Online (AJOL)
This paper describes the results of experiments to test the effect of the larvae of Tenebrio molitor Linnaeus on the immune systems of mice. Mice were given a decoction of T. molitor in water at doses of 1.87, 3.75 and 7.50 g/kg/d for four weeks, after which their immune function was studied. The results indicate that T. molitor ...
Lv, Xiaotian; Liu, Chen; Li, Yaobin; Gao, Yongxin; Guo, Baoyuan; Wang, Huili; Li, Jianzhong
2013-12-01
The bioaccumulation and excretion of enantiomers of myclobutanil in Tenebrio molitor larvae through dietary exposure under laboratory conditions were investigated using high-performance liquid chromatography tandem mass spectrometry (HPLC-MS/MS) based on a ChiralcelOD-3R [cellulosetris-tris-(3, 5-dichlorophenyl-carbamate)] column. The wheat bran fed to Tenebrio molitor larvae was spiked with racemic myclobutanil at two dose levels of 20 mg/kg and 2 mg/kg (dry weight). The results showed that there was a significant trend of enantioselective bioaccumulation in the larvae with a preferential accumulation of (-)-myclobutanil in 20 mg/kg dose exposure, but it was not obviously observed in the 2 mg/kg dose group. A kinetic model considering enantiomerization between the two enantiomers based on first-order reactions was built and the rate constants were estimated to discuss the kinetic reason for the different concentrations of individual enantiomers in the larvae. The approximations implied an inversion between the two enantiomers with a relatively higher rate of the inversion from (-)-myclobutanil to (+)-myclobutanil. Meanwhile, analysis of data of excretion samples suggested the active excretion is probably an important pathway for the insect to eliminate myclobutanil rapidly with nonenantioselectivity as a passive transport process, which was consistent with the low accumulation efficiency of myclobutanil measured by BAF (bioaccumulation factor). © 2013 Wiley Periodicals, Inc.
Physical and catalytic properties of alpha-amylase from Tenebrio molitor L. larvae.
Buonocore, V; Poerio, E; Silano, V; Tomasi, M
1976-01-01
The amylase from Tenebrio molitor L. larvae (yellow mealworm) was characterized according to a number of its molecular and catalytic properties. The insect amylase is a single polypeptide chain with mol.wt. 68000, an isoelectric point of 4.0 and a very low content of sulphur-containing amino acids. The enzyme is a Ca2+-protein and behaves as an alpha-amylase. Removal of Ca2+ by exhaustive dialysis against water causes the irreversible inactivation of the enzyme. Moreover, the enzyme is activated by the presence in the assay mixture of Cl-, or some other inorganic anions that are less effective than Cl-, and is inhibited by F-. Optimal conditions of pH and temperature for the enzymic activity are 5.8 and 37 degrees C. The insect amylase exhibits an identical kinetic behaviour toward starch, amylose and amylopectin; the enzyme hydrolyses glycogen with a higher affinity constant. Compared with the non-insect alpha-amylases described in the literature, Tenebrio molitor amylase has a lower affinity for starch. PMID:942374
Han, So-Ri; Yun, Eun-Young; Kim, Ji-Young; Hwang, Jae Sam; Jeong, Eun Ju; Moon, Kyoung-Sik
2014-01-01
The larval form of Tenebrio molitor (T. molitor) has been eaten in many countries and provides benefits as a new food source of protein for humans. However, no information exists regarding its safety for humans. The objective of the present study was to evaluate the genotoxicity and repeated dose oral toxicity of the freeze-dried powder of T. molitor larvae. The genotoxic potential was evaluated by a standard battery testing: bacterial reverse mutation test, in vitro chromosome aberration tes...
Seo, Minchul; Kim, Jongwan; Moon, Seong-Su; Hwang, Jae-Sam; Kim, Mi-Ae
2017-08-01
We recently reported the in vitro and in vivo antiobesity effects of Tenebrio molitor larvae, a traditional food in many countries, but it remains unknown how the larvae affect appetite regulation in mice with diet-induced obesity. We hypothesized that the extract of T molitor larvae mediates appetite by regulating neuropeptide expression. We investigated T molitor larvae extract's (TME's) effects on anorexigenesis and endoplasmic reticulum (ER) stress-induced orexigenic neuropeptide expression in the hypothalami of obese mice. Intracerebroventricular TME administration suppressed feeding by down-regulating the expression of the orexigenic neuropeptides neuropeptide Y and agouti-related protein. T molitor larvae extract significantly reduced the expression of ER stress response genes. These results suggest that TME and its bioactive components are potential therapeutics for obesity and ER stress-driven disease states. Copyright © 2017 Elsevier Inc. All rights reserved.
Gao, Yongxin; Chen, Jinhui; Wang, Huili; Liu, Chen; Lv, Xiaotian; Li, Jianzhong; Guo, Baoyuan
2013-09-25
The enantiomerization and enatioselecive bioaccumulation of benalaxyl by dietary exposure to Tenebrio molitor larvae under laboratory conditions were studied by HPLC-MS/MS. Exposure of enantiopure R-benalaxyl and S-benalaxyl in T. molitor larvae revealed significant enantiomerization with formation of the R enantiomers from the S enantiomers, and vice versa. Enantiomerization was not observed in wheat bran during the period of 21 days. For the bioaccumulation experiment, the enantiomer fraction in T. molitor larvae was maintained approximately at 0.6, whereas the enantiomer fraction in wheat bran was maintained at 0.5; in other words, the bioaccumulation of benalaxyl was enantioselective in T. molitor larvae. Mathematical models for a process of uptake, degradation, and enantiomerization were developed, and the rates of uptake, degradation, and enantiomerization of R-benealaxyl and S-benealaxyl were estimated, respectively. The results were that the rate of uptake of R-benalaxyl (kRa = 0.052 h(-1)) was slightly lower than that of S-benalaxyl (kSa = 0.061 h(-1)) from wheat bran; the rate of degradation of R-benalaxyl (kRd = 0.285 h(-1)) was higher than that of S-benalaxyl (kSd = 0.114 h(-1)); and the rate of enantiomerization of R-benalaxyl (kRS = 0.126 h(-1)) was higher than that of S-benalaxyl (kSR = 0.116 h(-1)). It was suggested that enantioselectivtiy was caused not only by actual degradation and metabolism but also by enantiomerization, which was an important process in the environmental fate and behavior of chiral pesticides.
DEFF Research Database (Denmark)
Andersen, Svend Olav
2002-01-01
Proteins extracted from the cuticle of pharate larvae and pupae of the mealworm Tenebrio molitor are more soluble at low temperatures than at higher temperatures, a behaviour characteristic of hydrophobic proteins. When the temperature of an unfractionated cuticular extract is raised from 4 to 25...... undergo plasticization during and/or immediately after ecdysis....
Tang, Yujiao; Debnath, Trishna; Choi, Eun-Ju; Kim, Young Wook; Ryu, Jung Pyo; Jang, Sejin; Chung, Sang Uk; Choi, Young-Jin; Kim, Eun-Kyung
2018-01-01
Tenebrio molitor (T. molitor) larvae provide food at low environmental cost and contribute positively to livelihoods. In this research, we compared the amino acids compositions and antioxidant activities of various extracts of T. molitor to enhance their quality as food. For the comparison, distilled water extracts, enzymatic hydrolysates, and condensed enzymatic hydrolysates of T. molitor larvae were prepared. Their amino acids (AAs) profiles and antioxidant activities, including ferric-reducing antioxidant power, oxygen radical absorption capacity, and DPPH, hydroxyl radical, and hydrogen peroxide radical scavenging properties assay were analyzed. DW extracts had the lowest AAs contents and antioxidant activity compared with enzymatic extracts. Condensed hydrolysates with a combination of alcalase and flavourzyme (C-A+F) exhibited the highest levels of total free AAs (11.1759 g/100 g). C-A+F produced higher total hydrolyzed AAs (32.5292 g/100 g) compared with the other groups. The C-A+F possessed the strongest antioxidant activity. Notably, the antioxidant activities of the hydrolysates and the total hydrolyzed AAs amount were correlated. Taken together, our findings showed that C-A+F was a promising technique for obtaining extracts of T. molitor larvae with antioxidant activity as potential nutritious functional food.
Latney, La'Toya V; Toddes, Barbara D; Wyre, Nicole R; Brown, Dorothy C; Michel, Kathryn E; Briscoe, Johanna A
2017-02-01
OBJECTIVE To evaluate whether the nutritive quality of Tenebrio molitor larvae and Zophobas morio larvae, which are commonly cultured as live food sources, is influenced by 4 commercially available diets used as nutritional substrates; identify which diet best improved calcium content of larvae; and identify the feeding time interval that assured the highest calcium intake by larvae. ANIMALS 2,000 Zophobas morio larvae (ie, superworms) and 7,500 Tenebrio molitor larvae (ie, mealworms). PROCEDURES Larvae were placed in control and diet treatment groups for 2-, 7-, and 10-day intervals. Treatment diets were as follows: wheat millings, avian hand feeding formula, organic avian mash diet, and a high-calcium cricket feed. Control groups received water only. After treatment, larvae were flash-frozen live with liquid nitrogen in preparation for complete proximate and mineral analyses. Analyses for the 2-day treatment group were performed in triplicate. RESULTS The nutrient composition of the high-calcium cricket feed groups had significant changes in calcium content, phosphorus content, and metabolizable energy at the 2-day interval, compared with other treatment groups, for both mealworms and superworms. Calcium content and calcium-to-phosphorus ratios for larvae in the high-calcium cricket feed group were the highest among the diet treatments for all treatment intervals and for both larval species. CONCLUSIONS AND CLINICAL RELEVANCE A 2-day interval with the high-calcium cricket feed achieved a larval nutrient composition sufficient to meet National Research Council dietary calcium recommendations for nonlactating rats. Mealworm calcium composition reached 2,420 g/1,000 kcal at 48 hours, and superworm calcium composition reached 2,070g/1,000 kcal at 48 hours. These findings may enable pet owners, veterinarians, insect breeders, and zoo curators to optimize nutritive content of larvae fed to insectivorous animals.
Tenebrio molitor L. (Coleoptera: Tenebrionidae) larva ve pupasının yağ asidi bileşimi
TAŞKIN, Deniz; AKSOYLAR, M. Yaşar
2010-01-01
Fatty acid compositions of last instar larvae and pupae of Tenebrio molitor were analysed by gas chromatographic methods. It was determined that total fatty acid compositions of both stages were contituted C12:0-C18:2 fatty acids. Oleic acid was found as the major fatty acid. Palmitic and linoleic acids also were high pencentage fatty acids.
Directory of Open Access Journals (Sweden)
José Cola Zanuncio
2005-09-01
Full Text Available Reproduction and longevity of Supputius cincticeps (Stål (Heteroptera: Pentatomidae fed on Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae or Musca domestica (L. (Diptera: Muscidae larvae were studied during two generations at 24.7 ± 1.1ºC, 70 ± 10% R.H. and 12 h of photophase. Body weight of newly-emerged adults, oviposition period, number of egg masses, total number of eggs and longevity of S. cincticeps were higher when fed on Z. confusa or T. molitor larvae than on M. domestica larvae. Regardless of diet, S. cincticeps showed better reproduction and longevity in the second generation in laboratory conditions.Foram avaliadas, em duas gerações, a reprodução e a longevidade de Supputius cincticeps (Stål (Heteroptera: Pentatomidae alimentado com larvas de Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae ou Musca domestica (L. (Diptera: Muscidae a 24,7 ± 1,1ºC, 70 ± 10% de U.R. e fotofase de 12 h. O peso de adultos recém emergidos, o período de oviposição, o número de posturas, de ovos totais e a longevidade de fêmeas de S. cincticeps foram maiores com larvas de Z. confusa ou T. molitor que com M. domestica. Independentemente do tipo de presa, S. cincticeps mostrou melhor performance reprodutiva e longevidade na segunda geração.
SUSURLUK, Alper
2014-01-01
The efficiency of the entomopathogenic nematodes Steinernema feltiae Tur-S3 and Heterorhabditis bacteriophora Tur-H2, isolated in Turkey, against larvae of Tenebrio molitor L. was investigated in different soil type and temperature conditions. Sterilized and non-sterilized silver sand, clay-loam soil, and compost soil were tested, each at 12, 18, and 24 ºC. Temperature had the greatest effect on the mortality of T. molitor larvae caused by both nematode species. The efficiency of the 2 nemato...
Directory of Open Access Journals (Sweden)
Harley Nonato de Oliveira
2004-10-01
Full Text Available Ninfas de Podisus nigrispinus (Heteroptera: Pentatomidae têm sido criadas em laboratório com larvas de Tenebrio molitor L. (Coleoptera: Tenebrionidae. No entanto, não existem relatos sobre a predação, no campo ou em laboratório, de P. nigrispinus em Spodoptera frugiperda (Lepidoptera: Noctuidae, uma das principais pragas de inúmeras culturas no Brasil. Este trabalho teve o objetivo de avaliar o desenvolvimento ninfal e características reprodutivas do percevejo predador P. nigrispinus em lagartas de S. frugiperda e em larvas de T. molitor, em laboratório. A presa S. frugiperda proporcionou ao predador menor longevidade, maior produção e viabilidade de ovos do que as larvas de T. molitor. Esses resultados demonstram que a lagarta S. frugiperda melhora as características reprodutivas de P. nigrispinus, de forma que a sua utilização como presa alternativa pode servir para incrementar a produção massal desse inimigo natural.Nymphys of Podisus nigrispinus (Heteroptera: Pentatomidae have been reared on Tenebrio molitor L. (Coleoptera: Tenebrionidae, in laboratory conditions. However, there are no reports on P. nigrispinus predation, in field or laboratory, on Spodoptera frugiperda (Lepidoptera: Noctuidae, one of the most damaging pests in crops in Brazil. This research had the objective to evaluate nymphal development and reproductive characteristics of the predator P. nigrispinus when reared on caterpillars of S. frugiperda and on larvae of T. molitor, in laboratory conditions. S. frugiperda provided a smaller longevity, higher egg production and viability to predator than T. molitor. The nutricional quality of this caterpillar improves the reproductive characteristics of the predator, so that its utilization as factitious host can increase mass production of this natural enemy.
Dipeptidyl peptidase 4 - An important digestive peptidase in Tenebrio molitor larvae.
Tereshchenkova, Valeriia F; Goptar, Irina A; Kulemzina, Irina A; Zhuzhikov, Dmitry P; Serebryakova, Marina V; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N
2016-09-01
Dipeptidyl peptidase 4 (DPP 4) is a proline specific serine peptidase that plays an important role in different regulatory processes in mammals. In this report, we isolated and characterized a unique secreted digestive DPP 4 from the anterior midgut of a stored product pest, Tenebrio molitor larvae (TmDPP 4), with a biological function different than that of the well-studied mammalian DPP 4. The sequence of the purified enzyme was confirmed by mass-spectrometry, and was identical to the translated RNA sequence found in a gut EST database. The purified peptidase was characterized according to its localization in the midgut, and substrate specificity and inhibitor sensitivity were compared with those of human recombinant DPP 4 (rhDPP 4). The T. molitor enzyme was localized mainly in the anterior midgut of the larvae, and 81% of the activity was found in the fraction of soluble gut contents, while human DPP 4 is a membrane enzyme. TmDPP 4 was stable in the pH range 5.0-9.0, with an optimum activity at pH 7.9, similar to human DPP 4. Only specific inhibitors of serine peptidases, diisopropyl fluorophosphate and phenylmethylsulfonyl fluoride, suppressed TmDPP 4 activity, and the specific dipeptidyl peptidase inhibitor vildagliptin was most potent. The highest rate of TmDPP 4 hydrolysis was found for the synthetic substrate Arg-Pro-pNA, while Ala-Pro-pNA was a better substrate for rhDPP 4. Related to its function in the insect midgut, TmDPP 4 efficiently hydrolyzed the wheat storage proteins gliadins, which are major dietary proteins of T. molitor. Published by Elsevier Ltd.
Involvement of phenoloxidase in browning during grinding of Tenebrio molitor larvae.
Directory of Open Access Journals (Sweden)
Renske H Janssen
Full Text Available Insects are investigated as alternative protein source to meet the increasing demand for proteins in the future. Enzymatic browning occurring during grinding of insect and subsequent extraction of proteins can influence the proteins' properties, but it is unclear which enzymes are responsible for this phenomenon. This study was performed on larvae of three commonly used insect species, namely Tenebrio molitor, Alphitobius diaperinus and Hermetia illucens. Oxygen consumption measurements on protein extracts showed activity on L-tyrosine, L-3,4-di-hydroxy-phenylalanine (L-DOPA and L-dopamine, indicating phenoloxidase as a key player in browning. Furthermore, no reaction on 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid was observed, ruling out an important contribution of laccase to browning. The browning reaction was most prominent at pH 6 for T. molitor and A. diaperinus, and 7 for H. illucens. As the enzyme activity of H. illucens was the lowest with the darkest color formation, this was likely caused by another factor. The activity of phenoloxidase was confirmed for T. molitor and A. diaperinus by activity measurements after fractionation by anion-exchange chromatography. Color measurements showed the presence of activity on both L-DOPA and L-tyrosine in the same fractions. Both substrates were converted into dopachrome after incubation with enzyme-enriched fractions. No DOPA-decarboxylase, tyrosine hydroxylase and peroxidase activities were observed. By using native PAGE with L-DOPA as staining-solution, active T. molitor protein bands were resolved and characterized, identifying a tyrosinase/phenoloxidase as the active enzyme species. All together, these data confirmed that tyrosinase is an important enzyme in causing enzymatic browning in T. molitor and likely in A. diaperinus.
Involvement of phenoloxidase in browning during grinding of Tenebrio molitor larvae.
Janssen, Renske H; Lakemond, Catriona M M; Fogliano, Vincenzo; Renzone, Giovanni; Scaloni, Andrea; Vincken, Jean-Paul
2017-01-01
Insects are investigated as alternative protein source to meet the increasing demand for proteins in the future. Enzymatic browning occurring during grinding of insect and subsequent extraction of proteins can influence the proteins' properties, but it is unclear which enzymes are responsible for this phenomenon. This study was performed on larvae of three commonly used insect species, namely Tenebrio molitor, Alphitobius diaperinus and Hermetia illucens. Oxygen consumption measurements on protein extracts showed activity on L-tyrosine, L-3,4-di-hydroxy-phenylalanine (L-DOPA) and L-dopamine, indicating phenoloxidase as a key player in browning. Furthermore, no reaction on 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) was observed, ruling out an important contribution of laccase to browning. The browning reaction was most prominent at pH 6 for T. molitor and A. diaperinus, and 7 for H. illucens. As the enzyme activity of H. illucens was the lowest with the darkest color formation, this was likely caused by another factor. The activity of phenoloxidase was confirmed for T. molitor and A. diaperinus by activity measurements after fractionation by anion-exchange chromatography. Color measurements showed the presence of activity on both L-DOPA and L-tyrosine in the same fractions. Both substrates were converted into dopachrome after incubation with enzyme-enriched fractions. No DOPA-decarboxylase, tyrosine hydroxylase and peroxidase activities were observed. By using native PAGE with L-DOPA as staining-solution, active T. molitor protein bands were resolved and characterized, identifying a tyrosinase/phenoloxidase as the active enzyme species. All together, these data confirmed that tyrosinase is an important enzyme in causing enzymatic browning in T. molitor and likely in A. diaperinus.
A new method to refine existing dietary supplements for improving production of the yellow mealworm, Tenebrio molitor L. (Coleoptera: Tenebrionidae), was tested. Self selected ratios of 6 dietary ingredients by T. molitor larvae were used to produce a dietary supplement. This supplement was compared...
Gut microbiota of Tenebrio molitor and their response to environmental change.
Jung, Jaejoon; Heo, Aram; Park, Yong Woo; Kim, Ye Ji; Koh, Hyelim; Park, Woojun
2014-07-01
A bacterial community analysis of the gut of Tenebrio molitor larvae was performed using pyrosequencing of the 16S rRNA gene. A predominance of genus Spiroplasma species in phylum Tenericutes was observed in the gut samples, but there was variation found in the community composition between T. molitor individuals. The gut bacteria community structure was not significantly affected by the presence of antibiotics or by the exposure of T. molitor larvae to a highly diverse soil bacteria community. A negative relationship was identified between bacterial diversity and ampicillin concentration; however, no negative relationship was identified with the addition of kanamycin. Ampicillin treatment resulted in a reduction in the bacterial community size, estimated using the 16S rRNA gene copy number. A detailed phylogenetic analysis indicated that the Spiroplasma-associated sequences originating from the T. molitor larvae were distinct from previously identified Spiroplasma type species, implying the presence of novel Spiroplasma species. Some Spiroplasma species are known to be insect pathogens; however, the T. molitor larvae did not experience any harmful effects arising from the presence of Spiroplasma species, indicating that Spiroplasma in the gut of T. molitor larvae do not act as a pathogen to the host. A comparison with the bacterial communities found in other insects (Apis and Solenopsis) showed that the Spiroplasma species found in this study were specific to T. molitor.
Morphometric analysis of instar variation in Tenebrio molitor (Coleoptera: Tenebrionidae)
Measurements of head capsule, mandible, metanotum, and body weight were done on larvae of Tenebrio molitor L. (Coleoptera: Tenebrionide) from the second to the last instar. Instar number varied from 14 to 18, but 15 or 16 instars were the most common. The value of dimensional measurements was evalua...
Morales-Ramos, J A; Rojas, M G; Shapiro-Ilan, D I; Tedders, W L
2011-10-01
We studied the ability of Tenebrio molitor L. (Coleoptera: Tenebrionidae) to self-select optimal ratios of two dietary components to approach nutritional balance and maximum fitness. Relative consumption of wheat bran and dry potato flakes was determined among larvae feeding on four different ratios of these components (10, 20, 30, and 40% potato). Groups of early instars were provided with a measured amount of food and the consumption of each diet component was measured at the end of 4 wk and again 3 wk later. Consumption of diet components by T. molitor larvae deviated significantly from expected ratios indicating nonrandom self-selection. Mean percentages of dry potato consumed were 11.98, 19.16, 19.02, and 19.27% and 11.89, 20.48, 24.67, and 25.97% during the first and second experimental periods for diets with 10, 20, 30, and 40% potato, respectively. Life table analysis was used to determine the fitness of T. molitor developing in the four diet mixtures in a no-choice experiment. The diets were compared among each other and a control diet of wheat bran only. Doubling time was significantly shorter in groups consuming 10 and 20% potato than the control and longer in groups feeding on 30 and 40% potato. The self-selected ratios of the two diet components approached 20% potato, which was the best ratio for development and second best for population growth. Our findings show dietary self-selection behavior in T. molitor larvae, and these findings may lead to new methods for optimizing dietary supplements for T. molitor.
Han, So-Ri; Yun, Eun-Young; Kim, Ji-Young; Hwang, Jae Sam; Jeong, Eun Ju; Moon, Kyoung-Sik
2014-06-01
The larval form of Tenebrio molitor (T. molitor) has been eaten in many countries and provides benefits as a new food source of protein for humans. However, no information exists regarding its safety for humans. The objective of the present study was to evaluate the genotoxicity and repeated dose oral toxicity of the freeze-dried powder of T. molitor larvae. The genotoxic potential was evaluated by a standard battery testing: bacterial reverse mutation test, in vitro chromosome aberration test, and in vivo micronucleus test. To assess the repeated dose toxicity, the powder was administered once daily by oral gavage to Sprague-Dawley (SD) rats at dose levels of 0, 300, 1000 and 3000 mg/kg/day for 28 days. The parameters which were applied to the study were mortality, clinical signs, body and organ weights, food consumption, ophthalmology, urinalysis, hematology, serum chemistry, gross findings and histopathologic examination. The freezedried powder of T. molitor larvae was not mutagenic or clastogenic based on results of in vitro and in vivo genotoxicity assays. Furthermore, no treatment-related changes or findings were observed in any parameters in rats after 28 days oral administration. In conclusion, the freeze-dried powder of T. molitor larvae was considered to be non-genotoxic and the NOAEL (No Observed Adverse Effect Level) was determined to be 3000 mg/kg/day in both sexes of SD rats under our experimental conditions.
Han, So-Ri; Yun, Eun-Young; Kim, Ji-Young; Hwang, Jae Sam; Jeong, Eun Ju
2014-01-01
The larval form of Tenebrio molitor (T. molitor) has been eaten in many countries and provides benefits as a new food source of protein for humans. However, no information exists regarding its safety for humans. The objective of the present study was to evaluate the genotoxicity and repeated dose oral toxicity of the freeze-dried powder of T. molitor larvae. The genotoxic potential was evaluated by a standard battery testing: bacterial reverse mutation test, in vitro chromosome aberration test, and in vivo micronucleus test. To assess the repeated dose toxicity, the powder was administered once daily by oral gavage to Sprague-Dawley (SD) rats at dose levels of 0, 300, 1000 and 3000 mg/kg/day for 28 days. The parameters which were applied to the study were mortality, clinical signs, body and organ weights, food consumption, ophthalmology, urinalysis, hematology, serum chemistry, gross findings and histopathologic examination. The freezedried powder of T. molitor larvae was not mutagenic or clastogenic based on results of in vitro and in vivo genotoxicity assays. Furthermore, no treatment-related changes or findings were observed in any parameters in rats after 28 days oral administration. In conclusion, the freeze-dried powder of T. molitor larvae was considered to be non-genotoxic and the NOAEL (No Observed Adverse Effect Level) was determined to be 3000 mg/kg/day in both sexes of SD rats under our experimental conditions. PMID:25071922
Seo, Minchul; Goo, Tae-Won; Chung, Mi Yeon; Baek, Minhee; Hwang, Jae-Sam; Kim, Mi-Ae; Yun, Eun-Young
2017-02-28
Despite the increasing interest in insect-based bioactive products, the biological activities of these products are rarely studied adequately. Larvae of Tenebrio molitor , the yellow mealworm, have been eaten as a traditional food and provide many health benefits. Therefore, we hypothesized that T. molitor larvae might influence adipogenesis and obesity-related disorders. In the present study, we investigated the anti-adipogenic and antiobesity effects of T. molitor larvae in vitro and in vivo. The lipid accumulation and triglyceride content in mature adipocytes was reduced significantly (up to 90%) upon exposure to an ethanol extract of T. molitor larvae, without a reduction in cell viability. Exposure also resulted in key adipogenic and lipogenic transcription factors. Additionally, in adipogenic differentiation medium the extract induced phosphorylation of adenosine monophosphate (AMP)-activated protein kinase and mitogen-activated protein kinases. Daily oral administration of T. molitor larvae powder to obese mice fed high-fat diet attenuated body weight gain. We also found that the powder efficiently reduced hepatic steatosis as well as aspartate and alanine transaminase enzyme levels in mice fed a high-fat diet. Our results suggest that T. molitor larvae extract has an antiobesity effect when administered as a food supplement and has potential as a therapeutic agent for obesity.
Directory of Open Access Journals (Sweden)
Minchul Seo
2017-02-01
Full Text Available Despite the increasing interest in insect-based bioactive products, the biological activities of these products are rarely studied adequately. Larvae of Tenebrio molitor, the yellow mealworm, have been eaten as a traditional food and provide many health benefits. Therefore, we hypothesized that T. molitor larvae might influence adipogenesis and obesity-related disorders. In the present study, we investigated the anti-adipogenic and antiobesity effects of T. molitor larvae in vitro and in vivo. The lipid accumulation and triglyceride content in mature adipocytes was reduced significantly (up to 90% upon exposure to an ethanol extract of T. molitor larvae, without a reduction in cell viability. Exposure also resulted in key adipogenic and lipogenic transcription factors. Additionally, in adipogenic differentiation medium the extract induced phosphorylation of adenosine monophosphate (AMP-activated protein kinase and mitogen-activated protein kinases. Daily oral administration of T. molitor larvae powder to obese mice fed high-fat diet attenuated body weight gain. We also found that the powder efficiently reduced hepatic steatosis as well as aspartate and alanine transaminase enzyme levels in mice fed a high-fat diet. Our results suggest that T. molitor larvae extract has an antiobesity effect when administered as a food supplement and has potential as a therapeutic agent for obesity.
Directory of Open Access Journals (Sweden)
Eduardo B. Beserra
1995-09-01
Full Text Available Egg viability and nymphal development of the predatory bug Supputius cincticeps (Stål, 1860 were evaluated during two generations in the Biological Control Laboratory of the Núcleo de Biotecnologia Aplicada à Agropecuária (Bioagro/UFV in Viçosa (Minas Gerais, Brazil at 24.72±1.10ºC and photophase of 12 hours. Three treatments were represented by S. cincticeps fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 and Musca domestica Linnaeus, 1758 larvae. Higher egg viability of this predator was found when the preys were Z. confusa and T. molitor, 74.46% and 80.91 %, than in M. domestica, 57.02%, but incubation period showed no differences between preys. Shorter nymphal development and higher nymphal viability were found with Z. confusa and T. molitor than with M. domestica. Higher weight increase was found for nymphs which originated males and females in the second generation specialy with the first two preys.
Directory of Open Access Journals (Sweden)
V. O. Martynov
2017-08-01
Full Text Available The broad spectrum of negative effects of food additives and surfactants on living organisms and the environment in general indicate a necessity of a detailed study on this issue. The aim of this article is to evaluate the impact of food additives and surfactants in a concentration of 350 mg/kg of fodder on the body weight of third age Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae larvae. A significant change in the body weight of T. molitor larvae was observed when they consumed a diet containing 350 mg/kg of sodium glutamate, sodium cyclamate and sodium benzoate. We observed a tendency towards increase in body weight after addition of the food colouring Allura Red, saccharin, benzoic acid, betaine, emulsifying wax, AOS and SLES, and also we observed a decrease in body weight after addition of Tartrazine and Indigo Carmine in the same concentration. Out of the 18 tested food additives, 3 significantly stimulated an increase in the body weight of third age T. molitor larvae, and 3 manifested the same effect at the level of tendency (stimulated an increase in mass on average by 43–58% over the 14-day experiment, and 2 caused decrease in the body weight of larvae. Also, the 4 studied surfactants manifested a tendency towards increase in the body weight of T. molitor. This study on the impact of food additives and surfactants on organisms of insects is of great significance for protecting rare species of insects.
The studies on waste biodegradation by Tenebrio molitor
Directory of Open Access Journals (Sweden)
Bożek Magdalena
2017-01-01
Full Text Available As cities are growing in size with a rise in the population, the amount of plastic waste generated is increasing and becoming unmanageable. The treatment and disposal of plastic waste is an urgent need of our present and future. It has been proved recently that mealworms, the larvae of Tenebrio molitor Linnaeus, are able eat styrofoam, a common polystyrene product. Polystyrene is one of the most widely used plastics, the scale of its production being several million tons per year. Tenebrio molitor is one of the largest pests found in stored-grain products. The insect is indigenous to Europe, but is currently cosmopolitan in distribution. The styrofoam is efficiently degraded in the larval gut by microorganisms. We have used the larvae of T. molitor to biodegrade three types of food packaging plastics: polystyrene (PS, polyvinyl chloride (PVC and polylactide (PLA. PVC is a thermoplastic made of 57% chlorine (derived from industrial grade salt and 43% carbon (derived predominantly from oil /gas via ethylene. It is the world's third-most widely produced synthetic plastic polymer, which is not biodegradable easily. On the other hand, PLA is an easily biodegradable and bioactive thermoplastic aliphatic polyester derived from corn and tapioca starch or sugarcane. Three groups of larvae were fed selected types of polymers as an only food, while a control population was fed on oatmeal. The mass loss, dry matter content and biochemical composition of mealworms were assessed in the performed laboratory experiments. The protein concentration in homogenates of the larvae was determined by the Bradford method. To determine the level of hydrolized carbohydrates we used anthrone method. The classical sulfo-phospho-vanillin assay (SPVA was used to quantitate total lipids in mealworms. The results allowed to compare the decomposition efficiency of selected polymer materials by mealworms and to recognize the mechanism of decomposition contributing to the future
Directory of Open Access Journals (Sweden)
А. К. Гулевский
2016-11-01
Full Text Available The molecular-mass distribution of peptides from supernatants, obtained from the tissues of larvae Tenebrio molitor and goldfish Carassius auratus during cold acclimation, has been determined by chromatography. The results showed that peptide spectrum of the supernatants from larvae T. molitor and C. auratus varied during cold acclimation. The supernatants from non-acclimated larvae of T. molitor and deacclimated fish possessed the highest number of peptide fractions. Furthermore, the cold-acclimated larvae of T. molitor had the peptide fractions of the low molecular weight (ca. 5.4×102 ÷22.6×102 Da, and non-acclimated insects had the peptides of the high molecular weight (ca. 46.8×102÷66×102 Da. Next, the organ-specific changes of the peptide composition of the goldfish during winter deacclimation have been revealed. Specifically, the low molecular weight peptides (ca. (14.1 ± 0.3×102 and (6.75 ± 0.25×102 Da, have been detected in the C. auratus muscles, and both the high (ca. (67.83 ± 0.21×102 ( ca. 64.16 ± 0.26×102 Da and low (ca. (34.1 ± 1.0×102 and (14.29 ± 0.15×102 Da molecular weight peptides have been detected in the liver. Quantitative and qualitative changes in the peptide spectra from supernatants of the T. molitor and C. auratus during cold acclimation could be one of the mechanisms of their natural adaptation to low temperatures.
Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis
2012-01-01
Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence dataset for T. molitor
Directory of Open Access Journals (Sweden)
Brenda Oppert
Full Text Available Bacillus thuringiensis (Bt crystal (Cry proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence
Beserra, Eduardo B.; Zanuncio, Teresinha V.; Zanuncio, José C.; Santos, Germi P.
1995-01-01
Egg viability and nymphal development of the predatory bug Supputius cincticeps (Stål, 1860) were evaluated during two generations in the Biological Control Laboratory of the Núcleo de Biotecnologia Aplicada à Agropecuária (Bioagro/UFV) in Viçosa (Minas Gerais, Brazil) at 24.72±1.10ºC and photophase of 12 hours. Three treatments were represented by S. cincticeps fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 and Musca domestica Linnaeus, 1758 larvae. Higher egg viabil...
Morales-Ramos, Juan A; Rojas, M Guadalupe; Shelby, Kent S; Coudron, Thomas A
2016-04-01
Life-table analysis yielded demographic parameter values that indicate that Tenebrio molitor (L.) pupae are potentially more suitable factitious prey to mass-produce the predator Podisus maculiventris (Say) and are more suitable prey than the larvae. P. maculiventris developed faster (23.2 vs. 25.5 d), weighed more (females 80.9 vs. 66.6 mg and males 64.7 vs. 53.7 mg), and had a higher survival rate (0.88 vs. 0.7), fecundity, and reproductive output (87.1 vs. 22.8 eggs/female) when reared on pupae compared with larvae of T. molitor. The total protein content and soluble protein content were significantly higher in pupae (60.2 and 23%, respectively) than larvae (53.1 and 14.4%, respectively). Lipid content was significantly lower in pupae (32.1%) than larvae (35.9%), and larvae had more polyunsaturated fatty acids (83.6 vs. 56.6 mg/g) and less oleic (0.1 mg/g) and steric (6.1 mg/g) acids than pupae (37.3 and 12.3 mg/g, respectively). The total sugar content was not significantly different between pupae and larvae. However, larvae had significantly more fructose than pupae, but pupae had more galactose, glucosamine, glucose, mannose, and trehalose than larvae. Differences in nutritional composition and its impact on predator demographic parameters are potential factors that make the pupal stage a better food source.
Tomchaney, A P; Morris, J P; Kang, S H; Duman, J G
1982-02-16
Proteins which produce a thermal hysteresis (difference between the freezing and melting points) in aqueous solution are well-known for their antifreeze activity in polar marine fishes. Much less is known about the biology and biochemistry of similar antifreeze proteins found in certain insects. A thermal hysteresis protein was purified from cold acclimated larvae of the beetle, Tenebrio molitor, by using ethanol fractionation, DEAE ion-exchange chromatography, gel filtration, and high-pressure liquid chromatography. The purified protein had a molecular mass of 17 000 daltons and its N terminus was lysine. The amino acid composition of the antifreeze protein contained more hydrophilic amino acids than the fish antifreezes. This is consistent with the compositions of previously purified insect thermal hysteresis proteins. However, the percentage of hydrophilic amino acids in this Tenebrio antifreeze protein was considerably less than that of other insect thermal hysteresis proteins. The freezing point depressing activity of the Tenebrio antifreeze was less than that of fish proteins and glycoproteins at low protein concentrations but was greater at high protein concentrations.
Mechanism of dealkylation of clionasterol in the insect Tenebrio molitor
International Nuclear Information System (INIS)
Pettler, P.; Lockley, W.J.S.; Rees, H.H.; Goodwin, T.W.
1978-01-01
25- 3 H- and 26- 14 C-labelled (24S)-24-ethylcholest-5-en-3 β-ol (clionasterol) were synthesized from (24S)-24-ethylcholesta-5,25-dien-3β-ol. These labelled substrates were mixed and administered, together with the hypocholesterolemic agent, triparanol citrate, to Tenebrio molitor larvae. The 3 H label from the clionasterol substrate was retained in both the desmosterol and the cholesterol isolated from the larvae. Location of this 3 H label in the desmosterol showed that dealkylation of the clionasterol involved 3 H migration from C-25 to C-24. A possible mechanism for dealkylation is presented. (author)
Li, Leyuan; Stasiak, Michael; Li, Liang; Xie, Beizhen; Fu, Yuming; Gidzinski, Danuta; Dixon, Mike; Liu, Hong
2016-01-01
Rearing of yellow mealworm (Tenebrio molitor L.) will provide good animal nutrition for astronauts in a bioregenerative life support system. In this study, growth and biomass conversion data of T. molitor larvae were tested for calculating the stoichiometric equation of its growth. Result of a respiratory quotient test proved the validity of the equation. Fiber had the most reduction in mass during T. molitor‧s consumption, and thus it is speculated that fiber is an important factor affecting larval growth of T. molitor. In order to further confirm this hypothesis and find out a proper feed fiber content, T. molitor larvae were fed on diets with 4 levels of fiber. Larval growth, development and respiration in each group were compared and analyzed. Results showed that crude-fiber content of 5% had a significant promoting effect on larvae in early instars, and is beneficial for pupa eclosion. When fed on feed of 5-10% crude-fiber, larvae in later instars reached optimal levels in growth, development and respiration. Therefore, we suggest that crude fiber content in feed can be controlled within 5-10%, and with the consideration of food palatability, a crude fiber of 5% is advisable.
Cloning and expression of Tenebrio molitor antifreeze protein in Escherichia coli.
Yue, Chang-Wu; Zhang, Yi-Zheng
2009-03-01
A novel antifreeze protein cDNA was cloned by RT-PCR from the larva of the yellow mealworm Tenebrio molitor. The coding fragment of 339 bp encodes a protein of 112 amino acid residues and was fused to the expression vectors pET32a and pTWIN1. The resulted expression plasmids were transformed into Escherischia coli strains BL21 (DE3), ER2566, and Origami B (DE3), respectively. Several strategies were used for expression of the highly disulfide-bonded beta-helix-contained protein with the activity of antifreeze in different expression systems. A protocol for production of refolded and active T. molitor antifreeze protein in bacteria was obtained.
Directory of Open Access Journals (Sweden)
QingFeng TANG
2016-01-01
Full Text Available Abstract In order to take full advantage of Tenebrio molitor larvae (yellow mealworm resources, the supercritical CO2 fluid freeze-dried powder of T. molitor larvae (fdTML extraction on the immune systems of mice was carried out. The results about the effects of supercritical CO2 fluid fdTML extraction on carbon expurgation and phagocytosis of peritoneal macrophages experiments of mice indicated that the fdTML extraction enhanced observably carbon expurgatory index, phagocytic rate and phagocytic index. The fdTML extraction could stimulate response of delayed hypersensitivity. The proliferation of ConA-induced mitogenic reponse for spleen lymphocyte was also increased. The amount of hemolytic antibody in mice serum increased compared with those of the control group mice. The half of hemolysis values in serum of treated mice increased compared to the control group. Furthermore, serum NO content in all treatment groups was higher than that of the control group whereas acid phosphatase and alkaline phosphatase activity was only significantly higher relative to the control group. Our findings suggest that supercritical CO2 fluid the fdTML extraction has potential as a health food supplement.
Liu, Ying; Jiang, Yu-xin; Li, Chao-pin
2011-12-01
To clone tenecin gene, an antibacterial peptide gene, from Tenebrio molitor for its prokaryotic expression and explore the molecular mechanism for regulating the expression of antibacterial peptide in Tenebrio molitor larvae. The antibacterial peptide was induced from the larvae of Tenebrio molitor by intraperitoneal injection of Escherichia coli DH-5α (1×10(8)/ml). RT-PCR was performed 72 h after the injection to clone Tenecin gene followed by sequencing and bioinformatic analysis. The recombinant expression vector pET-28a(+)-Tenecin was constructed and transformed into E. coli BL21(DE3) cells and the expression of tenecin protein was observed after IPTG induction. Tenecin expression was detected in transformed E.coli using SDS-PAGE after 1 mmol/L IPTG induction. Tenecin gene, which was about 255 bp in length, encoded Tenecin protein with a relative molecular mass of 9 kD. Incubation of E.coli with 80, 60, 40, and 20 µg/ml tenecin for 18 h resulted in a diameter of the inhibition zone of 25.1∓0.03, 20.7∓0.06, 17.2∓0.11 and 9.3∓0.04 mm, respectively. Tenecin protein possesses strong antibacterial activity against E. coli DH-5α, which warrants further study of this protein for its potential as an antibacterial agent in clinical application.
Directory of Open Access Journals (Sweden)
Stefania Marono
2015-07-01
Full Text Available The aims of this study were to evaluate the correlation between in vitro crude protein digestibility coefficients of insect meals from Tenebrio molitor (TI and Hermetia illucens (HI and their chemical composition traits as well as to develop regression equations able to estimate the in vitro crude protein digestibility (CPd from proximate analysis of insect meals. Twelve samples of insect meals (6 from TM larvae, TM 1-6 and 6 from HI larvae, HI 1-6 were obtained from different producers and analysed for chemical composition and in vitro crude protein digestibility by a two-step enzymatic method (digestion with pepsin and trypsin-enriched pancreatin. For both insect meal samples, CPd was negatively correlated to ADF and chitin contents, while just for HI there was a positive correlation (P<0.01 between CP percentage of the samples and CPd. For both insect meals the former variable chosen in the stepwise analysis was the chitin, explaining the 79.45% of CPd variability for Tenebrio molitor samples and the 98.30% for Hermetia illucens. In the second step, the amount of protein linked to ADF was added in the model for T. molitor and CP for H. illucens samples. The coefficients chitin is the main constituent of insect body able to affect the crude protein digestibility of Tenebrio molitor and Hermetia illucens larvae meals estimated by an in vitro enzymatic method.
Directory of Open Access Journals (Sweden)
Zhiqing Guo
Full Text Available Species of Fusarium have significant agro-economical and human health-related impact by infecting diverse crop plants and synthesizing diverse mycotoxins. Here, we investigated interactions of grain-feeding Tenebrio molitor larvae with four grain-colonizing Fusarium species on wheat kernels. Since numerous metabolites produced by Fusarium spp. are toxic to insects, we tested the hypothesis that the insect senses and avoids Fusarium-colonized grains. We found that only kernels colonized with F. avenaceum or Beauveria bassiana (an insect-pathogenic fungal control were avoided by the larvae as expected. Kernels colonized with F. proliferatum, F. poae or F. culmorum attracted T. molitor larvae significantly more than control kernels. The avoidance/preference correlated with larval feeding behaviors and weight gain. Interestingly, larvae that had consumed F. proliferatum- or F. poae-colonized kernels had similar survival rates as control. Larvae fed on F. culmorum-, F. avenaceum- or B. bassiana-colonized kernels had elevated mortality rates. HPLC analyses confirmed the following mycotoxins produced by the fungal strains on the kernels: fumonisins, enniatins and beauvericin by F. proliferatum, enniatins and beauvericin by F. poae, enniatins by F. avenaceum, and deoxynivalenol and zearalenone by F. culmorum. Our results indicate that T. molitor larvae have the ability to sense potential survival threats of kernels colonized with F. avenaceum or B. bassiana, but not with F. culmorum. Volatiles potentially along with gustatory cues produced by these fungi may represent survival threat signals for the larvae resulting in their avoidance. Although F. proliferatum or F. poae produced fumonisins, enniatins and beauvericin during kernel colonization, the larvae were able to use those kernels as diet without exhibiting increased mortality. Consumption of F. avenaceum-colonized kernels, however, increased larval mortality; these kernels had higher enniatin
Guo, Zhiqing; Döll, Katharina; Dastjerdi, Raana; Karlovsky, Petr; Dehne, Heinz-Wilhelm; Altincicek, Boran
2014-01-01
Species of Fusarium have significant agro-economical and human health-related impact by infecting diverse crop plants and synthesizing diverse mycotoxins. Here, we investigated interactions of grain-feeding Tenebrio molitor larvae with four grain-colonizing Fusarium species on wheat kernels. Since numerous metabolites produced by Fusarium spp. are toxic to insects, we tested the hypothesis that the insect senses and avoids Fusarium-colonized grains. We found that only kernels colonized with F. avenaceum or Beauveria bassiana (an insect-pathogenic fungal control) were avoided by the larvae as expected. Kernels colonized with F. proliferatum, F. poae or F. culmorum attracted T. molitor larvae significantly more than control kernels. The avoidance/preference correlated with larval feeding behaviors and weight gain. Interestingly, larvae that had consumed F. proliferatum- or F. poae-colonized kernels had similar survival rates as control. Larvae fed on F. culmorum-, F. avenaceum- or B. bassiana-colonized kernels had elevated mortality rates. HPLC analyses confirmed the following mycotoxins produced by the fungal strains on the kernels: fumonisins, enniatins and beauvericin by F. proliferatum, enniatins and beauvericin by F. poae, enniatins by F. avenaceum, and deoxynivalenol and zearalenone by F. culmorum. Our results indicate that T. molitor larvae have the ability to sense potential survival threats of kernels colonized with F. avenaceum or B. bassiana, but not with F. culmorum. Volatiles potentially along with gustatory cues produced by these fungi may represent survival threat signals for the larvae resulting in their avoidance. Although F. proliferatum or F. poae produced fumonisins, enniatins and beauvericin during kernel colonization, the larvae were able to use those kernels as diet without exhibiting increased mortality. Consumption of F. avenaceum-colonized kernels, however, increased larval mortality; these kernels had higher enniatin levels than F
Guo, Zhiqing; Döll, Katharina; Dastjerdi, Raana; Karlovsky, Petr; Dehne, Heinz-Wilhelm; Altincicek, Boran
2014-01-01
Species of Fusarium have significant agro-economical and human health-related impact by infecting diverse crop plants and synthesizing diverse mycotoxins. Here, we investigated interactions of grain-feeding Tenebrio molitor larvae with four grain-colonizing Fusarium species on wheat kernels. Since numerous metabolites produced by Fusarium spp. are toxic to insects, we tested the hypothesis that the insect senses and avoids Fusarium-colonized grains. We found that only kernels colonized with F. avenaceum or Beauveria bassiana (an insect-pathogenic fungal control) were avoided by the larvae as expected. Kernels colonized with F. proliferatum, F. poae or F. culmorum attracted T. molitor larvae significantly more than control kernels. The avoidance/preference correlated with larval feeding behaviors and weight gain. Interestingly, larvae that had consumed F. proliferatum- or F. poae-colonized kernels had similar survival rates as control. Larvae fed on F. culmorum-, F. avenaceum- or B. bassiana-colonized kernels had elevated mortality rates. HPLC analyses confirmed the following mycotoxins produced by the fungal strains on the kernels: fumonisins, enniatins and beauvericin by F. proliferatum, enniatins and beauvericin by F. poae, enniatins by F. avenaceum, and deoxynivalenol and zearalenone by F. culmorum. Our results indicate that T. molitor larvae have the ability to sense potential survival threats of kernels colonized with F. avenaceum or B. bassiana, but not with F. culmorum. Volatiles potentially along with gustatory cues produced by these fungi may represent survival threat signals for the larvae resulting in their avoidance. Although F. proliferatum or F. poae produced fumonisins, enniatins and beauvericin during kernel colonization, the larvae were able to use those kernels as diet without exhibiting increased mortality. Consumption of F. avenaceum-colonized kernels, however, increased larval mortality; these kernels had higher enniatin levels than F
Li, Leyuan; Liu, lh64. Hong
2012-07-01
It has been confirmed in our previous work that in bioregenerative life support systems, feeding yellow mealworms (Tenebrio molitor L.) using fermented straw has the potential to provide good animal protein for astronauts, meanwhile treating with plant wastes. However, since the nitrogen content in straw is very low, T. molitor larvae can not obtain sufficient nitrogen, which results in a relatively low growth efficiency. In this study, wheat straw powder was mixed with simulated human urine before fermentation. Condition parameters, e.g. urine:straw ratio, moisture content, inoculation dose, fermentation time, fermentation temperature and pH were optimized using Taguchi method. Larval growth rate and average individual mass of mature larva increased significantly in the group of T. molitor larvae fed with feedstuff prepared with the optimized process.
Thermal effects on tenebrio molitor and lawn irradiated by high power centimeter wave
International Nuclear Information System (INIS)
Zhang Jie; Han Lijun; Qi Hongxing; Chen Shude; Qiao Dengjiang
2008-01-01
A system of high power centimeter wave(HPCW) was built up. The temperature change of tenebrio molitor and lawn was sampled during HPCW irradiation. It is shown that the relationship between the temperature increase of tenebrio molitor and irradiation time is approximately linear, and the relationship between the temperature increase of lawn and irradiation time is nonlinear. It is also considered that the temperature of lawn increases faster than that of tenebrio molitor does during the earlier stage of irradiation. The death percentage of tenebrio molitor and injury rate of lawn irradiated by HPCW could be fitted by normal distribution. The fitting curves of relations between death rate and irradiation time and between death rate and temperature are presented. (authors)
We studied protein digestion the tenebrionids Tenebrio molitor and Tribolium castaneum, pests of stored grains and grain products, to identify potential targets for biopesticide development. Tenebrionid larvae have highly compartmentalized guts, with primarily cysteine peptidases in the acidic anter...
Tenebrio molitor (Coleoptera: Tenebrionidae) as an alternative host to study fungal infections.
de Souza, Patrícia Canteri; Morey, Alexandre Tadachi; Castanheira, Gabriel Marcondes; Bocate, Karla Paiva; Panagio, Luciano Aparecido; Ito, Fabio Augusto; Furlaneto, Márcia Cristina; Yamada-Ogatta, Sueli Fumie; Costa, Idessânia Nazareth; Mora-Montes, Hector Manuel; Almeida, Ricardo Sergio
2015-11-01
Models of host–pathogen interactions are crucial for the analysis of microbial pathogenesis. In this context, invertebrate hosts, including Drosophila melanogaster (fruit fly), Caenorhabditis elegans (nematode) and Galleria mellonella (moth), have been used to study the pathogenesis of fungi and bacteria. Each of these organisms offers distinct benefits in elucidating host–pathogen interactions. In this study,we present a newinvertebrate infection model to study fungal infections: the Tenebrio molitor (beetle) larvae. Here we performed T. molitor larvae infection with one of two important fungal human pathogens, Candida albicans or Cryptococcus neoformans, and analyzed survival curves and larva infected tissues.We showed that increasing concentrations of inoculum of both fungi resulted in increased mortality rates, demonstrating the efficiency of the method to evaluate the virulence of pathogenic yeasts. Additionally, following 12 h post-infection, C. albicans formsmycelia, spreading its hyphae through the larva tissue,whilst GMS stain enabled the visualization of C. neoformans yeast and theirmelanin capsule. These larvae are easier to cultivate in the laboratory than G. mellonella larvae, and offer the same benefits. Therefore, this insect model could be a useful alternative tool to screen clinical pathogenic yeast strainswith distinct virulence traits or different mutant strains.
Youn, Kumju; Yun, Eun-Young; Lee, Jinhyuk; Kim, Ji-Young; Hwang, Jae-Sam; Jeong, Woo-Sik; Jun, Mira
2014-02-01
In our ongoing research to find therapeutic compounds for Alzheimer's disease (AD) from natural resources, the inhibitory activity of the BACE1 enzyme by Tenebrio molitor larvae and its major compounds were evaluated. The T. molitor larvae extract and its fractions exhibited strong BACE1 suppression. The major components of hexane fraction possessing both high yield and strong BACE1 inhibition were determined by thin layer chromatography, gas chromatography, and nuclear magnetic resonance analysis. A remarkable composition of unsaturated long chain fatty acids, including oleic acid and linoleic acid, were identified. Oleic acid, in particular, noncompetitively attenuated BACE1 activity with a half-maximal inhibitory concentration (IC₅₀) value of 61.31 μM and Ki value of 34.3 μM. Furthermore, the fatty acids were stably interacted with BACE1 at different allosteric sites of the enzyme bound with the OH of CYS319 and the NH₃ of TYR320 for oleic acid and with the C=O group of GLN304 for linoleic acid. Here, we first revealed novel pharmacophore features of oleic acids and linoleic acid to BACE1 by in silico docking studies. The present findings would clearly suggest potential guidelines for designing novel BACE1 selective inhibitors.
Zanuncio,José Cola; Beserra,Eduardo Barbosa; Molina-Rugama,Adrián José; Zanuncio,Teresinha Vinha; Pinon,Tobias Baruc Moreira; Maffia,Vanessa Pataro
2005-01-01
Reproduction and longevity of Supputius cincticeps (Stål) (Heteroptera: Pentatomidae) fed on Zophobas confusa Gebien, Tenebrio molitor L. (Coleoptera: Tenebrionidae) or Musca domestica (L.) (Diptera: Muscidae) larvae were studied during two generations at 24.7 ± 1.1ºC, 70 ± 10% R.H. and 12 h of photophase. Body weight of newly-emerged adults, oviposition period, number of egg masses, total number of eggs and longevity of S. cincticeps were higher when fed on Z. confusa or T. mol...
Li, Xingyue; Liu, Qizhi; Lewis, Edwin E; Tarasco, Eustachio
2016-12-01
Entomopathogenic nematodes (EPNs) of the genera Steinernema and Heterorhabditis are lethal parasites of many insect species. To investigate defensive mechanisms towards EPNs in relation to antioxidative and detoxifying enzymes, we chose Tenebrio molitor (Coleoptera: Tenebrionidae) as experimental insect. We studied the activity changes of superoxide dismutases (SODs), peroxidases (PODs), and catalases (CATs), as well as tyrosinase (TYR), acetylcholinesterase (AChE), carboxylesterase (CarE), and glutathione S-transferase (GSTs) for 40 h in T. molitor larvae infected with Heterorhabditis beicherriana infective juveniles (IJs) at 5 rates (0, 20, 40, 80, and 160 IJs/larva). We found that when T. molitor larvae infected with H. beicherriana at higher rates (80 and 160 IJs/larva), SOD activity quickly increased to more than 70 % higher than that control levels. The activities of POD and CAT increased after 24 h. TYR activity increased slowly at lower rates of infection for 16 h, followed by a slight decrease, and then increasing from 32 to 40 h. The other detoxifying enzymes (GST, CarE, and AChE) were enhanced at lower infection rates, but were inhibited at higher rates. Our results suggested that host antioxidative response and detoxification reactions played a central role in the defensive reaction to EPNs, and that this stress which was reflected by the higher level enzymes activity contributed to the death of hosts. Further study should explore the exact function of these enzymes using different species of EPNs and investigate the links between enzyme activity and host susceptibility to EPNs.
Won, Seong-Min; Cha, Hye-Uk; Yi, Sun Shin; Kim, Sung-Jo; Park, Sang-Kyu
2016-09-08
Tenebrio molitor are large insects and their larvae are consumed as food in many countries. The nutritional composition of T. molitor has been studied and contains high amounts of proteins, unsaturated fatty acids, and valuable minerals. However, the bioactivity of T. molitor has not been fully understood. We examined the effects of T. molitor extracts on resistance to oxidative stress and organism's lifespan using Caenorhabditis elegans as a model system. The response to heat shock and ultraviolet (UV) irradiation was monitored in vivo. The extracts from T. molitor showed significant effects on resistance to oxidative stress and UV irradiation and extend both mean and maximum lifespan of C. elegans. The number of progeny produced significantly increased in animals supplemented with T. molitor extracts. In addition, the expression of hsp-16.2 and sod-3 was markedly upregulated by supplementation with T. molitor extracts. These findings suggest that T. molitor extracts can increase response to stressors and extend lifespan by the induction of longevity assurance genes in C. elegans.
OLIVEIRA, H.N. de; PRATISSOLI, D.; PEDRUZZI, E.P.; ESPINDULA, M.C.
2004-01-01
Ninfas de Podisus nigrispinus (Heteroptera: Pentatomidae) têm sido criadas em laboratório com larvas de Tenebrio molitor L. (Coleoptera: Tenebrionidae). No entanto, não existem relatos sobre a predação, no campo ou em laboratório, de P. nigrispinus em Spodoptera frugiperda (Lepidoptera: Noctuidae), uma das principais pragas de inúmeras culturas no Brasil. Este trabalho teve o objetivo de avaliar o desenvolvimento ninfal e características reprodutivas do percevejo predador P. nigrispinus em la...
Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola
2017-01-01
This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20–40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control. PMID:28425475
Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola
2017-04-20
This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20-40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control.
Directory of Open Access Journals (Sweden)
Matías García
2003-12-01
Full Text Available In order to evaluate the allelochemical activity of some sesquiterpenes isolated from the native plant Tessaria absinthioides (Hook. et Arn. DC, and some semi synthetic derivatives against Tenebrio molitor L. larvae, we have developed bioassays directed to quantify repellency, larval mortality, and its effects on the development. Although costic aldehyde caused the maximum repellent effect, all the compounds showed a significant effect at some dose or time, indicating behavioral avoidance. The topical application of costic aldehyde produced the largest increase on the duration of the pupal stage. Tessaric acid exhibited the highest toxicity by topical application at the experiment closure. Both eremophilane-1(10,2,11(13-triene-12-oic, and -costic acids induced some morphological deformities.Con el objeto de evaluar sesquiterpenos aislados de la planta nativa Tessaria absinthioides (Hook et Arn y algunos derivados semisintéticos frente a larvas de Tenebrio molitor L., se desarrollaron bioensayos orientados a la cuantificación de la repelencia, mortalidad de larvas y efectos sobre el desarrollo. Aldehído cóstico produjo el mayor incremento en la duración del estado pupal por aplicación tópica. Acido tessárico exhibió el más alto porcentaje de mortalidad al finalizar el período de experimentación. Los productos eremophilan-1(10,2, 11(13-trien-12-oico y ácido -cóstico dieron lugar al mayor número de malformaciones. Si bien aldehído cóstico mostró la máxima actividad de repelencia, todos los compuestos evaluados produjeron efectos significativos en el ensayo de elección.
Prolidase is a critical enzyme for complete gliadin digestion in Tenebrio molitor larvae.
Tereshchenkova, Valeriia F; Goptar, Irina A; Zhuzhikov, Dmitry P; Belozersky, Mikhail A; Dunaevsky, Yakov E; Oppert, Brenda; Filippova, Irina Yu; Elpidina, Elena N
2017-08-01
Prolidase is a proline-specific metallopeptidase that cleaves imidodipeptides with C-terminal Pro residue. Prolidase was purified and characterized from the Tenebrio molitor larval midgut. The enzyme was localized in the soluble fraction of posterior midgut tissues, corresponding to a predicted cytoplasmic localization of prolidase according to the structure of the mRNA transcript. Expression of genes encoding prolidase and the major digestive proline-specific peptidase (PSP)-dipeptidyl peptidase 4-were similar. The pH optimum of T. molitor prolidase was 7.5, and the enzyme was inhibited by Z-Pro, indicating that it belongs to type I prolidases. In mammals, prolidase is particularly important in the catabolism of a proline-rich protein-collagen. We propose that T. molitor larval prolidase is a critical enzyme for the final stages of digestion of dietary proline-rich gliadins, providing hydrolysis of imidodipeptides in the cytoplasm of midgut epithelial cells. We propose that the products of hydrolysis are absorbed from the luminal contents by peptide transporters, which we have annotated in the T. molitor larval gut transcriptome. The origin of prolidase substrates in the insect midgut is discussed in the context of overall success of grain feeding insects. © 2017 Wiley Periodicals, Inc.
Morales-Ramos, Juan A; Rojas, M Guadalupe
2015-10-01
Crowding conditions of larvae may have a significant impact on commercial production efficiency of some insects, such as Tenebrio molitor L. (Coleoptera: Tenebrionidae). Although larval densities are known to affect developmental time and growth in T. molitor, no reports were found on the effects of crowding on food utilization. The effect of larval density on food utilization efficiency of T. molitor larvae was studied by measuring efficiency of ingested food conversion (ECI), efficiency of digested food conversion (EDC), and mg of larval weight gain per gram of food consumed (LWGpFC) at increasing larval densities (12, 24, 36, 48, 50, 62, 74, and 96 larvae per dm(2)) over four consecutive 3-wk periods. Individual larval weight gain and food consumption were negatively impacted by larval density. Similarly, ECI, ECD, and LWGpFC were negatively impacted by larval density. Larval ageing, measured as four consecutive 3-wk periods, significantly and independently impacted ECI, ECD, and LWGpFC in a negative way. General linear model analysis showed that age had a higher impact than density on food utilization parameters of T. molitor larvae. Larval growth was determined to be responsible for the age effects, as measurements of larval mass density (in grams of larvae per dm(2)) had a significant impact on food utilization parameters across ages and density treatments (in number of larvae per dm(2)). The importance of mass versus numbers per unit of area as measurements of larval density and the implications of negative effects of density on food utilization for insect biomass production are discussed. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.
Directory of Open Access Journals (Sweden)
Fausto da Costa Matos Neto
2004-03-01
Full Text Available Entre las ninfas de los asopíneos usados para el control de gusanos desfoliadores en plantaciones de eucalipto, Podisus distinctus (Stal (Heteroptera: Pentatomidae representa un potencial agente de control biológico, sin embargo esta especie ha sido poco estudiada. El presente trabajo evaluó el efecto de las diferentes combinaciones de las presas Musca domestica L. (Diptera: Muscidae y Tenebrio molitor L. (Coleoptera: Tenebrionidae sobre el peso de ninfas de P. distinctus. El experimento se realizó en laboratorio do "Instituto de Biotecnologia Aplicada à Agropecuaria (BIOAGRO", a 25 ± 0.5ºC, 60 ± 10% de humedad relativa y 14 horas de fotoperiodo. Las ninfas de P. distinctus fueron individualizadas en cajas de Petri y alimentadas de acuerdo con los siguientes tratamientos: T1- larvas de M. domestica durante toda la fase ninfal; T2- larvas de M. domestica en el II estadio y de T. molitor en los III, IV y V estadios; T3- larvas de M. domestica en el II y III estadios y de T. molitor en los IV y V estadios; T4- larvas de M. domestica en el II, III y IV estadios y de T. molitor en el V estadio; T5- larvas de T. molitor en todos los estadios. Los mejores resultados de peso y ganancia de peso fueron encontrados cuando P. distinctus fue alimentado alternadamente con larvas de M. domestica y T. molitor. Cuando esse depredador fue solamente alimentado con larvas de M. domestica, presentó pesos menoresLitlle is known about Podisus distinctus (Stal (Heteroptera: Pentatomidae one of the Asopinae species with good possibilities for mass rearing and releasing against defoliator caterpillars in eucalyptus reforested areas in Brazil. We evaluated the impact of prey combinations on weight of nymphs and adults of P. distinctus. The prey were Musca domestica L. (Diptera: Muscidae and Tenebrio molitor L. (Coleoptera: Tenebrionidae. The experiment was developed under 25 ± 0.5ºC, 60 ± 10% R.H. and photophase of 14 hr, with nymphs of P. distinctus
Directory of Open Access Journals (Sweden)
Oliveira Harley Nonato de
2004-01-01
Full Text Available Esse trabalho avaliou o efeito de diferentes presas e da combinação destas sobre percevejo Podisus nigrispinus. O delineamento experimental foi inteiramente casualizado com três tratamentos e 60 repetições. No tratamento um (T1, os percevejos receberam como alimento, lagartas de Spodoptera frugiperda, de 4o estádio, durante todo o seu ciclo de vida, no tratamento dois (T2, larvas de Tenebrio molitor, também durante o todo ciclo, enquanto que, no tratamento três (T3, foram oferecidas lagartas de S. frugiperda do 2masculine ao 4masculine estádios, e larvas de T. molitor do 4masculine estádio até o final do ciclo de vida. O ganho de peso em todas as fases ninfais e em adultos de até terceiro dia mostrou valores semelhantes de incremento, para todas as dietas utilizadas. No entanto, para os percevejos alimentados, com S. frugiperda (T1, observaram-se uma maior produção de ovos num menor período, com 80% dos ovos até 31masculine dia, enquanto que, no tratamento com larvas de T. molitor (T2, os mesmos 80% foram conseguidos somente no 45masculine dia, e no tratamento com a combinação de presas (T3, no 48masculine dia.
Toxic effects of two essential oils and their constituents on the mealworm beetle, Tenebrio molitor.
Martínez, L C; Plata-Rueda, A; Colares, H C; Campos, J M; Dos Santos, M H; Fernandes, F L; Serrão, J E; Zanuncio, J C
2017-12-14
The study identified insecticidal effects from the cinnamon and clove essential oils in Tenebrio molitor L. (Coleoptera: Tenebrionidae). The lethal concentrations (LC50 and LC90), lethal time, and repellent effect on larvae, pupae, and adults of T. molitor after exposure to six concentrations of each essential oil and toxic compounds were evaluated. The chemical composition of the cinnamon oil was also determined and primary compounds were eugenol (10.19%), trans-3-caren-2-ol (9.92%), benzyl benzoate (9.68%), caryophyllene (9.05%), eugenyl acetate (7.47%), α-phellandrene (7.18%), and α-pinene (6.92%). In clove essential oil, the primary compounds were eugenol (26.64%), caryophyllene (23.73%), caryophyllene oxide (17.74%), 2-propenoic acid (11.84%), α-humulene (10.48%), γ-cadinene (4.85%), and humulene oxide (4.69%). Cinnamon and clove essential oils were toxic to T. molitor. In toxic chemical compounds, eugenol have stronger contact toxicity in larvae, pupae, and adult than caryophyllene oxide, followed by α-pinene, α-phellandrene, and α-humulene. In general, the two essential oils were toxic and repellent to adult T. molitor. Cinnamon and clove essential oils and their compounds caused higher mortality and repellency on T. molitor and, therefore, have the potential for integrated management programs of this insect.
Development of the predator Podisus nigrispinus fed on Spodoptera frugiperda and Tenebrio molitor
Oliveira, Harley Nonato de; Pratissoli, Dirceu; Pedruzzi, Eder Pin; Espindula, Marcelo Curitiba
2004-01-01
Ninfas de Podisus nigrispinus (Heteroptera: Pentatomidae) têm sido criadas em laboratório com larvas de Tenebrio molitor L. (Coleoptera: Tenebrionidae). No entanto, não existem relatos sobre a predação, no campo ou em laboratório, de P. nigrispinus em Spodoptera frugiperda (Lepidoptera: Noctuidae), uma das principais pragas de inúmeras culturas no Brasil. Este trabalho teve o objetivo de avaliar o desenvolvimento ninfal e características reprodutivas do percevejo predador P. nigrispinus em la...
Bosch, Guido; Fels-Klerx, H J van der; Rijk, Theo C de; Oonincx, Dennis G A B
2017-06-02
Crops contaminated with fungal mycotoxins such as aflatoxin B1 (AFB1) are often downgraded or removed from the food chain. This study aimed to evaluate the tolerance and accumulation of AFB1 in two insect species to determine whether they could be used to retain condemned mycotoxin contaminated crops in the food chain. First, instar black soldier fly larvae ( Hermetia illucens , BSF) and yellow mealworm ( Tenebrio molitor , YMW) were fed poultry feed spiked with AFB1 and formulated to contain levels of 0.01, 0.025, 0.05, 0.10, 0.25, and up to 0.5 mg/kg dry feed. Poultry feed without any additions and feed with only the solvent added served as controls. The AFB1 in the feed did not affect survival and body weight in the BSF and YMW larvae ( p > 0.10), indicating a high tolerance to aflatoxin B1 in both species. Furthermore, AFB1 and aflatoxin M1 (AFM1) were below the detection limit (0.10 µg/kg) in BSF larvae, whereas the YMW had AFB1 levels that were approximately 10% of the European Union's legal limit for feed materials and excreted AFM1. It is concluded that both BSF larvae and YMW have a high AFB1 tolerance and do not accumulate AFB1.
Li, Leyuan; Xie, Beizhen; Dong, Chen; Hu, Dawei; Wang, Minjuan; Liu, Guanghui; Liu, Hong
2015-11-01
Yellow mealworm (Tenebrio molitor L.) is one of the animal candidates for space bioregenerative life support systems. In this study, T. molitor was involved in a 105-day multi-crew closed integrative BLSS experiment for a tentative rearing study. The results showed that the overall bioconversion rate (ratio of T. molitor gained to the total feed consumed) of T. molitor reared in the closed system was 8.13%, while 78.43% of the feed was excreted as frass. T. molitor reared in the closed system had a good nutritional composition. The eight essential amino acids (EAAs) in T. molitor larvae accounted for 41.30% of its total amino acids, and most EAA contents were higher than the suggested amino acid pattern recommended by the FAO/WHO. T. molitor sample obtained in this work was high in polyunsaturated fatty acids, and low in saturated fatty acids, indicating that the composition of fatty acids was beneficial to human health. In the open environment outside the experimental system, we simultaneously reared three parallel groups of larval T. molitor using the same feeding regime and temperature condition. Compared with T. molitor reared in the open environment, larvae reared in the closed system grew slower. With the course of time t, the growth rate of T. molitor in the open environment was 0.839e0.017t times that of larvae in the closed system. This paper can provide data for future design and improvement of BLSS containing a T. molitor rearing unit.
Pesticide contamination of Tenebrio molitor (Coleoptera: Tenebrionidae) for human consumption.
Houbraken, Michael; Spranghers, Thomas; De Clercq, Patrick; Cooreman-Algoed, Margot; Couchement, Tasmien; De Clercq, Griet; Verbeke, Sarah; Spanoghe, Pieter
2016-06-15
The use of pesticides contributes to the productivity and the quality of the cultivated crop. A large portion of the agricultural produce is not consumed as it is not an edible part or the quality of the product is too low. This waste of agricultural produce can be valorised as a substrate for the production of certain insects for human consumption. However, pesticides applied on the plants might accumulate during the life cycle of the insects fed on the waste materials and may cause a health risk to humans consuming the insects. Pesticide residues in larvae of the yellow mealworm, Tenebrio molitor, were investigated. We monitored the accumulation of pesticides in the larvae upon consumption of contaminated fresh produce. An increased uptake rate by the insects was found for pesticides with higher Kow-values. Excretion of pesticides by the insect was inversely related to the log(Kow) values of the pesticides. Copyright © 2016 Elsevier Ltd. All rights reserved.
Li, Leyuan; Xie, Beizhen; Dong, Chen; Hu, Dawei; Wang, Minjuan; Liu, Guanghui; Liu, Hong
2015-11-01
Yellow mealworm (Tenebrio molitor L.) is one of the animal candidates for space bioregenerative life support systems. In this study, T. molitor was involved in a 105-day multi-crew closed integrative BLSS experiment for a tentative rearing study. The results showed that the overall bioconversion rate (ratio of T. molitor gained to the total feed consumed) of T. molitor reared in the closed system was 8.13%, while 78.43% of the feed was excreted as frass. T. molitor reared in the closed system had a good nutritional composition. The eight essential amino acids (EAAs) in T. molitor larvae accounted for 41.30% of its total amino acids, and most EAA contents were higher than the suggested amino acid pattern recommended by the FAO/WHO. T. molitor sample obtained in this work was high in polyunsaturated fatty acids, and low in saturated fatty acids, indicating that the composition of fatty acids was beneficial to human health. In the open environment outside the experimental system, we simultaneously reared three parallel groups of larval T. molitor using the same feeding regime and temperature condition. Compared with T. molitor reared in the open environment, larvae reared in the closed system grew slower. With the course of time t, the growth rate of T. molitor in the open environment was 0.839e(0.017t) times that of larvae in the closed system. This paper can provide data for future design and improvement of BLSS containing a T. molitor rearing unit. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.
Bu?ler, Sara; Rumpold, Birgit A.; Jander, Elisabeth; Rawel, Harshadrai M.; Schl?ter, Oliver K.
2016-01-01
Depending on the species, edible insects are highly nutritious and thus represent a noteworthy alternative food and feed source. The current work investigates the protein extractability and techno-functionality of insect flour fractions recovered from Tenebrio molitor and Hermetia illucens. T. molitor and H. illucens flours contained about 20% crude fat and 60% and 36 % crude protein, respectively. Defatting reduced the crude fat content to 2.8% (T. molitor) and 8.8% (H. illucens) and increas...
Li, LeYuan; Zhao, ZhiRuo; Liu, Hong
2013-11-01
In bioregenerative life support systems, using inedible plant biomass to feed animals can provide animal protein for astronauts, while at the same time treating with wastes so as to increase the degree of system closure. In this study, the potential of yellow mealworms (Tenebrio molitor L.) as an animal candidate in the system was analyzed. The feasibility of feeding T. molitor with inedible parts of wheat and vegetable was studied. To improve the feed quality of wheat straw, three methods of fermentation were tested. A feeding regime was designed to contain a proper proportion of bran, straw and old leaves. The results showed that T. molitor larvae fed on the plant waste diets grew healthily, their fresh and dry weight reached 56.15% and 46.76% of the larvae fed on a conventional diet (control), respectively. The economic coefficient of the larvae was 16.07%, which was 88.05% of the control. The protein and fat contents of the larvae were 76.14% and 6.44% on dry weigh basis, respectively. Through the processes of facultative anaerobic fermentation and larval consumption, the straw lost about 47.79% of the initial dry weight, and its lignocellulose had a degradation of about 45.74%. Wheat germination test indicated that the frass of T. molitor needs a certain treatment before the addition to the cultivation substrate.
Czech Academy of Sciences Publication Activity Database
Loponte, R.; Nizza, S.; Bovera, F.; De Riu, N.; Fliegerová, Kateřina; Lombardi, P.; Vassalotti, G.; Mastellone, V.; Nizza, A.; Moniello, G.
2017-01-01
Roč. 115, č. 3 (2017), s. 183-188 ISSN 0034-5288 Institutional support: RVO:67985904 Keywords : Barbary partridge * Hermetia illucens * Tenebrio molitor Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 1.298, year: 2016
Li, Leyuan; Liu, lh64. Hong; Ruo Zhao, Zhi
2012-07-01
In bioregenerative life support systems, using inedible plant biomass to feed animals can provide animal protein for astronauts, while at the same time treating with wastes so as to increase the degree of system closure and the efficiency of material cycling. In this study, an analysis and demonstration on the potential of yellow mealworms (Tenebrio molitor L.) as an animal candidate in the system was presented. The feasibility of feeding T. molitor with inedible parts of wheat and vegetables was studied. Moreover, a process for straw fermentation was selected. T. molitor was fed on wheat bran for the first 10 days, and then gradually, fermented straw was added. Old leaves of Chinese cabbage were used as supplementary feedstuff. The results showed that T. molitor larvae fed on this diet survived and grew normally, their fresh and dry weight achieved 56.15% and 46.76% of the larvae fed on a conventional diet, respectively. The bioconversion rate of the larvae was 16.07%, which was 88.05% of the conventional diet group. The protein and fat contents were 76.14% and 6.44% on dry weigh, respectively. Through the processes of anaerobic fermentation and mealworm consumption, the straw lost about 47.79% of the initial dry weight, and its lignocellulose had a degradation of about 45.74%. Wheat germination test indicated that the frass of T. molitor has the potential to be utilized as plant cultivation substrate after certain treatment. Stoichiometric modeling of BLSS containing T. molitor was also conducted.
Complete mitochondrial genome of yellow meal worm (Tenebrio molitor).
Liu, Li-Na; Wang, Cheng-Ye
2014-11-18
The yellow meal worm (Tenebrio molitor L.) is an important resource insect typically used as animal feed additive. It is also widely used for biological research. The first complete mitochondrial genome of T. molitor was determined for the first time by long PCR and conserved primer walking approaches. The results showed that the entire mitogenome of T. molitor was 15 785 bp long, with 72.35% A+T content [deposited in GenBank with accession number KF418153]. The gene order and orientation were the same as the most common type suggested as ancestral for insects. Two protein-coding genes used atypical start codons (CTA in ND2 and AAT in COX1), and the remaining 11 protein-coding genes started with a typical insect initiation codon ATN. All tRNAs showed standard clover-leaf structure, except for tRNA(Ser) (AGN), which lacked a dihydrouridine (DHU) arm. The newly added T. molitor mitogenome could provide information for future studies on yellow meal worm.
Tindwa, Hamisi; Jo, Yong Hun; Patnaik, Bharat Bhusan; Lee, Yong Seok; Kang, Sang Sun; Han, Yeon Soo
2015-07-01
Macroautophagy (hereinafter called autophagy) is a highly regulated process used by eukaryotic cells to digest portions of the cytoplasm that remodels and recycles nutrients and disposes of unwanted cytoplasmic constituents. Currently 36 autophagy-related genes (ATG) and their homologs have been characterized in yeast and higher eukaryotes, including insects. In the present study, we identified and functionally characterized the immune function of an ATG8 homolog in a coleopteran insect, Tenebrio molitor (TmATG8). The cDNA of TmATG8 comprises of an ORF of 363 bp that encodes a protein of 120 amino acid residues. TmATG8 transcripts are detected in all the developmental stages analyzed. TmAtg8 protein contains a highly conserved C-terminal glycine residue (Gly116) and shows high amino acid sequence identity (98%) to its Tribolium castaneum homolog, TcAtg8. Loss of function of TmATG8 by RNAi led to a significant increase in the mortality rates of T. molitor larvae against Listeria monocytogenes. Unlike dsEGFP-treated control larvae, TmATG8-silenced larvae failed to turn-on autophagy in hemocytes after injection with L. monocytogenes. These data suggest that TmATG8 play a role in mediating autophagy-based clearance of Listeria in T. molitor. Copyright © 2015 Elsevier Ltd. All rights reserved.
Bharadwaj, Anuja; Stafford, Kirby C
2011-12-01
The yellow mealworm, Tenebrio molitor L., has been used to indicate qualitatively the presence of entomopathogenic fungi in the soil or as a model for evaluating stress and other factors on fungal activity. Although this beetle appears highly susceptible to many of these fungi, little quantitative information is available on the sensitivity of T. molitor to a specific fungus and, therefore, fungal presence or as an indicator for pathogenicity to other species. The purpose of this study was to establish the suitability of T. molitor larvae as a bioassay probe for Metarhizium brunneum for comparison against the blacklegged tick, Ixodes scapularis. Nine concentrations of M. brunneum strain F52 ranging from 1.0 x 10(1) to 8.4 x 10(8) conidial/ml were simultaneously tested against T. molitor larvae and I. scapularis adults. Larvae of yellow mealworm were less sensitive to M. brunneum than I. scapularis adults (LC50's 4.4 x 10(7) and 1.7 x 10(5) conidia/ml, respectively, 4-wk post-treatment). The greater sensitivity of I. scapularis to the fungus suggests that the detection of fungal mycosis in mealworms would indicate sufficient inoculum to be pathogenic to I. scapularis and make this insect a suitable probe for evaluation of the presence and activity of M. brunneum against the blacklegged tick in field applications.
Han, So-Ri; Lee, Byoung-Seok; Jung, Kyung-Jin; Yu, Hee-Jin; Yun, Eun-Young; Hwang, Jae Sam; Moon, Kyoung-Sik
2016-06-01
Worldwide demand for novel food source has grown and edible insects are a promising food sources for humans. Tenebrio molitor, as known as yellow mealworm, has advantages of being rich in protein, and easy to raise as a novel food source. The objective of this study was to evaluate subchronic toxicity, including potential hypersensitivity, of freeze-dried powdered T. molitor larvae (fdTML) in male and female Sprague-Dawley rats. The fdTML was administered orally once daily at dose levels of 0, 300, 1000 and 3000 mg/kg/day for 90 days. A toxicological assessment was performed, which included mortality, clinical signs, body and organ weights, food consumption, ophthalmology, urinalysis, hematology, serum chemistry, gross findings, histopathologic examination and allergic reaction. There were no fdTML- related findings in clinical signs, urinalysis, hematology and serum chemistry, gross examination, histopathologic examination or allergic reaction. In conclusion, the No Observed Adverse Effect Level (NOAEL) for fdTML was determined to be in excess of 3000 mg/kg/day in both sexes of rats under the experimental conditions of this study. Copyright © 2016 Elsevier Inc. All rights reserved.
Bednarska, Agnieszka J; Świątek, Zuzanna
2016-11-01
By studying the internal compartmentalization of metals in different subcellular fractions we are able to better understand the mechanisms of metal accumulation in organisms and the transfer of metals through trophic chains. We investigated the internal compartmentalization of cadmium (Cd) and zinc (Zn) in mealworm beetle (Tenebrio molitor) larvae by breeding them in flour contaminated with either Cd at 100, 300 and 600mgkg(-1), or Zn at 1000 and 2000mgkg(-1). We separated the cellular components of the larvae into 3 fractions: the S1 or cytosolic fraction containing organelles, heat-sensitive and heat-stable proteins, the S2 or cellular debris fraction and the G or metal-rich granule fraction. The concentration of Cd and Zn in each fraction was measured at 0, 7, 14 and 21 days of being fed the flour. The concentration of Cd in the flour affected the concentration of Cd measured in each larval subcellular fraction (p≤0.0001), while the concentration of Zn in the flour only affected the Zn concentration in the S2 and G fractions (p≤0.02). Both Cd and Zn concentrations in mealworms remained relatively constant during the exposure (days 7, 14 and 21) in all three fractions, but the Cd concentrations were much higher than those found in larvae before the exposure (day 0). The concentration of Cd in the flour, however, did not affect the percentage of Cd in the S1 fraction. The contribution of Cd in the G fraction to the total Cd amount was similar (30-40%) in all Cd treatments. The percentage of Zn in all three fractions was not affected by the concentration of Zn in the flour and the relative contributions of each subcellular fraction to the total burden of Zn remained generally constant for both control and treated larvae. In general, larvae sequestered approximately 30% of Cd and Zn in the S1 fraction, which is important for the transport of metals to higher trophic levels in a food web. Copyright © 2016 Elsevier Inc. All rights reserved.
A nuptially transmitted Ichthyosproean symbiont of Tenebrio molitor (Coleoptera: Tenebrionidae)
The yellow mealworm, Tenebrio molitor, harbors a symbiont that has spores with a thick, laminated wall and infects the fat body and ventral nerve chord of adult and larval beetles. In adult males, there is heavy infection of the epithelial cells of the testes and between testes lobes with occasional...
MALISZEWSKA, Justyna; TĘGOWSKA, Eugenia
2016-01-01
Pesticides are known to affect insects metabolic rate and CO2 release patterns. In the presented paper metabolic rate and mortality of mealworms Tenebrio molitor L. exposed to four different insecticides was evaluated, to find out whether there is a relationship between mealworms sensitivity to pesticides and their metabolic rate. Tenebrio molitor mortality was determined after intoxication with pyrethroid, oxadiazine, neonicotinoid and organophosphate. Metabolic rate before and after intoxic...
Immune function responds to selection for cuticular colour in Tenebrio molitor
DEFF Research Database (Denmark)
Armitage, Sophie Alice Octavia; Siva-Jothy, M. T.
2005-01-01
Cuticular colour in the mealworm beetle (Tenebrio molitor) is a quantitative trait, varying from tan to black. Population level variation in cuticular colour has been linked to pathogen resistance in this species and in several other insects: darker individuals are more resistant to pathogens...
Janssen, Renske H; Vincken, Jean-Paul; van den Broek, Lambertus A M; Fogliano, Vincenzo; Lakemond, Catriona M M
2017-03-22
Insects are considered a nutritionally valuable source of alternative proteins, and their efficient protein extraction is a prerequisite for large-scale use. The protein content is usually calculated from total nitrogen using the nitrogen-to-protein conversion factor (Kp) of 6.25. This factor overestimates the protein content, due to the presence of nonprotein nitrogen in insects. In this paper, a specific Kp of 4.76 ± 0.09 was calculated for larvae from Tenebrio molitor, Alphitobius diaperinus, and Hermetia illucens, using amino acid analysis. After protein extraction and purification, a Kp factor of 5.60 ± 0.39 was found for the larvae of three insect species studied. We propose to adopt these Kp values for determining protein content of insects to avoid overestimation of the protein content.
Protein identification and in vitro digestion of fractions from Tenebrio molitor
Yi, Liya; Boekel, van M.A.J.S.; Boeren, Sjef; Lakemond, Catriona M.M.
2016-01-01
The nutritional value of insect protein is evaluated not only in amino acid composition, but also in protein digestibility. The general amino acid composition of Tenebrio molitor has been reported before, but limited knowledge is available on its digestibility. The objective of this study was to
Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Bravo, Alejandra; Soberón, Mario
2013-03-01
Bacillus thuringiensis Cry toxins recognizes their target cells in part by the binding to glycosyl-phosphatidyl-inositol (GPI) anchored proteins such as aminopeptidase-N (APN) or alkaline phosphatases (ALP). Treatment of Tenebrio molitor brush border membrane vesicles (BBMV) with phospholipase C that cleaves out GPI-anchored proteins from the membranes, showed that GPI-anchored proteins are involved in binding of Cry3Aa toxin to BBMV. A 68 kDa GPI-anchored ALP was shown to bind Cry3Aa by toxin overlay assays. The 68 kDa GPI-anchored ALP was preferentially expressed in early instar larvae in comparison to late instar larvae. Our work shows for the first time that GPI-anchored ALP is important for Cry3Aa binding to T. molitor BBMV suggesting that the mode of action of Cry toxins is conserved in different insect orders. Copyright © 2012 Elsevier Inc. All rights reserved.
A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*
Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis
2009-01-01
Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera. PMID:19416969
Oppert, Brenda; Martynov, Alexander G; Elpidina, Elena N
2012-09-01
The yellow mealworm, Tenebrio molitor, is a pest of stored grain products and is sensitive to the Bacillus thuringiensis (Bt) Cry3Aa toxin. As digestive peptidases are a determining factor in Cry toxicity and resistance, we evaluated the expression of peptidase transcripts in the midgut of T. molitor larvae fed either a control or Cry3Aa protoxin diet for 24 h (RNA-Seq), or in larvae exposed to the protoxin for 6, 12, or 24 h (microarrays). Cysteine peptidase transcripts (9) were similar to cathepsins B, L, and K, and their expression did not vary more than 2.5-fold in control and Cry3Aa-treated larvae. Serine peptidase transcripts (48) included trypsin, chymotrypsin and chymotrypsin-like, elastase 1-like, and unclassified serine peptidases, as well as homologs lacking functional amino acids. Highly expressed trypsin and chymotrypsin transcripts were severely repressed, and most serine peptidase transcripts were expressed 2- to 15-fold lower in Cry3Aa-treated larvae. Many serine peptidase and homolog transcripts were found only in control larvae. However, expression of a few serine peptidase transcripts was increased or found only in Cry3Aa-treated larvae. Therefore, Bt intoxication significantly impacted the expression of serine peptidases, potentially important in protoxin processing, while the insect maintained the production of critical digestive cysteine peptidases. Published by Elsevier Inc.
Castilla, Aurora M; Dauwe, Tom; Mora, Isabel; Malone, Jim; Guitart, Raimon
2010-01-01
We examined experimentally whether fertilizers or herbicides commonly used by farmers affect mortality of the adult grain beetle Tenebrio molitor. After a period of 4 weeks in direct contact with all treatments, a higher percentage of mortality occurred in contact with nitrates than with pig manure or turkey litter. Herbicides (a mixture of glyphosate and 2,4-D: ) caused 100% mortality. Our results also indicate that more beetles escaped from the herbicides and nitrate treatments than from the others, suggesting some kind of behavioural avoidance of toxic environments. The traditional organic fertilizers appear to be less toxic than inorganic fertilizers for Tenebrio molitor.
Tindwa, Hamisi; Patnaik, Bharat Bhusan; Kim, Dong Hyun; Mun, Seulgi; Jo, Yong Hun; Lee, Bok Luel; Lee, Yong Seok; Kim, Nam Jung; Han, Yeon Soo
2013-11-14
Peptidoglycan recognition proteins (PGRPs) are a family of innate immune molecules that recognize bacterial peptidoglycan. PGRP-LE, a member of the PGRP family, selectively binds to diaminopimelic acid (DAP)-type peptidoglycan to activate both the immune deficiency (Imd) and proPhenoloxidase (proPO) pathways in insects. A PGRP-LE-dependent induction of autophagy to control Listeria monocytogenes has also been reported. We identified and partially characterized a novel PGRP-LE homologue, from Tenebrio molitor and analyzed its functional role in the survival of the insect against infection by a DAP-type PGN containing intracellular pathogen, L. monocytogenes. The cDNA is comprised of an open reading frame (ORF) of 990 bp and encodes a polypeptide of 329 residues. TmPGRP-LE contains one PGRP domain, but lacks critical residues for amidase activity. Quantitative RT-PCR analysis showed a broad constitutive expression of the transcript at various stages of development spanning from larva to adult. RNAi mediated knockdown of the transcripts, followed by a challenge with L. monocytogenes, showed a significant reduction in survival rate of the larvae, suggesting a putative role of TmPGRP-LE in sensing and control of L. monocytogenes infection in T. molitor. These results implicate PGRP-LE as a defense protein necessary for survival of T. molitor against infection by L. monocytogenes.
Directory of Open Access Journals (Sweden)
Yeon Soo Han
2013-11-01
Full Text Available Peptidoglycan recognition proteins (PGRPs are a family of innate immune molecules that recognize bacterial peptidoglycan. PGRP-LE, a member of the PGRP family, selectively binds to diaminopimelic acid (DAP-type peptidoglycan to activate both the immune deficiency (Imd and proPhenoloxidase (proPO pathways in insects. A PGRP-LE-dependent induction of autophagy to control Listeria monocytogenes has also been reported. We identified and partially characterized a novel PGRP-LE homologue, from Tenebrio molitor and analyzed its functional role in the survival of the insect against infection by a DAP-type PGN containing intracellular pathogen, L. monocytogenes. The cDNA is comprised of an open reading frame (ORF of 990 bp and encodes a polypeptide of 329 residues. TmPGRP-LE contains one PGRP domain, but lacks critical residues for amidase activity. Quantitative RT-PCR analysis showed a broad constitutive expression of the transcript at various stages of development spanning from larva to adult. RNAi mediated knockdown of the transcripts, followed by a challenge with L. monocytogenes, showed a significant reduction in survival rate of the larvae, suggesting a putative role of TmPGRP-LE in sensing and control of L. monocytogenes infection in T. molitor. These results implicate PGRP-LE as a defense protein necessary for survival of T. molitor against infection by L. monocytogenes.
Zhu, Jia-Ying; Ze, Sang-Zi; Stanley, David W; Yang, Bin
2014-09-01
Superoxide dismutase (SOD) is an antioxidant enzyme involved in detoxifying reactive oxygen species. In this study, we identified genes encoding the extracellular and intracellular copper-zinc SODs (ecCuZnSOD and icCuZnSOD) and a manganese SOD (MnSOD) in the yellow mealworm beetle, Tenebrio molitor. The cDNAs for ecCuZnSOD, icCuZnSOD, and MnSOD, respectively, encode 24.55, 15.81, and 23.14 kDa polypeptides, which possess structural features typical of other insect SODs. They showed 20-94% identity to other known SOD sequences from Bombyx mori, Musca domestica, Nasonia vitripennis, Pediculus humanus corporis, and Tribolium castaneum. Expression of these genes was analyzed in selected tissues and developmental stages, and following exposure to Escherichia coli and parasitization by Scleroderma guani. We recorded expression of all three SODs in cuticle, fat body, and hemocytes and in the major developmental stages. Relatively higher expressions were detected in late-instar larvae and pupae, compared to other developmental stages. Transcriptional levels were upregulated following bacterial infection. Analysis of pupae parasitized by S. guani revealed that expression of T. molitor SOD genes was significantly induced following parasitization. We infer that these genes act in immune response and in host-parasitoid interactions. © 2014 Wiley Periodicals, Inc.
Superoxide dismutase (SOD) is an antioxidant enzyme involved in detoxifying reactive oxygen species. In this study, we identified genes encoding the extracellular and intracellular copper-zinc SODs (ecCuZnSOD and icCuZnSOD) and a manganese SOD (MnSOD) in the yellow mealworm beetle, Tenebrio molitor....
Directory of Open Access Journals (Sweden)
Sara Bußler
2016-12-01
Full Text Available Depending on the species, edible insects are highly nutritious and thus represent a noteworthy alternative food and feed source. The current work investigates the protein extractability and techno-functionality of insect flour fractions recovered from Tenebrio molitor and Hermetia illucens. T. molitor and H. illucens flours contained about 20% crude fat and 60% and 36 % crude protein, respectively. Defatting reduced the crude fat content to 2.8% (T. molitor and 8.8% (H. illucens and increased the crude protein content to 68% and 47%, respectively. To isolate proteins from the flours, protein solubility was optimized by varying the pH, the ionic strength, and the extraction temperature of the solvent. All products and by-products accumulated in the protein production process were characterized by composition, selected techno-functional properties, protein solubility, composition and structure as well as their microbial load.
Bußler, Sara; Rumpold, Birgit A; Jander, Elisabeth; Rawel, Harshadrai M; Schlüter, Oliver K
2016-12-01
Depending on the species, edible insects are highly nutritious and thus represent a noteworthy alternative food and feed source. The current work investigates the protein extractability and techno-functionality of insect flour fractions recovered from Tenebrio molitor and Hermetia illucens . T. molitor and H. illucens flours contained about 20% crude fat and 60% and 36 % crude protein, respectively. Defatting reduced the crude fat content to 2.8% ( T. molitor ) and 8.8% ( H. illucens ) and increased the crude protein content to 68% and 47%, respectively. To isolate proteins from the flours, protein solubility was optimized by varying the pH, the ionic strength, and the extraction temperature of the solvent. All products and by-products accumulated in the protein production process were characterized by composition, selected techno-functional properties, protein solubility, composition and structure as well as their microbial load.
Study of the effect of microwaves on the tanning process in Tenebrio molitor L
International Nuclear Information System (INIS)
You Hing Tchao; Huet, Claude; Lenoir-Rousseau, J.-J.
1977-01-01
The anterior part of Tenebrio molitor releases enzymatic substances inducing the tanning process of the adult cuticle. These substances would be released before larval-pupal ecdysis. Their presence at a low rate enables the tanning process to occur normally although later [fr
Meireles, Elaine A.; Carneiro, Cíntia N. B.; DaMatta, Renato A.; Samuels, Richard I.; Silva, Carlos P.
2009-01-01
Scanning electron microscopy images were taken of starch granules from different sources following exposure in vivo and in vitro to gut α-amylases isolated from Tenebrio molitor L. (Coleoptera: Tenebrionidae) and Zabrotes subfasciatus Boheman (Coleoptera: Bruchidae). One α-amylase was isolated from whole larval midguts of T. molitor using non-denaturing SDS-PAGE, while two other α-amylase fractions were isolated from whole larval midguts of Z. subfasciatus using hydrophobic interaction chromatography., Digested starch granules from larvae fed on maize, potato or wheat were isolated from midgut contents. Combinations of starch granules with isolated α-amylases from both species showed similar patterns of granule degradation. In vitro enzymatic degradation of maize starch granules by the three different α-amylase fractions began by creating small holes and crater-like areas on the surface of the granules. Over time, these holes increased in number and area resulting in extensive degradation of the granule structure. Granules from potato did not show formation of pits and craters on their surface, but presented extensive erosion in their interior. For all types of starch, as soon as the interior of the starch granule was reached, the inner layers of amylose and amylopectin were differentially hydrolyzed, resulting in a striated pattern. These data support the hypothesis that the pattern of starch degradation depends more on the granule type than on the α-amylase involved. PMID:19619014
The bacterial biota of laboratory-reared edible mealworms (Tenebrio molitor L.): From feed to frass.
Osimani, Andrea; Milanović, Vesna; Cardinali, Federica; Garofalo, Cristiana; Clementi, Francesca; Pasquini, Marina; Riolo, Paola; Ruschioni, Sara; Isidoro, Nunzio; Loreto, Nino; Franciosi, Elena; Tuohy, Kieran; Petruzzelli, Annalisa; Foglini, Martina; Gabucci, Claudia; Tonucci, Franco; Aquilanti, Lucia
2018-05-02
Tenebrio molitor represents one of the most popular species used for the large-scale conversion of plant biomass into protein and is characterized by high nutritional value. In the present laboratory study, the bacterial biota characterizing a pilot production chain of fresh T. molitor larvae was investigated. To this end, different batches of fresh mealworm larvae, their feeding substrate (wheatmeal) and frass were analyzed by viable microbial counts, PCR-DGGE and Illumina sequencing. Moreover, the occurrence of Coxiella burnetii, Pseudomonas aeruginosa and Shiga toxin-producing E. coli (STEC) was assessed through qualitative real-time PCR assays. Microbial viable counts highlighted low microbial contamination of the wheatmeal, whereas larvae and frass were characterized by high loads of Enterobacteriaceae, lactic acid bacteria, and several species of mesophilic aerobes. Spore-forming bacteria were detected to a lesser extent in all the samples. The combined molecular approach used to profile the microbiota confirmed the low microbial contamination of wheatmeal and allowed the detection of Enterobacter spp., Erwinia spp., Enterococcus spp. and Lactococcus spp. as dominant genera in both larvae and frass. Moreover, Klebsiella spp., Pantoea spp., and Xenorhabdus spp. were found to be in the minority. Entomoplasmatales (including Spiroplasma spp.) constituted a major fraction of the microbiota of one batch of larvae. From the real-time PCR assays, no sample was positive for either C. burnetii or STEC, whereas P. aeruginosa was detected in one sample of frass. Based on the overall results, two sources of microbial contamination were hypothesized, namely feeding with wheatmeal and vertical transmission of microorganisms from mother to offspring. Since mealworms are expected to be eaten as a whole, the overall outcomes collected in this laboratory study discourage the consumption of fresh mealworm larvae. Moreover, microbial loads and the absence of potential pathogens
A new biological recovery approach for PHA using mealworm, Tenebrio molitor.
Murugan, Paramasivam; Han, Lizhu; Gan, Chee-Yuen; Maurer, Frans H J; Sudesh, Kumar
2016-12-10
Bacterial polyhydroxyalkanoates (PHA) are expensive partly due to the recovery and purification processes. Thus, many studies have been carried out in order to minimize the cost. Here we report on the use of mealworm, which is the larva of mealworm beetle (Tenebrio molitor) to recover PHA granules from Cupriavidus necator. Mealworms were shown to readily consume the freeze-dried C. necator cells and excrete the PHA granules in the form of whitish feces. Further purification using water, detergent and heat resulted in almost 100% pure PHA granules. Comparison with chloroform extraction showed no signs of reduction in the molecular weight and dispersion of the PHA molecules. Scanning electron microscopy and dynamic light scattering measurements revealed that the biologically recovered PHA granules retained their native spherical morphology. The PHA granules were subjected to a battery of tests to determine their purity and properties in comparison to the chloroform extracted PHA. This study has demonstrated the possibility of using mealworms as a biological agent to partially purify the PHA granules. Copyright © 2016 Elsevier B.V. All rights reserved.
Dreassi, Elena; Cito, Annarita; Zanfini, Assunta; Materozzi, Lara; Botta, Maurizio; Francardi, Valeria
2017-03-01
Fat is the second most abundant component of the nutrient composition of the mealworm Tenebrio molitor (Coleoptera: Tenebrionidae) that represents also an interesting source of PUFA, especially n-6 and n-3 fatty acids, involved in prevention of cardiovascular diseases. This study investigated the possibility of modifying the fat content and the FA composition of yellow mealworms through feeding and how this would be influenced by developmental stages, pupal sex, and generation with the future aim of applying this coleopteran as a diet supplement for human health. Growth rate and cumulative mortality percentage on the different feeding substrates were also evaluated to select the optimal conditions for a mass-raising of this insect species. Despite the different fat content in the six different breeding substrates used, T. molitor larvae and pupae contained a constant fat percentage (>34% in larvae and >30% in pupae). A similar total fat content was found comparing larvae and male and female pupae of the second generation to those of the first generation. On the contrary, FA composition differed both in larvae and pupae reared on the different feeding substrates. However, the exemplars reared on the diets based on 100% bread and 100% oat flour showed SFA, PUFA percentages, and an n-6/n-3 ratio more suitable for human consumption; the diet based on beer yeast, wheat flour, and oat flour resulted in a contemporary diet that most satisfied the balance between a fat composition of high quality and favorable growth conditions.
Seo, Gi Won; Jo, Yong Hun; Seong, Jeong Hwan; Park, Ki Beom; Patnaik, Bharat Bhusan; Tindwa, Hamisi; Kim, Sun-Am; Lee, Yong Seok; Kim, Yu Jung; Han, Yeon Soo
2016-08-20
The 14-3-3 family of phosphorylated serine-binding proteins acts as signaling molecules in biological processes such as metabolism, division, differentiation, autophagy, and apoptosis. Herein, we report the requirement of 14-3-3ɛ isoform from Tenebrio molitor (Tm14-3-3ɛ) in the hemocyte antimicrobial activity. The Tm14-3-3ɛ transcript is 771 nucleotides in length and encodes a polypeptide of 256 amino acid residues. The protein has the typical 14-3-3 domain, the nuclear export signal (NES) sequence, and the peptide binding residues. The Tm14-3-3ɛ transcript shows a significant three-fold expression in the hemocyte of T. molitor larvae when infected with Escherichia coli Tm14-3-3ɛ silenced larvae show significantly lower survival rates when infected with E. coli. Under Tm14-3-3ɛ silenced condition, a strong antimicrobial activity is elicited in the hemocyte of the host inoculated with E. coli. This suggests impaired secretion of antimicrobial peptides (AMP) into the hemolymph. Furthermore, a reduction in AMP secretion under Tm14-3-3ɛ silenced condition would be responsible for loss in the capacity to kill bacteria and might explain the reduced survivability of the larvae upon E. coli challenge. This shows that Tm14-3-3ɛ is required to maintain innate immunity in T. molitor by enabling antimicrobial secretion into the hemolymph and explains the functional specialization of the isoform.
Directory of Open Access Journals (Sweden)
Gi Won Seo
2016-08-01
Full Text Available The 14-3-3 family of phosphorylated serine-binding proteins acts as signaling molecules in biological processes such as metabolism, division, differentiation, autophagy, and apoptosis. Herein, we report the requirement of 14-3-3ɛ isoform from Tenebrio molitor (Tm14-3-3ɛ in the hemocyte antimicrobial activity. The Tm14-3-3ɛ transcript is 771 nucleotides in length and encodes a polypeptide of 256 amino acid residues. The protein has the typical 14-3-3 domain, the nuclear export signal (NES sequence, and the peptide binding residues. The Tm14-3-3ɛ transcript shows a significant three-fold expression in the hemocyte of T. molitor larvae when infected with Escherichia coli Tm14-3-3ɛ silenced larvae show significantly lower survival rates when infected with E. coli. Under Tm14-3-3ɛ silenced condition, a strong antimicrobial activity is elicited in the hemocyte of the host inoculated with E. coli. This suggests impaired secretion of antimicrobial peptides (AMP into the hemolymph. Furthermore, a reduction in AMP secretion under Tm14-3-3ɛ silenced condition would be responsible for loss in the capacity to kill bacteria and might explain the reduced survivability of the larvae upon E. coli challenge. This shows that Tm14-3-3ɛ is required to maintain innate immunity in T. molitor by enabling antimicrobial secretion into the hemolymph and explains the functional specialization of the isoform.
The impact of adult weight, age, and density on reproduction of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied. The impact of adult weight on reproduction was determined in two ways: 1) counting the daily progeny of individual adult pairs of known weight and analyzing the data with line...
Chae, Jun-Ho; Kurokawa, Kenji; So, Young-In; Hwang, Hyun Ok; Kim, Min-Su; Park, Ji-Won; Jo, Yong-Hun; Lee, Yong Seok; Lee, Bok Luel
2012-03-01
The biochemical characterization of novel antimicrobial peptides (AMPs) and the determination of ligand molecules that induce AMP production are essential for understanding the host innate immune response in insects. Here, we purified a new 14-kDa AMP, named tenecin 4, from the larval hemolymph of the beetle Tenebrio molitor. Tenecin 4 contains 14% glycine residues and has moderate similarities both to the C-terminal region of Drosophila attacin and to silk-moth gloverin proteins. Purified tenecin 4 showed bactericidal activity against Gram-negative Escherichia coli but not against Gram-positive Bacillus subtilis or the fungus Candida albicans. Tenecin 4 production was induced by Toll cascade-activating ligands, such as β-1,3-glucan, lysine-type peptidoglycan and active Spätzle, and by the probable Imd pathway-activating ligand monomeric meso-diaminopimelic acid-type peptidoglycan. Taken together, these data show that tenecin 4 is a defense protein against Gram-negative pathogens and is induced by multiple ligands in Tenebrio larvae. Copyright © 2011 Elsevier Ltd. All rights reserved.
A tapeworm molecule manipulates vitellogenin expression in the beetle Tenebrio molitor
Warr, E.; Meredith, J. M.; Nimmo, D. D.; Basu, S.; Hurd, H.; Eggleston, P.
2006-01-01
Metacestodes of Hymenolepis diminuta secrete a molecule that decreases vitellogenin (Vg) synthesis in the beetle host, Tenebrio molitor. The 5608 bp T. molitor Vg cDNA represents a single-copy gene encoding a single open reading frame of 1821 amino acids with a predicted molecular mass of 206 kDa. Northern blot analysis revealed detectable levels of transcripts only in adult females. In vivo, Vg mRNA abundance was significantly higher in fat bodies from infected females compared with control females at all but the earliest time point. In vitro, Vg mRNA abundance was significantly increased in fat bodies incubated with live stage I–II parasites. The apparent conflict between increased Vg mRNA abundance and decreased Vg protein in fat bodies from infected females is discussed. PMID:16907836
Beton, Daniela; Guzzo, Cristiane R; Ribeiro, Alberto F; Farah, Chuck S; Terra, Walter R
2012-09-01
Cathepsin L-like proteinases (CAL) are major digestive proteinases in the beetle Tenebrio molitor. Procathepsin Ls 2 (pCAL2) and 3 (pCAL3) were expressed as recombinant proteins in Escherichia coli, purified and activated under acidic conditions. Immunoblot analyses of different T. molitor larval tissues demonstrated that a polyclonal antibody to pCAL3 recognized pCAL3 and cathepsin L 3 (CAL3) only in the anterior two-thirds of midgut tissue and midgut luminal contents of T. molitor larvae. Furthermore, immunocytolocalization data indicated that pCAL3 occurs in secretory vesicles and microvilli in anterior midgut. Therefore CAL3, like cathepsin L 2 (CAL2), is a digestive enzyme secreted by T. molitor anterior midgut. CAL3 hydrolyses Z-FR-MCA and Z-RR-MCA (typical cathepsin substrates), whereas CAL2 hydrolyses only Z-FR-MCA. Active site mutants (pCAL2C25S and pCAL3C26S) were constructed by replacing the catalytic cysteine with serine to prevent autocatalytic processing. Recombinant pCAL2 and pCAL3 mutants (pCAL2C25S and pCAL3C26S) were prepared, crystallized and their 3D structures determined at 1.85 and 2.1 Å, respectively. While the overall structure of these enzymes is similar to other members of the papain superfamily, structural differences in the S2 subsite explain their substrate specificities. The data also supported models for CAL trafficking to lysosomes and to secretory vesicles to be discharged into midgut contents. Copyright © 2012 Elsevier Ltd. All rights reserved.
Wu, W.; Yang, S.; Brandon, A. M.; Yang, Y.; Flanagan, J. A.; Fan, H. Q.; Cai, S. Y.; Wang, Z. Y.; Din, L. Y.; Daliang, N.; Yang, J.; Ren, J.; Tao, H. C.; Phillips, D.; Ren, N. Q.; Zhou, J.; Waymouth, R.; Criddle, C. S.
2016-12-01
Pollution of waste plastics in soil, river, ocean, landfill and potentially groundwater has been a major environment concern for decades. They include polystyrene (PS), polyethylene (PE) and others. Plastic particles could penetrate into groundwater and become potential threats to our groundwater Our recent research demonstrated that mealworm (larvae of Tenebrio molitor ), which are commercially used as animal and bird food and insect protein, can biodegrade PS and convert it to CO2 up within 48% within 12-14 hrs in mealworm gut. PS degradation was performed initially via depolymerization and then degradation within the mealworm guts. Gut microbiota plays a major role in PS biodegradation because the degradation is nearly completely inhibited when mealworms were fed with antibiotics. Physical and chemical analysis as well 13C labeled tests confirmed the biodegradation and mineralization of PS. The generality of plastic eating behavior of mealworms and biodegradation has been observed by testing mealworms from 11 different sources in China and the USA. All of the mealworms tested consume PS although at different relative rates. At ambient temperature (20-24 oC), the average daily consumption rate of PS ranged from 0.01 to 0.3 mg per 100 mealworms when fed PS alone. The mealworms also consumed low density polyethylene (LDPE) foam as sole diet. When mealworms were fed PS alone, the consumption rate and total amount consumed increased slightly as a function of temperature from 20 to 30 oC. Supplementing the diet with normal food (bran) enhanced the PS consumption rate and the total PS mass consumed. Microbial community analysis indicated that the microbial structure changed significantly after the diet was switched from normal food bran to PS or PS plus bran. PS-degrading bacterial strains have isolated and characterized. Our discoveries brings hopes to prevent or solve potential microplastics threats to groundwater.
Endogenous egg immune defenses in the yellow mealworm beetle (Tenebrio molitor).
Jacobs, Chris G C; Gallagher, Joe D; Evison, Sophie E F; Heckel, David G; Vilcinskas, Andreas; Vogel, Heiko
2017-05-01
In order to survive microbe encounters, insects rely on both physical barriers as well as local and systemic immune responses. Most research focusses on adult or larval defenses however, whereas insect eggs are also in need of protection. Lately, the defense of eggs against microbes has received an increasing amount of attention, be it through endogenous egg defenses, trans-generational immune priming (TGIP) or parental investment. Here we studied the endogenous immune response in eggs and adults of Tenebrio molitor. We show that many immune genes are induced in both adults and eggs. Furthermore, we show that eggs reach comparable levels of immune gene expression as adults. These findings show that the eggs of Tenebrio are capable of an impressive endogenous immune response, and indicate that such inducible egg defenses are likely common in insects. Copyright © 2016 Elsevier Ltd. All rights reserved.
We studied the ability of Tenebrio molitor L. (Coleoptera: Tenebrionidae) to self-select optimal ratios of two dietary components to approach nutritional balance and maximum fitness. Life table analysis was used to determine the fitness of T. molitor developing in diet mixtures comprised of four dif...
Liu, Su; Rao, Xiang-Jun; Li, Mao-Ye; Feng, Ming-Feng; He, Meng-Zhu; Li, Shi-Guang
2015-03-01
We present the first antennal transcriptome sequencing information for the yellow mealworm beetle, Tenebrio molitor (Coleoptera: Tenebrionidae). Analysis of the transcriptome dataset obtained 52,216,616 clean reads, from which 35,363 unigenes were assembled. Of these, 18,820 unigenes showed significant similarity (E-value molitor OBPs and CSPs are closely related to those of T. castaneum. Real-time quantitative PCR assays showed that eight TmolOBP genes were antennae-specific. Of these, TmolOBP5, TmolOBP7 and TmolOBP16 were found to be predominantly expressed in male antennae, while TmolOBP17 was expressed mainly in the legs of males. Several other genes were identified that were neither tissue-specific nor sex-specific. These results establish a firm foundation for future studies of the chemosensory genes in T. molitor. Copyright © 2015 Elsevier Inc. All rights reserved.
Céspedes, Carlos L; Salazar, J Rodrigo; Martínez, Mariano; Aranda, Eduardo
2005-10-01
A methanol extract from the roots and aerial parts of Myrtillocactus geometrizans (Cactaceae) yielded peniocerol 1, macdougallin 2, and chichipegenin 3. The natural products 1, 2 their mixtures, MeOH and CH(2)Cl(2) extracts showed insecticidal and insect growth regulatory activity against fall armyworm [Spodoptera frugiperda J. E. Smith (Lepidoptera: Noctuidae)], an important insect pest of corn, and [Tenebrio molitor (Coleoptera)], a pest of stored grains in Mexico. The most active compounds were 1, 2, and a mixture (M(2)) of 1 and 2 (6:4). All these extracts, compounds and the mixture had insect growth regulating (IGR) activity between 5.0 and 50.0 ppm and insecticidal effects between 50 and 300 ppm in diets. The extracts were insecticidal to larvae, with lethal doses between 100 and 200 ppm. These compounds appear to have selective effects on the pre-emergence metabolism of Coleoptera, because in all treatments of the larvae of T. molitor, pupation were shortened and this process show precociousness in relation to controls. In contrast to S. frugiperda larvae, onset of pupation was noticeably delayed. Emergence in both cases was drastically diminished. In both pupae and in the few adults that were able to emerge, many deformations were observed. The results of these assays indicated that the compounds were more active than other known natural insect growth inhibitors such as gedunin and methanol extracts of Cedrela salvadorensis and Yucca periculosa. Peniocerol, macdougallin and chichipegenin, as well as mixtures of these substances, may be useful as natural insecticidal agents.
Tindwa, Hamisi; Jo, Yong Hun; Patnaik, Bharat Bhusan; Noh, Mi Young; Kim, Dong Hyun; Kim, Iksoo; Han, Yeon Soo; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung
2015-01-01
Macroautophagy (autophagy) is an evolutionarily conserved catabolic process involved in physiological and developmental processes including cell survival, death, and innate immunity. Homologues of most of 36 originally discovered autophagy-related (ATG) genes in yeast have been characterized in higher eukaryotes including insects. In this study, the homologues of ATG3 (TmATG3) and ATG5 (TmATG5) were isolated from the coleopteran beetle, Tenebrio molitor by expressed sequence tag and RNAseq approaches. The cDNA of TmATG3 and TmATG5 comprise open-reading frame sizes of 963 and 792 bp encoding polypeptides of 320 and 263 amino acid residues, respectively. TmATG3 and TmATG5 mRNA are expressed in all developmental stages, and mainly in fat body and hemocytes of larvae. TmATG3 and TmATG5 showed an overall sequence identity of 58-95% to other insect Atg proteins. There exist clear one-to-one orthologs of TmATG3 and TmATG5 in Tribolium and that they clustered together in the gene tree. Depletion of TmATG3 and TmATG5 by RNA interference led to a significant reduction in survival ability of T. molitor larvae against an intracellular pathogen, Listeria monocytogenes. Six days post-Listeria challenge, the survival rate in the dsEGFP-injected (where EGFP is enhanced green fluorescent protein) control larvae was significantly higher (55%) compared to 4 and 3% for TmATG3 and TmATG5 double-stranded RNA injected larvae, respectively. These data suggested that TmATG3 and TmATG5 may play putative role in mediating autophagy-based clearance of Listeria in T. molitor model. © 2014 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Yuliantoro Baliadi
2011-10-01
Full Text Available The pathogenicity, development and reproduction of Steinernema sp., isolate Skpr-20/Str, were studied using Tenebrio molitor. Results revealed that pathogenicity, development and reproduction were significantly influenced by nematode doses. Although the number of invading IJs increased with increasing dose, percentage penetration declined. The IJs reached adulthood within 3 days. Females laid eggs from day 4-7. All eggs remaining inside uterus develop inside the maternal body. The first female bearing endotokia matricida was observed on day 5. In a sand-based assay, nematode was more pathogenic at lower dose instead of higher ones, where optimum dose was 80 nematodes per larva and average number of progeny per female was 5438. Under crowded conditions, development proceeds to IJ stage instead of the J3. The average length and width decreased with increasing of nematode doses. The IJ produced in cadavers infested with 640 nematodes per larva was significantly smaller (492 ± 6.4 µm than offspring from other doses. The number of days which nematodes first emerged from the cadavers decreased with increasing dose. IJ first emerged at the average of 10-13 days at high IJ densities. It is concluded that the wide experimental characteristic of EPNs is also true for Steinernema sp., isolate Skpr-20/Str.
Patnaik, Bharat Bhusan; Kang, Seong Min; Seo, Gi Won; Lee, Hyo Jeong; Patnaik, Hongray Howrelia; Jo, Yong Hun; Tindwa, Hamisi; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung; Bang, In Seok; Han, Yeon Soo
2013-10-15
CD63, a member of the tetraspanin membrane protein family, plays a pivotal role in cell growth, motility, signal transduction, host-pathogen interactions and cancer. In this work, the cDNA encoding CD63 homologue (TmCD63) was cloned from larvae of a coleopteran beetle, Tenebrio molitor. The cDNA is comprised of an open reading frame of 705 bp, encoding putative protein of 235 amino acid residues. In silico analysis shows that the protein has four putative transmembrane domains and one large extracellular loop. The characteristic "Cys-Cys-Gly" motif and "Cys188" residues are highly conserved in the large extracellular loop. Phylogenetic analysis of TmCD63 revealed that they belong to the insect cluster with 50%-56% identity. Analysis of spatial expression patterns demonstrated that TmCD63 mRNA is mainly expressed in gut and Malphigian tubules of larvae and the testis of the adult. Developmental expression patterns of CD63 mRNA showed that TmCD63 transcripts are detected in late larval, pupal and adult stages. Interestingly, TmCD63 transcripts are upregulated to the maximum level of 4.5 fold, in response to DAP-type peptidoglycan during the first 6 h, although other immune elicitors also caused significant increase to the transcript level at later time-points. These results suggest that CD63 might contribute to T. molitor immune response against various microbial pathogens.
Directory of Open Access Journals (Sweden)
Yeon Soo Han
2013-10-01
Full Text Available CD63, a member of the tetraspanin membrane protein family, plays a pivotal role in cell growth, motility, signal transduction, host-pathogen interactions and cancer. In this work, the cDNA encoding CD63 homologue (TmCD63 was cloned from larvae of a coleopteran beetle, Tenebrio molitor. The cDNA is comprised of an open reading frame of 705 bp, encoding putative protein of 235 amino acid residues. In silico analysis shows that the protein has four putative transmembrane domains and one large extracellular loop. The characteristic “Cys-Cys-Gly” motif and “Cys188” residues are highly conserved in the large extracellular loop. Phylogenetic analysis of TmCD63 revealed that they belong to the insect cluster with 50%–56% identity. Analysis of spatial expression patterns demonstrated that TmCD63 mRNA is mainly expressed in gut and Malphigian tubules of larvae and the testis of the adult. Developmental expression patterns of CD63 mRNA showed that TmCD63 transcripts are detected in late larval, pupal and adult stages. Interestingly, TmCD63 transcripts are upregulated to the maximum level of 4.5 fold, in response to DAP-type peptidoglycan during the first 6 h, although other immune elicitors also caused significant increase to the transcript level at later time-points. These results suggest that CD63 might contribute to T. molitor immune response against various microbial pathogens.
Patnaik, Bharat Bhusan; Kang, Seong Min; Seo, Gi Won; Lee, Hyo Jeong; Patnaik, Hongray Howrelia; Jo, Yong Hun; Tindwa, Hamisi; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung; Bang, In Seok; Han, Yeon Soo
2013-01-01
CD63, a member of the tetraspanin membrane protein family, plays a pivotal role in cell growth, motility, signal transduction, host-pathogen interactions and cancer. In this work, the cDNA encoding CD63 homologue (TmCD63) was cloned from larvae of a coleopteran beetle, Tenebrio molitor. The cDNA is comprised of an open reading frame of 705 bp, encoding putative protein of 235 amino acid residues. In silico analysis shows that the protein has four putative transmembrane domains and one large extracellular loop. The characteristic “Cys-Cys-Gly” motif and “Cys188” residues are highly conserved in the large extracellular loop. Phylogenetic analysis of TmCD63 revealed that they belong to the insect cluster with 50%–56% identity. Analysis of spatial expression patterns demonstrated that TmCD63 mRNA is mainly expressed in gut and Malphigian tubules of larvae and the testis of the adult. Developmental expression patterns of CD63 mRNA showed that TmCD63 transcripts are detected in late larval, pupal and adult stages. Interestingly, TmCD63 transcripts are upregulated to the maximum level of 4.5 fold, in response to DAP-type peptidoglycan during the first 6 h, although other immune elicitors also caused significant increase to the transcript level at later time-points. These results suggest that CD63 might contribute to T. molitor immune response against various microbial pathogens. PMID:24132157
Directory of Open Access Journals (Sweden)
Murilo Fazolin
2007-02-01
Full Text Available Óleos essenciais das piperáceas Piper aduncum L., Piper hispidinervum C. DC. e da bignoniácea Tanaecium nocturnum (Barb. Rodr. Bur. & K. Shum foram avaliados para o controle de larvas de Tenebrio molitor L., 1758. Para a avaliação do efeito por contato em superfície contaminada, foram utilizados papéis-filtro impregnados com diferentes quantidades dos óleos essenciais. Para a avaliação do efeito tópico foram aplicados 5 mL de soluções com diferentes concentrações dos óleos sobre larvas de quinto instar do inseto. A taxa de mortalidade foi a variável utilizada para avaliar os experimentos. Todos os óleos essenciais apresentaram efeito inseticida sobre larvas de T. molitor, sendo que as respostas variaram em função da concentração utilizada, assim como do método de exposição do inseto. A toxicidade dos óleos essenciais foi elevada apresentando os seguintes valores de CL50: 0,045; 0,033 e 1,515 mL de óleo cm-2 para exposição por contato (papel filtro aos óleos de P. hispidinervum,P. aduncum e T. nocturnum, respectivamente. Para a aplicação tópica, os valores da DL50 foram de: 0,000025; 0,009 e 0,000015 mL de óleo mg de inseto -1 para os óleos essenciais de P. hispidinervum,P. aduncum e T. nocturnum, respectivamente. Resultados promissores para o emprego desses óleos essenciais como inseticidas foram obtidos utilizando-se concentrações acima de 3,0% (v v-1 para P. hispidinervum e 2,5% (v v-1 para P. aduncum e T. nocturnum.Essential oils from Piper aduncum L., Piper hispidinervum C. DC. (Piperaceae and Tanaecium nocturnum (Barb. Rodr. Bur.& K. Shum (Bignoniaceae were tested against Tenebrio molitor L., 1758 larvaes. Filter paper with different amounts of oils were employed for contact toxicity effects study. For topical effect study, aliquots of 5 mL of oils at different concentrations were applied on larvaes of the fifth instar. Mortality rate was used to evaluate the assays. All essential oils possessed
Jo, Yong Hun; Jung Kim, Yu; Beom Park, Ki; Hwan Seong, Jeong; Gon Kim, Soo; Park, Soyi; Young Noh, Mi; Seok Lee, Yong; Soo Han, Yeon
2017-01-01
Cactin was originally identified as an interactor of the Drosophila IκB factor Cactus and shown to play a role in controlling embryonic polarity and regulating the NF-κB signaling pathway. While subsequent studies have identified the roles for Cactin in the mammalian immune response, the immune function of Cactin in insects has not been described yet. Here, we identified a Cactin gene from the mealworm beetle, Tenebrio molitor (TmCactin) and characterized its functional role in innate immunity. TmCactin was highly expressed in prepupa to last instar stages, and its expression was high in the integument and Malpighian tubules of last instar larvae and adults. TmCactin was induced in larvae after infection with different pathogens and detectable within 3 hours of infection. The highest levels of TmCactin expression were detected at 9 hours post infection. TmCactin RNAi significantly decreased the survival rates of larvae after challenge with Escherichia coli and Staphylococcus aureus, but had no significant effect after challenge with Candida albicans. Furthermore, TmCactin RNAi significantly reduced the expression of seven antimicrobial peptide genes (AMPs) after bacterial challenge. Our results suggest that TmCactin may serve as an important regulator of innate immunity, mediating AMP responses against both Gram-positive and Gram-negative bacteria in T. molitor. PMID:28418029
Directory of Open Access Journals (Sweden)
Justyna MALISZEWSKA
2016-09-01
Full Text Available Pesticides are known to affect insects metabolic rate and CO2 release patterns. In the presented paper metabolic rate and mortality of mealworms Tenebrio molitor L. exposed to four different insecticides was evaluated, to find out whether there is a relationship between mealworms sensitivity to pesticides and their metabolic rate. Tenebrio molitor mortality was determined after intoxication with pyrethroid, oxadiazine, neonicotinoid and organophosphate. Metabolic rate before and after intoxication with insecticides was also determined. The highest CO2 production and mortality rate was observed after mealworms exposition to neonicotinoid insecticide. The results suggest that high CO2 release after intoxication is adequate to the intensity of the non-specific action of the xenobiotic (e.g. hyperactivity of neuromuscular system, rather than the intensity of detoxification processes, and it is correlated with mealworms mortality.
Lee, Wonhwa; Kim, Mi-Ae; Park, InWha; Hwang, Jae Sam; Na, MinKyun; Bae, Jong-Sup
2017-11-01
Tenebrio molitor is an edible insect that has antimicrobial, anticancer, and antihypertensive effects. The aim of this study was to identify the unreported bioactive compounds from T. molitor larvae with inhibitory activities against factor Xa (FXa) and platelet aggregation. Isolated compounds were evaluated for their anti-FXa and anti-platelet aggregation properties by monitoring clotting time, platelet aggregation, FXa activity, and thrombus formation. A diketopiperazine (1, cyclo( L -Pro- L -Tyr)) and a phenylethanoid (2, N-acetyltyramine) were isolated and inhibited the catalytic activity of FXa in a mixed inhibition model and inhibited platelet aggregation induced by adenosine diphosphate (ADP) and U46619. They inhibited ADP- and U46619-induced phosphorylation of myristoylated alanine-rich C kinase substrate (MARCKS) and the expression of P-selectin and PAC-1 in platelets. They also improved the production of nitric oxide and inhibited the oversecretion of endothelin-1 compared to that of the ADP- or U46619-treated group. In an animal model of arterial and pulmonary thrombosis, the isolated compounds showed enhanced antithrombotic effects. They also elicited anticoagulant effects in mice. Compounds 1-2 inhibited ADP-, collagen-, or U46619-induced platelet aggregation and showed similar anti-thrombotic efficacy to rivaroxaban, a positive control. Therefore, 1-2 could serve as candidates and provide scaffolds for the development of new anti-FXa and anti-platelet drugs. Copyright © 2017 Elsevier Ltd. All rights reserved.
Transcriptomic immune response of Tenebrio molitor pupae to parasitization by Scleroderma guani.
Directory of Open Access Journals (Sweden)
Jia-Ying Zhu
Full Text Available BACKGROUND: Host and parasitoid interaction is one of the most fascinating relationships of insects, which is currently receiving an increasing interest. Understanding the mechanisms evolved by the parasitoids to evade or suppress the host immune system is important for dissecting this interaction, while it was still poorly known. In order to gain insight into the immune response of Tenebrio molitor to parasitization by Scleroderma guani, the transcriptome of T. molitor pupae was sequenced with focus on immune-related gene, and the non-parasitized and parasitized T. molitor pupae were analyzed by digital gene expression (DGE analysis with special emphasis on parasitoid-induced immune-related genes using Illumina sequencing. METHODOLOGY/PRINCIPAL FINDINGS: In a single run, 264,698 raw reads were obtained. De novo assembly generated 71,514 unigenes with mean length of 424 bp. Of those unigenes, 37,373 (52.26% showed similarity to the known proteins in the NCBI nr database. Via analysis of the transcriptome data in depth, 430 unigenes related to immunity were identified. DGE analysis revealed that parasitization by S. guani had considerable impacts on the transcriptome profile of T. molitor pupae, as indicated by the significant up- or down-regulation of 3,431 parasitism-responsive transcripts. The expression of a total of 74 unigenes involved in immune response of T. molitor was significantly altered after parasitization. CONCLUSIONS/SIGNIFICANCE: obtained T. molitor transcriptome, in addition to establishing a fundamental resource for further research on functional genomics, has allowed the discovery of a large group of immune genes that might provide a meaningful framework to better understand the immune response in this species and other beetles. The DGE profiling data provides comprehensive T. molitor immune gene expression information at the transcriptional level following parasitization, and sheds valuable light on the molecular
Transcriptomic immune response of Tenebrio molitor pupae to parasitization by Scleroderma guani.
Zhu, Jia-Ying; Yang, Pu; Zhang, Zhong; Wu, Guo-Xing; Yang, Bin
2013-01-01
Host and parasitoid interaction is one of the most fascinating relationships of insects, which is currently receiving an increasing interest. Understanding the mechanisms evolved by the parasitoids to evade or suppress the host immune system is important for dissecting this interaction, while it was still poorly known. In order to gain insight into the immune response of Tenebrio molitor to parasitization by Scleroderma guani, the transcriptome of T. molitor pupae was sequenced with focus on immune-related gene, and the non-parasitized and parasitized T. molitor pupae were analyzed by digital gene expression (DGE) analysis with special emphasis on parasitoid-induced immune-related genes using Illumina sequencing. In a single run, 264,698 raw reads were obtained. De novo assembly generated 71,514 unigenes with mean length of 424 bp. Of those unigenes, 37,373 (52.26%) showed similarity to the known proteins in the NCBI nr database. Via analysis of the transcriptome data in depth, 430 unigenes related to immunity were identified. DGE analysis revealed that parasitization by S. guani had considerable impacts on the transcriptome profile of T. molitor pupae, as indicated by the significant up- or down-regulation of 3,431 parasitism-responsive transcripts. The expression of a total of 74 unigenes involved in immune response of T. molitor was significantly altered after parasitization. obtained T. molitor transcriptome, in addition to establishing a fundamental resource for further research on functional genomics, has allowed the discovery of a large group of immune genes that might provide a meaningful framework to better understand the immune response in this species and other beetles. The DGE profiling data provides comprehensive T. molitor immune gene expression information at the transcriptional level following parasitization, and sheds valuable light on the molecular understanding of the host-parasitoid interaction.
Transcriptomic Immune Response of Tenebrio molitor Pupae to Parasitization by Scleroderma guani
Zhu, Jia-Ying; Yang, Pu; Zhang, Zhong; Wu, Guo-Xing; Yang, Bin
2013-01-01
Background Host and parasitoid interaction is one of the most fascinating relationships of insects, which is currently receiving an increasing interest. Understanding the mechanisms evolved by the parasitoids to evade or suppress the host immune system is important for dissecting this interaction, while it was still poorly known. In order to gain insight into the immune response of Tenebrio molitor to parasitization by Scleroderma guani, the transcriptome of T. molitor pupae was sequenced with focus on immune-related gene, and the non-parasitized and parasitized T. molitor pupae were analyzed by digital gene expression (DGE) analysis with special emphasis on parasitoid-induced immune-related genes using Illumina sequencing. Methodology/Principal Findings In a single run, 264,698 raw reads were obtained. De novo assembly generated 71,514 unigenes with mean length of 424 bp. Of those unigenes, 37,373 (52.26%) showed similarity to the known proteins in the NCBI nr database. Via analysis of the transcriptome data in depth, 430 unigenes related to immunity were identified. DGE analysis revealed that parasitization by S. guani had considerable impacts on the transcriptome profile of T. molitor pupae, as indicated by the significant up- or down-regulation of 3,431 parasitism-responsive transcripts. The expression of a total of 74 unigenes involved in immune response of T. molitor was significantly altered after parasitization. Conclusions/Significance obtained T. molitor transcriptome, in addition to establishing a fundamental resource for further research on functional genomics, has allowed the discovery of a large group of immune genes that might provide a meaningful framework to better understand the immune response in this species and other beetles. The DGE profiling data provides comprehensive T. molitor immune gene expression information at the transcriptional level following parasitization, and sheds valuable light on the molecular understanding of the host
Yi, L.; Boekel, van T.; Lakemond, C.M.M.
2017-01-01
The potential of insects as an alternative protein source for food applications was investigated by studying the effect of pH and NaCl on extraction yield of water-soluble proteins from Tenebrio molitor, while preventing browning due to polyphenol oxidation. Minimum protein solubility (29.6%) was at
Broekhoven, van S.; Mota Gutierrez, J.; Rijk, de T.C.; Nijs, de W.C.M.; Loon, van J.J.A.
2017-01-01
Insects could provide an alternative and more sustainable source of animal protein compared to conventional livestock. Yellow mealworms (Tenebrio molitor L.) can be grown on diets composed of organic by-products. However, these diets could be contaminated with mycotoxins. Thus far, little is
Bovera, F; Piccolo, G; Gasco, L; Marono, S; Loponte, R; Vassalotti, G; Mastellone, V; Lombardi, P; Attia, Y A; Nizza, A
2015-01-01
The aim of the study was to evaluate the feasibility of replacing soybean meal (SBM) with Tenebrio molitor larvae (TML) meal in broiler diets. A total of 80 30-d-old male Shaver brown broilers were divided into two groups fed on two isoproteic and isoenergetic diets differing for protein source (SBM vs. TML). Up to 62 d of age, body weight and feed intake were recorded weekly and body weight gain, feed conversion ratio (FCR), protein efficiency ratio (PER) and European efficiency factor (EEF) were calculated. At 62 d, blood samples were collected from 16 birds/group for evaluation of blood profiles. Feed intake was not different between groups considering the entire period of the trial. The FCR was more favourable in the TML than SBM group from 46 d of age and in the entire period of the trial (4.13 vs. 3.62). The PER was higher in the SBM than in the TML group (1.92 vs. 1.37) while the EEF was higher in broilers fed on the TML diet (132.6 vs. 156.2). Albumin-to-globulin ratio was higher in broilers fed on SBM than in the other group (0.44 vs. 0.30). aspartate aminotransferase and alanine aminotransferase were higher in TML than SBM (195.1 vs. 178.6 U/l and 82.07 vs. 46.71 U/l, respectively). Uric acid was higher in broilers fed on SBM than TML (5.40 vs. 4.16 mg/dl). TML did not affect feed intake and growth rate of broilers from 30 to 62 d of age when compared to an isoproteic and isoenergetic SBM diet, but FCR of the TML group was more favourable than that of the SBM group. The lowest albumin-to-globulin ratio in broilers fed on TML suggests a higher immune response, probably due to the prebiotic effects of chitin.
Noh, Ju Young; Patnaik, Bharat Bhusan; Tindwa, Hamisi; Seo, Gi Won; Kim, Dong Hyun; Patnaik, Hongray Howrelia; Jo, Yong Hun; Lee, Yong Seok; Lee, Bok Luel; Kim, Nam Jung; Han, Yeon Soo
2014-01-25
Apolipophorin III (apoLp-III) is a well-known hemolymph protein having a functional role in lipid transport and immune response of insects. We cloned full-length cDNA encoding putative apoLp-III from larvae of the coleopteran beetle, Tenebrio molitor (TmapoLp-III), by identification of clones corresponding to the partial sequence of TmapoLp-III, subsequently followed with full length sequencing by a clone-by-clone primer walking method. The complete cDNA consists of 890 nucleotides, including an ORF encoding 196 amino acid residues. Excluding a putative signal peptide of the first 20 amino acid residues, the 176-residue mature apoLp-III has a calculated molecular mass of 19,146Da. Genomic sequence analysis with respect to its cDNA showed that TmapoLp-III was organized into four exons interrupted by three introns. Several immune-related transcription factor binding sites were discovered in the putative 5'-flanking region. BLAST and phylogenetic analyses reveal that TmapoLp-III has high sequence identity (88%) with Tribolium castaneum apoLp-III but shares little sequence homologies (molitor. Copyright © 2013 Elsevier B.V. All rights reserved.
van der Fels-Klerx, H J; Camenzuli, L; van der Lee, M K; Oonincx, D G A B
2016-01-01
Insects have potential as a novel source of protein in feed and food production in Europe, provided they can be used safely. To date, limited information is available on the safety of insects, and toxic elements are one of the potential hazards of concern. Therefore, we aimed to investigate the potential accumulation of cadmium, lead and arsenic in larvae of two insect species, Tenebrio molitor (yellow mealworm) and Hermetia illucens (black soldier fly), which seem to hold potential as a source of food or feed. An experiment was designed with 14 treatments, each in triplicate, per insect species. Twelve treatments used feed that was spiked with cadmium, lead or arsenic at 0.5, 1 and 2 times the respective maximum allowable levels (ML) in complete feed, as established by the European Commission (EC). Two of the 14 treatments consisted of controls, using non-spiked feed. All insects per container (replicate) were harvested when the first larva in that container had completed its larval stage. Development time, survival rates and fresh weights were similar over all treatments, except for development time and total live weight of the half of the maximum limit treatment for cadmium of the black soldier fly. Bioaccumulation (bioaccumulation factor > 1) was seen in all treatments (including two controls) for lead and cadmium in black soldier fly larvae, and for the three arsenic treatments in the yellow mealworm larvae. In the three cadmium treatments, concentrations of cadmium in black soldier fly larvae are higher than the current EC maximum limit for feed materials. The same was seen for the 1.0 and 2.0 ML treatments of arsenic in the yellow mealworm larvae. From this study, it can be concluded that if insects are used as feed materials, the maximum limits of these elements in complete feed should be revised per insect species.
Directory of Open Access Journals (Sweden)
Anna Adámková
2016-12-01
Full Text Available Edible insects have gained the status of highly nutritious food with high protein and fat content. However, nutritional value of insects is not constant. It could be affected by species, developmental stage, rearing technology, nutrition or sex. This study's goal is to determine the protein and fat contents of three edible beetle species (giant mealworm - larvae of Zophobas morio, mealworm - larvae of Tenebrio molitor and, lesser mealworm - larvae of Alphitobius diaperinus bred in the Czech Republic. Based on the obtained results, all investigated species could be considered as a reasonable source of lipids and two of them (mealworm and lesser mealworm are also an excellent source of protein. Crude protein content of mealworm (630 g. kg-1 DM was found to be higher than in other studies. The investigated species of lesser mealworm contained 600 g of crude protein/kg DM, which was equal to the results of other authors. Most authors report a higher content of nitrogen in the giant mealworm than were the values measured by this experiment (390 g.kg-1 DM. The lipid content in the tested samples was found in a range of 170 - 390 g.kg-1 DM. The highest lipid content was found in the larvae of giant mealworm and the lowest lipid content was found in the larvae of mealworm. The determined fat content of lesser mealworms was 290 g.kg-1. The fatty acid profiles of all samples were also determined.
Effect of temperature and gamma radiation on pupae of tenebrio molitor LINNE
International Nuclear Information System (INIS)
Arthur, Valter; Arthur, Paula Bergamin
2001-01-01
Among insect pests of grains and stored products Tenebrio molitor (Coleoptera : Tenebriodae) is one of the species of insects that attack flours, corn meal, rations, macaronis and damages grains. Chemical treatment is not always the remedy because it causes problems of residue on treated food. One alternative method of control is the application of ionization radiations as suggested by Hunter, some others recommended the use of gamma radiation to control insects that attack grains and stored products. Arthur and Wiendl reported that the sterilizing dose to adults of this species is 60 Gy. The effect of temperature after and before the gamma radiation to Laemophleous spp. Zabrotes subfasciatus and Sitophilus oryzae has been studied by many workers. Since no study with radiological effects in combination with temperature is reported on T. molitor, research work has been carried out to study the synergistic effects of gamma radiation and temperature on pupae of this insect
[Effects of venom from Sclerodermus sichuanensis Xiao on pupa of Tenebrio molitor].
Zhuo, Zhi-Hang; Yang, Wei; Qin, Huan; Yang, Chun-Ping; Yang, Hua; Xu, Dan-Ping
2013-11-01
To explore the regulatory mechanisms of parasitism of Sclerodermus sichuanensis on Tenebrio molitor, the methods of natural parasitism and venom injection were adopted to investigate the effects of the venom from S. sichuanensis on the pupa of T. molitor in the parasitic process. Under venom injection, the paralytic degree of the pupa had a positive correlation with the concentration of injected venom, and the number of recovered pupa had a negative correlation with the injected venom concentration. The T. molitor pupa was in slight and reversible paralysis when injected with 0.01 VRE (venom reservoir equivalent) of venom, and in non-reversible and complete paralysis when 0.2 VRE was injected. The pupa died massively and appeared a wide range of melanization when injected with soil bacterial suspension alone, but the melanization delayed and the mortality declined significantly when the mixed liquor of bacterium and venom was injected. The bacteriostasis of the venom on Staphylococcus aureus was significantly stronger than that on Escherichia coli. Within a definite range of temperature, the paralytic activity decreased significantly with increasing temperature, the bacteriostasis on S. aureus increased significantly, while that on E. coli was opposite. This study showed that the venom from S. sichuanensis had the effects of paralysis, bacteriostasis, inhibiting exuviations, and delaying melanization.
The variation in instar number and the pattern of sequential instar development time of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied under 4 different diet regimes. Addition of dietary supplements consisting of dry potato or a mix of dry potato and dry egg whites significantly reduced...
A nuptially transmitted ichthyosporean symbiont of Tenebrio molitor (Coleoptera: Tenebrionidae).
Lord, Jeffrey C; Hartzer, Kris L; Kambhampati, Srinivas
2012-01-01
The yellow mealworm, Tenebrio molitor, harbors a symbiont that has spores with a thick, laminated wall and infects the fat body and ventral nerve chord of adult and larval beetles. In adult males, there is heavy infection of the epithelial cells of the testes and between testes lobes with occasional penetration of the lobes. Spores are enveloped in the spermatophores when they are formed at the time of mating and transferred to the female's bursa copulatrix. Infection has not been found in the ovaries. The sequence of the nuclear small subunit rDNA indicates that the symbiont is a member of the Ichthyosporea, a class of protists near the animal-fungi divergence. © 2012 The Author(s) Journal of Eukaryotic Microbiology © 2012 International Society of Protistologists.
Cloning and baculovirus expression of a desiccation stress gene from the beetle, Tenebrio molitor.
Graham, L A; Bendena, W G; Walker, V K
1996-02-01
The cDNA sequence encoding a novel desiccation stress protein (dsp28) found in the hemolymph of the common yellow mealworm beetle, Tenebrio molitor, has been determined. The sequence encodes a 225 amino acid protein containing a 20 amino acid signal peptide. Dsp28 shows no significant similarity to any known nucleic acid or protein sequence. Levels of dsp28 mRNA were found to increase approx 5-fold following desiccation. Dsp28 cDNA has been cloned into a baculovirus expression vector and the expressed protein was compared to native dsp28. Both dsp28 expressed by recombinant baculovirus and native dsp28 are glycosylated and N-terminally processed. Although dsp28 is induced by cold in addition to desiccation stress, it does not contribute to the freezing point depression (thermal hysteresis) observed in Tenebrio hemolymph.
Ramli, Nur Hasyimah; Yaakop, Salmah
2018-04-01
Tenebrio molitor known as darkling beetle is burrowing insects and can be found all over the world. Tenebrio molitor samples were put in Open Roof Ventilation System, Free Air CO2 Enrichment and Rearing Room system. The development of Tenebrio molitor adult parents (P) and first generation (F1) that more exposed to high level of CO2 were studied. As the results, parent and first generation (F1) of T. molitor shows that there are no significant effects of CO2 on their development. But, decreased development pattern showed between parent and F1 can be used to estimate that prolonged exposure of CO2 will change their development. The highest development of parent showed by OFVSP (0.1708±0.0013) mm, while the lowest showed by FACEP (0.1686±0.0013) mm. For F1, the highest development showed by OFVS F1 (0.1705±0.0015) mm, while RR F1 becomes the lowest (0.1649±0.0023) mm. No significant difference shown by ANOVA test. Unfortunately, the data cannot be used to prove that the development of parent and F1 were affected by CO2 because no significant difference recorded between them. Correlation coefficient analysis of OFVSP and OFVS F1 presented to support the results. It shows that the correlation coefficient among characters from parents and F1 are different. Further study should be done in future to increase our knowledge of the climate change on insects.
Directory of Open Access Journals (Sweden)
Daniele Fabiana Glaeser
2014-06-01
Full Text Available The successive rearing of parasitoids in factitious hosts may affect its biological quality. Trichospilus diatraeae Cherian & Margabandhu, 1942 (Hymenoptera: Eulophidae has been studied for the biological control of sugarcane borer [Diatraea saccharalis (Fabricius, 1794 (Lepidoptera: Crambidae]. This study aimed to evaluate whether the rearing of T. diatraeae for three generations in the factitious host Tenebrio molitor Linnaeus, 1758 (Coleoptera: Tenebrionidae affects its reproductive performance, when subsequently reared in the natural host pupae D. saccharalis. Two groups of T. diatraeae were reared separately for three generations: one in pupae of T. molitor and the other in pupae of D. saccharalis. Subsequently, 20 pupae of D. saccharalis were exposed, for 72 hours, to the parasitism of T. diatraeae females reared earlier in pupae of T. molitor or D. saccharalis. The successive rearing of T. diatraeae in the factitious host did not affect the number of pupae parasitized and the number of pupae in which the emergence of parasitoids occurred in the natural host D. saccharalis, and increased the longevity of females and the sex ratio of T. diatraeae. The progeny, duration of developmental cycle (egg to adult, width of head capsule of males and females and longevity of males of T. diatraeae were similar on both treatments. T. diatraeae can be reared in the factitious host T. molitor for three generations without compromising its reproductive performance, when subsequently reared in the natural host D. saccharalis.
Inbreeding affects sexual signalling in males but not females of Tenebrio molitor.
Pölkki, Mari; Krams, Indrikis; Kangassalo, Katariina; Rantala, Markus J
2012-06-23
In many species of animals, individuals advertise their quality with sexual signals to obtain mates. Chemical signals such as volatile pheromones are species specific, and their primary purpose is to influence mate choice by carrying information about the phenotypic and genetic quality of the sender. The deleterious effects of consanguineous mating on individual quality are generally known, whereas the effect of inbreeding on sexual signalling is poorly understood. Here, we tested whether inbreeding reduces the attractiveness of sexual signalling in the mealworm beetle, Tenebrio molitor, by testing the preferences for odours of inbred and outbred (control) individuals of the opposite sex. Females were more attracted to the odours produced by outbred males than the odours produced by inbred males, suggesting that inbreeding reduces the attractiveness of male sexual signalling. However, we did not find any difference between the attractiveness of inbred and outbred female odours, which may indicate that the quality of females is either irrelevant for T. molitor males or quality is not revealed through female odours.
The movement observed in the Tenebrio molitor L., 1758 (Coleoptera: Tenebrionidae) pupae can be a type of defense strategy. This makes it significant to study the development and reproduction of the predatory stinkbugs Asopinae with the immobilized pupae of this prey. The aim was to evaluate the per...
Gallagher, Joe D; Siva-Jothy, Michael T; Evison, Sophie E F
2018-02-01
Social immunization (SI) is a horizontal transfer of immunity that protects naive hosts against infection following exposure to infected nestmates. While mainly documented in eusocial insects, non-social species also share similar ecological features which favour the development of group-level immunity. Here, we investigate SI in Tenebrio molitor by pairing naive females with a pathogen-challenged conspecific for 72 h before measuring a series of immune and fitness traits. We found no evidence for SI, as beetles who cohabited with a live pathogen-challenged conspecific were not better protected against bacterial challenge. However, exposure to a heat-killed-bacteria-challenged conspecific appeared to increase pathogen tolerance, which manifested in differential fitness investment. Our results together suggest that T. molitor do respond to immune-related cues in the social environment, despite not showing a classic immunization response as predicted. © 2018 The Author(s).
Jin, X. H.; Heo, P. S.; Hong, J. S.; Kim, N. J.; Kim, Y. Y.
2016-01-01
This experiment was conducted to investigate the effects of dried mealworm (Tenebrio molitor larva) on growth performance, nutrient digestibility and blood profiles in weaning pigs. A total of 120 weaning pigs (28±3 days and 8.04±0.08 kg of body weight) were allotted to one of five treatments, based on sex and body weight, in 6 replicates with 4 pigs per pen by a randomized complete block design. Supplementation level of dried mealworm was 0%, 1.5%, 3.0%, 4.5%, or 6.0% in experimental diet as treatment. Two phase feeding programs (phase I from 0 day to 14 day, phase II from 14 day to 35 day) were used in this experiment. All animals were allowed to access diet and water ad libitum. During phase I, increasing level of dried mealworm in diet linearly improved the body weight (p<0.01), average daily gain (ADG) (p<0.01) and average daily feed intake (ADFI) (p<0.01). During phase II, ADG also tended to increase linearly when pigs were fed higher level of dried mealworm (p = 0.08). In addition, increasing level of dried mealworm improved the ADG (p<0.01), ADFI (p<0.05) and tended to increase gain to feed ratio (p = 0.07) during the whole experimental period. As dried mealworm level was increased, nitrogen retention and digestibility of dry matter as well as crude protein were linearly increased (p = 0.05). In the results of blood profiles, decrease of blood urea nitrogen (linear, p = 0.05) and increase of insulin-like growth factor (linear, p = 0.03) were observed as dried mealworm was increased in diet during phase II. However, there were no significant differences in immunoglobulin A (IgA) and IgG concentration by addition of dried mealworm in the growth trial. Consequently, supplementation of dried mealworm up to 6% in weaning pigs’ diet improves growth performance and nutrient digestibility without any detrimental effect on immune responses. PMID:27282974
DEFF Research Database (Denmark)
Maistrou, Sevasti; Paris, Véronique; Jensen, Annette Bruun
2018-01-01
-evolution they share. In this study, we investigated role of a constitutively expressed thaumatin-like peptide with antifungal activity expressed by the mealworm beetle Tenebrio molitor, named Tenecin 3, during a natural infection with the entomopathogenic fungus Beauveria bassiana. We monitored the effect...
Wang, Xuegui; Hao, Qiang; Chen, Yiqu; Jiang, Surong; Yang, Qunfang; Li, Qing
2015-01-01
The major chemical components of four essential oils (EOs) extracted from dry leaves of Citrus limonum, Cymbopogon citratus, Litsea cubeba, and Muristica fragrans were analyzed with gas chromatograph-mass spectrometer and their fumigant, contact, and repellent activities against 10th instar and adults of Tenebrio molitor were also assayed. The results indicated that the major constituents of C. limonum and Cy. citrates were D-limonene (38.22%) and 3,7-dimethyl-6-octenal (26.21%), while which of L. cubeba and M. fragrans were (E)-3, 7-dimethyl-2, 6-octadienal (49.78%) and (E)-cinnamaldehyde (79.31%), respectively. Contact activities of L. cubeba and C. limonum with LC50 values of 21.2 and 13.9 µg/cm(2) at 48 h and repellence activities (>89.0% repellence indexes) (P molitor compared with the control. The mainly active ingredients of L. cubeba and C. limonum, including D-limonene and β-pinene, were demonstrated to coinhibit the actives of AChE and enhance the toxicities on 10th instar of T. molitor. These results indicate that the EOs of L. cubeba and C. limonum could have great potential as botanical insecticides against T. molitor. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
Effects of gamma radiation on various stages in the life cycle of meal worm, Tenebrio molitor Lin
International Nuclear Information System (INIS)
Chiravathanapong, S.; Segsarnviriya, S.
1984-12-01
Effect of gamma radiation on each growth stage of meal worm (Tenebrio molitor Lin.) were conducted at 27+-2 0 C and 75+-2% relative humidity. LD 50 and LD 99 of 5-day old eggs at 5 days after irradiation were 76 and 367 gray. The survived larvae could live no longer than 5 days and seldom moved or without feeding. LD 50 and LD 99 of last instar larvae at 10 days after irradiation were 662 and 1,367 gray. No pupation occurred in larvae after irradiation. Dead larvae caused by radiation turned blackish, liquid oozed out from the body, and survived no longer than 5 days. Some irradiated larvae had incomplete molting and died. LD 50 and LD 99 of 6-day-old pupae at 3 days after irradiation were 874 and 1,492 gray. Abnormal irradiated pupae, some abnormal pupae were underdeveloped wing and abdominal pupal characteristic was still remained. Pupal legs could develop to adult legs only and could survive no longer than 1 week. Unfortunately pupae irradiated at low dosage of radiation would develop to be complete adult head, but could survive no longer than 2 weeks with slow movement and no oviposition. LD 50 of male adults and female adults was checked in 7 days postirradiation and it was estimated as 788 and 786 gray while LD 99 was estimated as 1,375 and 1,350 gray respectively. Results of male adults and female adults checking in 10 days post-irradiation found that LD 50 was estimated as 533 and 598 gray and LD 99 was estimated as 1,227 and 1,229 gray respectively. The remained survivors of both sexes could survive no longer than 10 days without feeding and mating
Lee, Jung Hee; Jo, Yong Hun; Patnaik, Bharat Bhusan; Park, Ki Beom; Tindwa, Hamisi; Seo, Gi Won; Chandrasekar, Raman; Lee, Yong Seok; Han, Yeon Soo
2015-01-01
Autophagy is a process that is necessary during starvation, as it replenishes metabolic precursors by eliminating damaged organelles. Autophagy is mediated by more than 35 autophagy-related (Atg) proteins that participate in the nucleation, elongation, and curving of the autophagosome membrane. In a pursuit to address the role of autophagy during development and immune resistance of the mealworm beetle, Tenebrio molitor, we screened ATG gene sequences from the whole-larva transcriptome database. We identified a homolog of ATG13 gene in T. molitor (designated as TmATG13) that comprises a cDNA of 1176 bp open reading frame (ORF) encoding a protein of 391 amino acids. Analyses of the structure-specific features of TmAtg13 showed an intrinsically disordered middle and C-terminal region that was rich in regulatory phosphorylation sites. The N-terminal Atg13 domain had a HORMA (Hop1, Rev7, and Mad2) fold containing amino acid residues conserved across the Atg13 insect orthologs. A quantitative reverse-transcription-polymerase chain reaction analysis revealed that TmATG13 was expressed ubiquitously during all developmental stages of the insect. TmATG13 mRNA expression was high in the fat body and gut of the larval and adult stages of the insect. The TmATG13 transcripts were expressed at a high level until 6 days of ovarian development, followed by a significant decline. Silencing of ATG13 transcripts in T. molitor larvae showed a reduced survivability of 39 and 38% in response to Escherichia coli and Staphylococcus aureus infection. Furthermore, the role of TmAtg13 in initiating autophagy as a part of the host cell autophagic complex of the host cells against the intracellular pathogen Listeria monocytogenes is currently under study and will be critical to unfold the structure-function relationships. PMID:26136688
Bjørge, Julie Dahl; Overgaard, Johannes; Malte, Hans; Gianotten, Natasja; Heckmann, Lars-Henrik
2018-03-10
Insects are increasingly used as a dietary source for food and feed and it is therefore important to understand how rearing conditions affect growth and development of these agricultural animals. Temperature is arguably the most important factor affecting metabolism and growth rate in insects. Here, we investigated how rearing temperature affected growth rate, growth efficiency and macronutrient composition in two species of edible beetle larvae: Alphitobius diaperinus and Tenebrio molitor. Growth rates of both species were quantified at temperatures ranging from 15.2 to 38.0 °C after which we measured protein and lipid content of the different treatment groups. Metabolic rate was measured in a similar temperature range by measuring the rate of O 2 consumption (V·O 2 ) and CO 2 production (V·CO 2 ) using repeated measures closed respirometry. Using these measurements, we calculated the growth efficiency of mealworms by relating the energy assimilation rate to the metabolic rate. Maximum daily growth rates were 18.3% and 16.6% at 31 °C, for A. diaperinus and T. molitor respectively, and we found that A. diaperinus was better at maintaining growth at high temperatures while T. molitor had superior growth at lower temperatures. Both species had highest efficiencies of energy assimilation in the temperature range of 23.3-31.0 °C, with values close to 2 J assimilated/J metabolised in A. diaperinus and around 4 J assimilated/J metabolised in T. molitor. Compared to "conventional" terrestrial livestock, both species of insects were characterised by high growth rates and very high energy conversion efficiency at most experimental temperatures. For A. diaperinus, lipid content was approximately 30% of dry mass and protein content approximately 50% of dry mass across most temperatures. Temperature had a greater influence on the body composition of T. molitor. At 31.0 °C the lipid and protein content was measured to 47.4% and 37.9%, respectively but lipid
International Nuclear Information System (INIS)
Yang, Q.; Feng, H.
2013-01-01
Summary: A cDNA encoding antifreeze protein (AFP84c) was cloned by RT-PCR from the larva of the yellow mealworm Tenebrio molitor. The coding fragment of 252 bp encodes a protein of 84 amino acid residues and was fused to the expression vectors pMAL-c2X and pMAL-p2X. The expression plasmids pMAL-c2X-afp84c and pMAL-p2X-afp84c were constructed and transformed into Escherischia coli strains TBI, respectively. Strategy of optimization of induction conditions were used for expression of the highly disulfide-bonded beta-helix-contained protein with the activity of antifreeze in pMALTM expression system. The target fusion protein was released from the cytoplasm and periplasm by sonication and cold osmotic shock procedure respectively. Recombinant AFP84c was purified by amylose affinity column. The purified target protein displayed a single band in SDS-PAGE. Expressed AFP84c exhibits to increase low temperature resistance of bacteria. (author)
A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*
Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis
2009-01-01
Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepid...
Vorhees, Ashley S; Bradley, Timothy J
2012-07-01
Thermal limits to activity profoundly affect the abundance and distribution of ectothermic animals. Upper thermal limits to activity are typically reported as the critical thermal maximum (CT(max)), the temperature at which activity becomes uncontrolled. Thermolimit respirometry is a new technique that allows CT(max) to be quantified in small animals, such as insects, as the point of spiracular failure by measuring CO(2) release from the animal as temperature increases. Although prior studies have reported a characteristic pattern of CO(2) release for insects during thermolimit respirometry trials, no studies have been carried out to determine the universality of this pattern across development, or at what point death occurs along this pattern. Here, we compared the CT(max) and patterns of CO(2) release among three life stages of a beetle species, Tenebrio molitor, and mapped heat death onto these patterns. Our study is the first to report distinct patterns of CO(2) release in different life stages of an insect species during thermolimit respirometry. Our results show that CT(max) was significantly higher in adult beetles than in either larvae or pupae (P<0.001) and, similarly, death occurred at higher temperatures in adults than in larvae and pupae. We also found that death during heating closely follows CT(max) in these animals, which confirms that measuring the loss of spiracular control with thermolimit respirometry successfully identifies the point of physiological limitation during heat stress.
Kim, Soo Gon; Jo, Yong Hun; Seong, Jeong Hwan; Park, Ki Beom; Noh, Mi Young; Cho, Jun Ho; Ko, Hye Jin; Kim, Chang Eun; Tindwa, Hamisi; Patnaik, Bharat Bhusan; Bang, In Seok; Lee, Yong Seok; Han, Yeon Soo
2017-10-01
Scavenger receptors (SRs) constitute a family of membrane-bound receptors that bind to multiple ligands. The SR family of proteins is involved in removing cellular debris, oxidized low-density lipoproteins, and pathogens. Specifically, class C scavenger receptors (SR-C) have also been reported to be involved in phagocytosis of gram-positive and -negative bacteria in Drosophila and viruses in shrimp. However, reports are unavailable regarding the role of SR-C in antifungal immune mechanisms in insects. In this study, a full-length Tenebrio molitor SR-C (TmSR-C) sequence was obtained by 5'- and 3'-Rapid amplification of cDNA ends-polymerase chain reaction (RACE-PCR). The TmSR-C full-length cDNA comprised 1671 bp with 5'- and 3'-untranslated regions of 23- and 107-bp, respectively. TmSR-C encodes a putative protein of 556 amino acid residues that is constitutively expressed in all tissues of late instar larvae and 2-day-old adults, with the highest transcript levels observed in hemocytes of larvae and adults. TmSR-C mRNA showed a 2.5-fold and 3-fold increase at 24 and 6 h after infection with Candida albicans and β-glucan, respectively. Immunoassay with TmSR-C polyclonal antibody showed induction of the putative protein in the cytosols of hemocytes at 3 h after inoculation of C. albicans. RNA interference (RNAi)-based gene silencing and phagocytosis assays were used to understand the role of TmSR-C in antifungal immunity. Silencing of TmSR-C transcripts reduced the survivability of late instar larvae at 2 days post-inoculation of C. albicans, Escherichia coli, or Staphylococcus aureus. Furthermore, in TmSR-C-silenced larvae, there was a decline in the rate of microorganism phagocytosis. Taken together, results of this study suggest that TmSR-C plays a pivotal role in phagocytosing not only fungi but also gram-negative and -positive bacteria in T. molitor. Copyright © 2017. Published by Elsevier Ltd.
Welfare of the mealworm (Tenebrio molitor breeding with regard to nutrition value and food safety
Directory of Open Access Journals (Sweden)
Anna Adámková
2017-01-01
Full Text Available Livestock welfare is an important condition for obtaining high-quality and safe food. According to the legislation edible insects are classified as livestock; and for this reason it is necessary to comply with the edible insect welfare conditions. This article focuses on selected welfare conditions for mealworm (Tenebrio molitor breeding, with special focus on the fat content influenced by different breeding temperature (17 °C, 23 °C and 28 °C. Maximum fat content 24.56% was observed at 23 °C. To obtain maximum fat content this appears to be the optimal breeding temperature. Another evaluated aspect was the nutritional stress and a way of killing, and their impact on fat content, which showed to decrease with the nutrient stress. The most decline was detected towards the end of the observation period. The analysis showed that in terms of preservation of the fat content, the best way is killing by freezing, due to the metabolism slowdown. We also analysed the content of heavy metals in a mealworm larvae using cyclic voltammetry with subsequent evaluation. In the measured sample concentrations of heavy metals did not exceed the maximum allowable concentration of heavy metals in this commodity. From this point of view mealworm appears to be a safe food.
McCallum, Malcolm L; Matlock, Makensey; Treas, Justin; Safi, Barroq; Sanson, Wendy; McCallum, Jamie L
2013-12-01
The role that endocrine disruption could play in sexual selection remains relatively untested, and although estrogens occur in insects, little information exists about their biological role in insect reproduction. Atrazine is a commonly applied herbicide that mimics estrogen in vertebrates. Tenebrio molitor were raised from egg to adult under a gradation of environmentally relevant atrazine exposures and a non-treated control. Atrazine was delivered in the drinking water ad libitum. Female T. molitor were provided with a choice between unrelated males raised under three levels of atrazine exposures. Female preference for males demonstrated a non-monotonic inverted U-shaped response to atrazine exposure. There was no significant difference between the control and the high exposure to atrazine. Excluding the control, female preference increased as exposure concentration increased. These results have important repercussions for nonlethal effects of endocrine disruption on populations, their capacity to interfere with sexual selection, and the role of estrogen in pheromone communication among insects.
Furuya, K; Liao, S; Reynolds, S E; Ota, R B; Hackett, M; Schooley, D A
1993-12-01
We isolated several cardioactive peptides from extracts of whole heads of the mealworm, Tenebrio molitor, and the southern armyworm, Spodoptera eridania, using a semi-isolated heart of Manduca sexta for bioassay. We have now isolated from each species the peptide with the strongest effect on rate of contraction of the heart. The peptides were identified using micro Edman sequencing and mass spectrometric methods. This cardioactive peptide has the same primary structure from both species: Pro-Phe-Cys-Asn-Ala-Phe-Thr-Gly-Cys-NH2, a cyclic nonapeptide which is identical to crustacean cardioactive peptide (CCAP) originally isolated from the shore crab, Carcinus maenas, and subsequently isolated from Locusta migratoria and Manduca sexta. This is additional evidence that CCAP has widespread occurrence in arthropoda.
Trade-off between cellular immunity and life span in mealworm beetles Tenebrio molitor
Directory of Open Access Journals (Sweden)
Indrikis KRAMS, Janīna DAUKŠTE, Inese KIVLENIECE, Ants KAASIK, Tatjana KRAMA, Todd M. REEBERG, Markus J. RANTALA
2013-06-01
Full Text Available Encapsulation is a nonspecific, cellular response through which insects defend themselves against multicellular pathogens. During this immune reaction, haemocytes recognize an object as foreign and cause other haemocytes to aggregate and form a capsule around the object, often consisting of melanized cells. The process of melanisation is accompanied by the formation of potentially toxic reactive oxygen species, which can kill not only pathogens but also host cells. In this study we tested whether the encapsulation response is costly in mealworm beetles Tenebrio molitor. We found a negative relationship between the duration of implantation via a nylon monofilament and remaining life span. We also found a negative relationship between the strength of immune response and remaining life span, suggesting that cellular immunity is costly in T. molitor, and that there is a trade-off between immune response and remaining life span. However, this relationship disappeared at 31-32 hours of implantation at 25 ± 2℃. As the disappearance of a relationship between duration of implantation and lifespan coincided with the highest values of encapsulation response, we concluded that the beetles stopped investment in the production of melanotic cells, as the implant, a synthetic parasite, was fully isolated from the host’s tissues [Current Zoology 59 (3: 340–346, 2013].
Cloning and expression of a novel antifreeze protein AFP72 from the beetle Tenebrio molitor.
Yan, Qing-Hua; Yang, Li; Wang, Qing; Zhang, Hui-Rong; Shao, Qiang
2012-01-01
A novel antifreeze protein AFP72 cDNA (GenBbank accession No. AY929389) was obtained by RT-PCR from Tenebrio molitor. The 216 bp fragment encodes a protein of 72 amino acid residues. Sequence analysis revealed that the cDNA displays a high degree of homology with T. molitor antifreeze proteins, ranging up to 90.78%. Recombinant plasmids pMAL-p2X-afp72 and pMAL-c2X-afp72 were transferred into E. coil TBI to induce a MBP fusion protein by IPTG. The target fusion protein was released from the periplasm and cytoplasm by the cold osmotic shock procedure and sonication respectively. The content of the fusion protein came up to 38.9 and 41.5% of the total dissolved protein, respectively. The fusion protein was purified through an amylose affinity column, and incised by factor Xa. Molecular sieve chromatography was used to achieve a high state of purity of the target protein. The purified target protein displayed a single band in SDS-PAGE. The fusion protein was shown to increase resistance to low temperatures in bacteria. This finding could help in further investigations of the properties and function of antifreeze proteins.
Chowanski, Szymon; Rosinski, Grzegorz
2017-01-01
In mammals, the cholinergic nervous system plays a crucial role in neuronal regulation of physiological processes. It acts on cells by two types of receptors - nicotinic and muscarinic receptors. Both signal transmission pathways also operate in the central and peripheral cholinergic nervous system of insects. In our pharmacological experiments, we studied the effects of two muscarinic agonists (carbachol, pilocarpine) and two muscarinic antagonists (atropine, scopolamine) on the muscle contractile activity of visceral organs in the beetle, Tenebrio molitor. Both antagonists, when injected to haemolymph at concentration 10-5 M, caused delayed and prolonged cardioinhibitory effects on heart contractility in ortho- and antidromic phases of heart activity in T. molitor pupa what was observed as negative chrono- and inotropic effects. Agonist of muscarinic receptors - carbachol evoked opposite effect and increased contraction rate but only in antidromic phase. Pilocarpine, the second agonist induced weak negative chronotropic effects in the antiand orthodromic phases of heart activity. However, neither agonists had an effect on semi-isolated beetle heart in vitro. Only atropine at the highest tested concentrations slightly decreased the frequency of myocardial contractions. These suggest the regulation of heart activity by muscarinic system indirectly. The tested compounds also affected the contractility of the oviduct and hindgut, but the responses of these organs were varied and depended on the concentration of the applied compounds. These pharmacological experiments suggest the possible modulation of insect visceral muscle contractility by the cholinergic nervous system and indirectly indicate the presence of muscarinic receptor(s) in the visceral organs of the beetle T. molitor. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
Blankespoor, C L; Pappas, P W; Eisner, T
1997-07-01
The defensive glands of beetles, Tenebrio molitor, infected with metacestodes (cysticercoids) of Hymenolepis diminuta are everted less frequently upon stimulation, and contain less toluquinone (methylbenzoquinone) and m-cresol, than glands of uninfected controls. These differences, as shown in predation trials with wild rats, increase the likelihood that both cysticercoids and beetles will be ingested by the tapeworm's definitive host. This is the first documented case of a parasite inhibiting the chemical defence of an intermediate host, and one of only a few reports of parasite-induced manipulation of host biology supported by empirical evidence implicating facilitated parasite transmission between host species.
Kim, Dong Hyun; Patnaik, Bharat Bhusan; Seo, Gi Won; Kang, Seong Min; Lee, Yong Seok; Lee, Bok Luel; Han, Yeon Soo
2013-11-01
We have identified novel ricin-type (R-type) lectin by sequencing of random clones from cDNA library of the coleopteran beetle, Tenebrio molitor. The cDNA sequence is comprised of 495 bp encoding a protein of 164 amino acid residues and shows 49% identity with galectin of Tribolium castaneum. Bioinformatics analysis shows that the amino acid residues from 35 to 162 belong to ricin-type beta-trefoil structure. The transcript was significantly upregulated after early hours of injection with peptidoglycans derived from Gram (+) and Gram (-) bacteria, beta-1, 3 glucan from fungi and an intracellular pathogen, Listeria monocytogenes suggesting putative function in innate immunity. Copyright © 2013 Elsevier Inc. All rights reserved.
Andersen, Svend Olav; Roepstorff, Peter
2007-03-01
The number of reactive amino groups in cuticular proteins decreases during the early period of insect cuticular sclerotization, presumably due to reaction with oxidation products of N-acetyldopamine (NADA) and N-beta-alanyldopamine (NBAD). We have quantitated the decrease in cuticular N-terminal amino groups and lysine epsilon-amino groups during the first 24h of sclerotization in adult locusts, Schistocerca gregaria, and in larval and adult beetles, Tenebrio molitor, as well as the increase in beta-alanine amino groups in Tenebrio cuticle. The results indicate that nearly all glycine N-terminal groups and a significant part of the epsilon-amino groups from lysine residues are involved in the sclerotization process in both locusts and Tenebrio. A pronounced increase in the amount of free beta-alanine amino groups was observed in cuticle from adult Tenebrio and to a lesser extent also in Tenebrio larval cuticle, but from locust cuticle no beta-alanine was obtained. Hydrolysis of sclerotized cuticles from locusts and Tenebrio by dilute hydrochloric acid released a large number of compounds containing amino acids linked to catecholic moieties. Products have been identified which contain histidine residues linked via their imidazole group to the beta-position of various catechols, such as dopamine, 3,4-dihydroxyphenyl-ethanol (DOPET), and 3,4-dihydroxyphenyl-acetaldehyde (DOPALD), and a ketocatecholic compound has also been identified composed of lysine linked via its epsilon-amino group to the alpha-carbon atom of 3,4-dihydroxyacetophenone. Some of the hydrolysis products have previously been obtained from sclerotized pupal cuticle of Manduca sexta [Xu, R., Huang, X., Hopkins, T.L., Kramer, K.J., 1997. Catecholamine and histidyl protein cross-linked structures in sclerotized insect cuticle. Insect Biochemistry and Molecular Biology 27, 101-108; Kerwin, J.L., Turecek, F., Xu, R., Kramer, K.J., Hopkins, T.L., Gatlin, C.L., Yates, J.R., 1999. Mass spectrometric analysis
Zúñiga-Navarrete, Fernando; Gómez, Isabel; Peña, Guadalupe; Amaro, Itzel; Ortíz, Ernesto; Becerril, Baltazar; Ibarra, Jorge E; Bravo, Alejandra; Soberón, Mario
2015-04-01
Bacillus thuringiensis Cry toxins exert their toxic effect by specific recognition of larval midgut proteins leading to oligomerization of the toxin, membrane insertion and pore formation. The exposed domain II loop regions of Cry toxins have been shown to be involved in receptor binding. Insect cadherins have shown to be functionally involved in toxin binding facilitating toxin oligomerization. Here, we isolated a VHH (VHHA5) antibody by phage display that binds Cry3Aa loop 1 and competed with the binding of Cry3Aa to Tenebrio molitor brush border membranes. VHHA5 also competed with the binding of Cry3Aa to a cadherin fragment (CR12) that was previously shown to be involved in binding and toxicity of Cry3Aa, indicating that Cry3Aa binds CR12 through domain II loop 1. Moreover, we show that a loop 1 mutant, previously characterized to have increased toxicity to T. molitor, displayed a correlative enhanced binding affinity to T. molitor CR12 and to VHHA5. These results show that Cry3Aa domain II loop 1 is a binding site of CR12 T. molitor cadherin. Copyright © 2015 Elsevier Ltd. All rights reserved.
Shapiro-Ilan, David; Rojas, M. Guadalupe; Morales-Ramos, Juan A.; Lewis, Edwin E.; Tedders, W. Louis
2008-01-01
Entomopathogenic nematodes, Heterorhabditis indica and Steinernema riobrave, were tested for virulence and reproductive yield in Tenebrio molitor that were fed wheat bran diets with varying lipid- and protein-based supplements. Lipid supplements were based on 20% canola oil, peanut, pork or salmon, or a low lipid control (5% canola). Protein treatments consisted of basic supplement ingredients plus 0, 10, or 20% egg white; a bran-only control was also included. Some diet supplements had positive effects on nematode quality, whereas others had negative or neutral effects. All supplements with 20% lipids except canola oil caused increased T. molitor susceptibility to H. indica, whereas susceptibility to S. riobrave was not affected. Protein supplements did not affect host susceptibility, and neither lipid nor protein diet supplements affected reproductive capacity of either nematode species. Subsequently, we determined the pest control efficacy of progeny of nematodes that had been reared through T. molitor from different diets against Diaprepes abbreviatus and Otiorhynchus sulcatus. All nematode treatments reduced insect survival relative to the control (water only). Nematodes originating from T. molitor diets with the 0% or 20% protein exhibited lower efficacy versus D. abbreviatus than the intermediate level of protein (10%) or bran-only treatments. Nematodes originating from T. molitor lipid or control diets did not differ in virulence. Our research indicates that nutritional content of an insect host diet can affect host susceptibility to entomopathogenic nematodes and nematode fitness; therefore, host media could conceivably be optimized to increase in vivo nematode production efficiency. PMID:19259513
Li, Jieqiong; Ma, Wenjing; Ma, Ji
2016-01-01
Antifreeze proteins (AFPs) play important roles in protecting poikilothermic organisms from cold damage. The expression of AFP genes (afps) is induced by low temperature. However, it is reported that heat can influence the expression of afps in the desert beetle Microdera punctipennis. To further detect whether heat also induce the expression of afps in other insects, and to determine the expression profiling of insect afps at different temperatures. The expression of antifreeze protein genes in the two beetles, Microdera punctipennis and Tenebrio molitor that have quite different living environment, under different temperatures were studied by using real-time quantitative PCR. Mild low temperatures (5~15 degree C), high temperature (38~47 degree C for M. punctipennis, or 37~42 degree C for T. molitor) and temperature difference (10~30 degree C) all stimulated strongly to the expression of AFP genes (Mpafps) in M. punctipennis which lives in the wild filed in desert. The mRNA level of Mpafps after M. punctipennis were exposed to these temperatures for 1h~5h was at least 30-fold of the control at 25 degree C. For T. molitor which is breeding in door with wheat bran all these temperatures stimulated significantly to the expression of Tmafps, while the extent and degree of the temperature stimulation on Tmafps expression were much lower than on Mpafps. After T. molitor were exposed to 5 degree C and 15 degree C for 1h~5h, the mRNA level of Tmafps was over 6-fold and 45-fold of the control at 25 degree C. High temperature (37~42 degree C) for 1h~3h treatments increased Tmafps mRNA level 4.8-fold of the control. Temperature difference of 10 degree C was effective in stimulating Tmafps expression. The expression of insect antifreeze protein genes both in M. punctipennis and T. molitor was induced by heat, suggesting that this phenomenon may be common in insects; the extent and degree of the influence differ in species that have different living conditions. The heat
Sustainable farming of the mealworm Tenebrio molitor for the production of food and feed.
Grau, Thorben; Vilcinskas, Andreas; Joop, Gerrit
2017-09-26
The farming of edible insects is an alternative strategy for the production of protein-rich food and feed with a low ecological footprint. The industrial production of insect-derived protein is more cost-effective and energy-efficient than livestock farming or aquaculture. The mealworm Tenebrio molitor is economically among the most important species used for the large-scale conversion of plant biomass into protein. Here, we review the mass rearing of this species and its conversion into food and feed, focusing on challenges such as the contamination of food/feed products with bacteria from the insect gut and the risk of rapidly spreading pathogens and parasites. We propose solutions to prevent the outbreak of infections among farmed insects without reliance on antibiotics. Transgenerational immune priming and probiotic bacteria may provide alternative strategies for sustainable insect farming.
Distribution and sequence homogeneity of an abundant satellite DNA in the beetle, Tenebrio molitor.
Davis, C A; Wyatt, G R
1989-01-01
The mealworm beetle, Tenebrio molitor, contains an unusually abundant and homogeneous satellite DNA which constitutes up to 60% of its genome. The satellite DNA is shown to be present in all of the chromosomes by in situ hybridization. 18 dimers of the repeat unit were cloned and sequenced. The consensus sequence is 142 nt long and lacks any internal repeat structure. Monomers of the sequence are very similar, showing on average a 2% divergence from the calculated consensus. Variant nucleotides are scattered randomly throughout the sequence although some variants are more common than others. Neighboring repeat units are no more alike than randomly chosen ones. The results suggest that some mechanism, perhaps gene conversion, is acting to maintain the homogeneity of the satellite DNA despite its abundance and distribution on all of the chromosomes. Images PMID:2762148
Effects of dietary Tenebrio molitor meal inclusion in free-range chickens.
Biasato, I; De Marco, M; Rotolo, L; Renna, M; Lussiana, C; Dabbou, S; Capucchio, M T; Biasibetti, E; Costa, P; Gai, F; Pozzo, L; Dezzutto, D; Bergagna, S; Martínez, S; Tarantola, M; Gasco, L; Schiavone, A
2016-12-01
Insects are currently being considered as a novel protein source for animal feeds, because they contain a large amount of protein. The larvae of Tenebrio molitor (TM) have been shown to be an acceptable protein source for broiler chickens in terms of growth performance, but till now, no data on histological or intestinal morphometric features have been reported. This study has had the aim of evaluating the effects of dietary TM inclusion on the performance, welfare, intestinal morphology and histological features of free-range chickens. A total of 140 medium-growing hybrid female chickens were free-range reared and randomly allotted to two dietary treatments: (i) a control group and (ii) a TM group, in which TM meal was included at 75 g/kg. Each group consisted of five pens as replicates, with 14 chicks per pen. Growth performance, haematological and serum parameters and welfare indicators were evaluated, and the animals were slaughtered at the age of 97 days. Two birds per pen (10 birds/treatment) were submitted to histological (liver, spleen, thymus, bursa of Fabricius, kidney, heart, glandular stomach and gut) and morphometric (duodenum, jejunum and ileum) investigations. The inclusion of TM did not affect the growth performance, haematological or serum parameters. The morphometric and histological features were not significantly affected either, thus suggesting no influence on nutrient metabolization, performance or animal health. Glandular stomach alterations (chronic flogosis with epithelial squamous metaplasia) were considered paraphysiological in relation to free-range farming. The observed chronic intestinal flogosis, with concomitant activation of the lymphoid tissue, was probably due to previous parasitic infections, which are very frequently detected in free-range chickens. In conclusion, the findings of this study show that yellow mealworm inclusion does not affect the welfare, productive performances or morphological features of free-range chickens
Sheiman, I M; Kreshchenko, N D
2010-10-01
The effects of weak electromagnetic irradiation on simple forms of behavior were studied using adult Tenebrio molitor mealworms. The beetles' motor behavior was studied in conditions of different motivations, i.e., positive (food) and negative (avoidance of light), in otherwise identical experimental conditions. The beetles had to navigate a defined space to reach their target - potato or cover from light. Experiments consisted of one trial per day for five days. Target attainment time was measured in groups of beetles. Behavior in both cases developed as follows: an initial orientation reaction appeared and was followed by adaptation to the apparatus. Exposure to weak electromagnetic irradiation led to increases in the response time at the initial stages of the experiments. The effects of irradiation were seasonal in nature and differed in the two types of behavior.
Cito, Annarita; Barzanti, Gian Paolo; Strangi, Agostino; Francardi, Valeria; Zanfini, Assunta; Dreassi, Elena
2016-09-01
Beauveria bassiana is one of the most known entomopathogenic fungal species and its entomopathogenic mechanism involves several bioactive metabolites, mainly cuticle-degrading enzymes and toxic molecules, which are predicted to play a key role as virulence factors. In this study six Beauveria bassiana strains (B 13/I03, B 13/I11, B 13/I49, B 13/I57, B 13/I63, and B 13/I64) were assayed against Tenebrio molitor larvae. Enzymatic activity of total proteases and specifically Pr 1 and Pr 2, as well as the production of toxic compounds were investigated in each fungal strain. Toxins were detected both in vitro-in medium filtrates and mycelia-and in vivo-in Tenebrio molitor larvae infected by the fungal strains tested. B 13/I11 and B 13/I63 strains showed the most significant entomopathogenic activity against Tenebrio molitor larvae (cumulative mortality rate 100 and 97%, respectively; average survival time 5.85 and 6.74 days, respectively). A widely variable and fungal strain-dependent enzymatic activity of total proteases, Pr 1 and Pr 2 was found. Beauvericin, beauvericin A and bassianolide resulted the most prevalent toxins detected in the substrates analyzed. It has been found that an increase of beauvericin content in vivo resulted significantly correlated to a decrease of Tenebrio molitor larvae average survival time in entomopathogenic bioassay (inverse correlation). The involvement of beauvericin in B. bassiana entomopathogenic process is confirmed; in vitro analysis of cuticle degrading proteases activity and toxins production in relation to the methods adopted resulted insufficient for a rapid screening to determine the virulence of B. bassiana strains against Tenebrio molitor larvae. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Lardies, Marco A; Arias, María Belén; Poupin, María Josefina; Bacigalupe, Leonardo D
2014-08-01
Ectotherms constitute the vast majority of terrestrial biodiversity and are especially likely to be vulnerable to climate warming because their basic physiological functions such as locomotion, growth, and reproduction are strongly influenced by environmental temperature. An integrated view about the effects of global warming will be reached not just establishing how the increase in mean temperature impacts the natural populations but also establishing the effects of the increase in temperature variance. One of the molecular responses that are activated in a cell under a temperature stress is the heat shock protein response (HSP). Some studies that have detected consistent differences among thermal treatments and ontogenetic stages in HSP70 expression have assumed that these differences had a genetic basis and consequently expression would be heritable. We tested for changes in quantitative genetic parameters of HSP70 expression in a half-sib design where individuals of the beetle Tenebrio molitor were maintained in constant and varying thermal environments. We estimated heritability of HSP70 expression using a linear mixed modelling approach in different ontogenetic stages. Expression levels of HSP70 were consistently higher in the variable environment and heritability estimates were low to moderate. The results imply that within each ontogenetic stage additive genetic variance was higher in the variable environment and in adults compared with constant environment and larvae stage, respectively. We found that almost all the genetic correlations across ontogenetic stages and environment were positive. These suggest that directional selection for higher levels of expression in one environment will result in higher expression levels of HSP70 on the other environment for the same ontogenetic stage. Copyright © 2014 Elsevier Ltd. All rights reserved.
McGonigle, John E; Purves, Joanne; Rolff, Jens
2016-06-01
Survival of bacteria within host cells and tissues presents a challenge to the immune systems of higher organisms. Escape from phagocytic immune cells compounds this issue, as immune cells become potential vehicles for pathogen dissemination. However, the duration of persistence within phagocytes and its contribution to pathogen load has yet to be determined. We investigate the immunological significance of intracellular persistence within the insect model Tenebrio molitor, assessing the extent, duration and location of bacterial recovery during a persistent infection. Relative abundance of Staphylococcus aureus in both intracellular and extracellular fractions was determined over 21 days, and live S. aureus were successfully recovered from both the hemolymph and within phagocytic immune cells across the entire time course. The proportion of bacteria recovered from within phagocytes also increased over time. Our results show that to accurately estimate pathogen load it is vital to account for bacteria persisting within immune cells. Copyright © 2016 Elsevier Ltd. All rights reserved.
Recognition, survival and persistence of Staphylococcus aureus in the model host Tenebrio molitor.
Dorling, Jack; Moraes, Caroline; Rolff, Jens
2015-02-01
The degree of specificity of any given immune response to a parasite is governed by the complexity and variation of interactions between host and pathogen derived molecules. Here, we assess the extent to which recognition and immuno-resistance of cell wall mutants of the pathogen Staphylococcus aureus may contribute to establishment and maintenance of persistent infection in the model insect host, Tenebrio molitor. The cell surface of S. aureus is decorated with various molecules, including glycopolymers such as wall teichoic acid (WTA). WTA is covalently bound to peptidoglycan (PGN) and its absence has been associated with increased recognition of PGN by host receptors (PGRPs). WTA is also further modified by other molecules such as D-alanine (D-alanylation). Both the level of WTA expression and its D-alanylation were found to be important in the mediation of the host-parasite interaction in this model system. Specifically, WTA itself was seen to influence immune recognition, while D-alanylation of WTA was found to increase immuno-resistance and was associated with prolonged persistence of S. aureus in T. molitor. These results implicate WTA and its D-alanylation as important factors in the establishment and maintenance of persistent infection, affecting different critical junctions in the immune response; through potential evasion of recognition by PGRPs and resistance to humoral immune effectors during prolonged exposure to the immune system. This highlights a mechanism by which specificity in this host-parasite interaction may arise. Copyright © 2014 Elsevier Ltd. All rights reserved.
Czarniewska, Elżbieta; Rosiński, Grzegorz; Gabała, Elżbieta; Kuczer, Mariola
2014-01-30
The injection of Neb-colloostatin into T. molitor females causes gonadoinhibitory effects on ovarian development. This peptide inhibits intercellular space formation (patency) in follicular epithelium and results in slowed vitellogenesis, delayed ovulation, reduced number of eggs laid and presumably cell death in the terminal follicles. However, as does the form of cell death in the terminal follicle, the mode of action of Neb-colloostatin remains unknown. We tested Neb-colloostatin for a sterilizing effect on females of Tenebrio molitor. We report that injection of nanomolar doses of Neb-colloostatin induce ovarian follicle atresia in 4-day old females during their first gonadotropic cycle. Light microscope observations revealed morphological changes in the ovary: after Neb-colloostatin injection the terminal oocytes are significantly smaller and elicit massive follicle resorption, but the control terminal follicles possess translucent ooplasm in oocytes at different stages of vitellogenesis. A patency is visible in follicular epithelium of the control vitellogenic oocytes, whereas peptide injection inhibits intercellular space formation and, in consequence, inhibits vitellogenesis. Confocal and electron microscope examination showed that peptide injection causes changes in the morphology indicating death of follicular cells. We observed F-actin cytoskeleton disorganization, induction of caspase activity, changes in chromatin organization and autophagic vacuole formation. Moreover, the apical cytoplasm of follicular cells is filled with numerous free ribosomes, probably indicating a higher demand for protein biosynthesis, especially in preparation for autophagic vacuole formation. On the other hand, the process of polyribosomes formation is inhibited, indicating the contributing effect of this hormone. Neb-colloostatin induces atresia in the mealworm ovary. Degeneration of T. molitor follicles includes changes in morphology and viability of follicular cells, and
Institute of Scientific and Technical Information of China (English)
王清春; 刘玉升; 方加兴
2017-01-01
为探索浮萍Lemna minor生物质利用新途径,解决浮萍在污水中引起的二次污染现象,本研究利用黄粉虫Tenebrio molitor L食性杂,易饲养,可转化利用多种有机生物质资源的的特性,将浮萍烘干、磨碎后,与麦麸配制成50%浮萍∶50%麦麸,60%浮萍∶40%麦麸,70%浮萍∶30%麦麸,80%浮萍∶20%麦麸不同比例的混合饲料(加水使饲料含水量保持为18%)来饲养黄粉虫幼虫(以纯麦麸为对照组);同时以浮萍替代豆饼作为添加料,按照白菜∶麦麸∶浮萍=10∶4∶1做成混合饲料饲养成虫,来研究浮萍对黄粉虫生长发育及繁殖的影响.结果显示:与纯麦麸相比,幼虫试验中各处理组的生物量增长率、饲料利用率均降低,死亡率增高,而饲喂“50%浮萍∶50%麦麸”饲料的黄粉虫幼虫的各指标与对照组差异不显著,为最佳浮萍饲料配比;在成虫试验中,以浮萍为添加料的成虫单雌产卵量为586.33±6.84粒,成虫寿命为105.5 ±1.43 d,均显著高于以豆饼为添加料的对照组.本研究对利用黄粉虫转化处理浮萍的效果做出了初步评价,即黄粉虫取食转化浮萍是可行的,为浮萍的生物质利用提供参考.%In order to explore the utilization of Lemna minor biomass in new ways,and to solve the second pollution phenomenon caused by it in wastewater.In the study,we make use of some characteristics of Tenebrio molitor L.,such as omnivorous,easy to breed and can utilizate of a variety of organic biomass resources,to transform and utilize Lemna minor.First,we dried Lemna minor to constant weight and mixed with wheat bran in different proportions (add water to keep the water content of these artificial diet at 18%):"50% Lemna minor∶ 50%wheat bran","60% Lemna minor:40% wheat bran","70% Lemna minor∶30% wheat bran","80% Lemna minor∶20% wheat bran" to feed Tenebrio molitor larvae (pure wheat bran as the control group);Then,we use Lemna
Barnes, A I; Siva-Jothy, M T
2000-01-01
If there are costs involved with the maintenance of pathogen resistance, then higher investment in this trait is expected when the risk of pathogenesis is high. One situation in which the risk of pathogenesis is elevated is at increased conspecific density. This paper reports the results of a study of density-dependent polyphenism in pathogen resistance and immune function in the mealworm beetle Tenebrio molitor. Beetles reared at high larval densities showed lower mortality when exposed to a generalist entomopathogenic fungus and a higher degree of cuticular melanization than those reared solitarily. The degree of cuticular melanization was a strong indicator of resistance, with darker beetles being more resistant than lighter ones regardless of rearing density. No differences were found between rearing densities in the levels of phenoloxidase, an enzyme key to the insect immune response. The results show that pathogen resistance is phenotypically plastic in T. molitor, suggesting that the maintenance of this trait is costly. PMID:10687824
Sheiman, I. M.; Shkutin, M. F.; Terenina, N. B.; Gustafsson, M. K. S.
2006-06-01
The host-parasite relationship, Tenebrio molitor- Hymenolepis diminuta, was analyzed. The learning behavior of infected and uninfected (control) beetles in a T-maze was compared. The infected beetles moved much slower in the T-maze than the controls. The infected beetles reached the same level of learning as the controls. However, they needed more trials than the controls. The effect of the infection was already distinct after the first week and even higher after the second week. This indicates that the initial phase of infection caused stress in the beetles. Longer infection did not worsen their ability to learn. Thus, the parasites clearly changed the behavior of their intermediate host and probably made them more susceptible to their final host, the rat.
Moret, Yannick
2006-06-07
Encounters with parasites and pathogens are often unpredictable in time. However, experience of an infection may provide the host with reliable cues about the future risk of infection for the host itself or for its progeny. If the parental environment predicts the quality of the progeny's environment, then parents may further enhance their net reproductive success by differentially providing their offspring with phenotypes to cope with potential hazards such as pathogen infection. Here, I test for the occurrence of such an adaptive transgenerational phenotypic plasticity in the mealworm beetle, Tenebrio molitor. A pathogenic environment was mimicked by injection of bacterial lipopolysaccharides for two generations of insects. I found that parental challenge enhanced offspring immunity through the inducible production of antimicrobial peptides in the haemolymph.
Parasitization by Scleroderma guani influences protein expression in Tenebrio molitor pupae.
Zhu, Jia-Ying; Wu, Guo-Xing; Ze, Sang-Zi; Stanley, David W; Yang, Bin
2014-07-01
Ectoparasitoid wasps deposit their eggs onto the surface and inject venom into their hosts. Venoms are chemically complex and they exert substantial impact on hosts, including permanent or temporary paralysis and developmental arrest. These visible venom effects are due to changes in expression of genes encoding physiologically relevant proteins. While the influence of parasitization on gene expression in several lepidopterans has been reported, the molecular details of parasitoid/beetle relationships remain mostly unknown. This shortcoming led us to pose the hypothesis that envenomation by the ectoparasitic ant-like bethylid wasp Scleroderma guani leads to changes in protein expression in the yellow mealworm beetle Tenebrio molitor. We tested our hypothesis by comparing the proteomes of non-parasitized and parasitized host pupae using iTRAQ-based proteomics. We identified 41 proteins that were differentially expressed (32↑- and 9↓-regulated) in parasitized pupae. We assigned these proteins to functional categories, including immunity, stress and detoxification, energy metabolism, development, cytoskeleton, signaling and others. We recorded parallel changes in mRNA levels and protein abundance in 14 selected proteins following parasitization. Our findings support our hypothesis by documenting changes in protein expression in parasitized hosts. Copyright © 2014 Elsevier Ltd. All rights reserved.
Effects of inbreeding on potential and realized immune responses in Tenebrio molitor.
Rantala, Markus J; Viitaniemi, Heidi; Roff, Derek A
2011-06-01
Although numerous studies on vertebrates suggest that inbreeding reduces their resistance against parasites and pathogens, studies in insects have found contradictory evidence. In this study we tested the effect of 1 generation of brother-sister mating (inbreeding) on potential and realized immune responses and other life-history traits in Tenebrio molitor. We found that inbreeding reduced adult mass, pre-adult survival and increased development time, suggesting that inbreeding reduced the condition of the adults and thus potentially made them more susceptible to physiological stress. However, we found no significant effect of inbreeding on the potential immune response (encapsulation response), but inbreeding reduced the realized immune response (resistance against the entomopathogenic fungi, Beauveria bassiana). There was a significant family effect on encapsulation response, but no family effect on the resistance against the entomopathogenic fungi. Given that this latter trait showed significant inbreeding depression and that the sample size for the family-effect analysis was small it is likely that the lack of a significant family effect is due to reduced statistical power, rather than the lack of a heritable basis to the trait. Our study highlights the importance of using pathogens and parasites in immunoecological studies.
Directory of Open Access Journals (Sweden)
Rafaela Karin Lima
2011-08-01
Full Text Available The chemical composition of Lippia sidoides essential oils obtained by hydrodistillation was characterized and quantified by GC/MS and their insecticidal activity by fumigation test was assayed against Tenebrio molitor. Moreover, the toxicity of monoterpenes carvacrol, 1,8-cineol and thymol were also evaluated when applied alone or in binary (1:1 or tertiary (1:1:1 mixture. The essential oil of L. sidoides has as major constituents carvacrol (31.68%, ρ-cymene (19.58%, 1,8-cineole (9.26% and ϒ-terpinene (9.21%, from a 21 compounds identified, being 92.53% of total. Both compounds have insecticidal activity against T. molitor, being the degree of toxicity of carvacrol > 1,8-cineole > L. sidoides essential oil > thymol, and its respectively LC50 at 24h were 5.53; 5.71; 8.04 and 14.71 µL/L air. When the different mixture of carvacrol, 1,8-cineole and thymol was assayed against T. molitor, the synergism among them was observed. For the mixture of carvacrol:1,8-cineole LC50 was 5.34 µL/L air; carvacrol:thymol 7.67 µL/L air; 1,8-cineole:thymol 7.51 µL/L air and carvacrol:1,8-cineole:thymol 6.34 µL/L air. Mainly, the monoterpene thymol had a synergic effect, which increased the toxicity of carvacrol and 1,8-cineole, both in binary mixture like carvacrol:thymol and 1,8-cineole:thymol.A composição química do óleo essencial de Lippia sidoides obtido por hidrodestilação foi caracterizada e quantificada por GC/MS, bem como sua atividade inseticida por teste de fumigação foi avaliada sobre Tenebrio molitor. Além disso, a toxicidade dos monoterpenos carvacrol, 1,8-cineol e timol, também foi avaliada quando esses compostos foram aplicados isoladamente, ou em misturas binárias (1:1, ou terciárias (1:1:1. O óleo essencial de L. sidoides tem como principais constituintes o carvacrol (31,68%, ρ-cimeno (19,58%, 1,8-cineol (9,26% e ϒ-terpineno (9,21%, em 21 compostos identificados, sendo 92,53% do total. Ambos os compostos possuem atividade
Krams, Indrikis; Daukste, Janina; Kivleniece, Inese; Krama, Tatjana; Rantala, Markus J
2013-12-01
Immune defenses of insects show either broad reactions or specificity and durability of induced protection against attacking parasites and pathogens. In this study, we tested whether encapsulation response against nylon monofilament increases between two attempts of activation of immune system in mealworm beetles Tenebrio molitor, and whether previous exposure to nylon monofilament may also increase protection against an entomopathogenic fungus. We found that survival of beetles subjected to immune activation by nylon implant and subsequent fungal exposure a week later was significantly higher than survival of beetles which had been subjected to fungal infection only. This result suggests that previous immune activation by the nylon implant may be considered as broad spectrum "immune priming" which helps to fight not only the same intruder but also other parasites. © 2012 Institute of Zoology, Chinese Academy of Sciences.
Novikov, V V; Sheĭman, I M; Iablokova, E V; Fesenko, E E
2014-01-01
It is shown that an exposure of pupae of the mealworm beetle Tenebrio molitor to the combined static (42 μT) and very weak alternating (250 nT) magnetic fields exerts different influence, depending on the frequency of the alternating magnetic field, on duration of metamorphosis processes in these insects. For instance, an exposure of pupae to weak combined magnetic fields, adjusted to the frequency of ion cyclotron resonance for glutaminic acid (4,4 Hz), stimulates metamorphosis process--a transitional stage from pupae to imago lasts shorter. An inhibiting effect was observed when adjusted to the frequency of ion cyclotron resonance for Ca2 (32,2 Hz). At some frequencies this effect is not seen. For instance, an exposure at a frequency of ion cyclotron resonance for K+ (16,5 Hz) exerts no noticeable effect on the duration of the pupal metamorphosis stage.
2014-01-01
Background The injection of Neb-colloostatin into T. molitor females causes gonadoinhibitory effects on ovarian development. This peptide inhibits intercellular space formation (patency) in follicular epithelium and results in slowed vitellogenesis, delayed ovulation, reduced number of eggs laid and presumably cell death in the terminal follicles. However, as does the form of cell death in the terminal follicle, the mode of action of Neb-colloostatin remains unknown. Results We tested Neb-colloostatin for a sterilizing effect on females of Tenebrio molitor. We report that injection of nanomolar doses of Neb-colloostatin induce ovarian follicle atresia in 4-day old females during their first gonadotropic cycle. Light microscope observations revealed morphological changes in the ovary: after Neb-colloostatin injection the terminal oocytes are significantly smaller and elicit massive follicle resorption, but the control terminal follicles possess translucent ooplasm in oocytes at different stages of vitellogenesis. A patency is visible in follicular epithelium of the control vitellogenic oocytes, whereas peptide injection inhibits intercellular space formation and, in consequence, inhibits vitellogenesis. Confocal and electron microscope examination showed that peptide injection causes changes in the morphology indicating death of follicular cells. We observed F-actin cytoskeleton disorganization, induction of caspase activity, changes in chromatin organization and autophagic vacuole formation. Moreover, the apical cytoplasm of follicular cells is filled with numerous free ribosomes, probably indicating a higher demand for protein biosynthesis, especially in preparation for autophagic vacuole formation. On the other hand, the process of polyribosomes formation is inhibited, indicating the contributing effect of this hormone. Conclusion Neb-colloostatin induces atresia in the mealworm ovary. Degeneration of T. molitor follicles includes changes in morphology and
Lacerda, M. C.; Ferreira, A. M. R. M.; Zanuncio, T. V.; Zanuncio, J. C.; Bernardino, A. S.; Espindula, M. C.
2004-01-01
Biological control has been reducing the use of chemical products against insect pests, specially predatory Pentatomidae. Species of this group can present high variations in their life cycle as a result of their diet. Thus, the objective of this research was to study nymph development and reproduction of Podisus distinctus (Stäl, 1860) (Heteroptera: Pentatomidae) fed on Bombyx mori L., 1758 (Lepidoptera: Bombycidae) larvae (T1), compared to those fed on Tenebrio molitor L., 1758 (Coleoptera:...
Moret, Yannick
2006-01-01
Encounters with parasites and pathogens are often unpredictable in time. However, experience of an infection may provide the host with reliable cues about the future risk of infection for the host itself or for its progeny. If the parental environment predicts the quality of the progeny's environment, then parents may further enhance their net reproductive success by differentially providing their offspring with phenotypes to cope with potential hazards such as pathogen infection. Here, I test for the occurrence of such an adaptive transgenerational phenotypic plasticity in the mealworm beetle, Tenebrio molitor. A pathogenic environment was mimicked by injection of bacterial lipopolysaccharides for two generations of insects. I found that parental challenge enhanced offspring immunity through the inducible production of antimicrobial peptides in the haemolymph. PMID:16777729
Energy Technology Data Exchange (ETDEWEB)
Altabella, T.; Chrispeels, M.J. (Univ. of California, San Diego, La Jolla (USA))
1990-06-01
Bean (Phaseolus vulgaris L.) seeds contain a putative plant defense protein that inhibits insect and mammalian but not plant {alpha}-amylases. We recently presented strong circumstantial evidence that this {alpha}-amylase inhibitor ({alpha}Al) is encoded by an already-identified lectin gene whose product is referred to as lectin-like-protein (LLP). We have now made a chimeric gene consisting of the coding sequence of the lectin gene that encodes LLP and the 5{prime} and 3{prime} flanking sequences of the lectin gene that encodes phytohemagglutinin-L. When this chimeric gene was expressed in transgenic tobacco (Nicotiana tabacum), we observed in the seeds a series of polypeptides (M{sub r} 10,000-18,000) that cross-react with antibodies to the bean {alpha}-amylase inhibitor. Most of these polypeptides bind to a pig pancreas {alpha}-amylase affinity column. An extract of the seeds of the transformed tobacco plants inhibits pig pancreas {alpha}-amylase activity as well as the {alpha}-amylase present in the midgut of Tenebrio molitor. We suggest that introduction of this lectin gene (to be called {alpha}ai) into other leguminous plants may be a strategy to protect the seeds from the seed-eating larvae of Coleoptera.
Inducible defenses stay up late: temporal patterns of immune gene expression in Tenebrio molitor.
Johnston, Paul R; Makarova, Olga; Rolff, Jens
2013-12-06
The course of microbial infection in insects is shaped by a two-stage process of immune defense. Constitutive defenses, such as engulfment and melanization, act immediately and are followed by inducible defenses, archetypically the production of antimicrobial peptides, which eliminate or suppress the remaining microbes. By applying RNAseq across a 7-day time course, we sought to characterize the long-lasting immune response to bacterial challenge in the mealworm beetle Tenebrio molitor, a model for the biochemistry of insect immunity and persistent bacterial infection. By annotating a hybrid de novo assembly of RNAseq data, we were able to identify putative orthologs for the majority of components of the conserved insect immune system. Compared with Tribolium castaneum, the most closely related species with a reference genome sequence and a manually curated immune system annotation, the T. molitor immune gene count was lower, with lineage-specific expansions of genes encoding serine proteases and their countervailing inhibitors accounting for the majority of the deficit. Quantitative mapping of RNAseq reads to the reference assembly showed that expression of genes with predicted functions in cellular immunity, wound healing, melanization, and the production of reactive oxygen species was transiently induced immediately after immune challenge. In contrast, expression of genes encoding antimicrobial peptides or components of the Toll signaling pathway and iron sequestration response remained elevated for at least 7 days. Numerous genes involved in metabolism and nutrient storage were repressed, indicating a possible cost of immune induction. Strikingly, the expression of almost all antibacterial peptides followed the same pattern of long-lasting induction, regardless of their spectra of activity, signaling possible interactive roles in vivo. Copyright © 2014 Johnston et al.
da Silva, Fernanda Kerche Paes; Brück, Dieter W; Brück, Wolfram M
2017-09-15
The use of insects as a source of protein is becoming an important factor for feeding an increasing population. After protein extraction for food use, the insect exoskeleton may offer the possibility for the production of added value products. Here, the aim was to isolate bacteria from the surface of farmed mealworms (Tenebrio molitor Linnaeus, 1758) for the production of chitinous material from insect exoskeletons using microbial fermentation. Isolates were screened for proteases and acid production that may aid deproteination and demineralisation of insects through fermentation to produce chitin. Selected isolates were used single-step (isolated bacteria only) or two-step fermentations with Lactobacillus plantarum (DSM 20174). Two-step fermentations with isolates from mealworm exoskeletons resulted in a demineralisation of 97.9 and 98.5% from deproteinated mealworm fractions. Attenuated total reflectance-Fourier- transform infrared spectroscopy analysis showed that crude chitin was produced. However, further optimisation is needed before the process can be upscaled. This is, to our knowledge, the first report using microbial fermentation for the extraction of chitin from insects. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Hydration behavior at the ice-binding surface of the Tenebrio molitor antifreeze protein.
Midya, Uday Sankar; Bandyopadhyay, Sanjoy
2014-05-08
Molecular dynamics (MD) simulations have been carried out at two different temperatures (300 and 220 K) to study the conformational rigidity of the hyperactive Tenebrio molitor antifreeze protein (TmAFP) in aqueous medium and the structural arrangements of water molecules hydrating its surface. It is found that irrespective of the temperature the ice-binding surface (IBS) of the protein is relatively more rigid than its nonice-binding surface (NIBS). The presence of a set of regularly arranged internally bound water molecules is found to play an important role in maintaining the flat rigid nature of the IBS. Importantly, the calculations reveal that the strategically located hydroxyl oxygens of the threonine (Thr) residues in the IBS influence the arrangements of five sets of ordered waters around it on two parallel planes that closely resemble the basal plane of ice. As a result, these waters can register well with the ice basal plane, thereby allowing the IBS to preferentially bind at the ice interface and inhibit its growth. This provides a possible molecular reason behind the ice-binding activity of TmAFP at the basal plane of ice.
Bogoliubov, D S; Kiselev, A M; Shabel'nikov, S V; Parfenov, V N
2012-01-01
The nucleus ofvitellogenic oocytes of the yellow mealworm, Tenebrio molitor, contains a karyosphere that consists of the condensed chromatin embedded in an extrachromosomal fibrogranular material. Numerous nuclear bodies located freely in the nucleoplasm are also observed. Amongst these bodies, counterparts of nuclear speckles (= interchromatin granule clusters, IGCs) can be identified by the presence of the marker protein SC35. Microinjections of fluorescently tagged methyloligoribonucleotide probes 2'-O-Me(U)22, complementary to poly(A) tails of RNAs, revealed poly(A)+ RNA in the vast majority of IGCs. We found that all T. molitor oocyte IGCs contain heterogeneous ribonucleoprotein (hnRNP) core protein Al that localizes to IGCs in an RNA-dependent manner. The extrachromosomal material of the karyosphere and a part of nucleoplasmic IGCs also contain the adapter protein Aly that is known to provide a link between pre-mRNA splicing and mRNA export. The essential mRNA export factor/receptor NXF1 was observed to colocalize with Aly. In nucleoplasmic IGCs, NXF1 was found to localize in an RNA-dependent manner whereas it is RNA-independently located in the extrachromosomal material of the karyosphere. We believe our data suggest on a role of the nucleoplasmic IGCs in mRNA biogenesis and retention in a road to nuclear export.
Hurd, Hilary; Ardin, Richard
2003-01-01
During copulation, male insects pass accessory gland components to the female with the spermatophore. These gifts can affect female reproductive behaviour, ovulation and oviposition. Here, we show that female mealworm beetles, Tenebrio molitor, mated with males infected with metacestodes of the rat tapeworm, Hymenolepis diminuta, produced significantly more offspring than those mated with uninfected males. There is a significant positive relationship between parasite intensity in the male and reproductive output in the female. Infection results in a significant increase in bean-shaped accessory gland (BAG) size. We suggest that infected males pass superior nuptial gifts to females and discuss the confounding effects of infection in male and female beetles upon overall fitness costs of infection for the host and the likelihood that the parasite is manipulating host investment in reproduction. PMID:14667373
Daley, Margaret E.; Sykes, Brian D.
2003-01-01
Two-dimensional nuclear magnetic resonance spectroscopy was used to investigate the flexibility of the threonine side chains in the β-helical Tenebrio molitor antifreeze protein (TmAFP) at low temperatures. From measurement of the 3Jαβ 1H-1H scalar coupling constants, the χ1 angles and preferred rotamer populations can be calculated. It was determined that the threonines on the ice-binding face of the protein adopt a preferred rotameric conformation at near freezing temperatures, whereas the threonines not on the ice-binding face sample many rotameric states. This suggests that TmAFP maintains a preformed ice-binding conformation in solution, wherein the rigid array of threonines that form the AFP-ice interface matches the ice crystal lattice. A key factor in binding to the ice surface and inhibition of ice crystal growth appears to be the close surface-to-surface complementarity between the AFP and crystalline ice, and the lack of an entropic penalty associated with freezing out motions in a flexible ligand. PMID:12824479
International Nuclear Information System (INIS)
Ahmed, M.Y.Y.; Kloft, W.J.
1985-01-01
The haemolymph volume of Tenebrio molitor L. adults was determined by a radioisotope dilution technique. Two myl (14)C-inulin were injected into the haemolymph with a micro-syringe. After sufficient time for through mixing, the labelled haemolymph was collected individually under separation of sexes. Total haemolymph was calculated by a conventional formula for radioisotope dilution. The mean haemolymph volume of normal newly emerged males was 61.1+-14.2 myl and remained constant between day 2 (61.2 +-2.1) and day 3 (55.6+-9.2) after emergence. In comparison newly emerged females had a volume of 53.5+-2.3 myl which increased to 69.4+-11.7 myl day 2 resp. 64.0+-16.7 myl by day 3. The haemolymph volume of X-irradiated (5000 R) males remains almost constant. However in case of irradiated females the haemolymph volume also remains constant in contrast to unirradiated individuals
Park, Sun Hee; Piao, Shunfu; Kwon, Hyun-Mi; Kim, Eun-Hye; Lee, Bok Luel; Ha, Nam-Chul
2010-01-01
The Toll signalling pathway, which is crucial for innate immunity, is transduced in insect haemolymph via a proteolytic cascade consisting of three serine proteases. The proteolytic cascade is downregulated by a specific serine protease inhibitor (serpin). Recently, the serpin SPN48 was found to show an unusual specific reactivity towards the terminal serine protease, Spätzle-processing enzyme, in the beetle Tenebrio molitor. In this study, the mature form of SPN48 was overexpressed in Escherichia coli and purified. The purified SPN48 protein was crystallized using 14% polyethylene glycol 8000 and 0.1 M 2-(N-morpholino)ethanesulfonic acid pH 6.0 as the precipitant. The crystals diffracted X-rays to 2.1 Å resolution and were suitable for structure determination. The crystals belonged to space group P21. The crystal structure will provide information regarding how SPN48 achieves its unusual specificity for its target protease. PMID:20124722
Directory of Open Access Journals (Sweden)
Marco Belforti
2015-12-01
Full Text Available This study evaluated the effects of diets containing Tenebrio molitor (TM larvae meal on growth performances, somatic indexes, nutrient digestibility, dorsal muscle proximate and fatty acid (FA compositions of rainbow trout. Three hundred sixty fish were randomly divided into three groups with four replicates each. The groups were fed diets differing in TM inclusion: 0% (TM0, 25% (TM25 and 50% (TM50 as fed weight basis. Weight gain was not affected by treatment. Feeding rate was significantly higher in TM0 than TM50. Feed conversion ratio was significantly higher in TM0 than TM25 and TM50, while an opposite trend was observed for protein efficiency ratio and specific growth rate. The survival rate was significantly lower in TM0 than TM25 and TM50. The apparent digestibility of protein was significantly lower in the TM50 group than the other groups, while the apparent digestibility of dry matter, organic matter and lipids was unaffected by treatment. If compared to control, the protein and lipid contents of fillets were respectively increased and decreased following TM inclusion in the diet. The Σn3/Σn6 FA ratio of fish dorsal muscle was linearly (TM0>TM25>TM50 reduced by TM inclusion in the diet. Results suggested that TM could be used during the growing phase in trout farming; however, additional studies on specific feeding strategies and diet formulations are needed to limit its negative effects on the lipid fraction of fillets.
Vácha, M
1997-10-01
While investigating and describing interactions among living organisms and magnetic fields (MFs) it is imperative to lay great emphasis on independent reproducibility of published experimental results. Mutual confrontation of existing theoretical models with reliable data obtained under comparable conditions can aid gradual mapping of this hitherto badly organized and understood discipline of biology. The objective of our experiment, based on analysing extracardiac pulsations of the pupae of Tenebrio molitor under the influence of a MF, was to verify published data on allegedly accelerated development induced by a MF employing a different procedure. The obtained data are in agreement with a hypothesis of increased pupal metabolism during the period of MF activity. Furthermore, some dependence on the age of the pupae cannot be ruled out.
Maistrou, Sevasti; Paris, Véronique; Jensen, Annette B; Rolff, Jens; Meyling, Nicolai V; Zanchi, Caroline
2018-09-01
Antimicrobial peptides have been well studied in the context of bacterial infections. Antifungal peptides have received comparatively less attention. Fungal pathogens of insects and their hosts represent a unique opportunity to study host-pathogen interactions due to the million of years of co-evolution they share. In this study, we investigated role of a constitutively expressed thaumatin-like peptide with antifungal activity expressed by the mealworm beetle Tenebrio molitor, named Tenecin 3, during a natural infection with the entomopathogenic fungus Beauveria bassiana. We monitored the effect of the expression of Tenecin 3 on the survival of infected hosts as well as on the progression of the fungal infection inside the host. Finally, we tested the activity of Tenecin 3 against B. bassiana. These findings could help improving biocontrol strategies and help understanding the evolution of antifungal peptides as a defense mechanism. Copyright © 2018 Elsevier Ltd. All rights reserved.
Allen, Jessica L; Clusella-Trullas, Susana; Chown, Steven L
2012-05-01
Critical thermal limits provide an indication of the range of temperatures across which organisms may survive, and the extent of the lability of these limits offers insights into the likely impacts of changing thermal environments on such survival. However, investigations of these limits may be affected by the circumstances under which trials are undertaken. Only a few studies have examined these effects, and typically not for beetles. This group has also not been considered in the context of the time courses of acclimation and its reversal, both of which are important for estimating the responses of species to transient temperature changes. Here we therefore examine the effects of rate of temperature change on critical thermal maxima (CT(max)) and minima (CT(min)), as well as the time course of the acclimation response and its reversal in two beetle species, Tenebrio molitor and Cyrtobagous salviniae. Increasing rates of temperature change had opposite effects on T. molitor and C. salviniae. In T. molitor, faster rates of change reduced both CT(max) (c. 2°C) and CT(min) (c. 3°C), while in C. salviniae faster rates of change increased both CT(max) (c. 6°C) and CT(min) (c. 4°C). CT(max) in T. molitor showed little response to acclimation, while the response to acclimation of CT(min) was most pronounced following exposure to 35°C (from 25°C) and was complete within 24 h. The time course of acclimation of CT(max) in C. salviniae was 2 days when exposed to 36°C (from c. 26°C), while that of CT(min) was less than 3 days when exposed to 18°C. In T. molitor, the time course of reacclimation to 25°C after treatments at 15°C and 35°C at 75% RH was longer than the time course of acclimation, and varied from 3-6 days for CT(max) and 6 days for CT(min). In C. salviniae, little change in CT(max) and CT(min) (molitor and C. salviniae may be restricted in their ability to respond to transient temperature changes at short-time scales, and instead may have to rely on
Directory of Open Access Journals (Sweden)
Jung Hee eLee
2015-06-01
Full Text Available Autophagy is a process that is necessary during starvation as it replenishes metabolic precursors by eliminating damaged organelles. Autophagy is mediated by more than 35 autophagy-related (Atg proteins that manifest in the nucleation, elongation, and curving of autophagosome membrane. We isolated a homolog of an ATG13 gene from the transcriptome database of the larva of the mealworm beetle, Tenebrio molitor (designated as TmATG13. The sequence analysis showed that TmATG13 cDNA comprises of 1,176 bp open reading frame that encodes a protein of 391 amino acids. Analyses of the structure-specific features of TmAtg13 showed an intrinsically disordered middle and C-terminal region, rich in regulatory phosphorylation sites. The N-terminal Atg13 domain show a HORMA (Hop1, Rev7, and Mad2 fold containing conserved amino acid residues across the Atg13 orthologs in insects. qRT-PCR revealed that TmATG13 was expressed ubiquitously in all the developmental stages of insect. TmATG13 mRNA expression was high in fat body and gut of the larval and adult stages of the insect. During ovary development and maturation, the TmATG13 transcripts showed high expression until six days of development, followed by a significant decline. The prospective functions mediated by TmAtg13 during autophagy will be clarified by further studies in the near future.
Ramya, L; Ramakrishnan, Vigneshwar
2016-07-01
Antifreeze proteins (AFP) observed in cold-adapting organisms bind to ice crystals and prevent further ice growth. However, the molecular mechanism of AFP-ice binding and AFP-inhibited ice growth remains unclear. Here we report the interaction of the insect antifreeze protein (Tenebrio molitor, TmAFP) with ice crystal by molecular dynamics simulation studies. Two sets of simulations were carried out at 263 K by placing the protein near the primary prism plane (PP) and basal plane (BL) of the ice crystal. To delineate the effect of temperatures, both the PP and BL simulations were carried out at 253 K as well. The analyses revealed that the protein interacts strongly with the ice crystal in BL simulation than in PP simulation both at 263 K and 253 K. Further, it was observed that the interactions are primarily mediated through the interface waters. We also observed that as the temperature decreases, the interaction between the protein and the ice increases which can be attributed to the decreased flexibility and the increased structuring of the protein at low temperature. In essence, our study has shed light on the interaction mechanism between the TmAFP antifreeze protein and the ice crystal. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Prokkola, J; Roff, D; Kärkkäinen, T; Krams, I; Rantala, M J
2013-08-01
Insect cuticle melanism is linked to a number of life-history traits, and a positive relationship is hypothesized between melanism and the strength of immune defense. In this study, the phenotypic and genetic relationships between cuticular melanization, innate immune defense, individual development time and body size were studied in the mealworm beetle (Tenebrio molitor) using three different temperatures with a half-sib breeding design. Both innate immune defense and cuticle darkness were higher in females than males, and a positive correlation between the traits was found at the lowest temperature. The effect of temperature on all the measured traits was strong, with encapsulation ability and development time decreasing and cuticle darkness increasing with a rise in temperature, and body size showing a curved response. The analysis showed a highly integrated system sensitive to environmental change involving physiological, morphological and life-history traits.
Directory of Open Access Journals (Sweden)
MUHAMMAD A. AZIZ HENDITAMA
2015-05-01
Full Text Available Henditama MAA, Harini M, Budiharjo A. 2015. The effect of giving mixtured feed of fish pellet, mealworm (Tenebrio molitor and red algae (Gracilaria foliifera to the growth and survival rate of eel (Anguilla bicolor. Bioteknologi 12: 22-28. High demand of eels (Anguilla bicolor in the world has not followed by the capability of domestic production. The purpose of this research are to determine the effect and the precise composition of the feed mixture in the form of fish pellets, mealworms (Tenebrio molitor, red algae (Gracilaria foliifera to the growth and survival rate of eels. This research used completely randomized design with four variations of mixtured feed in the form of fish pellet, mealworms, and red algae specifically P1 (100% ; 0% ; 0%, P2 (75% ; 20% ; 5%, P3 (50% ; 45% ; 5%, P4 (25% ; 70% ; 5%. This research also has been done in 90 days with feeding in twice a day. The data of growth, survival rate, and water quality was collected once a week. The data result has been analized by ANOVA. The data result showed that have a real different to continue to the next analysis of DMRT with test level 5% to locate the differences between treatments. The eels growth after feeding a mixture feed in the form of fish pellets, mealworms, and red alga, specifically: P1 (K 26.3167 gram; P2 20.3167 gram; P3 28.2500 gram; and P4 22.0000 gram. The eels survival rate, specifically P1 (K 26.67%; P2 33.33%; P3 30%; dan P4 26.67%. Furthemore, the exact composition that give the best effect of growth and survival rate to eels is 50% fish pellets, 45% mealworms and 5% red alga.
Lacerda, M C; Ferreira, A M R M; Zanuncio, T V; Zanuncio, J C; Bernardino, A S; Espindula, M C
2004-05-01
Biological control has been reducing the use of chemical products against insect pests, especially predatory Pentatomidae. Species of this group can present high variations in their life cycle as a result of their diet. Thus, the objective of this research was to study nymph development and reproduction of Podisus distinctus (Stäl, 1860) (Heteroptera: Pentatomidae) fed on Bombyx mori L., 1758 (Lepidoptera: Bombycidae) larvae (T1), compared to those fed on Tenebrio molitor L., 1758 (Coleoptera: Tenebrionidae) (T2) and Musca domestica L., 1758 (Diptera: Muscidae) larvae (T3) at a temperature of 25 +/- 0.5 degrees C, relative humidity of 70 +/- 2%, and photophase of 12 h. Predators fed on B. mori showed duration of the nymph phase (18.68 +/- 1.02) similar to those fed on T. molitor (18.32 +/- 1.49). Pre-oviposition and oviposition periods and number of egg masses, besides eggs and nymphs per female, were higher with B. mori (5.83 +/- 2.02; 15.00 +/- 7.40; 8.42 +/- 1.84; 296.69 +/- 154.75; and 228.55 +/- 141.04, respectively) while longevity of males and females of P. distinctus was 25.76 +/- 16.15 and 35.00 +/- 16.15 days with T. molitor, and 20.57 +/- 13.60 and 23.46 +/- 12.35 days with B. mori, respectively.
Quantity estimation based on numerical cues in the mealworm beetle (Tenebrio molitor
Directory of Open Access Journals (Sweden)
Pau eCarazo
2012-11-01
Full Text Available In this study, we used a biologically relevant experimental procedure to ask whether mealworm beetles (Tenebrio molitor are spontaneously capable of assessing quantities based on numerical cues. Like other insect species, mealworm beetles adjust their reproductive behaviour (i.e. investment in mate guarding according to the perceived risk of sperm competition (i.e. probability that a female will mate with another male. To test whether males have the ability to estimate numerosity based on numerical cues, we staged matings between virgin females and virgin males in which we varied the number of rival males the experimental male had access to immediately preceding mating as a cue to sperm competition risk (from 1 to 4. Rival males were presented sequentially, and we controlled for continuous cues by ensuring that males in all treatments were exposed to the same amount of male-male contact. Males exhibited a marked increase in the time they devoted to mate guarding in response to an increase in the number of different rival males they were exposed to. Since males could not rely on continuous cues we conclude that they kept a running tally of the number of individuals they encountered serially, which meets the requirements of the basic ordinality and cardinality principles of proto-counting. Our results thus offer good evidence of ‘true’ numerosity estimation or quantity estimation and, along with recent studies in honey-bees, suggest that vertebrates and invertebrates share similar core systems of non-verbal numerical representation.
Directory of Open Access Journals (Sweden)
M. C. Lacerda
Full Text Available Biological control has been reducing the use of chemical products against insect pests, specially predatory Pentatomidae. Species of this group can present high variations in their life cycle as a result of their diet. Thus, the objective of this research was to study nymph development and reproduction of Podisus distinctus (Stäl, 1860 (Heteroptera: Pentatomidae fed on Bombyx mori L., 1758 (Lepidoptera: Bombycidae larvae (T1, compared to those fed on Tenebrio molitor L., 1758 (Coleoptera: Tenebrionidae (T2 and Musca domestica L., 1758 (Diptera: Muscidae larvae (T3 at a temperature of 25 ± 0.5ºC, relative humidity of 70 ± 2%, and photophase of 12 h. Predators fed on B. mori showed duration of the nymph phase (18.68 ± 1.02 similar to those fed on T. molitor (18.32 ± 1.49. Pre-oviposition and oviposition periods and number of egg masses, besides eggs and nymphs per female, were higher with B. mori (5.83 ± 2.02; 15.00 ± 7.40; 8.42 ± 1.84; 296.69 ± 154.75; and 228.55 ± 141.04, respectively while longevity of males and females of P. distinctus was 25.76 ± 16.15 and 35.00 ± 16.15 days with T. molitor, and 20.57 ± 13.60 and 23.46 ± 12.35 days with B. mori, respectively.
Noonin, Chadanat; Jiravanichpaisal, Pikul; Söderhäll, Irene; Merino, Susana; Tomás, Juan M.; Söderhäll, Kenneth
2010-01-01
Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS), bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish) and Tenebrio molitor larvae (mealworm). The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core) is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT) containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the proPO system
Directory of Open Access Journals (Sweden)
Chadanat Noonin
Full Text Available Aeromonas hydrophila is the most common Aeromonas species causing infections in human and other animals such as amphibians, reptiles, fish and crustaceans. Pathogenesis of Aeromonas species have been reported to be associated with virulence factors such as lipopolysaccharides (LPS, bacterial toxins, bacterial secretion systems, flagella, and other surface molecules. Several mutant strains of A. hydrophila AH-3 were initially used to study their virulence in two animal species, Pacifastacus leniusculus (crayfish and Tenebrio molitor larvae (mealworm. The AH-3 strains used in this study have mutations in genes involving the synthesis of flagella, LPS structures, secretion systems, and some other factors, which have been reported to be involved in A. hydrophila pathogenicity. Our study shows that the LPS (O-antigen and external core is the most determinant A. hydrophila AH-3 virulence factor in both animals. Furthermore, we studied the immune responses of these hosts to infection of virulent or non-virulent strains of A. hydrophila AH-3. The AH-3 wild type (WT containing the complete LPS core is highly virulent and this bacterium strongly stimulated the prophenoloxidase activating system resulting in melanization in both crayfish and mealworm. In contrast, the ΔwaaE mutant which has LPS without O-antigen and external core was non-virulent and lost ability to stimulate this system and melanization in these two animals. The high phenoloxidase activity found in WT infected crayfish appears to result from a low expression of pacifastin, a prophenoloxidase activating enzyme inhibitor, and this gene expression was not changed in the ΔwaaE mutant infected animal and consequently phenoloxidase activity was not altered as compared to non-infected animals. Therefore we show that the virulence factors of A. hydrophila are the same regardless whether an insect or a crustacean is infected and the O-antigen and external core is essential for activation of the
Kim, Jae Su; Choi, Jae Young; Lee, Se Jin; Lee, Ju Hyun; Fu, Zhenli; Skinner, Margaret; Parker, Bruce L; Je, Yeon Ho
2013-07-01
Efforts are underway to develop more effective and safer animal feed additives. Entomopathogenic fungi can be considered practical expression platforms of functional genes within insects which have been used as animal feed additives. In this work, as a model, the enhanced green fluorescent protein (egfp) gene was expressed in yellow mealworms, Tenebrio molitor by highly infective Beauveria bassiana ERL1170. Among seven test isolates, ERL1170 treatment showed 57.1% and 98.3% mortality of mealworms 2 and 5 days after infection, respectively. The fungal transformation vector, pABeG containing the egfp gene, was inserted into the genomic DNA of ERL1170 using the restriction enzyme-mediated integration method. This resulted in the generation of the transformant, Bb-egfp#3, which showed the highest level of fluorescence. Bb-egfp#3-treated mealworms gradually turned dark brown, and in 7-days mealworm sections showed a strong fluorescence. This did not occur in the wild-type strain. This work suggests that further valuable proteins can be efficiently produced in this mealworm-based fungal expression platform, thereby increasing the value of mealworms in the animal feed additive industry. © 2013 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Krams, I; Daukšte, J; Kivleniece, I; Krama, T; Rantala, MJ; Ramey, G; Šauša, L
2011-01-01
Increasing evidence suggests that secondary sexual traits reflect immunocompetence of males in many animal species. This study experimentally investigated whether a parasite-like immunological challenge via a nylon implant affects sexual attractiveness of males in Tenebrio molitor L. (Coleoptera: Tenebrionidae) Although a single immunological challenge significantly reduced sexual attractiveness and locomotor activity of males, it had no adverse effect on their survival. A second immune challenge of the same males increased their attractiveness. However, it was found that the repeated challenge significantly reduced locomotor activity of males and caused higher mortality. This result indicates terminal investment on sexual signaling, which is supposedly based on a trade-off between pheromone production and energy expenditures needed for such activities as recovery of immune system and locomotor activity. When the third implantation was carried out in the same group of males, melanization of nylon implants was found to be lower in more attractive than in less attractive males. This suggests that males that became sexually attractive after the second immune challenge did not invest in recovery of their immune system. PMID:21864151
Ferreira, Alexandre H P; Terra, Walter R; Ferreira, Clélia
2003-02-01
The midgut of the yellow mealworm, Tenebrio molitor L. (Coleoptera: Tenebrionidae) larvae has four beta-glycosidases. The properties of two of these enzymes (betaGly1 and betaGly2) have been described elsewhere. In this paper, the characterization of the other two glycosidases (betaGly3 and betaGly4) is described. BetaGly3 has one active site, hydrolyzes disaccharides, cellodextrins, synthetic substrates and beta-glucosides produced by plants. The enzyme is inhibited by amygdalin, cellotriose, cellotetraose and cellopentaose in high concentrations, probably due to transglycosylation. betaGly3 hydrolyzes beta 1,4-glycosidic linkages with a catalytic rate independent of the substrate polymerization degree (k(int)) of 11.9 s(-1). Its active site is formed by four subsites, where subsites +1 and -1 bind glucose residues with higher affinity than subsite +2. The main role of betaGly3 seems to be disaccharide hydrolysis. BetaGly4 is a beta-galactosidase, since it has highest activity against beta-galactosides. It can also hydrolyze fucosides, but not glucosides, and has Triton X-100 as a non-essential activator (K(a)=15 microM, pH 4.5). betaGly4 has two active sites that can hydrolyze p-nitrophenyl beta-galactoside (NPbetaGal). The one hydrolyzing NPbetaGal with more efficiency is also active against methylumbellipheryl beta-D-galactoside and lactose. The other active site hydrolyzes NPbetaFucoside and binds NPbetaGal weakly. BetaGly4 hydrolyzes hydrophobic substrates with high catalytical efficiency and is able to bind octyl-beta-thiogalactoside in its active site with high affinity. The betaGly4 physiological role is supposed to be the hydrolysis of galactolipids that are found in membranes from vegetal tissues. As the enzyme has a hydrophobic site where Triton X-100 can bind, it might be activated by membrane lipids, thus becoming fully active only at the surface of cell membranes.
Azzollini, D.; Derossi, A.; Fogliano, V.; Lakemond, C.M.M.; Severini, C.
2018-01-01
Extruded cereals made of wheat flour and grinded Yellow mealworm larvae (Tenebrio molitor) were produced to investigate the effect of insect inclusion (0%, 10%, 20%) and processing conditions (barrel temperature and screw speed) on their nutritional content, microstructure, texture and
Rho, Myung Suk; Lee, Kwang Pum
2014-12-01
Geometric analysis of the nutritional regulatory responses was performed on an omnivorous mealworm beetle, Tenebrio molitor L. (Coleoptera: Tenebrionidae) to test whether this beetle had the capacity to balance the intake of protein and carbohydrate. We also identified the pattern of ingestive trade-off employed when the insect was forced to balance the costs of over- and under-ingesting macronutrients. When allowed to mix their diet from two nutritionally imbalanced but complementary foods (protein-biased food: p35:c7 or p28:c5.6; carbohydrate-biased food: p7:c35 or p5.6:c28), beetles of both sexes actively regulated their intake of protein and carbohydrate to a ratio of 1:1. When confined to one of seven nutritionally imbalanced foods (p0:c42, p7:c35, p14:c28, p21:c21, p28:c14, p35:c7 or p42:c0), beetles over-ingested the excessive nutrient from these foods to such an extent that all the points of protein-carbohydrate intake aligned linearly in the nutrient space, a pattern that is characteristic of generalist feeders and omnivores. Under the restricted feeding conditions, males ate more nutrients but were less efficient at retaining their body lipids than females. Body lipid content was higher on carbohydrate-rich foods and was positively correlated with starvation resistance. Our results are consistent with the prediction based on the nutritional heterogeneity hypothesis, which links the nutritional regulatory responses of insects to their diet breadth and feeding ecology. Copyright © 2014. Published by Elsevier Ltd.
In vitro digestibility and fermentability of selected insects for dog foods
Bosch, Guido; Vervoort, J. J M; Hendriks, W. H.
2016-01-01
Insects are considered as a sustainable protein source for future pet foods. Here we aimed to evaluate the protein quality of larvae of the black soldier fly (Hermetia illucens, BSF), housefly (Musca domestica, HF) and yellow mealworm (Tenebrio molitor, YMW) and to evaluate the fermentation
Damasceno, Ticiane F; Dias, Renata O; de Oliveira, Juliana R; Salinas, Roberto K; Juliano, Maria A; Ferreira, Clelia; Terra, Walter R
2017-10-01
Cathepsins L are the major digestive peptidases in the beetle Tenebrio molitor. Two digestive cathepsins L (TmCAL2 and TmCAL3) from it had their 3D structures solved. The aim of this paper was to study in details TmCAL3 specificity and properties and relate them to its 3D structure. Recombinant TmCAL3 was assayed with 64 oligopeptides with different amino acid replacements in positions P2, P1, P1' and P2'. Results showed that TmCAL3 S2 specificity differs from the human enzyme and that its specificities also explain why on autoactivation two propeptide residues remain in the enzyme. Data on free energy of binding and of activation showed that S1 and S2' are mainly involved in substrate binding, S1' acts in substrate binding and catalysis, whereas S2 is implied mainly in catalysis. Enzyme subsite residues were identified by docking with the same oligopeptide used for kinetics. The subsite hydrophobicities were calculated from the efficiency of hydrolysis of different amino acid replacements in the peptide and from docking data. The results were closer for S1 and S2' than for S1' and S2, indicating that the residue subsites that were more involved in transition state binding are different from those binding the substrate seen in docking. Besides TmCAL1-3, there are nine other cathepsins L, most of them more expressed at midgut. They are supposed to be directed to lysosomes by a Drosophila-like Lerp receptor and/or motifs in their prodomains. The mannose 6-phosphate lysosomal sorting machinery is absent from T. molitor transcriptome. Cathepsin L direction to midgut contents seems to depend on overexpression. Copyright © 2017 Elsevier Ltd. All rights reserved.
Patnaik, Bharat Bhusan; Patnaik, Hongray Howrelia; Seo, Gi Won; Jo, Yong Hun; Lee, Yong Seok; Lee, Bok Luel; Han, Yeon Soo
2014-10-01
Myeloid differentiation factor 88 (MyD88), an intracellular adaptor protein involved in Toll/Toll-like receptor (TLR) signal processing, triggers activation of nuclear factor-kappaB (NF-κB) transcription factors. In the present study, we analyzed the gene structure and biological function of MyD88 in a coleopteran insect, Tenebrio molitor (TmMyD88). The TmMyD88 gene was 1380 bp in length and consisted of five exons and four introns. The 5'-flanking sequence revealed several putative transcription factor binding sites, such as STAT-4, AP-1, cJun, cfos, NF-1 and many heat shock factor binding elements. The cDNA contained a typical death domain, a conservative Toll-like interleukin-1 receptor (TIR) domain, and a C-terminal extension (CTE). The TmMyD88 TIR domain showed three significantly conserved motifs for interacting with the TIR domain of TLRs. TmMyD88 was grouped within the invertebrate cluster of the phylogenetic tree and shared 75% sequence identity with the TIR domain of Tribolium castaneum MyD88. Homology modeling of the TmMyD88 TIR domain revealed five parallel β-strands surrounded by five α-helices that adopted loop conformations to function as an adaptor. TmMyD88 expression was upregulated 7.3- and 4.79-fold after 12 and 6h, respectively, of challenge with Staphylococcus aureus and fungal β-1,3 glucan. Silencing of the TmMyD88 transcript by RNA interference led to reduced resistance of the host to infection by S. aureus. These results indicate that TmMyD88 is required for survival against Staphylococcus infection. Copyright © 2014 Elsevier Ltd. All rights reserved.
Lemos,Walkymário de Paulo; Ramalho,Francisco de Souza; Serrão,José Eduardo; Zanuncio,José Cola
2005-01-01
The morphology of the reproductive tract of Podisus nigrispinus (Dallas) females fed with Alabama argillacea (Hübner) larvae, artificial diet, Tenebrio molitor L. larvae or Musca domestica L. larvae were studied. The reproductive tract of females of this species presented yellow coloration and independent of the diet, each ovary had seven ovarioles joined through terminal filaments and forming a bunch shape structure. The histological data revealed that the ovary of P. nigrispinus was of mero...
In vitro digestibility and fermentability of selected insects for dog foods
Bosch, G.; Vervoort, J.J.M.; Hendriks, W.H.
2016-01-01
Insects are considered as a sustainable protein source for future pet foods. Here we aimed to evaluate the protein quality of larvae of the black soldier fly (Hermetia illucens, BSF), housefly (Musca domestica, HF) and yellow mealworm (Tenebrio molitor, YMW) and to evaluate the fermentation
Markou, T; Theophilidis, G
2000-11-01
Combined intracellular and extracellular recordings from various parts of the isolated dorsal vessel of Tenebrio molitor revealed some of the following electrophysiological properties of the heart and the aorta. (i) The wave of depolarization causing forward pulsation of the dorsal vessel was always transmitted from posterior to anterior, with a conduction velocity of 0.014 m s(-1) in the heart and 0.001 m s(-1) in the aorta when the heart rate was 60 beats min(-1). (ii) There was no pacemaker activity in the aorta. (iii) The duration of the compound action potential in the aortic muscle depended on the duration of the pacemaker action potential generated in the heart. (iv) Isolated parts of the heart continued to contract rhythmically for hours, indicating powerful pacemaker activity in individual cardiac segments. (v) There was a direct relationship between action potential duration and the length of the preceding diastolic interval. (vi) The rhythmic wave of depolarization was dependent on the influx of Ca(2+). (vii) The recovery of the electrical properties of myocardial cells that had been disrupted by sectioning was rapid. (viii) In hearts sectioned into two halves, the rhythmic pacemaker action potentials recorded simultaneously from the two isolated halves eventually drifted out of phase, but they had the same intrinsic frequency. In the light of these data, we discuss two alternative models for the generation of spontaneous rhythmic pumping movements of the heart and aorta.
A physiologically-oriented transcriptomic analysis of the midgut of Tenebrio molitor.
Moreira, Nathalia R; Cardoso, Christiane; Dias, Renata O; Ferreira, Clelia; Terra, Walter R
2017-05-01
Physiological data showed that T. molitor midgut is buffered at pH 5.6 at the two anterior thirds and at 7.9 at the posterior third. Furthermore, water is absorbed and secreted at the anterior and posterior midgut, respectively, driving a midgut counter flux of fluid. To look for the molecular mechanisms underlying these phenomena and nutrient absorption as well, a transcriptomic approach was used. For this, 11 types of transporters were chosen from the midgut transcriptome obtained by pyrosequencing (Roche 454). After annotation with the aid of databanks and manual curation, the sequences were validated by RT-PCR. The expression level of each gene at anterior, middle and posterior midgut and carcass (larva less midgut) was evaluated by RNA-seq taking into account reference sequences based on 454 contigs and reads obtained by Illumina sequencing. The data showed that sugar and amino acid uniporters and symporters are expressed along the whole midgut. In the anterior midgut are found transporters for NH 3 and NH 4 + that with a chloride channel may be responsible for acidifying the lumen. At the posterior midgut, bicarbonate-Cl - antiporter with bicarbonate supplied by carbonic anhydrase may alkalinize the lumen. Water absorption caused mainly by an anterior Na + -K + -2Cl - symporter and water secretion caused by a posterior K + -Cl - may drive the midgut counter flux. Transporters that complement the action of those described were also found. Copyright © 2017 Elsevier Ltd. All rights reserved.
Gomez, Ana; Cardoso, Christiane; Genta, Fernando A; Terra, Walter R; Ferreira, Clélia
2013-08-01
The soluble midgut trehalase from Tenebrio molitor (TmTre1) was purified after several chromatographic steps, resulting in an enzyme with 58 kDa and pH optimum 5.3 (ionizing active groups in the free enzyme: pK(e1) = 3.8 ± 0.2 pK(e2) = 7.4 ± 0.2). The purified enzyme corresponds to the deduced amino acid sequence of a cloned cDNA (TmTre1-cDNA), because a single cDNA coding a soluble trehalase was found in the T. molitor midgut transcriptome. Furthermore, the mass of the protein predicted to be coded by TmTre1-cDNA agrees with that of the purified enzyme. TmTre1 has the essential catalytic groups Asp 315 and Glu 513 and the essential Arg residues R164, R217, R282. Carbodiimide inactivation of the purified enzyme at different pH values reveals an essential carboxyl group with pKa = 3.5 ± 0.3. Phenylglyoxal modified a single Arg residue with pKa = 7.5 ± 0.2, as observed in the soluble trehalase from Spodoptera frugiperda (SfTre1). Diethylpyrocarbonate modified a His residue that resulted in a less active enzyme with pK(e1) changed to 4.8 ± 0.2. In TmTre1 the modified His residue (putatively His 336) is more exposed than the His modified in SfTre1 (putatively His 210) and that affects the ionization of an Arg residue. The architecture of the active site of TmTre1 and SfTre1 is different, as shown by multiple inhibition analysis, the meaning of which demands further research. Trehalase sequences obtained from midgut transcriptomes (pyrosequencing and Illumina data) from 8 insects pertaining to 5 different orders were used in a cladogram, together with other representative sequences. The data suggest that the trehalase gene went duplication and divergence prior to the separation of the paraneopteran and holometabolan orders and that the soluble trehalase derived from the membrane-bound one by losing the C-terminal transmembrane loop. Copyright © 2013 Elsevier Ltd. All rights reserved.
Klasing, K C; Thacker, P; Lopez, M A; Calvert, C C
2000-12-01
The purpose of these studies was to determine the husbandry variables that optimize the Ca content of mealworms (Tenebrio molitor) and to determine the bioavailability of this Ca for bone mineralization in chicks that consume the mealworms. To determine the optimal level of Ca in the substrates used in short-term (mealworms and to determine the length of time that mealworms should be exposed to high-Ca substrates, mealworms were placed in either a wheat bran or a chicken starter substrate supplemented with 0, 4, 8, or 12% Ca from CaCO3. The mealworms were harvested after 0.5, 1, 2, 3, 4, 7, or 14 days. The Ca content of the mealworms was greatest with the use of chicken starter and increased linearly with the Ca content of the substrate. In general, the Ca content of the mealworms increased during the first 24 hr and decreased after > or = 1 wk, especially at the higher levels of Ca supplementation. The chicken starter also resulted in higher levels of vitamin D in mealworms. Mealworms held in wheat bran with 8% Ca were fed to growing chicks. Ca bioavailability was calculated from the chicks' bone ash. The Ca in these mealworms was 76% as bioavailable as the Ca in oyster shell.
Osimani, Andrea; Cardinali, Federica; Aquilanti, Lucia; Garofalo, Cristiana; Roncolini, Andrea; Milanović, Vesna; Pasquini, Marina; Tavoletti, Stefano; Clementi, Francesca
2017-12-18
The present study aimed to assess the occurrence of transferable determinants conferring resistance to tetracyclines, macrolide-lincosamide-streptogramin B, vancomycin, beta-lactams, and aminoglycosides in 40 samples of commercialized edible mealworms (Tenebrio molitor L.) purchased from European Union (EU) and non-EU producers. A high prevalence of tet(K) was observed in all of the samples assayed, with percentages of PCR-based positivity that ranged from 80% (samples from Thailand) to 100% (samples from the Netherlands, Belgium and France). For macrolides, erm(B) prevailed, being detected in 57.5% of the samples assayed, whereas erm(A) and erm(C) were detected with lower frequencies. Genes for resistance to vancomycin were only detected in samples produced in France and Belgium, with 90% and 10% of the samples being positive for vanA, respectively. Beta-lactamase genes were found with low occurrence, whereas the gene aac-aph, conferring high resistance to aminoglycosides, was found in 40% of the samples produced in the Netherlands and Belgium and 20% of the samples produced in Thailand. The results of Principal Coordinate Analysis and Principal Component Analysis depicted a clean separation of the samples collected from the four producers based on the distribution of the 12 AR determinants considered. Given the growing interest on the use of mealworms as a novel protein source, AR detection frequencies found in the present study suggest further investigation into the use of antibiotics during rearing of this insect species and more extensive studies focused on the factors that can affect the diffusion of transferable ARs in the production chain. Until such studies are completed, prudent use of antibiotics during rearing of edible insects is recommended. Copyright © 2017 Elsevier B.V. All rights reserved.
Insect midgut α-mannosidases from family 38 and 47 with emphasis on those of Tenebrio molitor.
Moreira, Nathalia R; Cardoso, Christiane; Ribeiro, Alberto F; Ferreira, Clelia; Terra, Walter R
2015-12-01
α-Mannosidases are enzymes which remove non-reducing terminal residues from glycoconjugates. Data on both GH47 and GH38 (Golgi and lysosomal) enzymes are available. Data on insect midgut α-mannosidases acting in digestion are preliminary and do not include enzyme sequences. Tenebrio molitor midgut α-mannosidases were separated by chromatography into two activity peaks: a major (Man1) and a minor (Man2). An antibody generated against a synthetic peptide corresponding to a sequence of α-mannosidase fragment recognizes Man2 but not Man1. That fragment was later found to correspond to TmMan2 (GenBank access KP892646), showing that the cDNA coding for Man2 is actually TmMan2. TmMan2 codes for a mature α-mannosidase with 107.5 kDa. Purified Man2 originates after SDS-PAGE one band of about 72 kDa and another of 51 kDa, which sums 123 kDa, in agreement with gel filtration (123 kDa) data. These results suggest that Man2 is processed into peptides that remain noncovalently linked within the functional enzyme. The physical and kinetical properties of purified Man1 and Man2 are similar. They have a molecular mass of 123 kDa (gel filtration), pH optimum (5.6) and response to inhibitors like swainsonine (Man1 Ki, 68 nM; Man2 Ki, 63 nM) and deoxymannojirimycin (Man1 Ki, 0.12 mM; Man2 Ki, 0.15 mM). Their substrate specificities are a little different as Man2 hydrolyzes α-1,3 and α-1,6 bonds better than α-1,2, whereas the contrary is true for Man1. Thus, they pertain to Class II (GH38 α-mannosidases), that are catabolic α-mannosidases similar to lysosomal α-mannosidase. However, Man2, in contrast to true lysosomal α-mannosidase, is secreted (immunocytolocalization data) into the midgut contents. There, Man2 may participate in digestion of fungal cell walls, known to have α-mannosides in their outermost layer. The amount of family 38 α-mannosidase sequences found in the transcriptome (454 pyrosequencing) of the midgut of 9 insects pertaining to 5 orders is
Directory of Open Access Journals (Sweden)
Francisco Roberto de Azevedo
1999-02-01
Full Text Available A pesquisa objetivou determinar se a temperatura e a defesa da presa afetam o consumo e a utilização de larvas de Tenebrio molitor L. por ninfas de Supputius cincticeps (Stäl. Quantificaram-se em cada um dos ínstares do predador Supputius cincticeps os consumos bruto e diário das larvas de T. molitor com e sem defesa, ganho de peso total e ganho de peso diário pelo predador. Foram determinados os efeitos da defesa da presa e da temperatura ambiente no consumo de alimento pelas ninfas de 2º, 3º, 4º e 5º ínstares de S. cincticeps. A pesquisa foi conduzida na Unidade de Controle Biológico da Embrapa-Centro Nacional de Pesquisa de Algodão, em Campina Grande, PB, a 20, 25, e 30ºC, 60±10% UR e fotofase de 14 horas. Os resultados mostraram que o consumo bruto de larvas de T. molitor pelo S. cincticeps depende do ínstar do predador e da temperatura, do ínstar do predador e da defesa da presa, e da temperatura e defesa da presa; o consumo diário de S. cincticeps depende do ínstar do predador e da temperatura, e do ínstar do predador e da defesa da presa, e o ganho de peso de S. cincticeps depende do seu ínstar, da temperatura e da defesa apresentada pelas larvas de T. molitor. O tamanho das larvas de T. molitor funciona como defesa ao ataque de S. cincticeps.The objective of the research was to determine if the temperature and pray defense affect the consumption and utilization of Tenebrio molitor L. larvae by nymphs of Supputius cincticeps (Stäl. The gross and daily consumptions of T. molitor larvae with and without defense by the predator Supputius cincticeps, and the gross and daily weight gains of the predator were quantified. Effects of the prey defense and temperature on the food consumption by the 2nd, 3rd, 4th and 5th instar nimphs of S. cincticeps were determined. The research was carried out in the Biological Control Unit of the Embrapa-Centro Nacional de Pesquisa de Algodão, at Campina Grande, PB, Brazil, at 20, 25, and
Dhakal, Suraj; Meyling, Nicolai V; Williams, Andrew R; Mueller-Harvey, Irene; Fryganas, Christos; Kapel, Christian M O; Fredensborg, Brian L
2015-01-15
Natural anti-parasitic compounds in plants such as condensed tannins (CT) have anthelmintic properties against a range of gastrointestinal nematodes, but for other helminths such effects are unexplored. The aim of this study was to assess the effects of CT from three different plant extracts in a model system employing the rat tapeworm, Hymenolepis diminuta, in its intermediate host, Tenebrio molitor. An in vitro study examined infectivity of H. diminuta cysticercoids (excystation success) isolated from infected beetles exposed to different concentrations of CT extracts from pine bark (PB) (Pinus sps), hazelnut pericarp (HN) (Corylus avellana) or white clover flowers (WC) (Trifolium repens), in comparison with the anthelmintic drug praziquantel (positive control). In the in vitro study, praziquantel and CT from all three plant extracts had dose-dependent inhibitory effects on cysticercoid excystation. The HN extract was most effective at inhibiting excystation, followed by PB and WC. An in vivo study was carried out on infected beetles (measured as cysticercoid establishment) fed different doses of PB, HN and praziquantel. There was a highly significant inhibitory effect of HN on cysticercoid development (p=0.0002). Overall, CT showed a promising anti-cestodal effect against the metacestode stage of H. diminuta. Copyright © 2014 Elsevier B.V. All rights reserved.
Tenebrio beetles use magnetic inclination compass
Vácha, Martin; Drštková, Dana; Půžová, Tereza
2008-08-01
Animals that guide directions of their locomotion or their migration routes by the lines of the geomagnetic field use either polarity or inclination compasses to determine the field polarity (the north or south direction). Distinguishing the two compass types is a guideline for estimation of the molecular principle of reception and has been achieved for a number of animal groups, with the exception of insects. A standard diagnostic method to distinguish a compass type is based on reversing the vertical component of the geomagnetic field, which leads to the opposite reactions of animals with two different compass types. In the present study, adults of the mealworm beetle Tenebrio molitor were tested by means of a two-step laboratory test of magnetoreception. Beetles that were initially trained to memorize the magnetic position of the light source preferred, during the subsequent test, this same direction, pursuant geomagnetic cues only. In the following step, the vertical component was reversed between the training and the test. The beetles significantly turned their preferred direction by 180°. Our results brought until then unknown original findings that insects, represented here by the T. molitor species, use—in contrast to another previously researched Arthropod, spiny lobster—the inclination compass.
ISOLASI NEMATODA PATOGEN SERANGGA STEINERNEMA DAN HETERORHABDITIS
Directory of Open Access Journals (Sweden)
Chaerani, Y. Suryadi, T.P. Priyatno, D. Koswanudin1, U. Rahmat , Sujatmo, Yusuf, dan C.T. Griffin.
2012-02-01
Full Text Available Isolation of Entomopathogenic Nematodes Steinernema and Heterorhabditis. Entomopathogenic nematodes from the genus Steinernema and Heterorhabditis (Rhabditida: Steinernematidae and Heterorhabditidae are promising biological control agent of insect pests. Indigenous nematodes have been isolated and collected for the use in local biological control program of important insect pests. The nematodes were isolated using soil baiting method with insect larvae. Laboratory tests have shown that the mealworm larvae Tenebrio molitor (Coleoptera: Tenebrionidae served as a good alternative to the standard insect bait, the greater wax moth larvae Galleria mellonella (Lepidoptera: Galleriidae for isolation and maintenance of nematodes. Both nematodes were successfully isolated using T. molitor larvae from 13% soil samples (26 out of a total of 207 collected from 14 locations in West and Central Java and Lampung provinces in the period of 1993 until 2006. Heterorhabditis (9% was more prevalent than Steinernema (4%. Both nematodes were successfully propagated on mealworm larvae.
A study of the female produced sex pheromone of Tenebrio molitor (Coleoptera: Tenebrionidae)
Mangat, Jaswinder
Mating behaviour in the yellow mealworm beetle, Tenebrio molitor , is mediated by several pheromones, including the female-produced 4-methylnonanol (4-MNol). Mating causes a decline in the titre of 4-MNol. The overall goal of this study was to determine the biochemical mechanism(s) responsible for this decline: i.e., whether the decline was due to an inhibition of pheromone biosynthesis and/or a stimulation of pheromone degradation; whether the decline was caused by the physical effect of mating or was due to the transfer of a factor from the male; and to conduct a preliminary investigation of the regulatory and signal transduction mechanisms involved in the regulation of 4-MNol production. In vitro radioassays for 4-MNol biosynthesis and degradation were developed and used to compare the levels of 4-MNol biosynthesis and degradation in virgin and mated females. Mating caused an inhibition of 4-MNol biosynthesis within 2 hours, but did not affect the rate of pheromone degradation. Decapitation of virgin females caused an inhibition of pheromone biosynthesis and did not prevent the inhibitory effect of mating. The inhibitory effect of mating was mimicked in females that were artificially inseminated with male reproductive tract homogenates (MRTH), but not in females similarly "inseminated" with water, saline, or air. Furthermore, 4-MNol biosynthesis could be inhibited in vitro by the addition of MRTH. These findings indicate that the male transferred one or more pheromonostatic factor(s) to the female during copulation that acted directly on the pheromone-producing tissue (the ovaries). In order to investigate the biochemical basis for the inhibition of pheromone biosynthesis after mating, the role of calcium was determined by modulating the level of calcium (using a calcium chelator, an ionophore, and calcium). However, due to the precipitation of calcium with the phosphate present in the buffer solution, we were unable to determine the role of calcium in the
Alimu, Reyihanguli; Mao, Xinfang; Liu, Zhongyuan
2013-06-01
To improve the expression level of tmAMP1m gene from Tenebrio molitor in Escherichia coli, we studied the effects of expression level and activity of the fusion protein HIS-TmAMP1m by conditions, such as culture temperature, inducing time and the final concentration of inductor Isopropyl beta-D-thiogalactopyranoside (IPTG). We analyzed the optimum expression conditions by Tricine-SDS-PAGE electrophoresis, meanwhile, detected its antibacterial activity by using agarose cavity diffusion method. The results suggest that when inducing the recombinant plasmid with a final IPTG concentration of 0.1 mmol/L at 37 degrees C for 4 h, there was the highest expression level of fusion protein HIS-TmAMP1m in Escherichia coli. Under these conditions, the expression of fusion protein accounted for 40% of the total cell lysate with the best antibacterial activity. We purified the fusion protein HIS-TmAMPlm with nickel-nitrilotriacetic acid (Ni-NTA) metal-affinity chromatography matrices. Western blotting analysis indicates that the His monoclonal antibody could be specifically bound to fusion protein HIS-TmAMPlm. After expression by inducing, the fusion protein could inhibit the growth of host cell transformed by pET30a-tmAMP1m. The fusion protein HIS-TmAMP1m had better stability and remained higher antibacterial activities when incubated at 100 degrees C for 10 h, repeated freeze thawing at -20 degrees C, dissolved in strong acid and alkali, or treated by organic solvents and protease. Moreover, the minimum inhibitory concentration results demonstrated that the fusion protein HIS-TmAMP1m has a good antibacterial activity against Staphylococcus aureus, Staphylococcus sp., Corynebacterium glutamicum, Bacillus thuringiensis, Corynebacterium sp. This study laid the foundation to promote the application of insect antimicrobial peptides and further research.
Rho, Myung Suk; Lee, Kwang Pum
2016-01-01
Recent developments in insect gerontological and nutritional research have suggested that the dietary protein:carbohydrate (P:C) balance is a critical determinant of lifespan and reproduction in many insects. However, most studies investigating this important role of dietary P:C balance have been conducted using dipteran and orthopteran species. In this study, we used the mealworm beetles, Tenebrio molitor L. (Coleoptera: Tenebrionidae), to test the effects of dietary P:C balance on lifespan and reproduction. Regardless of their reproductive status, both male and female beetles had the shortest lifespan at the protein-biased ratio of P:C 5:1. Mean lifespan was the longest at P:C 1:1 for males and at both P:C 1:1 and 1:5 for females. Mating significantly curtailed the lifespan of both males and females, indicating the survival cost of mating. Age-specific egg laying was significantly higher at P:C 1:1 than at the two imbalanced P:C ratios (1:5 or 5:1) at any given age throughout their lives, resulting in the highest lifetime reproductive success at P:C 1:1. When given a choice, beetles actively regulated their intake of protein and carbohydrate to a slightly carbohydrate-biased ratio (P:C 1:1.54-1:1.64 for males and P:C 1:1.3-1:1.36 for females). The self-selected P:C ratio was significantly higher for females than males, reflecting a higher protein requirement for egg production. Collectively, our results add to a growing body of evidence suggesting the key role played by dietary macronutrient balance in shaping lifespan and reproduction in insects. Copyright © 2016 Elsevier Ltd. All rights reserved.
浮萍饲喂黄粉虫的效益分析%Effects and profits of feeding Tenebrio molitor with Lemna minor
Institute of Scientific and Technical Information of China (English)
郑燕玲; 赖锦洪; 杨靖; 谢思; 羊海军
2015-01-01
以传统饲料配方为对照,测试添加不同用量浮萍(Lemna minor)对黄粉虫(Tenebrio molitor)幼虫生长发育及蛋白、粗脂肪含量等指标的影响.结果表明,黄粉虫幼虫对新鲜浮萍适口性良好;新鲜浮萍投饲比例大于80%,对黄粉虫幼虫的生长发育有阻滞,但对其蛋白、粗脂肪含量无显著影响(P>0.05);以鲜浮萍∶麦麸质量百分比为65%∶35%配置,可使饲料成本降低33.95%,且不影响黄粉虫的饲喂周期、产量和质量.利用新鲜浮萍饲喂黄粉虫幼虫是可行的,通过构建“浮萍-黄粉虫”食物链,可显著降低养殖成本,增加经济效益和生态效益,促进黄粉虫养殖行业发展.
2007-04-09
wood roach (Parcoblatta uhleriana [ Saussure ]), mosquito (Culex sp.), ant (Camponotus pennsylvanicus [DeGeer]), and beetle (Tenebrio molitor Linnaeus...wood roach (Parcoblatta uhleriana [ Saussure ]), beetle (Tenebrio molitor linnaeus), mosquito (Culex sp), and ant (Camponotus pennsylvanicus [De Geer
Stoops, J; Crauwels, S; Waud, M; Claes, J; Lievens, B; Van Campenhout, L
2016-02-01
In Western countries, the popularity of edible insects as an alternative animal protein source is increasing. Nevertheless, there is a lack of profound insight into the microbial safety and shelf life of living insects sold for human consumption. The purpose of this study was to characterise the microflora of fresh edible mealworm larvae and grasshoppers in a quantitative and qualitative way. Therefore, culture-dependent analyses (the total viable aerobic count, Enterobacteriaceae, lactic acid bacteria, yeasts and moulds, and bacterial endospores) and next-generation sequencing (454amplicon pyrosequencing) were performed. High microbial counts were obtained for both insect species. Different insect batches resulted in quite similar microbial numbers, except for bacterial endospores. However, the bacterial community composition differed between both insect species. The most abundant operational taxonomic unit in mealworm larvae was Propionibacterium. Also members of the genera Haemophilus, Staphylococcus and Clostridium were found. Grasshoppers were mainly dominated by Weissella, Lactococcus and Yersinia/Rahnella. Overall, a variety of potential spoilage bacteria and food pathogens were characterised. The results of this study suggest that a processing step with a microbiocidal effect is required to avoid or minimize risks involved with the consumption of edible insects. Copyright © 2015 Elsevier Ltd. All rights reserved.
Proteome response of Tribolium castaneum larvae to Bacillus thuringiensis toxin producing strains.
Directory of Open Access Journals (Sweden)
Estefanía Contreras
Full Text Available Susceptibility of Tribolium castaneum (Tc larvae was determined against spore-crystal mixtures of five coleopteran specific and one lepidopteran specific Bacillus thuringiensis Cry toxin producing strains and those containing the structurally unrelated Cry3Ba and Cry23Aa/Cry37Aa proteins were found toxic (LC(50 values 13.53 and 6.30 µg spore-crystal mixture/µL flour disc, respectively. Using iTRAQ combined with LC-MS/MS allowed the discovery of seven novel differentially expressed proteins in early response of Tc larvae to the two active spore-crystal mixtures. Proteins showing a statistically significant change in treated larvae compared to non-intoxicated larvae fell into two major categories; up-regulated proteins were involved in host defense (odorant binding protein C12, apolipophorin-III and chemosensory protein 18 and down-regulated proteins were linked to metabolic pathways affecting larval metabolism and development (pyruvate dehydrogenase Eα subunit, cuticular protein, ribosomal protein L13a and apolipoprotein LI-II. Among increased proteins, Odorant binding protein C12 showed the highest change, 4-fold increase in both toxin treatments. The protein displayed amino acid sequence and structural homology to Tenebrio molitor 12 kDa hemolymph protein b precursor, a non-olfactory odorant binding protein. Analysis of mRNA expression and mortality assays in Odorant binding protein C12 silenced larvae were consistent with a general immune defense function of non-olfactory odorant binding proteins. Regarding down-regulated proteins, at the transcriptional level, pyruvate dehydrogenase and cuticular genes were decreased in Tc larvae exposed to the Cry3Ba producing strain compared to the Cry23Aa/Cry37Aa producing strain, which may contribute to the developmental arrest that we observed with larvae fed the Cry3Ba producing strain. Results demonstrated a distinct host transcriptional regulation depending upon the Cry toxin treatment. Knowledge
Inhibition of Methane Hydrate Formation by Ice-Structuring Proteins
DEFF Research Database (Denmark)
Jensen, Lars; Ramløv, Hans; Thomsen, Kaj
2010-01-01
, assumed biodegradable, are capable of inhibiting the growth of methane hydrate (a structure I hydrate). The ISPs investigated were type III HPLC12 (originally identified in ocean pout) and ISP type III found in meal worm (Tenebrio molitor). These were compared to polyvinylpyrrolidone (PVP) a well...... of inhibitors. The profile of the nonlinear growth was concentration-dependent but also dependent on the stirring rate. ISP type III HPLC12 decreased the growth rate of methane hydrate during the linear growth period by 17−75% at concentrations of 0.01−0.1 wt % (0.014−0.14 mM) while ISP from Tenebrio molitor...... and PVP decreased the growth rate by 30% and 39% at concentrations of 0.004 wt % (0.005 mM) and 0.1 wt % (0.1 mM), respectively. Considering the low concentration of Tenebrio molitor ISP used, these results indicate that ISP from Tenebrio molitor is the most effective hydrate inhibitor among those...
Wang, Yan; Shi, Meng; Hou, Xiaojuan; Meng, Shanshan; Zhang, Fuchun; Ma, Ji
2014-01-01
Abstract Microdera punctipennis Kaszab (Coleoptera: Tenebrionidae) is an endemic species in Guerbantonggut desert in China. To explore the ways that M. punctipennis egg adapts to dry desert environment, morphological characteristics of the egg was investigated along with the egg of the nondesert beetle Tenebrio molitor (Coleoptera: Tenebrionidae). Water loss rate and survival rate of these eggs under different dry treatments (relative humidity0, 10, and 20%) were measured to evaluate the desiccation resistance of the eggs at different developmental stages (day 0, 2, and 5 eggs). Our results showed that the 50-egg weight in T. molitor was heavier than M. punctipennis , while the 50-first-instar larva weight in T. molitor was almost the same as in M. punctipennis . The water loss rate of M. punctipennis egg under dry conditions was significantly lower than T. molitor , and the egg survival rate was significantly higher than T. molitor . The estimated developmental threshold temperature of M. punctipennis egg was 18.30°C, and the critical thermal maximum of M. punctipennis egg is above 39°C. These features partly account for the adaptability of M. punctipennis to desert environment in egg stage. PMID:25525108
Czarniewska, Elżbieta; Rosiński, Grzegorz; Gabała, Elżbieta; Kuczer, Mariola
2014-01-01
Background The injection of Neb-colloostatin into T. molitor females causes gonadoinhibitory effects on ovarian development. This peptide inhibits intercellular space formation (patency) in follicular epithelium and results in slowed vitellogenesis, delayed ovulation, reduced number of eggs laid and presumably cell death in the terminal follicles. However, as does the form of cell death in the terminal follicle, the mode of action of Neb-colloostatin remains unknown. Results We tested Neb-col...
Directory of Open Access Journals (Sweden)
Walkymário de Paulo Lemos
2005-01-01
Full Text Available The morphology of the reproductive tract of Podisus nigrispinus (Dallas females fed with Alabama argillacea (Hübner larvae, artificial diet, Tenebrio molitor L. larvae or Musca domestica L. larvae were studied. The reproductive tract of females of this species presented yellow coloration and independent of the diet, each ovary had seven ovarioles joined through terminal filaments and forming a bunch shape structure. The histological data revealed that the ovary of P. nigrispinus was of meroistic telotrophic type, with each individual ovariole divided in a terminal filament, a tropharium (trophic chamber, a vitellarium, and a pedicel. The prey type affected the development and morphometry of these structures. Females of P. nigrispinus fed with 3rd or 5th instar larvae of cotton leafworm (A. argillacea presented developed ovaries with ovarioles showing a great number of oocytes in advanced stages of development. Females fed with artificial diet presented atrophic ovaries and ovarioles practically without oocytes. Females fed with T. molitor or M. domestica showed ovaries in intermediary stage of development. The central ovariole was longer in females fed with 5th instar larvae of cotton leafworm and shorter in those fed with artificial diet. Most developed oocytes were observed in ovaries of females fed with 5th or 3rd instar larvae of cotton leafworm, and the majority of atrophic oocytes were found in females fed with artificial diet.Este estudo apresenta a morfologia do sistema reprodutor feminino de Podisus nigrispinus (Dallas alimentado com larvas de Alabama argillacea (Hübner, Musca domestica L. e de Tenebrio molitor L. ou dieta artificial. As gônadas internas desse predador apresentaram coloração amarelada e, independente da dieta, cada ovário apresentou sete ovaríolos unidos pelos filamentos terminais em uma estrutura em forma de cacho. A análise histológica revelou que o ovário de P. nigrispinus é do tipo meroístico telotr
Goldring, J P; Read, J S
1993-12-01
1. The activity of the lipogenic enzyme, acetyl-CoA carboxylase, was investigated in four insect species; Bombyx mori (Lepidoptera), Tenebrio molitor (Coleoptera), Glossina morsitans and Sarcophaga nodosa (Diptera). 2. Acetyl-CoA carboxylase activity in larval, pupal and adult forms was compared with the saponifiable lipid mass at each stage of the life-cycle, and found to follow similar patterns except for Tenebrio molitor. 3. The results are examined in relation to known metabolic requirements for each insect.
Su, Jingzhi; Gong, Yulong; Cao, Shenping; Lu, Fei; Han, Dong; Liu, Haokun; Jin, Junyan; Yang, Yunxia; Zhu, Xiaoming; Xie, Shouqi
2017-10-01
This study evaluated the influence of diets containing mealworm (Tenebrio molitor) meal in partial substitution of fishmeal on growth performance and immune responses of juvenile yellow catfish (Pelteobagrus fulvidraco). Four diets were formulated to contain 0 (the control diet), 9, 18 and 27 g mealworm meal per 100 g diet with 0%, 25%, 50% and 75% of fishmeal replacement, respectively. Yellow catfish were randomly divided into 4 groups with 3 replicates in each group. The fish in each group were fed with one of the four experimental diets for 5 weeks. Growth performance, plasma parameters (SOD, MDA, IgM, C3, lysozyme) and immune related genes (MHC II, IL-1, CypA, IgM, HE) of yellow catfish were determined at the end of the feeding trial, as well as 24 h post bacterial (Edwardsiella ictaluri) challenge. The present results showed that dietary inclusion of mealworm meal (MW) had no negative effects on the growth performance of the juvenile yellow catfish, compared to the control group. At the end of the feeding trial, plasma MDA contents of MW supplemented groups were significant lower than the control group. Plasma SOD activities increased significantly with the increasing dietary MW contents at the end of feeding trial (pre-challenge) and 24 h post challenge with E. ictaluri. Significant increase of plasma lysozyme activity was found in MW supplemented groups compared to the control group 24 h post bacterial challenge. Plasma IgM levels increased significantly with the increasing dietary MW contents at the end of feeding trial. Compared with the control group, the immune related genes of MHC II, IL-1, IgM and HE of the fish in the MW supplemented groups significantly upregulated pre-challenge or 24 h post bacterial challenge. Finally, it was observed that the survival rate of the 27% MW group was significant higher (P < 0.05) than the control group but was not significantly differed from the 18% MW group. The present results indicated that dietary
Food Value of Mealworm Grown on Acrocomia aculeata Pulp Flour
Alves, Ariana Vieira; Sanjinez-Argandoña, Eliana Janet; Linzmeier, Adelita Maria; Cardoso, Claudia Andrea Lima; Macedo, Maria Lígia Rodrigues
2016-01-01
Insects have played an important role as human food throughout history, especially in Africa, Asia and Latin America. A good example of edible insects is the mealworm, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae), which are eaten in Africa, Asia, the Americas and Australia. This species is easily bred in captivity, requiring simple management. The bocaiuva (Acrocomia aculeata (Jacq.) Lodd) is an abundant palm tree found in the Brazilian Cerrado, providing fruits with high nutritional value. The aim of this work was to determine the chemical composition of T. molitor grown in different artificial diets with bocaiuva pulp flour. The nutritional composition, fatty acid composition, antioxidant activity, trypsin activity and anti-nutritional factors of larvae were analyzed. The results showed that mealworms grown on artificial diet with bocaiuva are a good source of protein (44.83%) and lipid (40.45%), with significant levels of unsaturated fatty acids (65.99%), antioxidant activity (4.5 μM Trolox/g of oil extracted from larvae) and absence of anti-nutritional factors. This study indicates a new source of biomass for growing mealworms and shows that it is possible to breed mealworms in artificial diet with bocaiuva flour without compromising the nutritional quality of the larvae. PMID:26974840
Food Value of Mealworm Grown on Acrocomia aculeata Pulp Flour.
Directory of Open Access Journals (Sweden)
Ariana Vieira Alves
Full Text Available Insects have played an important role as human food throughout history, especially in Africa, Asia and Latin America. A good example of edible insects is the mealworm, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae, which are eaten in Africa, Asia, the Americas and Australia. This species is easily bred in captivity, requiring simple management. The bocaiuva (Acrocomia aculeata (Jacq. Lodd is an abundant palm tree found in the Brazilian Cerrado, providing fruits with high nutritional value. The aim of this work was to determine the chemical composition of T. molitor grown in different artificial diets with bocaiuva pulp flour. The nutritional composition, fatty acid composition, antioxidant activity, trypsin activity and anti-nutritional factors of larvae were analyzed. The results showed that mealworms grown on artificial diet with bocaiuva are a good source of protein (44.83% and lipid (40.45%, with significant levels of unsaturated fatty acids (65.99%, antioxidant activity (4.5 μM Trolox/g of oil extracted from larvae and absence of anti-nutritional factors. This study indicates a new source of biomass for growing mealworms and shows that it is possible to breed mealworms in artificial diet with bocaiuva flour without compromising the nutritional quality of the larvae.
Food Value of Mealworm Grown on Acrocomia aculeata Pulp Flour.
Alves, Ariana Vieira; Sanjinez-Argandoña, Eliana Janet; Linzmeier, Adelita Maria; Cardoso, Claudia Andrea Lima; Macedo, Maria Lígia Rodrigues
2016-01-01
Insects have played an important role as human food throughout history, especially in Africa, Asia and Latin America. A good example of edible insects is the mealworm, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae), which are eaten in Africa, Asia, the Americas and Australia. This species is easily bred in captivity, requiring simple management. The bocaiuva (Acrocomia aculeata (Jacq.) Lodd) is an abundant palm tree found in the Brazilian Cerrado, providing fruits with high nutritional value. The aim of this work was to determine the chemical composition of T. molitor grown in different artificial diets with bocaiuva pulp flour. The nutritional composition, fatty acid composition, antioxidant activity, trypsin activity and anti-nutritional factors of larvae were analyzed. The results showed that mealworms grown on artificial diet with bocaiuva are a good source of protein (44.83%) and lipid (40.45%), with significant levels of unsaturated fatty acids (65.99%), antioxidant activity (4.5 μM Trolox/g of oil extracted from larvae) and absence of anti-nutritional factors. This study indicates a new source of biomass for growing mealworms and shows that it is possible to breed mealworms in artificial diet with bocaiuva flour without compromising the nutritional quality of the larvae.
Directory of Open Access Journals (Sweden)
Emeline Boni Campanini
2012-01-01
Full Text Available A bactéria Bacillus thuringiensis Berliner produz um corpo de inclusão paraesporal (cristal de natureza proteica, formado durante a esporulação, que atua de forma eficiente no controle de insetos-praga de culturas economicamente importantes. Esse cristal é constituído de proteínas Cry, que são codificadas pelos genes cry; um isolado pode ser caracterizado pelo conteúdo de genes cry que apresenta. Visando caracterizar novos isolados no combate de insetos-praga pertencentes às ordens Lepidoptera e Coleoptera, 76 isolados bacterianos foram analisados molecularmente e tiveram seu potencial de controle avaliado por meio de bioensaios com larvas de Spodoptera frugiperda (J.E. Smith, Sphenophorus levis Vaurie e Tenebrio molitor Linnaeus. As análises moleculares indicaram 11 isolados (14,5% da coleção, contendo genes lepidóptero-específicos e 17 (22,37% com genes coleóptero-específicos. As análises de patogenicidade revelaram dois isolados com alto potencial de controle para lagartas de S. frugiperda, um para larvas de S. levis e seis prejudiciais ao desenvolvimento das larvas de T. molitor. Esses isolados de B. thuringiensis podem ser promissores no controle biológico das referidas pragas.
The Study of the Microbes Degraded Polystyrene
Directory of Open Access Journals (Sweden)
Zhi-Long Tang
2017-01-01
Full Text Available Under the observation that Tenebrio molitor and Zophobas morio could eat polystyrene (PS, we setup the platform to screen the gut microbes of these two worms. To take advantage of that Tenebrio molitor and Zophobas morio can eat and digest polystyrene as its diet, we analyzed these special microbes with PS plate and PS turbidity system with time courses. There were two strains TM1 and ZM1 which isolated from Tenebrio molitor and Zophobas morio, and were identified by 16S rDNA sequencing. The results showed that TM1 and ZM1 were cocci-like and short rod shape Gram-negative bacteria under microscope. The PS plate and turbidity assay showed that TM1 and ZM1 could utilize polystyrene as their carbon sources. The further study of PS degraded enzyme and cloning warrants our attention that this platform will be an excellent tools to explore and solve this problem.
Directory of Open Access Journals (Sweden)
SERGIO URREJOLA
2011-12-01
Full Text Available Adaptive phenotypic plasticity, has been recognized as an important strategy by which organisms maximize fitness in variable environments, which vary through development. A disassociation among stages should represent a null effect of the environment experienced during early ontogeny in the expression of adult traits. Food quality greatly influences survival, development and reproduction in many arthropod herbivores. We examined the effects of diet protein in physiological and life-history traits in the yellow mealworm beetle Tenebrio molitor through ontogeny. We established four experimental treatments: Low Protein (LP, Low Protein Control (LPC, High Protein (HP, and High Protein Control (HPC with recently eclosioned larvae each. Individuals were maintained on the same diet or transferred to the opposite diet for all pupae period and almost all adult period. Contrary to the expected, the duration of life-cycle, larval growth rate and body mass in T. molitor were similar in diet treatments. We found intra-individual trade-offs between environmental diet (rich or poor in protein content during larval phase and egg number. Larvae fed on a protein-deficient diet exhibited significantly higher respiratory rates than larvae fed on a rich protein diet. Compensatory feeding could act in T. molitor larvae indicating differences in metabolism but not in growth rate, body mass and life-cycle characteristics. Our results demonstrate the plasticity of reproductive and metabolic traits and life-cycle characteristics of T. molitor and how changes that occur in relation to diet can have profound effects on progeny and female fitness.La plasticidad fenotípica adaptativa ha sido reconocida como una estrategia importante por el cual los organismos maximizan su adecuación biológica en ambientes variables y la cual varía a lo largo del desarrollo. En los organismos la plasticidad fenotípica generalmente se refiere a como los diferentes tipos de rasgos pueden
Directory of Open Access Journals (Sweden)
Rafael Braga da Silva
2012-06-01
Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.
. اﻟﺤﺸﺮات؛ ؛ ﻤﺎت اﻟﻨﻤﻮ ﻈ ﻣﻨ ؛ )ت .خ .ز ) ﺗﺠﺮﻳﺒﻲ زرع ﺧﻠﻮي ؛ي زرع
African Journals Online (AJOL)
benzoylphenylurea derivative, on. Tenebrio molito: comparison with diflubenzuon and triflumuron. Experientia, Vol. 49(12), 1993, p.1088-. 1091. [12] N. Soltani, N. Soltani-Mazouni, J. Delachambre, Evaluation of triflumuron, a benzoylphenylurea derivative, on. Tenebrio molitor pupae (Col.,. Tenebrionidae: effect on cuticle.
Directory of Open Access Journals (Sweden)
Rafael Braga da Silva
2012-06-01
Full Text Available Does the aggressiveness of the prey modify the attack behavior of the predator Supputius cincticeps (Stål (Hemiptera, Pentatomidae? The stink bug Supputius cincticeps (Stål (Hemiptera, Pentatomidae is a predator found in several Brazilian regions, which possesses desirable attributes as a natural control agent and in biological control programs. The aim of this study was to test if the attack behavior and predation success of S. cincticeps were affected by prey species. Larvae of Tenebrio molitor (L. (Coleoptera, Tenebrionidae, Spodoptera frugiperda (J. E. Smith (Lepidoptera, Noctuidae, and Thyrinteina arnobia (Stoll (Lepidoptera, Geometridae were offered to S. cincticeps in laboratory bioassays where predatory attack and prey defensive behaviors were observed for 2-hour periods. The attack behavior of S. cincticeps changed with the prey species offered. More than 25% of T. molitor and S. frugiperda larvae were immediately attacked, but T. arnobia was not immediately attacked by S. cincticeps. Successful attack (i.e., successful insertion of the predator stylets into the prey depends on the region of the body attacked, with a greater proportion of successful attacks in the anterior than in the median or posterior regions. Larvae of T. arnobia and S. frugiperda displayed a sequence of abrupt head and body movements in response to S. cincticeps attack. Attempts of predation were more successful on T. molitor and S. frugiperda than on T. arnobia. Information about the differential attack behavior of S. cincticeps on different prey species is important for designing successful biological control programs using this hemipteran predator.A agressividade da presa altera o comportamento de ataque do predador Supputius cincticeps (Stål (Hemiptera, Pentatomidae? O percevejo Supputius cincticeps (Stål (Hemiptera, Pentatomidae é um predador encontrado em várias regiões brasileiras, que possui atributos desejáveis como agente de controle natural ou em
Yang, Yi-Ting; Lee, Mi Rong; Lee, Se Jin; Kim, Sihyeon; Nai, Yu-Shin; Kim, Jae Su
2017-05-23
The Toll signaling pathway is responsible for defense against both Gram-positive bacteria and fungi. Gram-negative binding protein 3 (GNBP3) has a strong affinity for the fungal cell wall component, β-1,3-glucan, which can activate the prophenoloxidase (proPO) cascade and induce the Toll signaling pathway. Myeloid differentiation factor 88 (MyD88) is an intracellular adaptor protein involved in the Toll signaling pathway. In this study, we monitored the response of 5 key genes (TmGNBP3, TmMyD88, and Tenecin 1, 2, and 3) in the Toll pathway of the mealworm Tenebrio molitor immune system against the fungus Beauveria bassiana JEF-007 using RT-PCR. TmGNBP3, Tenecin 1, and Tenecin 2 were significantly upregulated after fungal infection. To better understand the roles of the Toll signaling pathway in the mealworm immune system, TmGNBP3 and TmMyD88 were knocked down by RNAi silencing. Target gene expression levels decreased at 2 d postknockdown and were dramatically reduced at 6 d post-dsRNA injection. Therefore, mealworms were compromised by B. bassiana JEF-007 at 6 d post-dsRNA injection. Silencing of TmMyD88 and TmGNBP3 resulted in reduced resistance of the host to fungal infection. Particularly, reducing TmGNBP3 levels obviously downregulated Tenecin 1 and Tenecin 2 expression levels, whereas silencing TmMyD88 expression resulted in decreased Tenecin 2 expression. These results indicate that TmGNBP3 is essential to induce downstream antifungal peptide Tenecin 1 expression against B. bassiana JEF-007. © 2017 Institute of Zoology, Chinese Academy of Sciences.
Directory of Open Access Journals (Sweden)
José Cola Zanuncio
1993-01-01
Full Text Available Longevity and survival of the predator Podisus connexivus (Hemiptera: Pentatomidae were studied in three alternative preys: T1 - Bombyx mori (Lepidoptera, Bombycidae catterpilars; T2 - Musca domestica (Diptera, Muscidae larva and T3 - Tenebrio molitor (Coleoptera, Tenebrionidae larva. Longevity and survival were: 22,1±0,6 days and 54,3±5,3%; 25,2±1,3 days and 56,0±4,9% and 22,0±0,8 days and 34,6±8,6%, for treatments T1, T2 and T3, respectively. Comparing to other researches, a lower survival was found. This is probably because a F2 generation from field material, was used. Since the insect was not well adapted to the laboratory conditions this could have led to lower survival.
Involvement of phenoloxidase in browning during grinding of Tenebrio molitor larvae
Janssen, Renske H.; Lakemond, Catriona M.M.; Fogliano, Vincenzo; Renzone, Giovanni; Scaloni, Andrea; Vincken, Jean-Paul
2017-01-01
Insects are investigated as alternative protein source to meet the increasing demand for proteins in the future. Enzymatic browning occurring during grinding of insect and subsequent extraction of proteins can influence the proteins’ properties, but it is unclear which enzymes are responsible for
Insects in the Classroom: A Study of Animal Behavior
Miller, Jon S.
2004-01-01
These activities allow students to investigate behavioral responses of the large Milkweed bug, "Oncopeltus fasciatus," and the mealworm, "Tenebrio molitor" or "Tenebrio obscurus," to external stimuli of light, color, and temperature. During the activities, students formulate hypotheses to research questions presented. They also observe insects for…
THE ALLEGED OCCURRENCE OF ADRENALIN IN THE MEALWORM
Gregerman, Robert I.; Wald, George
1952-01-01
Wense has reported the isolation of crystalline adrenalin from larvae of the beetle Tenebrio molitor. An attempt to repeat his procedures failed to yield any evidence of adrenalin. Analysis of mealworm extracts by paper chromatography and colorimetric means also yielded no indication of adrenalin, though adrenalin added to mealworms can be detected by these procedures in amounts less than 1 mg. per 100 gm. Mealworm extracts reveal on the paper chromatogram the presence of two other orthodiphenols, neither of which appears to be dopa but which may be 3,4-dihydroxyphenyllactic acid and 3,4-dihydroxyphenylacetic acid, compounds recently isolated elsewhere from this organism. PMID:14898031
Defatting and Sonication Enhances Protein Extraction from Edible Insects.
Choi, Byoung Deug; Wong, Nathan A K; Auh, Joong-Hyuck
2017-01-01
Edible insects are attracting growing interest as a sustainable source of protein for addition to processed meat and dairy products. The current study investigated the optimal method for protein extraction from mealworm larvae ( Tenebrio molitor ), cricket adults ( Gryllus bimaculatus ), and silkworm pupae ( Bombyx mori ), for use in further applications. After defatting with n-hexane for up to 48 h, sonication was applied for 1-20 min and the protein yield was measured. All samples showed a total residual fat percentage below 1.36%, and a 35% to 94% improvement in protein yield (%). In conclusion, defatting with n-hexane combined with sonication improves the protein yield from insect samples.
Directory of Open Access Journals (Sweden)
Emanuel Marques da Silva
2005-05-01
Full Text Available The influence of monospecific feeding on the post-embryonic development of L. intermedia, L. laeta and L. gaucho was evaluated. Two hundred and ten spiderlings were individualized in containers (120 ml, 105 being fed with Tenebrio molitor larvae and 105 with Pycnoscelus surinamensis nymphs. In the three species, the number of molts varied according to the diet. The number of spiders that reached maturity was lower in L. gaucho. In L. intermedia, the duration of the post-embryonic period was greater when larvae are fed. Mortality was higher in the second instar in the three species, the highest frequency being registered for L. gaucho. The data provided evidence that monospecific feeding influenced the post-embryonic development of the studied species. This influence might intensified by specific characteristics such as origin, habits and habitats.
Keyser, Chad A; Jensen, Birgit; Meyling, Nicolai V
2016-03-01
Crops are often prone to both insect herbivory and disease, which necessitate multiple control measures. Ideally, an efficacious biological control agent must adequately control the target organism and not be inhibited by other biological control agents when applied simultaneously. Wheat seeds infected with the plant pathogen Fusarium culmorum were treated with Metarhizium brunneum or M. flavoviride and Clonostachys rosea individually and in combination, with the expectation to control both root-feeding insects and the pathogen. Emerging roots were evaluated for disease and then placed with Tenebrio molitor larvae, which were monitored for infection. Plant disease symptoms were nearly absent for seeds treated with C. rosea, both individually and in combination with Metarhizium spp. Furthermore, roots grown from seeds treated with Metarhizium spp. caused significant levels of fungal infection in larvae when used individually or combined with C. rosea. However, cotreated seeds showed reduced virulence towards T. molitor when compared with treatments using Metarhizium spp. only. This study clearly shows that seed treatments with both the entomopathogenic fungus M. brunneum and the mycoparasitic fungus C. rosea can protect plant roots from insects and disease. The dual-treatment approach to biological control presented here is consistent with the ideals of IPM strategies. © 2015 Society of Chemical Industry.
Findings of Entomopathogenic Nematodes (Rhabditida, Steinernematidae in Nature Reserves in Ukraine
Directory of Open Access Journals (Sweden)
Yakovlev Ye. B.
2014-07-01
Full Text Available Findings of Entomopathogenic Nematodes (Rhabditida, Steinernematidae in Nature Reserves in-Ukraine. Yakovlev, Ye. B., Kharchenko, V. A., Mráček, Z. — Five strains of Steinernema Travassos, 1927 were isolated by live baiting method with last instar larvae of Tenebrio molitor Linnaeus, 1758 from the reserves of some central and southern oblasts of Ukraine and the Crimean AR. Entomopathogenic nematodes were recovered from 5 of 196 (2.6 % soil samples collected in 2010. Isolated nematodes were identified using a combination of molecular (ITS1-5.8S-ITS2 rDNA gene sequencing and morphological techniques. Four of the isolated strains were recognized as S. feltiae (Filipjev, 1934, one as S. arenarium (Artyukhovsky, 1967.
Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress
2014-01-01
Background Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. Results M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. Conclusions MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress. PMID:24383424
Efficacy of Metarhizium anisopliae isolate MAX-2 from Shangri-la, China under desiccation stress.
Chen, Zi-Hong; Xu, Ling; Yang, Feng-lian; Ji, Guang-Hai; Yang, Jing; Wang, Jian-Yun
2014-01-03
Metarhizium anisopliae, a soil-borne entomopathogen found worldwide, is an interesting fungus for biological control. However, its efficacy in the fields is significantly affected by environmental conditions, particularly moisture. To overcome the weakness of Metarhizium and determine its isolates with antistress capacity, the efficacies of four M. anisopliae isolates, which were collected from arid regions of Yunnan Province in China during the dry season, were determined at different moisture levels, and the efficacy of the isolate MAX-2 from Shangri-la under desiccation stress was evaluated at low moisture level. M. anisopliae isolates MAX-2, MAC-6, MAL-1, and MAQ-28 showed gradient descent efficacies against sterile Tenebrio molitor larvae, and gradient descent capacities against desiccation with the decrease in moisture levels. The efficacy of MAX-2 showed no significant differences at 35% moisture level than those of the other isolates. However, significant differences were found at 8% to 30% moisture levels. The efficacies of all isolates decreased with the decrease in moisture levels. MAX-2 was relatively less affected by desiccation stress. Its efficacy was almost unaffected by the decrease at moisture levels > 25%, but slowly decreased at moisture levels molitor larvae under desiccation stress and in wet microhabitat. Local black patches were found on the cuticles of the insects, and the cadavers dried without fungal growth under desiccation stress. However, dark black internodes and fungal growth were found after death of the insects in the wet microhabitat. MAX-2 showed significantly higher efficacy and superior antistress capacity than the other isolates under desiccation stress. The infection of sterile T. molitor larvae at low moisture level constituted a valid laboratory bioassay system in evaluating M. anisopliae efficacy under desiccation stress.
Energy Technology Data Exchange (ETDEWEB)
Ouellette, Y.
1988-01-01
Epidermal cells respond to 20-hydroxyecdysone (20HE) by altering their morphology, rate of proliferation and level of cell-to-cell communication. To study changes in polypeptide synthesis induced by 20HE, epidermal polypeptides from the midinstar larvae of the mealworm Tenebrio molitor were separated by one- and two-dimensional polyacrylamide gel electrophoresis. {sup 35}S-methionine-labelled polypeptides were extracted from cells incubated either in the absence or presence of 2{mu}g/ml 20HE for 14-16 h in vitro. Cells incubated with the hormone incorporated 28% more label into polypeptides. Over 250 polypeptides were detected in total cell lysates by this technique. Polypeptides that showed altered rates of synthesis in response to 20HE treatment were identified and characterized.
Nutritional Potential of Selected Insect Species Reared on the Island of Sumatra.
Adámková, Anna; Mlček, Jiří; Kouřimská, Lenka; Borkovcová, Marie; Bušina, Tomáš; Adámek, Martin; Bednářová, Martina; Krajsa, Jan
2017-05-12
Inhabitants of the Indonesian island of Sumatra are faced with the problem of insufficient food supplies and the consequent risk of undernourishment and health issues. Edible insects as a traditional and readily available food source could be part of the solution. The nutritional value of insects depends on many factors, e.g., species, developmental stage, sex, diet, and climatic conditions. However, edible insects bred in Sumatra for human consumption have never before been assessed with regard to their nutritional value. Our study involved analyses of crude protein, chitin, fat and selected fatty acid contents of giant mealworm larvae ( Zophobas morio ), larvae of the common mealworm ( Tenebrio molitor) and nymphs of the field cricket ( Gryllus assimilis ). Crude protein content in the samples ranged from 46% to 56%. Highest (35%) and lowest (31%) amounts of fat were recorded in giant mealworm larvae and larvae of the common mealworm, respectively. Chitin amounts ranged from 6% to 13%. Based on these values, which are comparable to those known from other food insects reared in different regions of the world, the edible species bred in Sumatra could become food sources with a potential to help stave off hunger and undernourishment.
Semashko, Tatiana A; Vorotnikova, Elena A; Sharikova, Valeriya F; Vinokurov, Konstantin S; Smirnova, Yulia A; Dunaevsky, Yakov E; Belozersky, Mikhail A; Oppert, Brenda; Elpidina, Elena N; Filippova, Irina Y
2014-03-15
This study describes the design, synthesis, and use of selective peptide substrates for cysteine peptidases of the C1 papain family, important in many biological processes. The structure of the newly synthesized substrates is Glp-Xaa-Ala-Y (where Glp=pyroglutamyl; Xaa=Phe or Val; and Y=pNA [p-nitroanilide], AMC [4-amino-7-methylcoumaride], or AFC [4-amino-7-trifluoromethyl-coumaride]). Substrates were synthesized enzymatically to guarantee selectivity of the reaction and optical purity of the target compounds, simplifying the scheme of synthesis and isolation of products. The hydrolysis of the synthesized substrates was evaluated by C1 cysteine peptidases from different organisms and with different functions, including plant enzymes papain, bromelain, ficin, and mammalian lysosomal cathepsins B and L. The new substrates were selective for C1 cysteine peptidases and were not hydrolyzed by serine, aspartic, or metallo peptidases. We demonstrated an application of the selectivity of the synthesized substrates during the chromatographic separation of a multicomponent set of digestive peptidases from a beetle, Tenebrio molitor. Used in combination with the cysteine peptidase inhibitor E-64, these substrates were able to differentiate cysteine peptidases from peptidases of other classes in midgut extracts from T. molitor larvae and larvae of the genus Tribolium; thus, they are useful in the analysis of complex mixtures containing peptidases from different classes. Published by Elsevier Inc.
Development of real-time PCR tests for the detection of Tenebrio molitor in food and feed.
Debode, Frédéric; Marien, Aline; Gérard, Amaury; Francis, Frédéric; Fumière, Olivier; Berben, Gilbert
2017-08-01
Insects are rich in proteins and could be an alternative source of proteins to feed animals and humans. Numerous companies have started the production of insects for feed purposes. In Europe, these processed animal proteins are not yet authorised by legislation as many questions still need to be answered concerning this 'novel food'. Authorisations will be possible when methods of authentication of the products are available. In this study we propose real-time PCR methods for the specific detection of the mealworm (Tenebriomolitor), one of the most widely used insects for food and feed production. Two PCR assays are proposed: the first based on the wingless gene and the second based on the cadherin gene. The PCR tests amplify fragments of 87 bp. These qualitative methods were tested according to several performance criteria. The specificity was tested on 34 insect species' DNA, but also on non-insect species including crustacean, mammals, birds and plants. The limit of detection was determined and was below 20 copies for the two PCR tests. The applicability of the tests was demonstrated by the analysis of real-life processed samples containing T. molitor.
Vandeweyer, D; Crauwels, S; Lievens, B; Van Campenhout, L
2017-02-02
The rising interest in insects for human consumption and the changing regulations in Europe require a profound insight into the food safety of insects reared and sold in Western society. The microbial quality of edible insects has only been studied occasionally. This study aimed at generating an overview of intrinsic parameters (pH, water activity and moisture content) and microbial quality of fresh mealworm larvae and crickets for several rearing companies and for several batches per rearer. In total, 21 batches obtained from 7 rearing companies were subjected to analysis of intrinsic parameters, a range of plate counts and presence-absence tests for Salmonella spp. and Listeria monocytogenes. The microbial counts of the fresh insects were generally high. Different rearing batches from a single rearing company showed differences in microbial counts which could not be explained by variations in intrinsic properties. The largest variations were found in numbers of bacterial endospores, psychrotrophs and fungi. Salmonella spp. and L. monocytogenes were not detected in any of the samples. Altogether, our study shows that large variations were found between batches from individual rearers. As a consequence, no overall differences between rearers could be observed. Copyright © 2016 Elsevier B.V. All rights reserved.
Bioanalogues oj juvenile hormones and intestines mycoflora of some insects
Directory of Open Access Journals (Sweden)
Andrzej Nespiak
2014-08-01
Full Text Available The subject of this paper is the influence of JH bioanalogues on the mycoflora of intestines of three species of inscets: Dysdereus cinaulams, Pyrrhocoris apterus and Tenebrio molitor. The results are presented in tables.
Luo, Zhibing; Ren, Hui; Mousa, Jarrod J; Rangel, Drauzio E N; Zhang, Yongjun; Bruner, Steven D; Keyhani, Nemat O
2017-02-01
The PacC transcription factor is an important component of the fungal ambient pH-responsive regulatory system. Loss of pacC in the insect pathogenic fungus Beauveria bassiana resulted in an alkaline pH-dependent decrease in growth and pH-dependent increased susceptibility to osmotic (salt, sorbitol) stress and SDS. Extreme susceptibility to Congo Red was noted irrespective of pH, and ΔBbpacC conidia showed subtle increases in UV susceptibility. The ΔBbPacC mutant showed a reduced ability to acidify media during growth due to failure to produce oxalic acid. The ΔBbPacC mutant also did not produce the insecticidal compound dipicolinic acid, however, production of a yellow-colored compound was noted. The compound, named bassianolone B, was purified and its structure determined. Despite defects in growth, stress resistance, and oxalate/insecticidal compound production, only a small decrease in virulence was seen for the ΔBbpacC strain in topical insect bioassays using larvae from the greater waxmoth, Galleria mellonella or adults of the beetle, Tenebrio molitor. However, slightly more pronounced decreases were seen in virulence via intrahemcoel injection assays (G. mellonella) and in assays using T. molitor larvae. These data suggest important roles for BbpacC in mediating growth at alkaline pH, regulating secondary metabolite production, and in targeting specific insect stages. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.
Sánchez-Peña, Sergio R.; Lara, Jorge San-Juan; Medina, Raúl F.
2011-01-01
Entomopathogenic fungi were collected from soil in four adjacent habitats (oak forest, agricultural soil, pine reforestation and chaparral habitat) in Saltillo, México using the insect bait method with Tenebrio molitor (L.) (Coleoptera: Tenebrionidae) larvae as bait. Overall, of the larvae exposed to soil, 171 (20%) hosted Beauveria bassiana (Balsamo) Vuillemin (Hypocreales: Cordycipitaceae), 25 (3%) hosted Metarhizium anisopliae (Metschnikoff) Sorokin (Hypocreales: Clavicipitaceae) and 1 (0.1%) hosted lsaria (=Paecilomyces) sp. (Hypocreales: Cordycipitaceae). B. bassiana was significantly more frequent on larvae exposed to oak forest soil. M. anisopliae was significantly more frequent on larvae exposed to agricultural soil. From the infected bait insects, 93 isolates of B. bassiana and 24 isolates of M. anisopliae were obtained. Strains were tested for their infectivity against Cuban laurel thrips, Gynaikothrips uzeli Zimmerman (Thysanoptera: Phlaeothripidae) and the greenhouse whitefly, Trialeurodes vaporariorum (Westwood) (Hemiptera: Aleyrodidae). B. bassiana isolates caused the highest mortality on thrips (some causing 88% mortality after 6 days); both fungal species caused similarly high mortality levels against whiteflies (75%) after 6 days. Large amounts of germplasm of entomopathogenic fungi, fundamentally B. bassiana and M. anisopliae, exist in the habitats sampled; pathogenicity varied among strains, and some strains possessed significant virulence. Soils in these habitats are reservoirs of diverse strains with potential for use in biocontrol. PMID:21521145
Preliminary investigations of the digestive processes of the white ...
African Journals Online (AJOL)
Portulacaria afra. Diospyros dichrophyl/a. Rhigozum obovatum. Lycium campanulatum. Hypoesta verticil/ata. Rhus sp. Scutia myrtina. Fruits and seeds. May tenus capitata. Asparagus africanus. Grewia robusta. Acacia karoo. Scutia myrtina. Rhus sp. Insects. Tenebrionid beetles. Tenebrio molitor. Mimorista pulchel/alis.
Insect lipid profile: aqueous versus organic solvent-based extraction methods
Tzompa Sosa, D.A.; Yi, L.; Valenberg, van H.J.F.; Boekel, van M.A.J.S.; Lakemond, C.M.M.
2014-01-01
In view of future expected industrial bio-fractionation of insects, we investigated the influence of extraction methods on chemical characteristics of insect lipids. Lipids from Tenebrio molitor, Alphitobius diaperinus, Acheta domesticus and Blaptica dubia, reared in the Netherlands, were extracted
Mechanical properties of the beetle elytron, a biological composite material
We determined the relationship between composition and mechanical properties of elytral (modified forewing) cuticle of the beetles Tribolium castaneum and Tenebrio molitor. Elytra of both species have similar mechanical properties at comparable stages of maturation (tanning). Shortly after adult ecl...
Interplay between behavioural thermoregulation and immune response in mealworms.
Catalán, Tamara P; Niemeyer, Hermann M; Kalergis, Alexis M; Bozinovic, Francisco
2012-11-01
Since the preferential body temperature should positively correlate with physiological performance, behavioural fever should enhance an organism's immune response under an immune challenge. Here we have studied the preferential body temperature (T(p)) and its consequences on immune response performance after an immune challenge in larvae of Tenebrio molitor. We evaluated T(p) and immune responses of larvae following a challenge with various concentrations of lipopolysaccharide (LPS), and we studied the correlation between T(p) and two immune traits, namely antibacterial and phenoloxidase (PO) activities. Larvae that were immune challenged with higher LPS concentrations (C(50) and C(100)) preferred in average, warmer temperatures than did larvae challenged with lower concentrations (C(0) and C(25)). T(p) of C(25)-C(100) (challenged)-mealworms was 2.3°C higher than of C(0) (control) larvae. At lower LPS concentration immune challenge (C(0) and C(25)) antibacterial activity correlated positively with T(p), but at C(50) and C(100) correlation was lose. PO activity was higher at higher LPS concentration, but its magnitude of response did not correlate with T(p) Our data suggest that behavioural fever may have a positive effect on host performance by enhancing antibacterial response under a low pathogen load situation. Copyright © 2012 Elsevier Ltd. All rights reserved.
Fostering students' experimentation skills - developmental time and offspring rates of flour beetles
Asshoff, R.; Roth, Olivia
2010-01-01
Tribolium castanaeum is a widespread insect in temperate regions. Because of its short generation time and easy handling, it serves as a model organism for various scientific questions. However, T. castanaeum, or its larger-sized relative Tenebrio molitor, can also he used at a school or college level to foster students' experimentation skills. We present a set of inquiry tasks that build stepwise on one another, using T. castanaeum or T. molitor as the model. The students will learn not only...
Extraction and characterisation of protein fractions from five insect species
Yi, L.; Lakemond, C.M.M.; Sagis, L.M.C.; Eisner-Schadler, V.R.; Huis, van A.; Boekel, van M.A.J.S.
2013-01-01
Tenebrio molitor, Zophobas morio, Alphitobius diaperinus, Acheta domesticus and Blaptica dubia were evaluated for their potential as a future protein source. Crude protein content ranged from 19% to 22% (Dumas analysis). Essential amino acid levels in all insect species were comparable with soybean
Mechanized Packing and Delivery System for Entomopathogenic Nematodes in Infected Mealworm Cadavers
This document describes a mechanized system to pack mealworm (Tenebrio molitor) cadavers infected with entomopathogenic nematodes between two sheets of masking tape. The document is also an operation manual for the machine and provides all the machine specifications, and wiring and pneumatic diagram...
Factitious foods to reduce production costs of beneficial insects
This article reports the use of factitious foods such as Tenebrio molitor pupa, E. kuehniella eggs, Ephestia eggs, and or Artemia franciscana eggs for the rearing of beneficial insect such as Podisus maculiventris, spined soldier bug and several ladybird predators belonging to the Coccinellidae fam...
Activité biologique d'un agoniste non stéroïdien de l'hormone de ...
African Journals Online (AJOL)
Tenebrio molitor. Phytoparasitica., Vol. 34 (2), 2006, p. 187-196. [12] H. Berghiche, G. Smagghe, S. Van. De Velde, N. Soltani, In vitro cultures of pupal integumental explants to bioassay insect growth regulators with ecdysteroid activity for ecdysteroid amounts and cuticle secretion. African Journal of. Agricultural Research.
Ultrastructural description of the corpora allata of Pimpla turionellae ...
African Journals Online (AJOL)
User
2011-05-09
May 9, 2011 ... 1Department of Biology, Faculty of Science and Art, Hitit University, Çorum, Turkey. 2Department of Biology, Faculty of Science, Ankara University, 06100 Tandoğan, Ankara, Turkey. Accepted 9 March, 2011 ..... neuroendocrine system during oocyte growth in Tenebrio molitor. Gen. Comp. Endocrinol.
Optimization of a host diet for in vivo production of entomopathogenic nematodes
In previous studies, we developed an improved diet for Tenebrio molitor, a host that is used for in vivo nematode production, and we demonstrated that single insect diet components (e.g., lipids and proteins) can have a positive or negative impact on entomopathogenic nematode fitness and quality. I...
Low cost production of nematodes for biological control of insect pests
Entomopathogenic nematodes are produced in two ways: in artificial media using liquid or solid fermentation methods (in vitro) or by mass producing insect hosts to be artificially exposed to mass infection by nematodes (in vivo). The yellow mealworm (Tenebrio molitor) is a good host for in vivo nema...
Directory of Open Access Journals (Sweden)
Teresinha V Zanuncio
1996-01-01
Full Text Available Nymphs of Podisus nigrispinus (Dallas, 1851 were fed with Zophobas confusa Gebien, 1906, Tenebrio molitor Linnaeus, 1758 (Coleoptera, Tenebrionidae and Musca domestica Linnaeus, 1758 (Diptera, Muscidae under 25±0.5ºC, 60±10% of RH and photophase of 12h. Nymphal viability of P. nigrispinus were 64.0%, 80.0% and 92.0% with Z. confusa, M. domestica and T. molitor, respectively. No differences were found for pre-oviposition period, number of egg masses, number of eggs, egg viability, and longevity for females of this predator fed with any of these preys.
Effect of diet on male reproductive tract of Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae
Directory of Open Access Journals (Sweden)
W. P Lemos
Full Text Available The morphology and histology of the reproductive tract of males of the predator Podisus nigrispinus (Dallas fed on different diets were studied. P. nigrispinus was fed on diets of: larvae of Alabama argillacea (Hübner, Tenebrio molitor L., Musca domestica L., and an artificial diet. The male reproductive tract, independent of diet, showed testes with intense red coloration in a compact, circular, or slightly oval structure. The vasa deferentia were similar in color to the testes and formed long filaments, which joined with the yellow-cream colored ejaculatory duct. The morphological characteristics of the male reproductive tract were similar under all diets, except for the artificial one. The histological studies demonstrated that independent of the diet the testes of P. nigrispinus were composed of four to six follicles. The testes with six follicles generally had four developed and two atrophied follicles. The morphological and histological differences of the testes of P. nigrispinus when fed with different prey are presented and discussed.
Energy Technology Data Exchange (ETDEWEB)
Bond, E.J.; Buckland, C.T.
1976-12-15
Acrylonitrile can be mixed with methyl bromide to increase toxicity so that the quantity of methyl bromide required for control of Sitophilus granarius (L.), Tenebrio molitor L., and Tribolium confusum Jacquelin duval is reduced by one half. Mixtures of methyl bromide and acrylonitrile are considerably more effective at low temperatures than methyl bromide alone.
stockées Ephestia kuehniella (Lepidoptera)
African Journals Online (AJOL)
PR BOKO
de Rebat (2008). [5] - B. DOUMANDJI-MITICHI. Etude d'un ravageur des denrées stockées E. Kuehiella, Am.El Harrach. (1997). [6] - F. TAIBI. Etude comparée du développement et de la reproduction chez deux ravageurs des denrées stockées Ephestia Kuehniella et Tenebrio molitor. Aspect endocrinien en rapport avec.
Directory of Open Access Journals (Sweden)
X. H. Jin
2016-07-01
Full Text Available This experiment was conducted to investigate the effects of dried mealworm (Tenebrio molitor larva on growth performance, nutrient digestibility and blood profiles in weaning pigs. A total of 120 weaning pigs (28±3 days and 8.04±0.08 kg of body weight were allotted to one of five treatments, based on sex and body weight, in 6 replicates with 4 pigs per pen by a randomized complete block design. Supplementation level of dried mealworm was 0%, 1.5%, 3.0%, 4.5%, or 6.0% in experimental diet as treatment. Two phase feeding programs (phase I from 0 day to 14 day, phase II from 14 day to 35 day were used in this experiment. All animals were allowed to access diet and water ad libitum. During phase I, increasing level of dried mealworm in diet linearly improved the body weight (p<0.01, average daily gain (ADG (p<0.01 and average daily feed intake (ADFI (p<0.01. During phase II, ADG also tended to increase linearly when pigs were fed higher level of dried mealworm (p = 0.08. In addition, increasing level of dried mealworm improved the ADG (p<0.01, ADFI (p<0.05 and tended to increase gain to feed ratio (p = 0.07 during the whole experimental period. As dried mealworm level was increased, nitrogen retention and digestibility of dry matter as well as crude protein were linearly increased (p = 0.05. In the results of blood profiles, decrease of blood urea nitrogen (linear, p = 0.05 and increase of insulin-like growth factor (linear, p = 0.03 were observed as dried mealworm was increased in diet during phase II. However, there were no significant differences in immunoglobulin A (IgA and IgG concentration by addition of dried mealworm in the growth trial. Consequently, supplementation of dried mealworm up to 6% in weaning pigs’ diet improves growth performance and nutrient digestibility without any detrimental effect on immune responses.
Pérez-Guzmán, D; Montesinos-Matías, R; Arce-Cervantes, O; Gómez-Quiroz, L E; Loera, O; Garza-López, P M
2016-08-01
The aim of this study was to determine the relationship between reactive oxygen species (ROS) production and conidial infectivity in Beauveria bassiana. Beauveria bassiana Bb 882.5 was cultured in solid-state culture (SSC) using rice under three oxygen conditions (21%, or pulses at 16 and 26%). Hydrophobicity was determined using exclusion phase assay. Bioassays with larvae or adults of Tenebrio molitor allowed the measurements of infectivity parameters. A fluorometric method was used for ROS quantification (superoxide and total peroxides). NADPH oxidase (NOX) activity was determined by specific inhibition. Conidial hydrophobicity decreased by O2 pulses. Mortality of larvae was only achieved with conidia harvested from cultures under 21% O2 ; whereas for adult insects, the infectivity parameters deteriorated in conidia obtained after pulses at 16 and 26% O2 . At day 7, ROS production increased after 16 and 26% O2 treatments. NOX activity induced ROS production at early stages of the culture. Modification of atmospheric oxygen increases ROS production, reducing conidial quality and infectivity. This is the first study in which conidial infectivity and ROS production in B. bassiana has been related, enhancing the knowledge of the effect of O2 pulses in B. bassiana. © 2016 The Society for Applied Microbiology.
Andersen, Svend Olav
2007-09-01
During sclerotization of insect cuticle the acyldopamines, N-acetyldopamine (NADA) and N-beta-alanyldopamine (NBAD), are oxidatively incorporated into the cuticular matrix, thereby hardening and stabilizing the material by forming crosslinks between the proteins in the cuticular matrix and by forming polymers filling the intermolecular spaces in the cuticle. Sclerotized cuticle from the locust, Schistocerca gregaria, and the beetle, Tenebrio molitor, was hydrolyzed in dilute hydrochloric acid, and from the hydrolysates some components presumably degradation products of cuticular crosslinks were isolated. In two of the components, the sidechain of 3,4-dihydroxyacetophenone was linked to the amino groups of glycine and beta-alanine, respectively, and in the third component to the phenolic group of tyrosine. These three compounds, glycino-dihydroxyacetophenone, beta-alanino-dihydroxyacetophenone, and O-tyrosino-dihydroxyacetophenone, as well as the previously reported compound, lysino-dihydroxyacetophenone [Andersen, S.O., Roepstorff, P., 2007. Aspects of cuticular sclerotization in the locust, Schistocerca gregaria, and the beetle, Tenebrio molitor. Insect Biochem. Mol. Biol. 37, 223-234], are suggested to be degradation products of cuticular crosslinks, in which amino acid residues formed linkages to both the alpha- and beta-positions of the sidechain of acyldopamines.
Directory of Open Access Journals (Sweden)
Anderson Mathias Holtz
2011-04-01
Full Text Available The effect of plant feeding on biological aspects of Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae was evaluated. Nymphs and adults of this predator were fed with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae on Eucalyptus urophylla plants inthe field or only with pupae of this prey in the laboratory. The development and nymphal survival, as well as the pre-oviposition period, number of egg masses, number, fertility and viability of eggs and the longevity of females of this predator were evaluated. The eucalyptus plants improved the development of P. nigrispinus. This demonstrates that this predator can present higher population growth with eucalyptus plants and T. molitor pupae than in the laboratory (controlled conditions only with this prey. These plants can supply nutrients that can the population growth and efficiency of P. nigrispinus for biological control in eucalyptus plantations.O efeito da alimentação em plantas sobre os aspectos biológicos de Podisus nigrispinus (Hemiptera: Pentatomidae foi avaliado. Ninfas e adultos desse predador foram alimentados com pupas de Tenebrio molitor L. (Coleotpera: Tenebrionidae em plantas de Eucalyptus urophylla no campo ou, apenas, em laboratório. O desenvolvimento e a sobrevivência ninfal desse predador, além do período de pré-oviposição, número de posturas, viabilidade dos ovos e afertilidade e longevidade de fêmeas foram avaliados. A planta de eucalipto proporcionou um incremento no desenvolvimento de P. nigrispinus. Isto demonstra que esse predador pode apresentar maior crescimento populacional com plantas de eucalipto e pupas de T. molitor alimentado com apenas a presa (condições controladas. A planta pode fornecer nutrientes que aumentam o crescimento populacional e a eficiência de P. nigrispinus para o controle biológico em plantios de eucalipto.
Foelkel, E; Voss, M; Monteiro, L B; Nishimura, G
2017-03-01
Entomopathogenic nematodes (EPNs) are a promising alternative to integrated control in many fruit pests. Few studies were made on the relationship of Anastrepha fraterculus natural population with native EPNs population and other biotic and abiotic factors. The aim of this work was to verify the occurrence of endemic nematodes in an apple orchard, concerning environmental conditions and technical procedure, and access isolates virulence to A. fraterculus larvae. The experiment was conducted during a year taking monthly soil samples from an apple orchard, with and without fallen fruits just above the soil. Samples were baited with Tenebrium molitor and A. fraterculus larvae in laboratory. Canopy and fallen fruits were sampled to access the pest infestation. Seventy three EPN isolates were captured, in 23.2% soil samples, more with T. molitor than with A. fraterculus baits. From the 20 isolates tested against A. fraterculus, only five were pathogenic, and they were identified as Oscheius sp. The nematodes were captured during all seasons in a similar frequency. Soil and weather conditions, presence of fruit over the orchard soil, and A. fraterculus pupae in the fruits had no significant influence on the capture. As a conclusion, nematodes of the genera Oscheius are found in an apple orchard of Porto Amazonas constantly along the year, independently of fluctuations in A. fraterculus population, climate conditions and presence of fruit over the soil. Some of the isolates are pathogenic to A. fraterculus.
Directory of Open Access Journals (Sweden)
Rosdah Thalib
2014-08-01
Full Text Available Pathogeicity of Beauveria bassiana and Metarhizium anisopliae Isolates from Fresh Swamp and Tidal Lowland, South Sumatra for Scirpophaga incertulas Biological Agents. The objectives of the research weret o explore and to determine the pathogenicity of entomopathogenic fungi againts the larvae of Scirpophaga incertulas, and to measure conidial viability and density of the fungi. The method for fungi exploration used larvae of Tenebrio molitor baiting submerged in the soil. The soil was taken from fresh swampand tidal lowland rice in South Sumatra. From the exploration study, we found two species of entomopathogenic fungi: Beauveria bassiana and Metarhizium anisopliae. Mortality of S. incertulas larvae that had been treated topically with fungal conidia (1x106 conidia ml-1 varied among the isolates. The highest mortality (98.33% caused by BPlus isolate of B. Bassiana and the lowest by MtmIn isolate of M. anisopliae (57.50% and BTmTr isolate of B. bassiana (57.50%. The fungal colonies grew fast from the second day up to the fourth day after incubation but the growth became slow after the fifth day. The highest conidial density was resulted by BPcMs of B. bassiana isolate (63.33x106 conidia ml-1 but this density was not significantly different from that of the BPlus of B. bassiana isolate (63.11x106 conidia ml-1. The lowest conidial density found in BTmTr of B. bassiana isolate (20.97x106 conidia ml-1 . The isolate B. bassiana was more effective than M. anisopliae againt the larvae of S.incertulas.
Three Pairs of Protease-Serpin Complexes Cooperatively Regulate the Insect Innate Immune Responses*
Jiang, Rui; Kim, Eun-Hye; Gong, Ji-Hee; Kwon, Hyun-Mi; Kim, Chan-Hee; Ryu, Kyoung-Hwa; Park, Ji-Won; Kurokawa, Kenji; Zhang, Jinghai; Gubb, David; Lee, Bok-Luel
2009-01-01
Serpins are known to be necessary for the regulation of several serine protease cascades. However, the mechanisms of how serpins regulate the innate immune responses of invertebrates are not well understood due to the uncertainty of the identity of the serine proteases targeted by the serpins. We recently reported the molecular activation mechanisms of three serine protease-mediated Toll and melanin synthesis cascades in a large beetle, Tenebrio molitor. Here, we purified three novel serpins ...
Edible insects - species suitable for entomophagy under condition of Czech Republic
Directory of Open Access Journals (Sweden)
Martina Bednářová
2013-01-01
Full Text Available Since 2002, when the first lecture on entomophagy took place at Mendel University in Brno, till today, participants of these educational lectures were asked to fill questionnaires in order to evaluate interest in entomophagy in Czech Republic and pick suitable species. Analyses of nutritional value of selected species were also performed during this time. The questionnaire was divided into several parts - suitable species, sensory properties, difficulty of breeding and processing and respondents own attitude to the consumption of insect species. For the purpose of this study the questionnaire was evaluated using the semantic differential, so to create a comprehensive picture of each insect species. Based on evaluation of more than 5,000 questionnaires, certain developmental stages of seven species of insect were selected for further evaluation: Tenebrio molitor (TM larvae, Zophobas morio (ZM larvae, Gryllus assimillis (GA nymphs, Locusta migratoria (LM nymphs, Galleria mellonella (GM larvae, Bombyx mori (BM Pupa, Apis mellifera (AM bee brood, while cockroaches were completely excluded for use in entomophagy. Although they are easy to breed and are available all year-round, consumers showed relatively great disgust. For all of these species, basic nutritional values were analysed, as well as content of amino acids and fattty acids. All parameters were statistically evaluated using ANOVA-1. Each species appears to be suitable for entomophagy for a different reason. Generally speaking, AM, TM and GA were best accepted considering the sensory aspect, nutritional values are interesting especially in BM and GM and TM wins with simplicity of its breeding.
Thermographic analysis of waveguide-irradiated insect pupae
Olsen, Richard G.; Hammer, Wayne C.
1982-01-01
Pupae of the insect Tenebrio molitor L. were thermographically imaged during waveguide irradiation through longitudinal slots. T. molitor pupae have been subjects of microwave-induced teratology for a number of years, but until now the smallness of the insect has prevented detailed dosimetry. High-resolution thermographic imaging equipment was used to obtain the magnitude and spatial distribution of absorbed microwave energy at three frequencies, 1.3, 5.95, and 10 GHz. The detail of the thermal images obtained is sufficient to show the differential heating of structures as small as a single insect leg. Results show that the electrical properties of the head, thorax, and abdomen are sufficiently different to seriously impair the usefulness of any theoretical dosimetric model of homogeneous composition. Some general features of correlation with a slab model in waveguide are given.
Bosch, G.; Fels, van der Ine; Rijk, de T.C.; Oonincx, D.G.A.B.
2017-01-01
Crops contaminated with fungal mycotoxins such as aflatoxin B1 (AFB1) are often downgraded or removed from the food chain. This study aimed to evaluate the tolerance and accumulation of AFB1 in two insect species to determine whether they could be used to retain condemned mycotoxin contaminated
Oppert, Brenda; Perkin, Lindsey; Martynov, Alexander G; Elpidina, Elena N
2018-04-01
The gut is one of the primary interfaces between an insect and its environment. Understanding gene expression profiles in the insect gut can provide insight into interactions with the environment as well as identify potential control methods for pests. We compared the expression profiles of transcripts from the gut of larval stages of two coleopteran insects, Tenebrio molitor and Tribolium castaneum. These tenebrionids have different life cycles, varying in the duration and number of larval instars. T. castaneum has a sequenced genome and has been a model for coleopterans, and we recently obtained a draft genome for T. molitor. We assembled gut transcriptome reads from each insect to their respective genomes and filtered mapped reads to RPKM>1, yielding 11,521 and 17,871 genes in the T. castaneum and T. molitor datasets, respectively. There were identical GO terms in each dataset, and enrichment analyses also identified shared GO terms. From these datasets, we compiled an ortholog list of 6907 genes; 45% of the total assembled reads from T. castaneum were found in the top 25 orthologs, but only 27% of assembled reads were found in the top 25 T. molitor orthologs. There were 2281 genes unique to T. castaneum, and 2088 predicted genes unique to T. molitor, although improvements to the T. molitor genome will likely reduce these numbers as more orthologs are identified. We highlight a few unique genes in T. castaneum or T. molitor that may relate to distinct biological functions. A large number of putative genes expressed in the larval gut with uncharacterized functions (36 and 68% from T. castaneum and T. molitor, respectively) support the need for further research. These data are the first step in building a comprehensive understanding of the physiology of the gut in tenebrionid insects, illustrating commonalities and differences that may be related to speciation and environmental adaptation. Published by Elsevier Ltd.
Regionalization of surface lipids in insects.
Wang, Yiwen; Yu, Zhitao; Zhang, Jianzhen; Moussian, Bernard
2016-05-11
Cuticular hydrocarbons (CHCs) play a critical role in the establishment of the waterproof barrier that prevents dehydration and wetting in insects. While rich data are available on CHC composition in different species, we know little about their distribution and organization. Here, we report on our studies of the surface barrier of the fruit fly Drosophila melanogaster applying a newly developed Eosin Y staining method. The inert Eosin Y penetrates different regions of the adult body at distinct temperatures. By contrast, the larval body takes up the dye rather uniformly and gradually with increasing temperature. Cooling down specimens to 25°C after incubation at higher temperatures restores impermeability. Eosin Y penetration is also sensitive to lipid solvents such as chloroform indicating that permeability depends on CHCs. As in D. melanogaster adult flies, Eosin Y penetration is regionalized in Tenebrio molitor larvae, whereas it is not in Locusta migratoria nymphs. Regionalization of the fly surface implies tissue-specific variation of the genetic or biochemical programmes of CHC production and deposition. The Eosin Y-based map of CHC distribution may serve to identify the respective factors that are activated to accommodate ecological needs. © 2016 The Author(s).
Masoudi, Abolfazl; Koprowski, John Lad; Bhattarai, Upendra Raj; Wang, Dun
2018-02-01
Entomopathogenic fungi are considered to be a safe microbiological pesticide alternative to chemical control. Efforts are underway to understand precisely their taxonomy and natural distribution through mycological and biodiversity studies based on molecular markers. Here, we present descriptions of the diversity of the entomopathogenic fungi in the genera Metarhizium and Beauveria found along the elevational gradients of the Qinling subtropical and temperate forests of Shaanxi province in China, using morphological aspects and molecular markers. Molecular characterization using the Mz_IGS3 intergenic region revealed that Metarhizium isolates phylogenetically clustered in the PARB clade with four different distinguishable species, but the 5'-TEF gene allowed only ambiguous delimitation of Metarhizium species. Beauveria isolates were characterized by sequence analyses of the translation elongation factor 1-α and the Bloc region. The richness of Metarhizium species decreased with increasing elevation, with Metarhizium robertsii s.l. being the most abundant species along the elevational gradient. Our bioassay suggests that certain species of Metarhizium are significantly pathogenic to the insect model Tenebrio molitor at both the adult and larvae stages and could potentially serve as a control of insect pests of forests.
Directory of Open Access Journals (Sweden)
Ihsan Ullah
2014-07-01
Full Text Available Photorhabdus temperata is an entomopathogenic enterobacterium; it is a nematode symbiont that possesses pathogenicity islands involved in insect virulence. Herein, we constructed a P. temperata M1021 cosmid library in Escherichia coli XL1-Blue MRF` and obtained 7.14 × 105 clones. However, only 1020 physiologically active clones were screened for insect virulence factors by injection of each E. coli cosmid clone into Galleria mellonella and Tenebrio molitor larvae. A single cosmid clone, PtC1015, was consequently selected due to its characteristic virulent properties, e.g., loss of body turgor followed by death of larvae when the clone was injected into the hemocoel. The sequence alignment against the available sequences in Swiss-Prot and NCBI databases, confirmed the presence of the mcf gene homolog in the genome of P. temperata M1021 showing 85% homology and 98% query coverage with the P. luminescens counterpart. Furthermore, a 2932 amino acid long Mcf protein revealed limited similarity with three protein domains. The N-terminus of the Mcf encompassed consensus sequence for a BH3 domain, the central region revealed similarity to toxin B, and the C-terminus of Mcf revealed similarity to the bacterial export domain of ApxIVA, an RTX-like toxin. In short, the Mcf toxin is likely to play a role in the elimination of insect pests, making it a promising model for use in the agricultural field.
Ullah, Ihsan; Jang, Eun-Kyung; Kim, Min-Sung; Shin, Jin-Ho; Park, Gun-Seok; Khan, Abdur Rahim; Hong, Sung-Jun; Jung, Byung-Kwon; Choi, JungBae; Park, YeongJun; Kwak, Yunyoung; Shin, Jae-Ho
2014-01-01
Photorhabdus temperata is an entomopathogenic enterobacterium; it is a nematode symbiont that possesses pathogenicity islands involved in insect virulence. Herein, we constructed a P. temperata M1021 cosmid library in Escherichia coli XL1-Blue MRF` and obtained 7.14 × 105 clones. However, only 1020 physiologically active clones were screened for insect virulence factors by injection of each E. coli cosmid clone into Galleria mellonella and Tenebrio molitor larvae. A single cosmid clone, PtC1015, was consequently selected due to its characteristic virulent properties, e.g., loss of body turgor followed by death of larvae when the clone was injected into the hemocoel. The sequence alignment against the available sequences in Swiss-Prot and NCBI databases, confirmed the presence of the mcf gene homolog in the genome of P. temperata M1021 showing 85% homology and 98% query coverage with the P. luminescens counterpart. Furthermore, a 2932 amino acid long Mcf protein revealed limited similarity with three protein domains. The N-terminus of the Mcf encompassed consensus sequence for a BH3 domain, the central region revealed similarity to toxin B, and the C-terminus of Mcf revealed similarity to the bacterial export domain of ApxIVA, an RTX-like toxin. In short, the Mcf toxin is likely to play a role in the elimination of insect pests, making it a promising model for use in the agricultural field. PMID:25014195
Addis, T; Mulawarman, M; Waeyenberge, L; Moens, M; Viaene, N; Ehlers, R U
2010-01-01
Four strains of Steinernema feltiae from Eastern Java, Indonesia were characterized based on morphometric, morphological and molecular data. In addition, their virulence against last instar Tenebrio molitor and heat tolerance was tested. Infective juvenile have a mean body length ranging from 749 to 792 microm. The maximum sequence difference among the four strains was 7 bp (8.8%) in the ITS and 2 bp (0.3%) in D2D3 regions of the rDNA. All the strains are not reproductively isolated and can reproduce with European strain S. feltiae Owiplant. The lowest LC50 was observed for strain SCM (373) and the highest for S. feltiae strain Owiplant (458) IJs/40 T. molitor. All four strains showed relatively better mean heat tolerance when compared with S. feltiae Owiplant, both in adapted and non-adapted heat tolerance experiments.
Regulatory effects of Tenebrio molitor Linnaeus on immunological ...
African Journals Online (AJOL)
AJL
2012-04-24
Apr 24, 2012 ... Abbreviations: SRBC, sheep red blood cells; HC50, half of hemolysis ... housed, five per cage, and maintained on 12 h day and night cycle. .... therapy, useful in cancer treatment, were found to deteriorate the immunity. The yellow mealworm, as an important food supplement, contains abundant active.
Genetic constraints and sexual dimorphism in immune defense
DEFF Research Database (Denmark)
Rolff, Jens; Armitage, Sophie Alice Octavia; Coltman, David W.
2005-01-01
The absence of continued evolutionary change despite the presence of genetic variation and directional selection is very common. Genetic correlations between traits can reduce the evolvability of traits. One intriguing example might be found in a sexual conflict over sexually dimorphic traits......: a common genetic architecture constrains the response to selection on a trait subjected to sexually asymmetric selection pressures. Here we show that males and females of the mealworm beetle Tenebrio molitor differ in the quantitative genetic architecture of four traits related to immune defense...
The microbiota of marketed processed edible insects as revealed by high-throughput sequencing.
Garofalo, Cristiana; Osimani, Andrea; Milanović, Vesna; Taccari, Manuela; Cardinali, Federica; Aquilanti, Lucia; Riolo, Paola; Ruschioni, Sara; Isidoro, Nunzio; Clementi, Francesca
2017-04-01
Entomophagy has been linked to nutritional, economic, social and ecological benefits. However, scientific studies on the potential safety risks in eating edible insects need to be carried out for legislators, markets and consumers. In this context, the microbiota of edible insects deserves to be deeply investigated. The aim of this study was to elucidate the microbial species occurring in some processed marketed edible insects, namely powdered small crickets, whole dried small crickets (Acheta domesticus), whole dried locusts (Locusta migratoria), and whole dried mealworm larvae (Tenebrio molitor), through culture-dependent (classical microbiological analyses) and -independent methods (pyrosequencing). A great bacterial diversity and variation among insects was seen. Relatively low counts of total mesophilic aerobes, Enterobacteriaceae, lactic acid bacteria, Clostridium perfringens spores, yeasts and moulds in all of the studied insect batches were found. Furthermore, the presence of several gut-associated bacteria, some of which may act as opportunistic pathogens in humans, were found through pyrosequencing. Food spoilage bacteria were also identified, as well as Spiroplasma spp. in mealworm larvae, which has been found to be related to neurodegenerative diseases in animals and humans. Although viable pathogens such as Salmonella spp. and Listeria monocytogenes were not detected, the presence of Listeria spp., Staphylococcus spp., Clostridium spp. and Bacillus spp. (with low abundance) was also found through pyrosequencing. The results of this study contribute to the elucidation of the microbiota associated with edible insects and encourage further studies aimed to evaluate the influence of rearing and processing conditions on that microbiota. Copyright © 2016 Elsevier Ltd. All rights reserved.
Purine derivate content and amino acid profile in larval stages of three edible insects.
Bednářová, Martina; Borkovcová, Marie; Komprda, Tomáš
2014-01-15
Considering their high content of protein, insects are a valuable alternative protein source. However, no evaluation of their purine content has so far been done. High content of purine derivates may lead to the exclusion of such food from the diet of people with specific diseases. The aim of this study was to analyse the content of selected purine derivates and amino acid profile in the three insect species most often used for entomophagy in Europe and compare them with the purine content in egg white and chicken breast. The content of individual purine derivates and their total content were significantly dependent on insect species. The purine content in all three species was significantly higher (P < 0.05) than in egg white, but some values were significantly lower (P < 0.05) than in chicken breast. The total protein content was 548.9 g kg(-1) dry matter (DM) in mealworm (Tenebrio molitor), 551.6 g kg(-1) DM in superworm (Zophobas atratus) and 564.9 g kg(-1) DM in cricket (Gryllus assimilis). Larvae of mealworm and superworm are protein-rich and purine-low meat alternatives. In contrast, cricket nymphs are protein-rich and purine-rich and cannot be recommended for people with hyperuricemia or gout. © 2013 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Patrícia S Golo
Full Text Available Destruxins (DTXs are cyclic depsipeptides produced by many Metarhizium isolates that have long been assumed to contribute to virulence of these entomopathogenic fungi. We evaluated the virulence of 20 Metarhizium isolates against insect larvae and measured the concentration of DTXs A, B, and E produced by these same isolates in submerged (shaken cultures. Eight of the isolates (ARSEF 324, 724, 760, 1448, 1882, 1883, 3479, and 3918 did not produce DTXs A, B, or E during the five days of submerged culture. DTXs were first detected in culture medium at 2-3 days in submerged culture. Galleria mellonella and Tenebrio molitor showed considerable variation in their susceptibility to the Metarhizium isolates. The concentration of DTXs produced in vitro did not correlate with percent or speed of insect kill. We established endophytic associations of M. robertsii and M. acridum isolates in Vigna unguiculata (cowpeas and Cucumis sativus (cucumber plants. DTXs were detected in cowpeas colonized by M. robertsii ARSEF 2575 12 days after fungal inoculation, but DTXs were not detected in cucumber. This is the first instance of DTXs detected in plants endophytically colonized by M. robertsii. This finding has implications for new approaches to fungus-based biological control of pest arthropods.
Beauveria medogensis sp. nov., a new fungus of the entomopathogenic genus from China.
Imoulan, Abdessamad; Wu, Hai-Jun; Lu, Wei-Lai; Li, Yi; Li, Bin-Bin; Yang, Rei-Heng; Wang, Wen-Jing; Wang, Xiao-Liang; Kirk, Paul M; Yao, Yi-Jian
2016-09-01
Beauveria is among the most ubiquitous genera of entomopathogenic fungi throughout the world. A previously unknown species of the genus was recently discovered from a soil sample collected from Tibetan Plateau, China and is here described as new to science, B. medogensis sp. nov. The new species is distinguished from its closest relatives based on both morphological characterization and molecular phylogenetic analyses. Beauveria medogensis is characterized by globose to subglobose conidia, morphologically similar to some other species of in the genus, but was conclusively separated from those species in the phylogenetic analyses including sequences of four nuclear genes (RPB1, RPB2, TEF1 and Bloc). The new species was clustered in the analyses in a single terminal lineage which was grouped with B. australis sequences together as a sister clade to the B. brongniartii terminal clade. Although molecularly closely related, the new species is distinct morphologically from its closest sisters, B. australis and B. brongniartii, in producing globose to subglobose conidia rather than subglobose, broadly ellipsoid to ellipsoid conidia or ellipsoidal to cylindrical conidia. As isolated from a soil sample, the entomopathogenicity of the new species has been confirmed using Helicoverpa armigera and Tenebrio molitor larvae. Copyright © 2016 Elsevier Inc. All rights reserved.
Bezerra, C A; Macedo, L L P; Amorim, T M L; Santos, V O; Fragoso, R R; Lucena, W A; Meneguim, A M; Valencia-Jimenez, A; Engler, G; Silva, M C M; Albuquerque, E V S; Grossi-de-Sa, M F
2014-12-10
α-Amylases are common enzymes responsible for hydrolyzing starch. Insect-pests, whose larvae develop in seeds, rely obligatorily on α-amylase activity to digest starch, as their major food source. Considering the relevance of insect α-amylases and the natural α-amylase inhibitors present in seeds to protect from insect damage, we report here the molecular cloning and nucleotide sequence of the full-length AmyHha cDNA of the coffee berry borer, Hypothenemus hampei, a major insect-pest of coffee crops. The AmyHha sequence has 1879 bp, containing a 1458 bp open reading frame, which encodes a predicted protein with 485 amino acid residues, with a predicted molecular mass of 51.2 kDa. The deduced protein showed 55-79% identity to other insect α-amylases, including Anthonomus grandis, Ips typographus and Sitophilus oryzae α-amylases. In depth analysis revealed that the highly conserved three amino acid residues (Asp184, Glu220, and Asp285), which compose the catalytic site are also presented in AmyHha amylase. The AmyHha gene seems to be a single copy in the haploid genome and AmyHha transcription levels were found higher in L2 larvae and adult insects, both corresponding to major feeding phases. Modeling of the AmyHha predicted protein uncovered striking structural similarities to the Tenebrio molitor α-amylase also displaying the same amino acid residues involved in enzyme catalysis (Asp184, Glu220 and Asp285). Since AmyHha gene was mostly transcribed in the intestinal tract of H. hampei larvae, the cognate α-amylase could be considered a high valuable target to coffee bean insect control by biotechnological strategies. Copyright © 2014. Published by Elsevier B.V.
Senescence in immune priming and attractiveness in a beetle.
Daukšte, J; Kivleniece, I; Krama, T; Rantala, M J; Krams, I
2012-07-01
Age-related decline in immune activity is referred to as immunosenescence and has been observed for both the adaptive immune response of vertebrates and the innate immune system of invertebrates. Because maintaining a basic level of immune defence and mounting an immune response is costly, optimal investment in immune function should vary over a wide range of individual states such as the individual's age. In this study, we tested whether the immune response and immunological priming within individuals become less efficient with age using mealworm beetles, Tenebrio molitor, as a model organism. We also tested whether ageing and immunological priming affected the odours produced by males. We found that young males of T. molitor were capable of mounting an immune response a sterile nylon monofilament implant with the potential to exhibit a simple form of immune memory through mechanisms of immune priming. Older males did not increase their immune response to a second immune challenge, which negatively affected their sexual attractiveness and remaining life span. Our results indicate that the immune system of older males in T. molitor is less effective, suggesting complex evolutionary trade-offs between ageing, immune response and sexual attractiveness. © 2012 The Authors. Journal of Evolutionary Biology © 2012 European Society For Evolutionary Biology.
Biology of Paenibacillus larvae, a deadly pathogen of honey bee larvae.
Ebeling, Julia; Knispel, Henriette; Hertlein, Gillian; Fünfhaus, Anne; Genersch, Elke
2016-09-01
The gram-positive bacterium Paenibacillus larvae is the etiological agent of American Foulbrood of honey bees, a notifiable disease in many countries. Hence, P. larvae can be considered as an entomopathogen of considerable relevance in veterinary medicine. P. larvae is a highly specialized pathogen with only one established host, the honey bee larva. No other natural environment supporting germination and proliferation of P. larvae is known. Over the last decade, tremendous progress in the understanding of P. larvae and its interactions with honey bee larvae at a molecular level has been made. In this review, we will present the recent highlights and developments in P. larvae research and discuss the impact of some of the findings in a broader context to demonstrate what we can learn from studying "exotic" pathogens.
Progresses in Polystyrene Biodegradation and Prospects for Solutions to Plastic Waste Pollution
Yang, S. S.; Brandon, A. M.; Xing, D. F.; Yang, J.; Pang, J. W.; Criddle, C. S.; Ren, N. Q.; Wu, W. M.
2018-05-01
Petroleum-based plastic pollution has been a global environmental concern for decades. The obvious contrast between the remarkable durability of the plastics and their short service time leads to the increasing accumulation of plastic wastes in the environment. A cost-effective, sustainable strategy to solve the problem should focus on source control and clean up. Polystyrene (PS) wastes, a recalcitrant plastic polymer, are among the wide spread man-made plastic pollutants. Destruction of PS wastes can be achieved using various abiotic methods such as incineration but such methods release potential air pollution and generation of hazardous by-products. Biodegradation and bioremediation has been proposed for years. Since the 1970’s, the microbial biodegradation of plastics, including PS, has been evaluated with mixed and isolated cultures from different sources such as activated sludge, trash, soil, and manure. To date, PS biodegradation by these microbial cultures is still quite slow. Recently, the larvae of yellow mealworms (Tenebrio molitor Linnaeus) have demonstrated promising PS biodegradation performance. Mealworms have demonstrated the ability to chew and ingest PS foam as food and are capable of degrading and mineralizing PS into CO2 via microbe-dependent activities within the gut in less than the 12-15 hrs gut retention time. These research results have revealed a potential for microbial biodegradation and bioremediation of plastic pollutants.
Inglis, P W; Aragão, F J; Frazão, H; Magalhães, B P; Valadares-Inglis, M C
2000-10-15
Metarhizium anisopliae var. acridum (syn. M. flavoviride) is recognized as a highly specific and virulent mycopathogen of locusts and grasshoppers and is currently being developed as a biological control agent for this group of insects in Brazil. Intact conidia of M. anisopliae var. acridum strain CG423 were transformed using microparticle bombardment. Plasmids used were: (1) pBARKS1 carrying the bar gene of Streptomyces hygroscopicus fused to the Aspergillus nidulans trpC promoter, encoding resistance to glufosinate ammonium (or phosphinothricin) and modified by addition of the telomeric repeat (TTAGGG)(18) of Fusarium oxysporum and 2.pEGFP/gpd/tel carrying a red-shifted variant gene for Aequorea victoria green fluorescent protein (EGFP) which we have fused to the A. nidulans gpd promoter and trpC terminator. Highly fluorescent co-transformants were selected on solid minimal medium containing 100 microg ml(-1) glufosinate ammonium using an inverted microscope with 450-490 nm excitation/510 nm emission filter set. Southern blot analysis of co-transformants revealed varying multiple chromosomal integrations of both bar and egfp genes at both telomeric and non-telomeric loci. Transformants retained pathogenicity in bioassays against Rhammatocerus schistocercoides and showed unaltered lack of pathogenicity against larvae of the non-target insect Anticarsia gemmatalis. One co-transformant from four tested, however, showed a significant, but non-dose-dependent, elevation in virulence against Tenebrio molitor.
Huarte-Bonnet, Carla; Paixão, Flávia R S; Ponce, Juan C; Santana, Marianela; Prieto, Eduardo D; Pedrini, Nicolás
2018-06-01
The entomopathogenic fungus Beauveria bassiana is able to grow on insect cuticle hydrocarbons, inducing alkane assimilation pathways and concomitantly increasing virulence against insect hosts. In this study, we describe some physiological and molecular processes implicated in growth, nutritional stress response, and cellular alterations found in alkane-grown fungi. The fungal cytology was investigated using light and transmission electron microscopy while the surface topography was examined using atomic force microscopy. Additionally, the expression pattern of several genes associated with oxidative stress, peroxisome biogenesis, and hydrophobicity were analysed by qPCR. We found a novel type of growth in alkane-cultured B. bassiana similar to mycelial pellets described in other alkane-free fungi, which were able to produce viable conidia and to be pathogenic against larvae of the beetles Tenebrio molitor and Tribolium castaneum. Mycelial pellets were formed by hyphae cumulates with high peroxidase activity, exhibiting peroxisome proliferation and an apparent surface thickening. Alkane-grown conidia appeared to be more hydrophobic and cell surfaces displayed different topography than glucose-grown cells. We also found a significant induction in several genes encoding for peroxins, catalases, superoxide dismutases, and hydrophobins. These results show that both morphological and metabolic changes are triggered in mycelial pellets derived from alkane-grown B. bassiana. Copyright © 2017 British Mycological Society. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Clark, D.R. Jr.; Prouty, R.M.
1977-03-01
Twenty-two female big brown bats (Eptesicus fuscus) were collected in a house attic in Montgomery County, Maryland. Seventeen were fed mealworms (Tenebrio molitor larvae) that contained 166 ppM DDE; the other five were fed uncontaminated mealworms. After 54 days of feeding, six dosed bats were frozen and the remaining 16 were starved to death. In a second experiment, 21 female big brown bats were collected in a house attic in Prince Georges County, Maryland. Sixteen were fed mealworms that contained 9.4 ppM Aroclor 1254 (PCB). After 37 days, two bats had died, four dosed bats were frozen, and the remaining 15 were starved to death. Starvation caused mobilization of stored residues. After the feeding periods, average weights of all four groups (DDE-dosed, DDE control, PCB-dosed, PCB control) had increased. However, weights of DDE-dosed bats had increased significantly more than those of their controls, whereas weights of PCB-dosed bats had increased significantly less than those of their controls. During starvation, PCB-dosed bats lost weight significantly more slowly than controls. Because PCB levels in dosed bats resembled levels found in some free-living big brown bats, PCBs may be slowing metabolic rates of some free-living bats. It is not known how various common organochlorine residues may affect metabolism in hibernating bats.
Simulación de un Robot Hexápodo Bioinspirado en el Tenebrio
Directory of Open Access Journals (Sweden)
Juan Pablo Rodríguez-Calderón
2015-06-01
Full Text Available Los insectos son base fundamental en el estudio de la robótica reactiva ya que estos poseen características biológicas y motrices que son de interés para ser implementadas en robots bioinspirados, teniendo en cuenta el desempeño de éstos en diferentes áreas. Por otra parte los animales hexápodos poseen omnidireccionalidad y estabilidad, debido a la formación del trípode de apoyo, el cual se crea en sus patas al dar un paso, lo cual les permite sobrepasar diferentes obstáculos con facilidad y velocidad constante. En este proyecto se implementa el sistema locomotor del insecto Tenebrio debido a la facilidad con que se pueden apreciar sus movimientos. Se analiza el desplazamiento de las patas del insecto en diferentes trayectorias, vistas y terreno plano, posteriormente se encontraron los parámetros, ecuaciones y restricciones que limitan los diferentes eslabones de cada una de las patas del Tenebrio, esto se realizó por medio de un análisis de imágenes. Finalmente la información recogida se implementa en la plataforma MATLAB para determinar las características de movimiento, estabilidad y desplazamiento.
Feeding for larvae of catfish Pangasionodon sp. larvae in different ages
Directory of Open Access Journals (Sweden)
Muhammad Agus Suprayudi
2015-05-01
Full Text Available ABSTRACT Sludge worm (Tubifex sp. as natural feed on catfish (Pangasionodon sp. larvae rearing is available in limited amount especially during rainy season. It becomes a constraint factor for larvae rearing sector. This research was conducted to evaluate the appropriate initial age of catfish larvae to get artificial feed as sludge worm replacement. Evaluation was conducted on the growth and survival of catfish larvae in 14 days of culture. There were four treatments of feeding in triplicates i.e. larvae were given natural feed without artificial feed, given artificial feed started from d3, d6, and d9 with three replications. The results showed that larvae fed on artificial feed on d3 had the lowest growth compared to the other treatments, whereas the survival was not significantly different (P>0.05 among the treatments. As a conclusion, artificial feed could be used to replace natural feed for catfish larvae started at the age of nine days. Keywords: sludge worm, catfish larvae, artificial feed ABSTRAK Cacing sutra (Tubifex sp. tersedia dalam jumlah terbatas terutama pada musim penghujan sebagai pakan alami dalam usaha pembenihan ikan patin (Pangasionodon sp.. Ini menjadi kendala dalam usaha pembenihan. Penelitian ini dilakukan untuk mengevaluasi umur larva ikan patin yang tepat untuk mulai diberi pakan buatan menggantikan cacing sutra. Evaluasi dilakukan pada pertumbuhan dan kelangsungan hidup larva ikan patin umur 14 hari. Selama pemeliharaan, larva diberi pakan dengan empat perlakuan; pemberian pakan alami tanpa pakan buatan, pemberian pakan buatan mulai d3, d6, dan d9 dengan tiga ulangan untuk masing-masing perlakuan. Hasil penelitian menunjukkan bahwa perlakuan pemberian pakan buatan mulai d3 memiliki pertumbuhan panjang yang terkecil dibandingkan perlakuan lain, sedangkan tingkat kelangsungan hidup larva tidak berbeda nyata (P>0,05 antarperlakuan. Berdasarkan hasil penelitian, dapat disimpulkan bahwa pakan buatan dapat digunakan
Do pheromones reveal male immunocompetence?
Rantala, Markus J; Jokinen, Ilmari; Kortet, Raine; Vainikka, Anssi; Suhonen, Jukka
2002-01-01
Pheromones function not only as mate attractors, but they may also relay important information to prospective mates. It has been shown that vertebrates can distinguish, via olfactory mechanisms, major histocompatibility complex types in their prospective mates. However, whether pheromones can transmit information about immunocompetence is unknown. Here, we show that female mealworm beetles (Tenebrio molitor) prefer pheromones from males with better immunocompetence, indicated by a faster encapsulation rate against a novel antigen, and higher levels of phenoloxidase in haemolymph. Thus, the present study indicates that pheromones could transmit information about males' parasite resistance ability and may work as a reliable sexual ornament for female choice. PMID:12204128
Key to marine arthropod larvae
Directory of Open Access Journals (Sweden)
John A. Fornshell
2012-03-01
Full Text Available The scope of this key is restricted to the larvae of marine arthropods. The key is based solely on their morphology, patterns of body segmentation, numbers of appendages, and mode of locomotion. An effort has been made to treat all traditionally named larval forms, both planktonic and benthic. It is intended that this key be useful for a researcher working with archived museum specimens and therefore, does not include habitat information as a identifying trait, even though this information is usually available in the archived records. Within the phylum Arthropoda there are two sub-phyla and eleven classes having larval stages in the marineenvironment. Where feasible the original names of the various larval types have been used. Because this nomenclature is less commonly used today compared to the past, the more recent taxonomic affinities are included in parentheses after the original larval name. The key includes the following thirty-four larvae: Branchhiopoda nauplii; Cephalocarida nauplii; Mystacocarida nauplii; trilobite larva; protonymphon; hexapod larvae; Remipedia nauplii; nauplius - Y larvae; Cirripedia nauplii; Ascothoracida nauplii; Ostracoda nauplii; Euphausiacea nauplii; Penaeidea nauplii; Cyclopoida nauplii; Calanoida nauplii; Harpacticoida nauplii;Polyarthra nauplii; cypris larva; eryonecius larva; cypris-Y larva; elapthocaris larvae; mysis larvae; lucifer zoea; acetes zoea; acanthosoma larva; phyllosoma; antizoea larva; anomuran zoea; brachyuran zoea; calyptopis larvae; furcilia larva; crytopia larva; puerulus larva; alima larva.
DEFF Research Database (Denmark)
Bjerrum, Lotte; Fischer, Christian Holst; Nordentoft, Steen
2013-01-01
Companies and researchers are in close collaboration developing a container- based system for cultivating fly larvae at organic poultry farms. In a one week process, manure will be converted to compost and the live larvae will be harvested and used for feeding laying hens. The larvae are expected...
Directory of Open Access Journals (Sweden)
Gilberto S. Andrade
2012-09-01
Full Text Available The knowledge on ovigeny in parasitoids is important for basic studies on physiology and applied biological control. The ovigeny pattern and type of ovariole of the parasitoid Palmistichus elaeisis Delvare & LaSalle (Hymenoptera: Eulophidae were studied in newly-emerged females at seven, 14, 24 and 48 h intervals after their emergence from Tenebrio molitor L. pupae (Coleoptera: Tenebrionidae. Females of P. elaeisis presented ovaries composed by four ovarioles of the meroistic polytrophic type. The yolk accumulation and chorionogenesis in P. elaeisis were concluded 24 h after the female emergence. The 48 h-old females show a high quantity of egg ready for oviposition. These findings can help to improve the mass production of P. elaeisis and the augmentative biological control by using this natural enemy.O conhecimento da ovigenia em parasitóides é importante para estudos básicos em fisiologia e para o controle biológico aplicado. O padrão de ovigenia e OVIGENY OF Palmistichus elaeisis (HYMENOPTERA: EULOPHIDAE o tipo de ovaríolo do parasitóide Palmistichus elaeisis Delvare & LaSalle (Hymenopera: Eulophidae foram estudados em fêmeas recém-emergidas e em intervalos de sete, 14, 24 de 48 horas após a emergência em pupas de Tenebrio molitor L. (Coleoptera: Tenebrionidae. Fêmeas de P. elaesis apresentaram o ovário composto por quatro ovaríolos do tipo meroístico politrófico. A deposição de vitelo e corionogênese em P. elaeisis foram concluídas 24 horas após a emergência. Fêmeas com 48 horas de idade apresentam grande quantidade de ovos prontos para a oviposição. Esses resultados podem ajudar a melhoria da produção massal de P. elaeisis e o controle biológico aplicado com esse parasitóide.
Directory of Open Access Journals (Sweden)
Jose Eduardo Serrão
2003-04-01
Full Text Available O potencial reprodutivo de fêmeas de Supputius cincticeps (Stal (Heteroptera: Pentatomidae de duas classes de peso foi avaliado. Machos e fêmeas desse predador foram obtidos de ninfas alimentadas com pupas de Tenebrio molitor L. (Coleoptera: Tenebrionidae. Foram analisadas fêmeas com peso inferior a 45 mg (fêmeas leves e superior a 60 mg (fêmeas pesadas. A longevidade e os períodos de pré-oviposição, oviposição e pós-oviposição foram semelhantes entre fêmeas das duas classes de peso, enquanto aquelas mais pesadas apresentaram maior número de posturas, ovos, ovos/postura e ninfas. Períodos entre posturas e de incubação dos ovos foram menores para fêmeas com peso superior a 60mg. Esses resultados são discutidos em relação ao uso de fêmeas mais pesadas de S. cincticeps para aumentar a produção em criação massal desse predadorThe reproductive potential of Supputius cincticeps (Stal (Heteroptera: Pentatomidae females of two weight classes was evaluated with males and females of this predator obtained from nymphs fed on Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae. Females of S. cincticeps weighing less than 45 mg (light females and more than 60 mg (heavy females constituted the treatments. Pre-oviposition, oviposition and post-oviposition periods besides adult longevity were similar between treatments while number of egg masses, eggs, eggs/egg mass and number of nymphs hatched were higher for heavier females. Periods between egg mass laying and egg incubation were shorter for insects of the last treatment. These results are discussed in relation to the use of heavier females of S. cincticeps to improve mass rearing of this predator in laboratory
Larva migrans visceral: relato de caso Visceral larva migrans: case report
Directory of Open Access Journals (Sweden)
Alexandre Bortoli Machado
2003-04-01
Full Text Available Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs from the environment originating from roundworms which commonly infect dogs and cats, Toxocara canis and Toxocara cati. The larvae penetrate the gut wall and migrate through the tissues causing disorders consequent to an inflammatory immune response¹. The authors describe a clinical case of visceral larva migrans with an unusual clinical presentation and also its clinical aspects, diagnosis and treatment are reviewed.
Directory of Open Access Journals (Sweden)
Clóvis Souza Bujes
1998-12-01
Full Text Available Liolaemus occipitalis (Boulenger, 1885 is an abundant lizard lbundalong lhe coastal dunes of Rio Grande do Sul, Brazil. Fourteen individuais were manually captured in the dunes of Quintão beach (Palmares do Sul, Rio Grande do Sul and studied in captivity from 23/VII/92 to 30/VII/93. They were kept in a terrarium with sand substrate and vegetation collected in their habitat. Snout-vent length (SVL and wcighted were measured weekly. They received Tenebrio molitor (Linnaeus, 1758 worms as food; water was abundant. Combats between males for food and territory, and other behavioral displays were observed, like copulation and nesting behaviors. Growth curves for each lizard were analyzed.
Interactions between parasites and insects vectors
Directory of Open Access Journals (Sweden)
Hilary Hurd
1994-01-01
Full Text Available This review stresses the importance of studies that will provide a basic understanding of the pathology of parasite-infected vector insects. This knowledge should be a vital component of the very focussed initiatives currently being funded in the areas of vector control. Vector fecundity reduction is discussed as an example of such pathology. Underlying mechanisms are being investigated in a model system, Hymenolepis diminuta-infected Tenebrio molitor and in Onchocerca-infected blackflies and Plasmodium-infected Anopheles stephensi. In all cases, host vitellogenesis is disrupted by the parasite and, in the tapeworm/beetle model, interaction between the parasite and the endocrine control of the insect's reproductive physiology has been demonstrated.
Directory of Open Access Journals (Sweden)
Dmitry Bogolyubov
2007-06-01
Full Text Available In the present study we used 5-bromouridine 5'-triphosphate (BrUTP microinjections to localize the transcription sites in oocytes of insects with different types of the ovarium structure: panoistic, meroistic polytrophic, and meroistic telotrophic. We found that in an insect with panoistic ovaries (Acheta domesticus, oocyte nuclei maintain their transcription activity during the long period of oocyte growth. In insects with meroistic ovaries (Tenebrio molitor and Panorpa communis, early oocyte chromosomes were found to be transcriptionally active, and some transcription activity still persist while the karyosphere, a compact structure formed by all condensed oocyte chromosomes, begins to develop. At the latest stages of karyosphere development, no anti-Br-RNA signal was registered in the karyosphere.
Dubuffet, Aurore; Zanchi, Caroline; Boutet, Gwendoline; Moreau, Jérôme; Teixeira, Maria; Moret, Yannick
2015-01-01
In many vertebrates and invertebrates, offspring whose mothers have been exposed to pathogens can exhibit increased levels of immune activity and/or increased survival to infection. Such phenomena, called “Trans-generational immune priming” (TGIP) are expected to provide immune protection to the offspring. As the offspring and their mother may share the same environment, and consequently similar microbial threats, we expect the immune molecules present in the progeny to be specific to the microbes that immune challenged the mother. We provide evidence in the mealworm beetle Tenebrio molitor that the antimicrobial activity found in the eggs is only active against Gram-positive bacteria, even when females were exposed to Gram-negative bacteria or fungi. Fungi were weak inducers of TGIP while we obtained similar levels of anti-Gram-positive activity using different bacteria for the maternal challenge. Furthermore, we have identified an antibacterial peptide from the defensin family, the tenecin 1, which spectrum of activity is exclusively directed toward Gram-positive bacteria as potential contributor to this antimicrobial activity. We conclude that maternal transfer of antimicrobial activity in the eggs of T. molitor might have evolved from persistent Gram-positive bacterial pathogens between insect generations. PMID:26430786
Directory of Open Access Journals (Sweden)
Aurore Dubuffet
2015-10-01
Full Text Available In many vertebrates and invertebrates, offspring whose mothers have been exposed to pathogens can exhibit increased levels of immune activity and/or increased survival to infection. Such phenomena, called "Trans-generational immune priming" (TGIP are expected to provide immune protection to the offspring. As the offspring and their mother may share the same environment, and consequently similar microbial threats, we expect the immune molecules present in the progeny to be specific to the microbes that immune challenged the mother. We provide evidence in the mealworm beetle Tenebrio molitor that the antimicrobial activity found in the eggs is only active against Gram-positive bacteria, even when females were exposed to Gram-negative bacteria or fungi. Fungi were weak inducers of TGIP while we obtained similar levels of anti-Gram-positive activity using different bacteria for the maternal challenge. Furthermore, we have identified an antibacterial peptide from the defensin family, the tenecin 1, which spectrum of activity is exclusively directed toward Gram-positive bacteria as potential contributor to this antimicrobial activity. We conclude that maternal transfer of antimicrobial activity in the eggs of T. molitor might have evolved from persistent Gram-positive bacterial pathogens between insect generations.
Contreras, Estefanía; Schoppmeier, Michael; Real, M. Dolores; Rausell, Carolina
2013-01-01
Understanding how Bacillus thuringiensis (Bt) toxins interact with proteins in the midgut of susceptible coleopteran insects is crucial to fully explain the molecular bases of Bt specificity and insecticidal action. In this work, aminopeptidase N (TcAPN-I), E-cadherin (TcCad1), and sodium solute symporter (TcSSS) have been identified by ligand blot as putative Cry3Ba toxin-binding proteins in Tribolium castaneum (Tc) larvae. RNA interference knockdown of TcCad1 or TcSSS proteins resulted in decreased susceptibility to Cry3Ba toxin, demonstrating the Cry toxin receptor functionality for these proteins. In contrast, TcAPN-I silencing had no effect on Cry3Ba larval toxicity, suggesting that this protein is not relevant in the Cry3Ba toxin mode of action in Tc. Remarkable features of TcSSS protein were the presence of cadherin repeats in its amino acid sequence and that a TcSSS peptide fragment containing a sequence homologous to a binding epitope found in Manduca sexta and Tenebrio molitor Bt cadherin functional receptors enhanced Cry3Ba toxicity. This is the first time that the involvement of a sodium solute symporter protein as a Bt functional receptor has been demonstrated. The role of this novel receptor in Bt toxicity against coleopteran insects together with the lack of receptor functionality of aminopeptidase N proteins might account for some of the differences in toxin specificity between Lepidoptera and Coleoptera insect orders. PMID:23645668
Gazara, Rajesh K; Cardoso, Christiane; Bellieny-Rabelo, Daniel; Ferreira, Clélia; Terra, Walter R; Venancio, Thiago M
2017-09-05
Despite the great morphological diversity of insects, there is a regularity in their digestive functions, which is apparently related to their physiology. In the present work we report the de novo midgut transcriptomes of four non-model insects from four distinct orders: Spodoptera frugiperda (Lepidoptera), Musca domestica (Diptera), Tenebrio molitor (Coleoptera) and Dysdercus peruvianus (Hemiptera). We employed a computational strategy to merge assemblies obtained with two different algorithms, which substantially increased the quality of the final transcriptomes. Unigenes were annotated and analyzed using the eggNOG database, which allowed us to assign some level of functional and evolutionary information to 79.7% to 93.1% of the transcriptomes. We found interesting transcriptional patterns, such as: i) the intense use of lysozymes in digestive functions of M. domestica larvae, which are streamlined and adapted to feed on bacteria; ii) the up-regulation of orthologous UDP-glycosyl transferase and cytochrome P450 genes in the whole midguts different species, supporting the existence of an ancient defense frontline to counter xenobiotics; iii) evidence supporting roles for juvenile hormone binding proteins in the midgut physiology, probably as a way to activate genes that help fight anti-nutritional substances (e.g. protease inhibitors). The results presented here shed light on the digestive and structural properties of the digestive systems of these distantly related species. Furthermore, the produced datasets will also be useful for scientists studying these insects. Copyright © 2017. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Dulce Maria Tocchetto Schuch
2003-03-01
Full Text Available Este trabalho objetivou detectar presença de esporos de Paenibacillus larvae subsp. larvae em produtos de um entreposto do interior do Estado do Rio Grande do Sul, a identificação de possíveis fontes de contaminação e a avaliação da possibilidade da transferência de esporos para colméias de apiários adjacentes a partir de produtos importados contaminados. Foram analisados mel e pólen importados disponíveis no entreposto, favo do ninho (crias, pólen e mel colhido de uma colméia sadia, mel estocado em um dos apiários e abelhas adultas. Os resultados foram positivosem relação ao mel e pólen importados, a três grupos de abelhas adultas e ao mel do favo.The objective of this work was to detect the presence of Paenibacillus larvae subsp. larvae spores in products from a warehouse located in Rio Grande do Sul State, Brazil, the identification of possible contamination sources, and the assessment of spores transference possibility from contaminated imported products from the warehouse to apiaries located in the surrounding area. Samples of imported pollen and bulk honey stocked in the warehouse, and honeycomb (brood, honey and pollen from a healthy hive, honey from one apiary and adult bees were analyzed. Imported honey and pollen, and three groups of adult bees and the honey collected from the honeycomb resulted positive.
Parasitization by Schleroderma guani influences protein expression in Tenebrio molitor pupae
Ectoparasitoid wasps deposit their eggs on the surface and inject venom into the host. Venoms are chemically complex and they exert substantial impact on hosts, including permanent or temporary paralysis and developmental arrest. These visible venom effects emerge from changes in expression of genes...
Parasitization by Scleroderma guani influences protein expression in Tenebrio molitor pupae
Ectoparasitoid wasps deposit their eggs on the surface and inject venom into the host. Venoms are chemically complex and they exert substantial impact on hosts, including permanent or temporary paralysis and developmental arrest. These visible venom effects emerge from changes in expression of genes...
Directory of Open Access Journals (Sweden)
Blondine Ch. P.
2012-09-01
Full Text Available A study to evaluate pathogenic organisms as cause of mosquito larvae death was conducted at Wonokerto and Pabelan villages, Salatiga Luar Kota subdistrict, Semarang regency in Central Java from May 1991 through December 1991. Bacterial isolation from dead larvae showed that 31 B. thuringicnsis isolates were obtained from 31 larvae samples collected from 2 location e.g Wonokerto village (3 samples, Pabelan village (28 samples. Nineteen isolates (61,3% showed a pathogenicity of more than 50% to third toward instar larvae of Aedes aegypti and Culex quinquefasciatus respectively 24 hours after exposure. This study shows the possible use of B. thuringiensis for biologic control of mosquitoes which can act as vectors for human diseases.
Directory of Open Access Journals (Sweden)
Ratih Pratiwi Sari
2017-10-01
Full Text Available Every human has uric acid, because uric acid is a normal substance in the body. When the level exceeds the normal limit value is called hyperuricemia. Continuous hyperuricemia without treatment will develop into gout. The prevalence of incidence of uric acid disease (hyperuricemia is increasing from year to year, both in developed and developing countries. This study aims to determine the effect of decreased levels of uric acid in male white rat with ethanol extract of Semut Jepang (Tenebrio Sp. This research is an experimental research with pre test and post test with control group design. This study used 12 male rats which were randomly divided into 3 groups consisting of group I (negative control were given aquadest, group II (treatment group was given ethanol extract 2.3 mg / kgBB Japanese ants and group III ( positive controls were given Allopurinol 27.15 mg / kgBW orally. The test animals were induced with potassium oxonate 300mg / kgBW for 6 days intraperitoneally for 6 days before treatment. The levels of uric acid of the test animals were measured using a uric acid strip test. The results of this study showed that ethanol extract of Semut Jepang (Tenebrio Sp with a dosage of 2.3 mg / kgBW did not have the effect of decreasing uric acid levels in male white rats.
Behrens, Dieter; Forsgren, Eva; Fries, Ingemar; Moritz, Robin F A
2010-10-01
We compared the mortality of honeybee (Apis mellifera) drone and worker larvae from a single queen under controlled in vitro conditions following infection with Paenibacillus larvae, a bacterium causing the brood disease American Foulbrood (AFB). We also determined absolute P. larvae cell numbers and lethal titres in deceased individuals of both sexes up to 8 days post infection using quantitative real-time PCR (qPCR). Our results show that in drones the onset of infection induced mortality is delayed by 1 day, the cumulative mortality is reduced by 10% and P. larvae cell numbers are higher than in worker larvae. Since differences in bacterial cell titres between sexes can be explained by differences in body size, larval size appears to be a key parameter for a lethal threshold in AFB tolerance. Both means and variances for lethal thresholds are similar for drone and worker larvae suggesting that drone resistance phenotypes resemble those of related workers. © 2010 Society for Applied Microbiology and Blackwell Publishing Ltd.
Directory of Open Access Journals (Sweden)
José Eduardo Bracco
1995-04-01
Full Text Available Com a finalidade de testar a metodologia de amostragem por larva-única na vigilância entomológica do Aedes aegypti, foram pesquisados domicílios do Município de Araraquara, SP (Brasil. Nos criadouros que continham larvas de Aedes uma delas foi coletada. Como controle, após a coleta da larva-única, todas as larvas foram coletadas para identificação posterior. Esse processo foi repetido no laboratório. Dos 447 domicílios visitados, apenas 12 foram considerados positivos e 20 criadouros foram identificados; destes, 13 continham larvas de Aedes; 5, larvas de Aedes e Culex e 2, larvas de Culex. Os resultados mostram o reconhecimento correto, no campo, de todos os criadouros, evidenciando que o método poderia ser utilizado na vigilância entomológica de municípios sem infestação domiciliar ou infestados apenas com uma única espécie de Aedes.Buildings in Araraquara city, Southeastern Brazil, were searched during a year for the presence of Aedes larvae using single larva sampling in order to check the single-larva methodology. In those breeding places in wich Aedes larvae were found, one of them was collected. As a control, after the single larva had been collected, all the larvae from the breeding place were collected for later identification. This process was repeated in the laboratory. Of the 447 domiciles searched, 12 were considered positive and 20 breeding places were found. Of the breeding places, 13 contained Aedes larvae, 5 both Aedes and Culex larvae and 2 Culex larvae only. The results show that all the breeding places in the field were properly recognited showing the method may be used for Aedes surveillance in cities infested with one species only or without any domiciliary infestation.
Molecular Characterization of Brevibacillus laterosporus and Its Potential Use in Biological Control
de Oliveira, Edmar Justo; Rabinovitch, Leon; Monnerat, Rose Gomes; Passos, Liana Konovaloff Jannotti; Zahner, Viviane
2004-01-01
Thirty-three strains of Brevibacillus laterosporus, including three novel strains isolated from Brazilian soil samples, were examined for genetic variability by the use of different PCR-based methods. Molecular markers that could characterize bacterial strains with regards to their pathogenic potential were investigated. In addition, toxicity was assessed by the use of insects belonging to the orders Lepidoptera and Coleoptera and the mollusk Biomphalaria glabrata. Among the targets tested, Biomphalaria glabrata demonstrated the highest degree of sensitivity to B. laterosporus, with some strains inducing 90 to 100% mortality in snails aged 3 and 12 days posteclosion. Larvae of the coleopteron Anthonomus grandis were also susceptible, presenting mortality levels of between 33 and 63%. Toxicity was also noted towards the lepidopteron Anticarsia gemmatalis. In contrast, no mortality was recorded among test populations of Tenebrio molitor or Spodoptera frugiperda. The application of intergenic transcribed spacer PCR and BOX-PCR generated 15 and 17 different genotypes, respectively. None of the molecular techniques allowed the identification of a convenient marker that was associated with any entomopathogenic phenotype. However, a 1,078-bp amplicon was detected for all strains of B. laterosporus when a primer for amplification of the BOXA1R region was used. Similarly, a 900-bp amplicon was generated from all isolates by use of the primer OPA-11 for randomly amplified polymorphic DNA analysis. These amplicons were not detected for other phenotypically related Brevibacillus species, indicating that they represent markers that are specific for B. laterosporus, which may prove useful for the isolation and identification of new strains of this species. PMID:15528531
Gregorovičová, Martina; Černíková, Alena
2015-06-01
The chemical defence of Heteroptera is primarily based on repellent secretions which signal the potential toxicity of the bug to its predators. We tested the aversive reactions of green lizards (Lacerta viridis) towards the major compounds of the defensive secretion of Graphosoma lineatum, specifically: (i) a mixture of three aldehydes: (E)-hex-2-enal, (E)-oct-2-enal, (E)-dec-2-enal; (ii) a mixture of these three aldehydes and tridecane; (iii) oxoaldehyde: (E)-4-oxohex-2-enal; (iv) secretion extracted from metathoracic scent glands of G. lineatum adults and (v) hexane as a non-polar solvent. All chemicals were presented on a palatable food (Tenebrio molitor larvae). The aversive reactions of the green lizards towards the mealworms were evaluated by observing the approach latencies, attack latencies and approach-attack intervals. The green lizards exhibited a strong aversive reaction to the mixture of three aldehydes. Tridecane reduced the aversive reaction to the aldehyde mixture. Oxoaldehyde caused the weakest, but still significant, aversive reaction. The secretion from whole metathoracic scent glands also clearly had an aversive effect on the green lizards. Moreover, when a living specimen of G. lineatum or Pyrrhocoris apterus (another aposematic red-and-black prey) was presented to the green lizards before the trials with the aldehyde mixture, the aversive effect of the mixture was enhanced. In conclusion, the mixture of three aldehydes had the strong aversive effect and could signal the potential toxicity of G. lineatum to the green lizards. Copyright © 2015 Elsevier GmbH. All rights reserved.
Severini, C; Azzollini, D; Albenzio, M; Derossi, A
2018-04-01
3D printing technology was employed to obtain snacks with a designed cylindrical geometry from wheat flour dough enriched by ground larvae of Yellow mealworms (Tenebrio molitor) as novel source of proteins. The main microstructural features, overall quality, and nutritional attributes were studied as a function of formulation, time and temperature of baking. The addition of ground insects up to 20 g/100 g (d.b.) resulted in softer dough. This caused an overflow in dough deposition producing the increase in diameter, height and weight of snacks. Baking conditions did not alter the overall aspect of the snacks, but modification of the main dimensional and microstructure attributes were observed due to the better water evaporation. The optimization of baking conditions found that 22 min and 200 °C allowed obtaining a maximum desirability of 0.693. Baked in these conditions, the printed snacks enriched with 10 and 20% of ground insects significantly increased the total essential amino acid, from 32.5 (0% insects) to 38.2 and 41.3 g/100 g protein, respectively. The protein digestibility corrected amino acid score increased from 41.6 to 65.2 from 0 to 20% insect enrichment, with lysine and methionine + cysteine being the respective limiting amino acid. Our results evidenced the rational promotion of insects based on nutritional arguments and validated the use of 3D printing as technology to manufacture innovative printed snacks without adverse impact on technological quality. Copyright © 2018 Elsevier Ltd. All rights reserved.
Kazacos, Kevin R.; Abbott, Rachel C.; van Riper, Charles
2016-05-26
SummaryBaylisascaris procyonis, the common raccoon roundworm, is the most commonly recognized cause of clinical larva migrans (LM) in animals, a condition in which an immature parasitic worm or larva migrates in a host animal’s tissues, causing obvious disease. Infection with B. procyonis is best known as a cause of fatal or severe neurologic disease that results when the larvae invade the brain, the spinal cord, or both; this condition is known as neural larva migrans (NLM). Baylisascariasis is a zoonotic disease, that is, one that is transmissible from animals to humans. In humans, B. procyonis can cause damaging visceral (VLM), ocular (OLM), and neural larva migrans. Due to the ubiquity of infected raccoons around humans, there is considerable human exposure and risk of infection with this parasite. The remarkable disease-producing capability of B. procyonis in animals and humans is one of the most significant aspects of the biology of ascarids (large roundworms) to come to light in recent years. Infection with B. procyonis has important health implications for a wide variety of free-ranging and captive wildlife, zoo animals, domestic animals, as well as human beings, on both an individual and population level. This report, eighth in the series of U.S. Geological Survey Circulars on zoonotic diseases, will help us to better understand the routes of Baylisascaris procyonis infections and how best to adequately monitor this zoonotic disease.
Visceral larva migrans: case report
Machado, Alexandre Bortoli; El Achkar, Marice Emanuela
2003-01-01
Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.Visceral larva migrans is an infectious human disease that occurs following ingestion of eggs...
Directory of Open Access Journals (Sweden)
V. Cherepnin
2016-09-01
Full Text Available Purpose. The purpose of these studies was to evaluate the effect of the cryoselection of carp sperm of multiple age groups depending on the quality of thawed sperm after modification of the composite cryoprotective medium, which was used for the dilution of native sperm before freezing. Methodology. Coenzyme B12 (cobamamide, blood plasma of Prussian carp (Carassius gibelio, which was subjected to natural cold-acclimation, and purified protein antifreeze tmAFP isolated from larval mealworm (Tenebrio molitor, which also was subjected to natural cold-acclimation, were sued as modifiers. Findings. The results of the study demonstrated that qualitative and quantitative characteristics of the defrosted sperm, results of the incubation, rearing of embryos and larvae of Nyvky scaled carp (NLC, as well as fish culture parameters of produced young-of-the-year depended from on the composition of cryoprotective medium. The best results were demonstrated for the experimental groups, obtained with the use of the cryoprotective solution supplemented with purified antifreeze protein tmAFP. The larvae obtained from the sperm cryopreserved with the addition of cryoprotective medium TmAFP had better resistance to dehydration, surpassing the experimental groups obtained from the modifiers of Prussian carp plasma and cobamamide. There is a consolidation in the action of the related extracellular cryoprotectors, which were isolated from the cold-resistant organisms. And carp produced with their used demonstrated better performance during their rearing. The fact can be established that the manifestation of cryoselective effect depends on the integrity of sperm hereditary material and does not depend on the effect of extremely low temperatures on the cell membranes. Originality. There were the first experiments, where Prussian carp plasma and antifreeze protein tmAFP were used as extracellular cryoprotectors. Practical value. The modifications of composite
Gimmel, A; Kempf, H; Öfner, S; Müller, D; Liesegang, A
2017-06-01
With an increased number of pet reptiles, many diseases occur due to nutritional disorders. Between 2013 and 2015, irregular gallbladder contents (sludge/choleliths) in adult bearded dragons (Pogona vitticeps) were recorded in many of the routinely conducted necropsies at the reptile rescue station in Munich (Auffangstation für Reptilien, München e.V., Munich, Germany). Nine animals, six from the rescue station and three from an associated veterinary practice (Tierärztliche Praxis für Exoten, Augsburg, Germany), were studied. Gallbladder contents from all animals were analysed at the Institute for Clinical Chemistry in Zurich, Switzerland. In three of nine animals, one cholelith composed of 100% calcium carbonate (CaCO 3 ) was detected and it precipitated either as pure calcite or as a calcite:vaterite combination. In the remaining six animals, analyses suggested a protein-based material. The detection of choleliths/sludge was not anticipated at necropsy or surgery in eight of nine animals. The diet of the six animals from the rescue station was retrospectively described as mainly insects, whereas the diet of the three animals from the veterinary practice also contained little plant matter. Fed insect species were mealworm larva (Tenebrio molitor), house cricket (Acheta domestica), migratory locust (Locusta migratoria) and zophobas larva (Zophobas morio), all high in protein and fat. In other species, a nidus must be present for CaCO 3 to precipitate. As a protein-based sludge was detected in six gallbladders, it is possible that a high-protein diet could lead to such a nidus and subsequently to cholelith formation. Cholelithiasis seems to be a rising problem in adult bearded dragons and is likely underdiagnosed, as many choleliths were found at necropsy. This rise in cholelithiasis may correlate with an unnatural high-protein, high-fat insect-based diet instead of a balanced plant-based diet. Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell
Role of allatostatin-like factors from the brain of Tenebrio molitor females
Czech Academy of Sciences Publication Activity Database
Wasielewski, O.; Skonieczna, M.; Kodrík, Dalibor
2009-01-01
Roč. 71, č. 4 (2009), s. 223-235 ISSN 0739-4462 Grant - others:State Committee for Scientific Research(PL) 3P04C03724; State Committee for Scientific Research(PL) 2P04C04928 Institutional research plan: CEZ:AV0Z50070508 Keywords : allatostatin * gonadotropic cycle * neural tissues Subject RIV: ED - Physiology Impact factor: 1.381, year: 2009
Extreme morphologies of mantis shrimp larvae
Directory of Open Access Journals (Sweden)
Carolin Haug
Full Text Available ABSTRACT Larvae of stomatopods (mantis shrimps are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages, alima and erichthus (the latter two representing later larval stages. These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoological Museum, University of Copenhagen and were collected during the Danish Dana Expedition round the world 1928-30. These new larval types all represent erichthus-type larvae, especially differing in their shield morphologies. The shield morphology ranges from almost spherical to rather disc-like, with sometimes extremely elongated spines, but only a general systematic assignment of the larvae was possible. Further investigations of these larvae are crucial to understand their life habits and ecological impact, especially as stomatopod and other crustacean larvae might have a much more important position in the marine ecosystems than their corresponding adults.
Self mixing of fly larvae during feeding
Shishkov, Olga; Johnson, Christopher; Hu, David
How do we sustainably feed a growing world population? One solution of increasing interest is the use of black solider fly larvae, pea-sized grubs envisioned to transform hundreds of tons of food waste into a sustainable protein source. Although startups across the world are raising these larvae, a physical understanding of how they should be raised and fed remains missing. In this study, we present experiments measuring their feeding rate as a function of number of larvae. We show that larger groups of larvae have greater mixing which entrains hungry larvae around the food, increasing feeding rate. Feeding of larvae thus differs from feeding of cattle or other livestock which exhibit less self-mixing.
Galli, Orlando B S; Fujimoto, Rodrigo Y; Abrunhosa, Fernando A
2012-08-01
Sodium metabisulphite (SMB) is used in marine shrimp aquaculture to prevent the occurrence of black spot. The release SMB into the estuarine environment from shrimp farm pond effluents has been reported. This study evaluated the susceptibility of larvae and post-larvae of land crab, Cardisoma guanhumi to this salt. A decrease in dissolved oxygen and pH occurred with increasing concentration of SMB and exposure time. LC(50) values after 48 h of exposure were 34 ± 1.1 mg/L, 31.1 ± 1.9 mg/L, and 30.6 ± 0.5 mg/L for I zoea larvae, megalopa larvae and stage I juveniles, respectively.
Cornman, Robert Scott; Lopez, Dawn; Evans, Jay D
2013-01-01
American foulbrood disease of honey bees is caused by the bacterium Paenibacillus larvae. Infection occurs per os in larvae and systemic infection requires a breaching of the host peritrophic matrix and midgut epithelium. Genetic variation exists for both bacterial virulence and host resistance, and a general immunity is achieved by larvae as they age, the basis of which has not been identified. To quickly identify a pool of candidate genes responsive to P. larvae infection, we sequenced transcripts from larvae inoculated with P. larvae at 12 hours post-emergence and incubated for 72 hours, and compared expression levels to a control cohort. We identified 75 genes with significantly higher expression and six genes with significantly lower expression. In addition to several antimicrobial peptides, two genes encoding peritrophic-matrix domains were also up-regulated. Extracellular matrix proteins, proteases/protease inhibitors, and members of the Osiris gene family were prevalent among differentially regulated genes. However, analysis of Drosophila homologs of differentially expressed genes revealed spatial and temporal patterns consistent with developmental asynchrony as a likely confounder of our results. We therefore used qPCR to measure the consistency of gene expression changes for a subset of differentially expressed genes. A replicate experiment sampled at both 48 and 72 hours post infection allowed further discrimination of genes likely to be involved in host response. The consistently responsive genes in our test set included a hymenopteran-specific protein tyrosine kinase, a hymenopteran specific serine endopeptidase, a cytochrome P450 (CYP9Q1), and a homolog of trynity, a zona pellucida domain protein. Of the known honey bee antimicrobial peptides, apidaecin was responsive at both time-points studied whereas hymenoptaecin was more consistent in its level of change between biological replicates and had the greatest increase in expression by RNA-seq analysis.
PERKEMBANGAN ENZIM PENCERNAAN LARVA IKAN PATIN, Pangasius hypophthalmus sp.
Directory of Open Access Journals (Sweden)
Irzal Effendi
2003-05-01
Full Text Available Development of digestive enzymes; protease, lipase and amylase were observed in patin catfish, Pangasius hypophthalmus, larvae. The 1 day old larvae (day after hatching, with 3,37-3,97 mm length and 0,62-0,79 mg weight, were reared in aquarium 60x50x40 cm with stocking density of 20 fish/l. Larvae were fed Artemia dan tubificid worms 2-8 dan 7-15 days after hatching (dAH, respectively (schedule I; 2-6 and 5-15 dAH (schedule II; and 2-4 and 5-15 dAH (schedule III. Chlorella was ready to eat by larvae at the entirely rearing. For enzyme assay, larvae were sampled from each aquarium at stages of 1, 2, 3, 5, 7, 10 and 15 dAH. Protease and lipase activity were detected in digestive tract of 1 dAH larvae. Digestive enzymes development have a similar pattern in larvae for all feeding schedules. Protease activity decreased with the increasing of age until 3 dAH, then increased until the larvae reached 7 dAH, and sharply decreased until 10 dAH and then slowly decreased thereafter. Lipase activity tended to increase slowly with age up to 3 dAH, and increased sharply until 5 dAH, and then decreased sharply until 7 dAH before decreased again up to the end of rearing. Amylase activity in larvae increased slowly with the increasing of age up to 5 dAH, then increased sharply until 7 dAH, and decreased thereafter. In dimly lighted larvae, amylase activity decreased before increased up to 12 d AH, then decreased thereafter. The amount of food organisms in larval gut, body weight and length, and survival rate of larvae were also measured and discussed.Key Words: Digestive enzymes, development, larvae, patin catfish, Pangasius hypophthalmus ABSTRAKPenelitian ini bertujuan untuk mengetahui perkembangan enzim protease, lipase dan amilase saluran pencernaan larva ikan patin akibat perubahan skedul pemberian pakan. Larva ikan patin (panjang 3,77–3,97 mm dan bobot 0,62-0,79 mg berumur 1 hari dipelihara di akuarium 60x
Directory of Open Access Journals (Sweden)
Susana Trivinho-Strixino
2012-09-01
Full Text Available First record of larvae of Chironomidae (Insecta, Diptera as prey of Temnocephala sp. (Platyhelminthes, Temnocephalidae, an ectosymbiont on larvae of Corydalidae (Megaloptera. This study constitutes the first record of Temnocephala Blanchard, an ectosymbiont on Corydalidae, as a possible predator of chironomid larvae. Twenty-eight Corydalidae larvae (Corydalus and Protochauliodes were examined under stereomicroscopic in search for Temnocephala and Chironomidae larvae, of which five megalopteran larvae had 24 Temnocephala sp. associated. Furthermore, eight of these Temnocephala worms had chironomid larvae in their gut contents, an interaction previously unknown. Gut content analyses revealed Corynoneura as the commonest chironomid, but larvae of Larsia, Rheotanytarsus and Tanytarsus were recorded as well. This study included Corydalus and Protochauliodes as hosts for Temnocephala, which might be important for this worm dispersion and population dynamics.
Long-wavelength photosensitivity in coral planula larvae.
Mason, Benjamin M; Cohen, Jonathan H
2012-04-01
Light influences the swimming behavior and settlement of the planktonic planula larvae of coral, but little is known regarding the photosensory biology of coral at this or any life-history stage. Here we used changes in the electrical activity of coral planula tissue upon light flashes to investigate the photosensitivity of the larvae. Recordings were made from five species: two whose larvae are brooded and contain algal symbionts (Porites astreoides and Agaricia agaricites), and three whose larvae are spawned and lack algal symbionts (Acropora cervicornis, Acropora palmata,and Montastrea faveolata). Photosensitivity originated from the coral larva rather than from, or in addition to, its algal symbionts as species with and without symbionts displayed similar tissue-level electrical responses to light. All species exhibited as much (or more) sensitivity to red stimuli as to blue/green stimuli, which is consistent with a role for long-wavelength visible light in the preference for substrata observed during settlement and in facilitating vertical positioning of larvae in the water column.
Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir
2015-09-01
Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.
Comparative Proteomic Analysis of Hymenolepis diminuta Cysticercoid and Adult Stages
Directory of Open Access Journals (Sweden)
Anna Sulima
2018-01-01
Full Text Available Cestodiases are common parasitic diseases of animals and humans. As cestodes have complex lifecycles, hexacanth larvae, metacestodes (including cysticercoids, and adults produce proteins allowing them to establish invasion and to survive in the hostile environment of the host. Hymenolepis diminuta is the most commonly used model cestode in experimental parasitology. The aims of the present study were to perform a comparative proteomic analysis of two consecutive developmental stages of H. diminuta (cysticercoid and adult and to distinguish proteins which might be characteristic for each of the stages from those shared by both stages. Somatic proteins of H. diminuta were isolated from 6-week-old cysticercoids and adult tapeworms. Cysticercoids were obtained from experimentally infected beetles, Tenebrio molitor, whereas adult worms were collected from experimentally infected rats. Proteins were separated by GeLC-MS/MS (one dimensional gel electrophoresis coupled with liquid chromatography and tandem mass spectrometry. Additionally protein samples were digested in-liquid and identified by LC-MS/MS. The identified proteins were classified according to molecular function, cellular components and biological processes. Our study showed a number of differences and similarities in the protein profiles of cysticercoids and adults; 233 cysticercoid and 182 adult proteins were identified. From these proteins, 131 were present only in the cysticercoid and 80 only in the adult stage samples. Both developmental stages shared 102 proteins; among which six represented immunomodulators and one is a potential drug target. In-liquid digestion and LC-MS/MS complemented and confirmed some of the GeLC-MS/MS identifications. Possible roles and functions of proteins identified with both proteomic approaches are discussed.
Directory of Open Access Journals (Sweden)
J.M. Costa
1993-01-01
Full Text Available The last instar larva of Erythemis mithroides (Brauer, 1900 is described and figured based on exuviae of reared specimens. A comparative analysis of this immature stage and the known larvae of the genus are furnished according to the data available in the literature and of specimens of E credula (Hagen, 1861 and E. vesiculosa (Fab., 1775 permiting a diagnose for the larvae of the genus Erylhemis Hagen, 1861.
Fate of pharmaceuticals and pesticides in fly larvae composting
Energy Technology Data Exchange (ETDEWEB)
Lalander, C., E-mail: cecilia.lalander@slu.se [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Senecal, J.; Gros Calvo, M. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden); Ahrens, L.; Josefsson, S.; Wiberg, K. [Department of Aquatic Sciences and Assessment, Swedish University of Agricultural Sciences (Sweden); Vinnerås, B. [Department of Energy and Technology, Swedish University of Agricultural Sciences (Sweden)
2016-09-15
A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.
Fate of pharmaceuticals and pesticides in fly larvae composting
International Nuclear Information System (INIS)
Lalander, C.; Senecal, J.; Gros Calvo, M.; Ahrens, L.; Josefsson, S.; Wiberg, K.; Vinnerås, B.
2016-01-01
A novel and efficient organic waste management strategy currently gaining great attention is fly larvae composting. High resource recovery efficiency can be achieved in this closed-looped system, but pharmaceuticals and pesticides in waste could potentially accumulate in every loop of the treatment system and spread to the environment. This study evaluated the fate of three pharmaceuticals (carbamazepine, roxithromycin, trimethoprim) and two pesticides (azoxystrobin, propiconazole) in a fly larvae composting system and in a control treatment with no larvae. It was found that the half-life of all five substances was shorter in the fly larvae compost (< 10% of control) and no bioaccumulation was detected in the larvae. Fly larvae composting could thus impede the spread of pharmaceuticals and pesticides into the environment. - Highlights: • Degradation of pharmaceuticals and pesticides in fly larvae composting (FLC). • Half-life considerably shorter in FLC than in control with no larvae. • Half-life of carbamazepine was less than two days in FLC. • No bioaccumulation in larvae detected. • FLC could impede the spreading of pharmaceuticals and pesticide in the environment.
Weinburgh, Molly
2007-12-01
This study explores the extent to which an activity used in an elementary science methods course affected the preservice teachers’ content knowledge, attitudes, and self-efficacy. The participants were 172 students enrolled in five sections of elementary science methods. Students participated in a 9-week investigation on life cycles using mealworms ( Tenebrio obscurus). Multiple data sources indicate that most of the students had limited prior content knowledge about mealworms, expressed neutral attitudes toward mealworms upon first exposure to them, and were uncomfortable with the idea of having to teach with and about them. At the end of 9 weeks, content knowledge on mealworms had greatly improved. The preservice teachers’ attitudes about mealworms and their self-efficacy about using mealworms with children had also improved.
Image-based automatic recognition of larvae
Sang, Ru; Yu, Guiying; Fan, Weijun; Guo, Tiantai
2010-08-01
As the main objects, imagoes have been researched in quarantine pest recognition in these days. However, pests in their larval stage are latent, and the larvae spread abroad much easily with the circulation of agricultural and forest products. It is presented in this paper that, as the new research objects, larvae are recognized by means of machine vision, image processing and pattern recognition. More visional information is reserved and the recognition rate is improved as color image segmentation is applied to images of larvae. Along with the characteristics of affine invariance, perspective invariance and brightness invariance, scale invariant feature transform (SIFT) is adopted for the feature extraction. The neural network algorithm is utilized for pattern recognition, and the automatic identification of larvae images is successfully achieved with satisfactory results.
Extracardiac versus cardiac haemocoelic pulsations in pupae of the mealworm (Tenebrio molitor L.)
Czech Academy of Sciences Publication Activity Database
Sláma, Karel
2000-01-01
Roč. 46, - (2000), s. 977-992 ISSN 0022-1910 Institutional research plan: CEZ:AV0Z5007907 Keywords : haemolymph pressure * electrocardiography * pressure transducers Subject RIV: ED - Physiology Impact factor: 1.468, year: 2000
Optimization of Replacing Pork Meat with Yellow Worm (Tenebrio molitor L.) for Frankfurters
Paik, Hyun-Dong
2017-01-01
The effects of replacing pork meat with yellow mealworms on the physicochemical properties and sensory characteristics of frankfurters were investigated in this study. The control (50% pork ham), T1 (45% pork ham + 5% yellow mealworm), T2 (40% pork ham + 10% yellow mealworm), T3 (35% pork ham + 15% yellow mealworm), T4 (30% pork ham + 20% yellow mealworm), T5 (25% pork ham + 25% yellow mealworm), and T6 (20% pork ham + 30% yellow mealworm) were prepared, replacing lean pork meat with yellow mealworm. The moisture content, lightness, sarcoplasmic protein solubility, hardness, gumminess, chewiness, and apparent viscosity of frankfurters with yellow mealworm were lower than those of the control (pmealworm were higher than those of the control (pmealworm concentrations (pmealworm concentrations had lower color, flavor, off-flavor, and juiciness scores. The overall acceptability was not significantly different in the control, T1, and T2 (p>0.05). Thus, the results of this study showed that replacing lean pork meat with up to 10% yellow mealworm successfully maintained the quality of frankfurters at a level similar to that of the regular control frankfurters. PMID:29147084
Feeding behavior of giant gourami, Osphronemus gouramy (Lacepede larvae
Directory of Open Access Journals (Sweden)
Thumronk Amornsakun
2014-06-01
Full Text Available Feeding experiments were carried out in 15-liter glass aquaria with 10 liters of water containing 1000 larvae aged 1.5 days post-hatching (before mouth opening in three replicates. It was found that the feeding scheme of larval giant gourami aged 5-17 days (TL 8.36-13.40 mm consumed Moina. The larvae aged 14-17 days (TL 12.40-13.40 mm consumed both Moina and artificial pellet. Larvae aged more than 18-days (TL 13.60 mm consumed only artificial pellet. Daily food uptake by the larvae and juvenile were determined in a 15-liter aquaria (water volume 10 liters containing 500 larvae. The larvae were fed with Moina at density of 10 ind/ml. Aquaria without larvae were also set for a control of natural fluctuation in food density. The amount of food intake was calculated based on changes of food density in the aquarium with and without fish larvae. It was found the average uptake of Moina in digestive tract per day of larvae aged 5, 8, 11, 14 and 17 days old were 38, 52, 182, 205 and 266 individual/larva, respectively at density of 1.27, 1.73, 6.07, 6.83, and 8.87 individual/ml, respectively.
Directory of Open Access Journals (Sweden)
Isaias Oliveira
2005-03-01
Full Text Available The objective of this work was to determine the fecundity of the predator Brontocoris tabidus (Signoret (Heteroptera: Pentatomidae females of two weight classes aiming to define, which one presented higher productivity in the laboratory. Males and females of B. tabidus were reared from nymphs fed with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae in laboratory. Females of B. tabidus weighting 95 to 150 mg and those with 160 to 220 mg constituted two treatments. Oviposition period and numbers of egg masses, eggs and nymphs per female of B. tabidus were higher in the treatment with heavier females, while the periods of preoviposition, between egg mass laying, egg incubation and number of eggs per egg mass, besides the percentage of nymphs hatched and adult longevity were similar between treatments. Heavier females of B. tabidus presented better productivity and for this reason they should be used in programs of mass rearing this predator.Este trabalho apresenta a fecundidade de fêmeas do predador Brontocoris tabidus (Signoret (Heteroptera: Pentatomidae de duas classes de peso, objetivando avaliar qual delas apresenta melhor produtividade em criações mantidas em laboratório. Machos e fêmeas foram alimentadas, desde o estádio ninfal, com pupas do besouro Tenebrio molitor L. (Coleoptera: Tenebrionidae. Fêmeas de B. tabidus pesando entre 95 e 150 mg e entre 160 e 220 mg constituíram as duas classes de peso. O período de oviposição e os números de posturas, de ovos e ninfas por fêmea de B. tabidus foram maiores naquelas fêmeas pertencentes à classe mais pesada, enquanto os períodos de pré-oviposição, entre posturas, incubação dos ovos e número de ovos por postura, bem como a percentagem de eclosão de ninfas e a longevidade dos adultos foram semelhantes entre ambas as classes de peso. Fêmeas mais pesadas de B. tabidus apresentaram maior número de ovos por fêmea e por esta razão devem ser utilizadas em programas de cria
The Identification of Congeners and Aliens by Drosophila Larvae.
Directory of Open Access Journals (Sweden)
Francisco Del Pino
Full Text Available We investigated the role of Drosophila larva olfactory system in identification of congeners and aliens. We discuss the importance of these activities in larva navigation across substrates, and the implications for allocation of space and food among species of similar ecologies. Wild type larvae of cosmopolitan D. melanogaster and endemic D. pavani, which cohabit the same breeding sites, used species-specific volatiles to identify conspecifics and aliens moving toward larvae of their species. D. gaucha larvae, a sibling species of D. pavani that is ecologically isolated from D. melanogaster, did not respond to melanogaster odor cues. Similar to D. pavani larvae, the navigation of pavani female x gaucha male hybrids was influenced by conspecific and alien odors, whereas gaucha female x pavani male hybrid larvae exhibited behavior similar to the D. gaucha parent. The two sibling species exhibited substantial evolutionary divergence in processing the odor inputs necessary to identify conspecifics. Orco (Or83b mutant larvae of D. melanogaster, which exhibit a loss of sense of smell, did not distinguish conspecific from alien larvae, instead moving across the substrate. Syn97CS and rut larvae of D. melanogaster, which are unable to learn but can smell, moved across the substrate as well. The Orco (Or83b, Syn97CS and rut loci are necessary to orient navigation by D. melanogaster larvae. Individuals of the Trana strain of D. melanogaster did not respond to conspecific and alien larval volatiles and therefore navigated randomly across the substrate. By contrast, larvae of the Til-Til strain used larval volatiles to orient their movement. Natural populations of D. melanogaster may exhibit differences in identification of conspecific and alien larvae. Larval locomotion was not affected by the volatiles.
Larva migrans visceral: relato de caso
Machado Alexandre Bortoli; El Achkar Marice Emanuela
2003-01-01
Larva migrans visceral é doença infecciosa, adquirida por ingestão de ovos provenientes dos vermes Toxocara canis e/ou Toxocara cati que infestam cães e gatos; as larvas penetram a parede intestinal e migram através dos tecidos levando a alterações diversas, conseqüentes a uma resposta inflamatória imune.¹ Os autores descrevem um caso clínico de larva migrans visceral com apresentação clínica atípica.
Efektivitas Bacillus thuringiensis dalam Pengendalian Larva Nyamuk Anopheles sp.
Directory of Open Access Journals (Sweden)
Citra Inneke Wibowo
2017-08-01
Full Text Available Nyamuk Anopheles sp adalah vektor penyakit malaria. Pengendalian vektor penyakit malaria dapat dilakukan secara biologis yaitu dengan menggunakan Bacillus thuringiensis. Tujuan penelitian adalah untuk mengetahui efektivitas konsentrasi Bacillus thuringiensis dalam pengendalian larva nyamuk Anopheles sp.Penelitian ini dilakukan secara eksperimental menggunakan Rancangan Acak Lengkap Faktorial (RAL Faktorial yang terdiri atas dua faktor yaitu konsentrasi Bacillus thuringiensis dan stadia larva Anopheles dengan pengulangan tiga kali.Perlakuan yang dicobakan adalahkonsentrasi Bacillus thuringiensis (A yang terdiri atas 5 taraf:A0: konsentrasi B.thuringiensis 0 CFU.mL-1, A1: konsentrasi B.thuringiensis 102 CFU.mL-1, A2: konsentrasi B.thuringiensis 104 CFU.mL-1, A3: konsentrasi B.thuringiensis 106CFU.mL-1, A4: konsentrasi B.thuringiensis 108CFU.mL-1. Perlakuan tahapan instar larva Anopheles sp. (B adalah sebagai berikut:B1: stadia larva instar I, B2: stadia larva instar II, B3: stadia larva instar III, B4: stadia larva instar IVsehingga terdapat 60 satuan percobaan. Hasil penelitian menunjukkan konsentrasi B. thuringiensis isolat CK dan IPB CC yang paling berpengaruh dalam pengendalian larva Anopheles sp adalah 108 CFU.mL-1 . Instar larva yang paling peka terhadap B. thuringiensis isolat IPB CC adalah instar I dan II sedangkan instar yang peka terhadap isolat CK adalah instar II, Perlakuan konsentrasi isolat B. thuringiensis dan tingkat instar larva yang paling baik dalam pengendalian larva Anopheles sp. adalah 108 CFU.mL-1, dan instar I dan II.
Hadfield, Michael G.
2011-01-01
Communities of microorganisms form thin coats across solid surfaces in the sea. Larvae of many marine invertebrates use biofilm components as cues to appropriate settlement sites. Research on the tube-dwelling polychaete worm Hydroides elegans, a globally common member of biofouling communities, is described to exemplify approaches to understanding biofilm bacteria as a source of settlement cues and larvae as bearers of receptors for bacterial cues. The association of species of the bacterial genus Pseudoalteromonas with larval settlement in many phyla is described, and the question of whether cues are soluble or surface-bound is reviewed, concluding that most evidence points to surface-bound cues. Seemingly contradictory data for stimulation of barnacle settlement are discussed; possibly both explanations are true. Paleontological evidence reveals a relationship between metazoans and biofilms very early in metazoan evolution, and thus the receptors for bacterial cues of invertebrate larvae are very old and possibly unique. Finally, despite more than 60 years of intense investigation, we still know very little about either the bacterial ligands that stimulate larval settlement or the cellular basis of their detection by larvae.
Safranyos, Richard G. A.; Caveney, Stanley; Miller, James G.; Petersen, Nils O.
1987-04-01
Intercellular (tissue) diffusion of molecules requires cytoplasmic diffusion and diffusion through gap junctional (or cell-to-cell) channels. The rates of tissue and cytoplasmic diffusion of fluorescent tracers, expressed as an effective diffusion coefficient, De, and a cytoplasmic diffusion coefficient, Dcyt, have been measured among the developing epidermal cells of a larval beetle, Tenebrio molitor L., to determine the contribution of the junctional channels to intercellular diffusion. Tracer diffusion was measured by injecting fluorescent tracers into cells and quantitating the rate of subsequent spread into adjacent cells. Cytoplasmic diffusion was determined by fluorescence photobleaching. These experiments show that gap junctional channels constitute approximately 70-80% of the total cell-to-cell resistance to the diffusion of organic tracers at high concentrations in this tissue. At low concentrations, however, the binding of tracer to cytoplasm slows down the cytoplasmic diffusion, which may limit intercellular diffusion.
Survival of mayfly larvae under mine acid conditions
Energy Technology Data Exchange (ETDEWEB)
Napier, S. Jr.; Hummon, W.D.
1976-01-01
Mayfly larvae were abundant and diverse in riffle zones of three control streams in southeastern Ohio. But none were found in such zones of three streams having current or past histories of mine acid pollution, despite vegetative recovery of reclaimed land bordering two of the streams. Laboratory studies showed stepwise increases in non-predatory mortality of mayfly larvae with increased mine acidity. Dragonfly larvae predation on mayfly larvae was constant at pH 8.1 to 4.1, but decreased at pH 3.1 despite tolerance of dragonfly larvae to low pH conditions. Extensive acid mine pollution thus may threaten aquatic biota through removal of food sources or reduced feeding rates as well as through direct mortality.
Freshly squeezed: anaphylaxis caused by drone larvae juice.
Stoevesandt, J; Trautmann, A
2017-11-30
Drone larvae are mostly considered a by-product of beekeeping, but have recently been advo-cated as a high-protein source of food. There are as yet no data concerning their allergenic po-tential. We report on a 29-year old bee keeper who experienced an anaphylactic reaction following the consumption of a freshly prepared beverage from raw drone larvae. Larvae-specific sensitization was confirmed by prick-to-prick and basophil activation testing. Bee stings and classical bee products including honey and royal jelly were tolerated. This is the hitherto first report on IgE-mediated allergy to drone larvae. We suggest that a certain awareness towards the allergenicity of bee larvae is required.
[Biotechnological aspects in "loco" larvae].
Inestrosa, N C; Labarca, R; Perelman, A; Campos, E O; Araneda, R; González, M; Brandan, E; Sánchez, J P; González-Plaza, R
1990-10-01
The biology of planktotrophic larvae of Concholepas concholepas is the main bottleneck towards developing biotechnologies to rear this muricid. Data concerning planktonic larvae development, diets and environmental signals triggering larval settlement and recruitment is scarce. We have begun the study of the molecular and cell biology of embryos, larvae and recruits having as a final goal, the development of appropriate biotechnologies to rear this gastropod. First, an inverse ratio between BuChE and AChE enzyme activities was established. This ratio may be a precise developmental marker for this species. Second, for the first time a phosphoinositide related regulatory pathway is reported in a muricid, opening a new approach to the biotechnological management of larvae. Third, the relation between sulfate in sea water and larval motility was studied. Concentrations below 125 microM sulfate decreases larval motility. The sulfate is incorporated in proteoglycans which participate in different developmental phenomena. Lastly, a genomic Concholepas concholepas DNA sequence, similar to that of a human growth hormone probe was detected. This is very interesting since growth factors are key molecules during development, growth and are involved in food conversion rates in fish and also, in a variety of marine invertebrates.
SEBARAN LARVA IKAN DAN KAITANNYA DENGAN KONDISI OSEANOGRAFI LAUT SULAWESI
Directory of Open Access Journals (Sweden)
Khairul Amri
2015-06-01
Full Text Available Laut Sulawesi diketahui sebagai daerah penangkapan ikan yang potensial sekaligus diduga sebagai lokasi pemijahan. Berbagai jenis larva ikan pelagis maupun demersal ditemukan di perairan ini. Kelimpahan dan sebaran larva ikan di suatu perairan sangat dipengaruhi oleh kondisi oseanografi seperti temperatur, salinitas dan sejumlah parameter lainnya termasuk ketersediaan pakan. Untuk mengetahui pengaruh parameter oseanografi terhadap kelimpahan dan sebaran spasial larva ikan di Laut Sulawesi, telah dilakukan penelitian menggunakan kapal riset KR Baruna Jaya VII pada Oktober 2012. Parameter oseanografi yaitu temperatur dan salinitas diukur menggunakan iCTD dan sampling larva menggunakan bonggo net pada 18 stasiun pengukuran. Analisa hubungan kondisi oseanografi dengan sebaran larva dilakukan secara deskriptif dan pemetaan sebarannya dilakukan secara spasial. Hasil menunjukan keterkaitan sejumlah parameter oseanografi dengan kelimpahan dan sebaran spasial larva ikan. Sebaran larva famili Scombroidae dominan berada pada perairan bersalinitas tinggi karena merupakan jenis ikan oseanik. Larva ikan demersal banyak ditemukan di perairan sekitar Kep.Sangihe Talaud. Kelimpahan larva tertinggi ditemukan di perairan bagian utara dan barat lokasi penelitian dimana kelimpahan plankton tinggi ditemukan. Celebes Sea is known as a potential fishing and spawning grounds for several pelagic fish species. Abundance and distribution of fish larvae are allegedly linked to oceanographic conditions such as temperature, salinity and others oceanographic parameters including food availablity. To see the effect of oceanographic on the abundance and spatial distribution of fish larvae in the Celebes Sea, has conducted a research in October 2012using the research vessel KR Baruna Jaya VII. The measurement of oceanographic parameters including temperature and salinity and larval sampling were done respectively by using iCTD and Bonggo net at 18 measuring stations. The
Tools for automating the imaging of zebrafish larvae.
Pulak, Rock
2016-03-01
The VAST BioImager system is a set of tools developed for zebrafish researchers who require the collection of images from a large number of 2-7 dpf zebrafish larvae. The VAST BioImager automates larval handling, positioning and orientation tasks. Color images at about 10 μm resolution are collected from the on-board camera of the system. If images of greater resolution and detail are required, this system is mounted on an upright microscope, such as a confocal or fluorescence microscope, to utilize their capabilities. The system loads a larvae, positions it in view of the camera, determines orientation using pattern recognition analysis, and then more precisely positions to user-defined orientation for optimal imaging of any desired tissue or organ system. Multiple images of the same larva can be collected. The specific part of each larva and the desired orientation and position is identified by the researcher and an experiment defining the settings and a series of steps can be saved and repeated for imaging of subsequent larvae. The system captures images, then ejects and loads another larva from either a bulk reservoir, a well of a 96 well plate using the LP Sampler, or individually targeted larvae from a Petri dish or other container using the VAST Pipettor. Alternative manual protocols for handling larvae for image collection are tedious and time consuming. The VAST BioImager automates these steps to allow for greater throughput of assays and screens requiring high-content image collection of zebrafish larvae such as might be used in drug discovery and toxicology studies. Copyright © 2015 The Author. Published by Elsevier Inc. All rights reserved.
Eischen, Frank A; Graham, R Henry; Cox, Robert
2005-08-01
We examined honey bee, Apis mellifera L., colonies pollinating almonds in California during February 2003 for Paenibacillus larvae subsp. Larvae, the causative organism of the virulent brood disease American foulbrood. Colonies originating from the Rocky Mountain area and California had significantly higher numbers (P bees, respectively) than colonies from the upper Midwest (1.28). Colonies from the northwestern, central, and southwestern United States had intermediate CFU or bacterial colony levels. Operations positive for P. larvae larvae were relatively uniform at approximately 70-80%, and no regional significant differences were found. Percentages of colonies with high CFUs (> or = 400 per 30 bees) differed significantly, with those from the Rocky Mountain region having 8.73% compared with those of the upper Midwest with 0%. The significance of CFU levels was evaluated by inoculating healthy colonies with diseased immatures and sampling adult bees. The number of CFUs detected per diseased immature was conservatively estimated to be approximately 399 CFUs per 30 adult bees. We defined this spore level as 1 disease equivalent. Based on this, 3.86% colonies in our survey had 1 or more disease equivalent number of P. larvae larvae CFUs. Operations with high P. larvae larvae spore levels in their colonies will likely observe American foulbrood if prophylaxis is not practiced diligently.
Directory of Open Access Journals (Sweden)
Claubert W.G de Menezes
2014-09-01
Full Text Available The diversity of plants in agricultural systems benefits natural enemies. Herbicides are used in weed management in corn (Zea mays L. to reduce competition and productivity losses, but they can impact natural enemies and contaminate the environment. The objective was to evaluate toxicity of herbicides on pupae parasitoid Palmistichus elaeisis Delvare and LaSalle, 1993 (Hymenoptera: Eulophidae. The treatments were represented by the host pupae Tenebrio molitor L., 1785 (Coleoptera: Tenebrionidae and herbicides atrazine, nicosulfuron, paraquat, and tembotrione in commercial doses compared to a control treatment with water. Pupae of T. molitor were immersed in the solution of herbicides and exposed to parasitism by six females of P. elaeisis each. The herbicides atrazine and paraquat were highly toxic and, therefore, not selective to P. elaeisis. Nicosulfuron reduced the sex ratio of P. elaeisis (0.20 ± 0.03, which may affect subsequent generations. Moreover, the herbicide tembotrione was selective to P. elaeisis, showing results comparable to the control. Floristic diversity of weeds can increase food source, habitat, shelter, breeding places and microclimates for insect parasitoids but herbicides formulations can be toxic and these products can affect P. elaeisis or its hosts by direct or indirect contact, showing the importance of selectivity studies for this natural enemy. However, the herbicide tembotrione was selective to P. elaeisis and it can be recommended for programs of sustainable management of weeds in corn crop with this parasitoid.
Effect of gamma rays on the larvae of Rhipicephalus bursa
International Nuclear Information System (INIS)
Gecheva, G.
1979-01-01
Rhipicephalus bursa larvae were exposed to a single acute gamma-irradiation from cobalt 60 source in doses from 0.5 to 40 kiloroentgen (kr). Doses higher than 20 kr rilled the larvae, lower than 10 kr produced disturbances in tick development, dependent on radiation; larvae irradiated with 2 to 3 kr started sucking blood as larvae ordinarily do, but could not undergo metamorphosis; larvae irradiated with lower doses (0.5 and 1 kr) had a prolonged metamorphosis, the onset of oviposition was delayed and the percentage of hatched second generation larvae was reduced. (A.B.)
A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.
Directory of Open Access Journals (Sweden)
Wendy Kloezen
Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.
Coral larvae move toward reef sounds
Vermeij, M.J.A.; Marhaver, K.L.; Huijbers, C.M.; Nagelkerken, I.; Simpson, S.D.
2010-01-01
Free-swimming larvae of tropical corals go through a critical life-phase when they return from the open ocean to select a suitable settlement substrate. During the planktonic phase of their life cycle, the behaviours of small coral larvae (<1 mm) that influence settlement success are difficult to
Peréz de la Rosa, D; Pérez de la Rosa, J J; Cossio-Bayugar, R; Miranda-Miranda, E; Lozano, L; Bravo-Díaz, M A; Rocha-Martínez, M K; Sachman-Ruiz, B
2015-08-27
Paenibacillus larvae strain MEX14 is a facultative anaerobic endospore-forming bacterium that infects Apis mellifera larvae. Strain MEX14 was isolated from domestic bee larvae collected in a backyard in Mexico City. The estimated genome size was determined to be 4.18 Mb, and it harbors 4,806 protein coding genes (CDSs). Copyright © 2015 Peréz de la Rosa et al.
Sun-Compass Orientation in Mediterranean Fish Larvae.
Faillettaz, Robin; Blandin, Agathe; Paris, Claire B; Koubbi, Philippe; Irisson, Jean-Olivier
2015-01-01
Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally.
Sun-Compass Orientation in Mediterranean Fish Larvae.
Directory of Open Access Journals (Sweden)
Robin Faillettaz
Full Text Available Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history, larvae of coastal species have to head back to the shore at the end of their pelagic episode, to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence of coast-related cues on orientation. In this study we quantified the in situ orientation behavior of settlement-stage larvae in a temperate region, with a continuous coast and a dominant along-shore current, and inspected both coast-dependent and independent cues. We tested six species: one Pomacentridae, Chromis chromis, and five Sparidae, Boops boops, Diplodus annularis, Oblada melanura, Spicara smaris and Spondyliosoma cantharus. Over 85% of larvae were highly capable of keeping a bearing, which is comparable to the orientation abilities of tropical species. Sun-related cues influenced the precision of bearing-keeping at individual level. Three species, out of the four tested in sufficient numbers, oriented significantly relative to the sun position. These are the first in situ observations demonstrating the use of a sun compass for orientation by wild-caught settlement-stage larvae. This mechanism has potential for large-scale orientation of fish larvae globally.
PERKEMBANGAN AWAL LARVA KERAPU KERTANG (Epinephelus lanceolatus
Directory of Open Access Journals (Sweden)
Philip Teguh Imanto
2016-11-01
Full Text Available Observasi pada larva kerapu kertang (E. lanceolatus dilaksanakan di Balai Besar Riset Perikanan Budidaya Laut (BBRPBL, Gondol-Bali, untuk mengumpulkan informasi dasar tentang perkembangan awal morfologi larva yang penting untuk menunjang keberhasilan pembenihannya. Larva berasal dari telur hasil pemijahan yang dirangsang dengan hormon (di Taiwan dan ditransportasikan segera setelah menetas (D-0 melalui transportasi udara ke laboratotium pembenihan BBRPBL, Gondol. Pengamatan dilakukan dengan memanfaatkan fasilitas tangki 500 L dengan sistem air resirkulasi. Dari data yang dihimpun diketahui bahwa rata-rata panjang total larva (D-1 2,48 mm; D-8 3,17 mm; dan tumbuh dengan cepat mencapai 10,79 mm pada D-19. Kuning telur larva yang berumur sehari (D-1 rata-rata bervolume 150,3 x 10-4 mm3 dan pada hari ketiga terserap 42,61% dan habis pada hari keempat (D-4. Butir minyak larva D-1 sebesar 41,9 x 10-4 mm3 dan masih tersisa sebesar 0,34 x 10-4 mm3 sampai dengan D-6. Mulut larva diperhitungkan sudah mencapai lebar sebesar 200 μm pada D-2. dan mampu untuk memangsa rotifer sejalan dengan pigmentasi mata yang mulai terjadi pada D-2 dan sempurna pada D-3. Dari analisis pertumbuhan terjadi titik belok (flexion point pada D-8 dan setelah itu terjadi kurva pertumbuhan yang cepat y= 0,6747x-2,5508. Berdasarkan hasil observasi tersebut maka pemberian pakan awal untuk larva kerapu kertang sudah bisa diberikan pada D-2 akhir (sore, pada D-8 komposisi pakan alami sudah harus diubah dengan memberikan pakan yang lebih besar dan bernutrisi tinggi. Observation on early development of E. lanceolatus larvae have been conducted in laboratory condition at Gondol Research Institute for Mariculture (GRIM Bali; the purpose was to gain basic data mainly on the larval development stage to support both larval rearing and aquaculture technique of this species. The larvae from egg were produced by induced spawning technique and transported on D-0 to GRIM. Observation have been
Radiosensitivity of spores of Paenibacillus larvae ssp. larvae in honey
Energy Technology Data Exchange (ETDEWEB)
Almeida, Wanderley Mendes de [Ministerio da Agricultura, Pecuaria e Abastecimento, Rio de Janeiro, RJ (Brazil). Servico de Inspecao de Produtos de Origem Animal]. E-mail: sipa-rj@agricultura.gov.br; Vital, Helio de Carvalho [Centro Tecnologico do Exercito CTEx, Rio de Janeiro, RJ (Brazil). Div. de Defesa Quimica, Biologica e Nuclear]. E-mail: vital@ctex.eb.br; Schuch, Dulce Maria Tocchetto [Ministerio da Agricultura, Pecuaria e Abastecimento, Porto Alegre, RS (Brazil)]. E-mail: micro-lara-rs@agricultura.gov.br
2007-07-01
Irradiation, usually used in combination with other conventional methods of conservation, has been proven to be an efficient tool to ensure the safety of many types of foods by destroying pathogenic microorganisms and extending their shelf-lives. This work has investigated the efficacy of gamma irradiation to inactivate spores of the bacterium Paenibacillus larvae that causes the 'American foulbrood', a highly contagious disease still exotic in Brazil that kills bees and contaminates honey, preventing its commercialization and causing great economical losses. In this study, 60 g samples of two types of honey inoculated with 3.5x10{sup 3} spores/mL of that bacterium were irradiated with doses of 0, 5, 7.5, 10, 12.5 and 15 kGy and counted. The analyses indicated a mean reduction of 97.5{+-}0.7% in the number of viable spores exposed to 5 kGy. The application of doses of 7.5 kGy or higher yielded no viable spores above the detection threshold (10/mL). In addition the value of D{sub 10} (3.1{+-}0.3 kGy) was estimated and the logarithm of the population of viable spores of Paenibacillus larvae subsp. larvae was determined as linear and quadratic polynomial functions of the radiation dose. The results indicated that the dose of 10 kGy could be insufficient to assure complete sterilization of honey in some cases while suggesting that 25 kGy would perform such task adequately. (author)
International Nuclear Information System (INIS)
Aikens, L.M.; Schad, G.A.
1989-01-01
A technique is described for radiolabeling Strongyloides stercoralis larvae with [ 75 Se]selenomethionine. Cultures of an auxotrophic methionine-dependent stain of Escherichia coli were grown in a medium containing Dulbecco's modified Eagle's medium supplemented with 5% nutrient broth, amino acids, and [ 75 Se]selenomethionine. When the 75 Se-labeled bacterial populations were in the stationary phase of growth, cultures were harvested and the bacteria dispersed on agar plates to serve as food for S. stercoralis larvae. Use of nondividing bacteria is important for successful labeling because the isotope is not diluted by cell division and death of larvae attributable to overgrowth by bacteria is prevented. First-stage S. stercoralis larvae were recovered from feces of infected dogs and reared in humid air at 30 C on agar plates seeded with bacteria. After 7 days, infective third-stage larvae were harvested. The mean specific activity of 6 different batches of larvae ranged from 75 to 330 counts per min/larva with 91.8 +/- 9.5% of the population labeled sufficiently to produce an autoradiographic focus during a practicable, 6-wk period of exposure. Labeled infective larvae penetrated the skin of 10-day-old puppies and migrated to the small intestine, where the developed to adulthood
Directory of Open Access Journals (Sweden)
Eduardo Lopes Beerli
2004-02-01
Full Text Available Conduziu-se este trabalho com o objetivo de avaliar o efeito da utilização de dietas naturais e artificiais sobre o desempenho e comportamento de larvas de pacu (Piaractus mesopotamicus, entre o 2º e o 10º dia de vida. Foram utilizadas 30 caixas plásticas, cada uma com 30 litros de água e renovação contínua, onde as larvas foram mantidas durante o período experimental. Cada caixa recebeu 10 larvas por litro, totalizando 300 larvas/caixa. Foram testados 6 tratamentos, cada qual com 5 repetições. Os tratamentos foram: T1-ração, T2-plâncton, T3-artêmia, T4-plâncton + ração, T5-artêmia + ração e T6-artêmia + plâncton. As larvas foram alimentadas 6 vezes ao dia, nos horários de 4, 8, 12, 16, 20 e 24 horas. A temperatura da água foi mantida constante a 27ºC, o oxigênio dissolvido permaneceu na faixa de 6,16 ± 0,34 e o pH, entre 7,16 ± 0,22. Aos 2, 4, 6, 8 e 10 dias de vida, foram coletadas amostras de 30 larvas para determinação do comprimento total e peso. No final do experimento (10º dia, as larvas que receberam artêmia + plâncton (T6 alcançaram os maiores valores de comprimento total (8,35 mm e peso corporal (3518 µg, em relação a todas as outras dietas testadas. As larvas devem permanecer em laboratório por um período de 6 dias após a eclosão, recebendo alimento do terceiro ao sexto dia. A partir do sexto dia, as larvas estão com a vesícula gasosa completamente inflada e apresentam nado contínuo.The objective of this research was to evaluate the effect of natural and artificial diets on the development and behavior of pacu (Piaractus mesopotamicus larvae, between the 2nd and 10th day post hatch. The larvaes were kept in 30L - plastic boxes (n = 30 boxes, in constant flow-through. The larvae density was 10 post-larvae/L (300 larvae/box. Six diets with 4 sampling days (4, 6, 8 and 10 days post-hatch, n = 30 larvae using 5 repetitions were tested. The diets were: T1- commercial feed, T2- plancton, T3
International Nuclear Information System (INIS)
Mansour, M.
2011-06-01
Mediterranean flour moth, Ephestia kuehniella, mature 5 t h instar larvae were exposed to gamma radiation dosages ranging from 50-350 Gy at 50 Gy increment and the effects of gamma radiation on pupation, adult emergence and sex ratio were investigated. In addition, effects of irradiation on the rate of development to pupae and adults and the acceptance of irradiated larvae by B. hebetor females were examined. Results showed that the radio-sensitivity of E. kuehniella larvae increased with increasing dose. Pupation was significantly affected at 100 Gy dose, and completely prevented at 350 Gy dose. Adult emergence was only slightly different from pupation; emergence was significantly affected at 100 Gy dose and completely prevented at 300 Gy dose. Irradiation also negatively affected the rate of development of larvae to pupae and adults. While more than 98% of control larvae pupated within 10 days of treatment, this ratio decreased to about 79% in larvae exposed to 50 Gy and less than 4% in larvae exposed to 100 Gy dose. The rate of development to the adult stage was also similarly affected. While 97% of control insects emerged as adults in the 1st 20 days of treatment, this ratio decreased to about 53, 2 and zero percent in larvae exposed to 50, 100 and 150 Gy dose respectively. In addition, irradiation significantly affected male: female ratio; sex ratio was skewed in favor of males, and at 250 Gy dose all emerged moths were males. Furthermore, irradiation had no adverse effect on the degree of acceptance of mature larvae to parasitization; irradiated insects were as acceptable to B. hebetor females as unirradiated ones. (author)
International Nuclear Information System (INIS)
Mansour, M.
2012-01-01
Mediterranean flour moth, Ephestia kuehniella, mature 5 t h instar larvae were exposed to gamma radiation dosages ranging from 50-350 Gy at 50 Gy increment and the effects of gamma radiation on pupation, adult emergence and sex ratio were investigated. In addition, effects of irradiation on the rate of development to pupae and adults and the acceptance of irradiated larvae by B. hebetor females were examined. Results showed that the radio-sensitivity of E. kuehniella larvae increased with increasing dose. Pupation was significantly affected at 100 Gy dose, and completely prevented at 350 Gy dose. Adult emergence was only slightly different from pupation; emergence was significantly affected at 100 Gy dose and completely prevented at 300 Gy dose. Irradiation also negatively affected the rate of development of larvae to pupae and adults. While more than 98% of control larvae pupated within 10 days of treatment, this ratio decreased to about 79% in larvae exposed to 50 Gy and less than 4% in larvae exposed to 100 Gy dose. The rate of development to the adult stage was also similarly affected. While 97% of control insects emerged as adults in the 1st 20 days of treatment, this ratio decreased to about 53, 2 and zero percent in larvae exposed to 50, 100 and 150 Gy dose respectively. In addition, irradiation significantly affected male: female ratio; sex ratio was skewed in favor of males, and at 250 Gy dose all emerged moths were males. Furthermore, irradiation had no adverse effect on the degree of acceptance of mature larvae to parasitization; irradiated insects were as acceptable to B. hebetor females as unirradiated ones. (author)
Directory of Open Access Journals (Sweden)
Evaldo Martins Pires
2006-12-01
Full Text Available Insetos da subordem Heteroptera apresentam ampla diversidade faunística, incluindo predadores de pragas agrícolas e florestais. Espécies do gênero Podisus destacam-se entre os percevejos predadores no controle biológico de lagartas desfolhadoras de eucalipto, soja, algodão e tomate. O objetivo foi estudar o comportamento reprodutivo e a atividade de predação de Podisus nigrispinus (Heteroptera: Pentatomidae alimentado com pupas de Tenebrio molitor L. (Coleoptera: Tenebrionidae em laboratório. Casais desse predador foram acondicionados em potes plásticos de 500 mL com pupas de T. molitor e água em tubos tipo anestésico odontológico, inseridos na tampa desses potes. Foram observados: a postura o acasalamento e a alimentação de machos e fêmeas de P. nigrispinus às 0 h, 6 h, 12 h e 18 h. O porcentual de fêmeas de P. nigrispinus predando foi de 26,26; 24,39; 15,91; e 34,21% e o de machos, de 7,41; 6,20; 4,88; e 5,77%, às 0 h, 6 h, 12 h e 18 h, respectivamente. O maior número de fêmeas ovipositando foi observado às 00 h. A maior porcentagem de fêmeas predando foi às 18 h (32,21% e a de atividade de postura, à 0 h (50,56% dos ovos depositados, enquanto foram registrados apenas 1,66% dos ovos às 12 h. O número de acasalamentos de P. nigrispinus foi maior às 12 h (34,58%, seguido das 00 h (29,65%, 18 h (22,36% e 6 h (16,60%.Insects of the sub-order Heteroptera present a wide diversity including predators of agricultural and forest pests. Species of the genus Podisus are important agents of biological control of defoliating caterpillars of eucalyptus, soybem, cotton and tomato. The objective was to study the reproductive behavior and predation rate of Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae fed with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae in the laboratory. Pairs of this predator were placed in 500 ml plastic pots with T. molitor pupae and water in tubes of anesthetic odontologic type inserted in the
Experimental feeding of DDE and PCB to female big brown bats (Eptesicus fuscus)
Clark, D.R.; Prouty, R.M.
1977-01-01
Twenty-two female big brown bats (Eptesicus fuscus) were collected in a house attic in Montgomery County, Maryland. Seventeen were fed mealworms (Tenebrio molitor larvae) that contained 166 ppm DDE; the other five were fed uncontaminated mealworms. After 54 days of feeding, six dosed bats were frozen and the remaining 16 were starved to death. In a second experiment, 21 female big brown bats were collected in a house attic in Prince Georges County, Maryland. Sixteen were fed mealworms that contained 9.4 ppm Aroclor 1254 (PCB). After 37 days, two bats had died, four dosed bats were frozen, and the remaining 15 were starved to death. Starvation caused mobilization of stored residues. After the feeding periods, average weights of all four groups (DDE-dosed, DDE control, PCB-dosed, PCB control) had increased. However, weights of DDE-dosed bats had increased significantly more than those of their contols, whereas weights of PCB-dosed bats had increased significantly less than those of their controls. During starvation, PCB-dosed bats lost weight significantly more slowly than controls. Because PCB levels in dosed bats resembled levels found in some free-living big brown bats, PCBs may be slowing metabolic rates of some free-living bats. It is not known how various common organochlorine residues may affect metabolism in hibernating bats. DDE and PCB increased in brains of starving bats as carcass fat was metabolized. Because the tremors and/or convulsions characteristic of neurotoxicity were not observed, we think even the maximum brain levels attained (132 ppm DDE, 20 ppm PCB) were sublethal. However, extrapolation of our DDE data predicted lethal brain levels when fat reserves declined sufficiently. PCB-dosed bats were probably in no danger of neurotoxic poisoning. However, PCB can kill by a nonneurotoxic mode, and this could explain the deaths of two bats on PCB dosage.
Self-heating by large insect larvae?
Cooley, Nikita L; Emlen, Douglas J; Woods, H Arthur
2016-12-01
Do insect larvae ever self-heat significantly from their own metabolic activity and, if so, under what sets of environmental temperatures and across what ranges of body size? We examine these questions using larvae of the Japanese rhinoceros beetle (Trypoxylus dichotomus), chosen for their large size (>20g), simple body plan, and underground lifestyle. Using CO 2 respirometry, we measured larval metabolic rates then converted measured rates of gas exchange into rates of heat production and developed a mathematical model to predict how much steady state body temperatures of underground insects would increase above ambient depending on body size. Collectively, our results suggest that large, extant larvae (20-30g body mass) can self-heat by at most 2°C, and under many common conditions (shallow depths, moister soils) would self-heat by less than 1°C. By extending the model to even larger (hypothetical) body sizes, we show that underground insects with masses >1kg could heat, in warm, dry soils, by 1.5-6°C or more. Additional experiments showed that larval critical thermal maxima (CT max ) were in excess of 43.5°C and that larvae could behaviorally thermoregulate on a thermal gradient bar. Together, these results suggest that large larvae living underground likely regulate their temperatures primarily using behavior; self-heating by metabolism likely contributes little to their heat budgets, at least in most common soil conditions. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Viviana R Randazzo
2011-12-01
Full Text Available El objetivo de este estudio fue determinar el efecto de diferentes temperaturas sobre la viabilidad de larvas libres y enquistadas de Trichinella spiralis aisladas en el sudoeste de la provincia de Buenos Aires, Argentina. Se trataron larvas libres y enquistadas a diferentes temperaturas (-30 °C, -20 °C, 4 °C, 20 °C, calentamiento gradual entre 0-100 °C. Se determinó el tiempo necesario para matar el 100 % de las larvas. Durante los primeros días, la mortalidad larvaria en todos los tratamientos con frío aumentó signifcativamente en función del tiempo. En todos los casos, las larvas libres sobrevivieron menor cantidad de días que las enquistadas. A -30 °C, -20 °C y 20 °C no se observaron diferencias signifcativas entre las curvas de mortalidad de cada estadio larvario, pero a 4 °C la mortalidad fue menos intensa entre las larvas enquistadas. El calentamiento disminuyó la viabilidad, sin observarse diferencias entre estadios larvarios. La totalidad de las larvas libres y enquistadas había muerto a los 61 y 95 días (-30 °C, a los 160 y 180 días (-20 °C, a los 280 y 330 días (4° C, y a los 460 y 590 días (20 °C, respectivamente. Fue necesaria una cocción durante 15 minutos a 90 °C para matar al 100 % de las larvas libres y a 100 °C para lograr igual mortalidad de las enquistadas. Nuestros resultados indican que la temperatura y los tiempos tradicionalmente utilizados para tratar productos cárnicos con potencial de transmisión de T. spiralis no serían los más efectivos para lograr la inactivación de la totalidad de larvas vivas de este parásito.The aim of this work was to study the effect of temperature on the viability of free and encysted larvae of Trichinella spiralis from southwest Buenos Aires province, Argentina. Larvae were treated at variable temperatures (-30 °C, -20 °C, 4 °C, 20 °C, gradual heating between 0-100 °C. The time necessary to kill 100 % of larvae was calculated. During the frst days of
Bacteria Present in Comadia redtenbacheri Larvae (Lepidoptera: Cossidae).
Hernández-Flores, L; Llanderal-Cázares, C; Guzmán-Franco, A W; Aranda-Ocampo, S
2015-09-01
The external and internal culturable bacterial community present in the larvae of Comadia redtenbacheri Hammerschmidt, an edible insect, was studied. Characterization of the isolates determined the existence of 18 morphotypes and phylogenetic analysis of the 16S rRNA gene revealed the existence of Paenibacillus sp., Bacillus safensis, Pseudomonas sp., Bacillus pseudomycoides, Corynebacterium variabile, Enterococcus sp., Gordonia sp., Acinetobacter calcoaceticus, Arthrobacter sp., Micrococcus sp., and Bacillus cereus. Greater diversity of bacteria was found in those larvae obtained from vendors than in those directly taken from Agave plants in nature. Many of the larvae obtained from vendors presented signs of potential disease, and after the analysis, results showed a greater bacterial community compared with the larvae with a healthy appearance. This indicates that bacterial flora can vary in accordance with how the larvae are handled during extraction, collection, and transport. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Antibacterial properties of grapefruit seed extract against Paenibacillus larvae subsp. larvae.
Semprini, P; Langella, V; Pasini, B; Falda, M T; Calvarese, S
2004-01-01
Twenty-one samples of grapefruit seed extract (GSE) either from marketed products or provided by an apiculturist were analysed to verify their inhibition activity, in particular against Paenibacillus larvae subsp. larvae, responsible for American foulbrood. The bactericide capacity of GSE has been measured in Bacillus subtilis BGA, Bacillus cereus 11778, Bacillus cereus K250 and Micrococcus luteus 9341a; these bacteria are normally used in the laboratory to study inhibitors. The results showed that not all GSE have the same inhibitory activity and two of those analysed do not inhibit the five bacteria used. Considering that 19 samples inhibited American foulbrood bacillus, the authors conclude that the use of a natural product (such as GSE) to control this important disease of bees, can be used as a substitute for chemotherapeutic products, after appropriate expedients.
Feeding frequency and caste differentiation in Bombus terrestris larvae
Ribeiro, M.F.; Velthuis, H.H.W.; Duchateau, Marie José; Tweel, I. van der
1998-01-01
The frequency with which bumble bee larvae are fed during their development was studied using video-recordings. The behaviour of the workers while feeding worker, male and queen larvae of Bombus terrestris was recorded. At the beginning of development, female larvae of both castes were fed at a
Immune responses accelerate ageing: proof-of-principle in an insect model.
Directory of Open Access Journals (Sweden)
E Rhiannon Pursall
Full Text Available The pathology of many of the world's most important infectious diseases is caused by the immune response. Additionally age-related disease is often attributed to inflammatory responses. Consequently a reduction in infections and hence inflammation early in life has been hypothesized to explain the rise in lifespan in industrialized societies. Here we demonstrate experimentally for the first time that eliciting an immune response early in life accelerates ageing. We use the beetle Tenebrio molitor as an inflammation model. We provide a proof of principle for the effects of early infection on morbidity late in life and demonstrate a long-lasting cost of immunopathology. Along with presenting a proof-of-principle study, we discuss a mechanism for the apparently counter-adaptive persistence of immunopathology in natural populations. If immunopathology from early immune response only becomes costly later in life, natural selection on reducing self-harm would be relaxed, which could explain the presence of immune self-harm in nature.
Energy Technology Data Exchange (ETDEWEB)
Daley, Margaret E.; Sykes, Brian D. [University of Alberta, Department of Biochemistry, CIHR Group in Protein Structure and Function and Protein Engineering Network of Centres of Excellence (Canada)
2004-06-15
The dynamics of threonine side chains of the Tenebrio molitor antifreeze protein (TmAFP) were investigated using natural abundance {sup 13}C NMR. In TmAFP, the array of threonine residues on one face of the protein is responsible for conferring its ability to bind crystalline ice and inhibit its growth. Heteronuclear longitudinal and transverse relaxation rates and the {sup 1}H-{sup 13}C NOE were determined in this study. The C{alpha}H relaxation measurements were compared to the previously measured {sup 15}N backbone parameters and these are found to be in agreement. For the analysis of the threonine side chain motions, the model of restricted rotational diffusion about the {chi}{sub 1} dihedral angle was employed [London and Avitabile (1978) J. Am. Chem. Soc., 100, 7159-7165]. We demonstrate that the motion experienced by the ice binding threonine side chains is highly restricted, with an approximate upper limit of less than {+-}25 deg.
International Nuclear Information System (INIS)
Daley, Margaret E.; Sykes, Brian D.
2004-01-01
The dynamics of threonine side chains of the Tenebrio molitor antifreeze protein (TmAFP) were investigated using natural abundance 13 C NMR. In TmAFP, the array of threonine residues on one face of the protein is responsible for conferring its ability to bind crystalline ice and inhibit its growth. Heteronuclear longitudinal and transverse relaxation rates and the 1 H- 13 C NOE were determined in this study. The CαH relaxation measurements were compared to the previously measured 15 N backbone parameters and these are found to be in agreement. For the analysis of the threonine side chain motions, the model of restricted rotational diffusion about the χ 1 dihedral angle was employed [London and Avitabile (1978) J. Am. Chem. Soc., 100, 7159-7165]. We demonstrate that the motion experienced by the ice binding threonine side chains is highly restricted, with an approximate upper limit of less than ±25 deg
Directory of Open Access Journals (Sweden)
A. I. A. Pereira
Full Text Available Abstract Sexual choice by male stink bugs is important because females that experience food shortages lay fewer eggs with lower viability compared with well-fed females. In this study, we investigated whether Podisus nigrispinus (Dallas (Heteroptera: Pentatomidae males fed with a low-quality diet during its nymphal stage show selectivity for sexual partners resulting in high-quality progeny. Lightweight males and females were obtained from nymphs fed weekly with Tenebrio molitor L. (Coleoptera: Tenebrionidae pupae. By contrast, heavyweight males and females were fed three times a week and received an extra nutritional source: cotton leaves, Gossypium hirsutum L. (Malvaceae. Lightweight males preferred to mate with heavy females (77.78 ± 14.69%, whereas heavyweight males did not discriminated between light or heavyweight females. Females mated with lightweight males showed similar levels of reproduction to those mated with heavyweight males. The results provide an indication of the importance of male and female body weight for sexual selection in Asopinae stink bugs.
Directory of Open Access Journals (Sweden)
Poonam Sharma
2009-01-01
Full Text Available Scirpophaga incertulas Walker (Lepidoptera: Pyralideae, commonly known as yellow stem borer, is a predominant monophagous pest of rice, which causes 5% to 30% loss of the rice crop. We report for the first time, the cloning and sequence analysis of the amylase gene of this pest. The cloned gene translates into a protein of 487 amino acids having a predicted molecular weight of 54,955 daltons and a theoretical pI of 5.9. The 3D structure of the amylase is predicted from its amino acid sequence by homology modeling using the structure of the amylase from Tenebrio molitor L (Coleoptera: Tenebrionidae. We also report the purification of a dimeric α-amylase inhibitor from a local variety of wheat MP Sehore that is specific for the amylase of this pest and does not inhibit human salivary amylase or porcine pancreatic amylase. The gene encoding this inhibitor has been cloned and its sequence has been analysed to find a possible explanation for this specificity.
Directory of Open Access Journals (Sweden)
N SOLTANI-MAZOUNI
2000-12-01
Full Text Available KK-42, an imidazole derivative was tested on adult females of Tenebrio molitor L. (Insecta: Coleoptera. The compound was applied topically (1, 5, 10 mg/insect on 0- or 2-day old adult females or added to the culture medium (1 and 10 mM of abdominal sternites explanted from newly ecdysed pupae or ovaries removed from 2- and 4-day old adult females. Ecdysteroid measurements using an enzymo-immunoassay demonstrated that this compound applied on newly emerged adult females reduced the hormonal amounts in ovaries. However, when applied later, i.e. on 2-day old females corresponding to the beginning of the vitellogenesis, it had no significant effect on the amount of ovarian ecdysteroids with the lowest dose. Finally, the compound was also tested on the in vitro production of ecdysteroids. The amount of ecdysteroid released into the culture medium by ovaries or integumental explants were significantly reduced by KK-42.
A novel neurotoxin from venom of the spider, Brachypelma albopilosum.
Directory of Open Access Journals (Sweden)
Yunhua Zhong
Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.
Uncommon formation of two antiparallel sperm bundles per cyst in tenebrionid beetles (Coleoptera)
Dias, Glenda; Yotoko, Karla S. C.; Gomes, Luiz F.; Lino-Neto, José
2012-09-01
Several species of Tenebrionidae are stored-grain pests. Since they belong to a specious family, the systematics of these beetles is still in doubt. In insects, spermatogenesis and the spermatozoa exhibit great diversity, and are therefore commonly used in phylogenetic and taxonomic analyses. During the spermatogenetic process in these organisms, the cells originating from a single spermatogonium develop synchronically in groups referred to as cysts. At the end of this process, there is usually only one sperm bundle per cyst, with all the cells in the same orientation. This paper details the spermiogenesis of the tenebrionid beetles Tenebrio molitor, Zophobas confusa, Tribolium castaneum and Palembus dermestoides using whole mount and histological sections of the cysts. In these species, spermatogenesis is similar to that which occurs in most insects. However, during spermiogenesis, the nuclei of the spermatids migrate to two opposite regions at the periphery of the cyst, leading to the uncommon formation of two bundles of spermatozoa per cyst. This feature is possibly an apomorphy for Tenebrionidae.
THE INVASIVE COLEOPTEROFAUNA FOR REPUBLIC OF MOLDOVA
Directory of Open Access Journals (Sweden)
Asea M. Timuş
2015-07-01
Full Text Available The invasive coleopterofauna for Republic of Moldova consists of the 100 species. After correlation local database with Fauna Europaea for our country registered are 31 of species, but for 69 mentioned with the „absent” and 38 „no date”. In the meantime 24 species were recorded for our country: Acanthoscelides abtectus, A.pallidipennis, Alphitobius diaperinus, Alphitophagus bifasciatus, Bruchus pisorum, B.rufimanus, Caulophilus latinasus, Diabrotica virgifera, Gnathocerus cornutus, Harmonia axyridis, Lasioderma serricorne, Leptinotarsa decemlineata, Lignyodes bischoffi, Lithocharis nigriceps, Oryzaephilus surinamensis, Rhyzopertha dominica, Sitophilus granarius, S. oryzae, S. zeamais, Tenebrio molitor, Tenebrioides mauritanicus, Tribolium castaneum, T. destructor, Trogoderma granarium. According periods penetration the invasive beetles it was found that 2 species have entered the XVIII century, 16 species in the XIX, 53 species in the XX and 29 species in the XXI century. The registration invasive beetles in countries of interest to the our country is in: Bulgaria – 54 species; Poland – 39; România – 3; other countries- 4.
Review of food composition data for edible insects.
Nowak, Verena; Persijn, Diedelinde; Rittenschober, Doris; Charrondiere, U Ruth
2016-02-15
Edible insects are considered rich in protein and a variety of micronutrients, and are therefore seen as potential contributors to food security. However, the estimation of the insects' contribution to the nutrient intake is limited since data are absent in food composition tables and databases. Therefore, FAO/INFOODS collected and published analytical data from primary sources with sufficient quality in the Food Composition Database for Biodiversity (BioFoodComp). Data were compiled for 456 food entries on insects in different developmental stages. A total of 5734 data points were entered, most on minerals and trace elements (34.8%), proximates (24.5%), amino acids (15.3%) and (pro)vitamins (9.1%). Data analysis of Tenebrio molitor confirms its nutritive quality that can help to combat malnutrition. The collection of data will assist compilers to incorporate more insects into tables and databases, and to further improve nutrient intake estimations. Copyright © 2015 Food and Agriculture Organization of the United Nations. Published by Elsevier Ltd.. All rights reserved.
Control of stored product pests by ionizing radiation
Energy Technology Data Exchange (ETDEWEB)
Hallman, Guy J [United States Department of Agriculture, Agricultural Research Service, Weslaco, TX (United States)
2013-01-15
Food irradiation for prevention of food-borne illness and disinfestation of commodities of pests is increasing in a number of countries. The goal of this review is to analyze the literature and current use of irradiation to control stored product pests and suggest research to optimize its potential. Doses to prevent reproduction of stored product pests range from 0.05 kGy for Tenebrio molitor L. to 0.45 kGy for Sitotroga cereallela (Olivier). Small but increasing amounts of grains and pulses are being irradiated in the world today especially in Asia. At least 33 countries permit irradiation of some stored products with 14 countries permitting it for all stored products. Ways in which stored product irradiation research and application may influence other uses of irradiation technology are also discussed. Deactivation of weed seeds might be an area of stored product phytosanitation where irradiation would have an advantage over other measures. (author)
Fish larvae from the Canary region in autumn
Directory of Open Access Journals (Sweden)
J. M. Rodríguez
2000-03-01
Full Text Available In this paper, the taxonomic composition of the fish larvae community in the Canary region in autumn 1991 is presented. In total, 8699 larvae belonging to 58 fish families were studied. 176 taxonomic groups were identified, 149 at species level and the rest were identified at a higher level. The most numerous family and the one that presented the greatest number of species was Myctophidae. The most frequently caught species was Cyclothone braueri. The taxonomic composition (at family level of the fish larvae community, dominated by four mesopelagic families, was typical of oceanic regions of warm waters. The most remarkable feature of the fish larvae community was its high specific diversity.
Analysis of feeding behavior of Drosophila larvae on liquid food.
Shen, Ping
2012-05-01
The food responses of Drosophila larvae offer an excellent opportunity to study the genetic and neural regulation of feeding behavior. Compared with fed larvae, hungry larvae are more likely to display aggressive foraging, rapid food intake, compensatory feeding, and stress-resistant food procurement. Behavioral assays have been developed to quantitatively assess particular aspects of the hunger-driven food response. In combination, these assays help define the specific role of signaling molecules or neurons in the regulation of feeding behavior in foraging larvae. This protocol describes the analysis of larvae feeding on liquid food. The test is designed for quantitative assessment of the food ingestion rate of individual larvae under different energy states. It provides a simple and reliable way to measure the graded modification of the baseline feeding rate of larvae as food deprivation is prolonged. The test is applicable to routine functional testing and larger-scale screening of genetic mutations and biologics that might affect food consumption.
Abscisic acid enhances cold tolerance in honeybee larvae.
Ramirez, Leonor; Negri, Pedro; Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo
2017-04-12
The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee ( Apis mellifera ). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro -reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin , and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. © 2017 The Author(s).
Abscisic acid enhances cold tolerance in honeybee larvae
Sturla, Laura; Guida, Lucrezia; Vigliarolo, Tiziana; Maggi, Matías; Eguaras, Martín; Zocchi, Elena; Lamattina, Lorenzo
2017-01-01
The natural composition of nutrients present in food is a key factor determining the immune function and stress responses in the honeybee (Apis mellifera). We previously demonstrated that a supplement of abscisic acid (ABA), a natural component of nectar, pollen, and honey, increases honeybee colony survival overwinter. Here we further explored the role of ABA in in vitro-reared larvae exposed to low temperatures. Four-day-old larvae (L4) exposed to 25°C for 3 days showed lower survival rates and delayed development compared to individuals growing at a standard temperature (34°C). Cold-stressed larvae maintained higher levels of ABA for longer than do larvae reared at 34°C, suggesting a biological significance for ABA. Larvae fed with an ABA-supplemented diet completely prevent the low survival rate due to cold stress and accelerate adult emergence. ABA modulates the expression of genes involved in metabolic adjustments and stress responses: Hexamerin 70b, Insulin Receptor Substrate, Vitellogenin, and Heat Shock Proteins 70. AmLANCL2, the honeybee ABA receptor, is also regulated by cold stress and ABA. These results support a role for ABA increasing the tolerance of honeybee larvae to low temperatures through priming effects. PMID:28381619
Al-Ghamdi, Ahmad; Ali Khan, Khalid; Javed Ansari, Mohammad; Almasaudi, Saad B; Al-Kahtani, Saad
2018-02-01
The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1), Proteus mirabilis (T2), Bacillus licheniformis (T3), Lactobacillus kunkeei (T4), Bacillus subtilis (T5), Enterobacter kobei (T6), and Morganella morganii (T7) on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet) and positive control (normal diet spiked with P. larvae spores). Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%), whereas T4 group showed the lowest mortality (56.67%). Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%). Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.
Workbook on Identification of Aedes Aegypti Larvae.
Pratt, Harry D.; And Others
This self-instructional booklet is designed to enable yellow fever control workers to identify the larvae of "Aedes aegypti." The morphological features of mosquito larvae are illustrated in this partially programed text, and the distinguishing features of "A. aegypti" indicated. A glossary is included. (AL)
Larvas migrans ganglionar: Presentación de un caso
Directory of Open Access Journals (Sweden)
María del Carmen Luis Álvarez
2003-04-01
Full Text Available Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. Se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.Visceral larvae migrans caused by the infestation with larvae of toxocara canis or cati are more frequent among children under 10. The case of an 8-year-old boy who was diagnosed ganglionar larva migrans is presented. Comments are made on some etioepidemiological aspects of the disease, as well as on his clinical picture and evolution. Emphasis is made on the hygienic and sanitary measures of control and manipulation of stools from pegs as dogs and cats. Las larvas migrans visceral cuya causa radica en la infestación con larvas de toxocara canis o cati, ocurre más frecuentemente en niños menores de 10 años. Se presenta el caso de un niño de 8 años de edad en el cual se diagnosticó larvas migrans ganglionar. Se comentan aspectos etioepidemiológicos de la enfermedad, su cuadro clínico y evolución. se hace énfasis en las medidas higiénicas sanitarias de control y manipulación de excretas de animales domésticos, en este caso de perros y gatos.
DEFF Research Database (Denmark)
Munk, Peter
2014-01-01
The reproduction and early life history of many fish species are linked to the physical and biological characteristics of fronts. In order to ascertain linkages between frontal physics and fish larvae, we investigated distributional differences among gadoid fish larvae comparing these to both...... the vertical and horizontal distributions of each species. However, the three-dimensional pattern of distribution differed significantly among species of larvae and species of copepods. The study underlines the complexity of bio-physical interrelationships in the frontal zone, and indicates that the zone...
Directory of Open Access Journals (Sweden)
Halide Nihal Açıkgöz
2017-12-01
Full Text Available Forensic entomological practices rely upon accurate larval identification and measurement of larval length, for the estimation of post-mortem intervals. The methods used for killing larvae may affect the length of larvae. In the autopsy hall, corpses which are contain entomological remains have been washed with grape vinegar. Besides, while collecting and killing the larvae on corpses, crime scene teams use alcohol 70% because it is practical. The aim of this study was to determine which of hot water (90°C, cold vinegar and cold alcohol 96 % method, preserved the best the length of larvae. To achieve this aim, third instar larvae which are reared on 200 g of veal meat were killed using hot water, cold vinegar and cold alcohol. Before killing and after killing the maggots, their length was measured. To determine the difference between the groups to be compared ANOVA test, to reliability and validity analyses Kruskal-Wallis and whether there was any difference between the groups were made with Tukey’s Honestly Significant Difference (Tukey’s HSD Hot water was found to preserve the length of the larvae more accurately than cold vinegar and alcohol.
Intraguild predation and cannibalism among larvae of detritivorous caddisflies in subalpine wetlands
Wissinger, S.A.; Sparks, G.B.; Rouse, G.L.; Brown, W.S.; Steltzer, Heidi
1996-01-01
Comparative data from subalpine wetlands in Colorado indicate that larvae of the limnephilid caddisflies, Asynarchus nigriculus and Limnephilus externus, are reciprocally abundant among habitats - Limnephilus larvae dominate in permanent waters, whereas Asynarchus larvae dominate in temporary basins. The purpose of this paper is to report on field and laboratory experiments that link this pattern of abundance to biotic interactions among larvae. In the first field experiment, growth and survival were compared in single and mixed species treatments in littoral enclosures. Larvae, which eat mainly vascular plant detritus, grew at similar rates among treatments in both temporary and permanent habitats suggesting that exploitative competition is not important under natural food levels and caddisfly densities. However, the survival of Limnephilus larvae was reduced in the presence of Asynarchus larvae. Subsequent behavioral studies in laboratory arenas revealed that Asynarchus larvae are extremely aggressive predators on Limnephilus larvae. In a second field experiment we manipulated the relative sizes of larvae and found that Limnephilus larvae were preyed on only when Asynarchus larvae had the same size advantage observed in natural populations. Our data suggest that the dominance of Asynarchus larvae in temporary habitats is due to asymmetric intraguild predation (IGP) facilitated by a phenological head start in development. These data do not explain the dominance of Limnephilus larvae in permanent basins, which we show elsewhere to be an indirect effect of salamander predation. Behavioral observations also revealed that Asynarchus larvae are cannibalistic. In contrast to the IGP on Limnephilus larvae, Asynarchus cannibalism occurs among same-sized larvae and often involves the mobbing of one victim by several conspecifics. In a third field experiment, we found that Asynarchus cannibalism was not density-dependent and occurred even at low larval densities. We
Dynamics of Social Behavior in Fruit Fly Larvae
Durisko, Zachary; Kemp, Rebecca; Mubasher, Rameeshay; Dukas, Reuven
2014-01-01
We quantified the extent and dynamics of social interactions among fruit fly larvae over time. Both a wild-type laboratory population and a recently-caught strain of larvae spontaneously formed social foraging groups. Levels of aggregation initially increased during larval development and then declined with the wandering stage before pupation. We show that larvae aggregated more on hard than soft food, and more at sites where we had previously broken the surface of the food. Groups of larvae initiated burrowing sooner than solitary individuals, indicating that one potential benefit of larval aggregations is an improved ability to dig and burrow into the food substrate. We also show that two closely related species, D. melanogaster and D. simulans, differ in their tendency to aggregate, which may reflect different evolutionary histories. Our protocol for quantifying social behavior in larvae uncovered robust social aggregations in this simple model, which is highly amenable to neurogenetic analyses, and can serve for future research into the mechanisms and evolution of social behavior. PMID:24740198
Paenilarvins: Iturin family lipopeptides from the honey bee pathogen Paenibacillus larvae.
Sood, Sakshi; Steinmetz, Heinrich; Beims, Hannes; Mohr, Kathrin I; Stadler, Marc; Djukic, Marvin; von der Ohe, Werner; Steinert, Michael; Daniel, Rolf; Müller, Rolf
2014-09-05
The bacterium Paenibacillus larvae has been extensively studied as it is an appalling honey bee pathogen. In the present work, we screened crude extracts derived from fermentations of P. larvae genotypes ERIC I and II for antimicrobial activity, following the detection of four putative secondary metabolite gene clusters that show high sequence homology to known biosynthetic gene clusters for the biosynthesis of antibiotics. Low molecular weight metabolites produced by P. larvae have recently been shown to have toxic effects on honey bee larvae. Moreover, a novel tripeptide, sevadicin, was recently characterized from laboratory cultures of P. larvae. In this study, paenilarvins, which are iturinic lipopeptides exhibiting strong antifungal activities, were obtained by bioassay-guided fractionation from cultures of P. larvae, genotype ERIC II. Their molecular structures were determined by extensive 2D NMR spectroscopy, high resolution mass spectrometry, and other methods. Paenilarvins are the first antifungal secondary metabolites to be identified from P. larvae. In preliminary experiments, these lipopeptides also affected honey bee larvae and might thus play a role in P. larvae survival and pathogenesis. However, further studies are needed to investigate their function. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Nutritional condition and vertical distribution of Baltic cod larvae
DEFF Research Database (Denmark)
Grønkjær, P.; Clemmesen, C.; St. John, Michael
1997-01-01
Newly hatched Baltic cod Gadus morhua larvae are typically found at depths >60 m. This is a region of low light and prey availability, hence generating the hypothesis that larvae have to migrate from hatching depth to the surface layer to avoid starvation and improve their nutritional condition...... aged 2-25 days (median 10 days) ranged from 0.4 to 6.2, corresponding to levels exhibited by starving and fast growing larvae in laboratory calibration studies (starvation, protein growth rate, G(pi)=-12.2% day(-1); fast-growing larvae, G(pi)=14.1% day(-1)) respectively. Seventy per cent of the field...
Extreme morphologies of mantis shrimp larvae
Haug, Carolin; Ahyong, Shane T.; Wiethase, Joris H.; Olesen, Jørgen; Haug, Joachim T.
2016-01-01
ABSTRACT Larvae of stomatopods (mantis shrimps) are generally categorized into four larval types: antizoea, pseudozoea (both representing early larval stages), alima and erichthus (the latter two representing later larval stages). These categories, however, do not reflect the existing morphological diversity of stomatopod larvae, which is largely unstudied. We describe here four previously unknown larval types with extreme morphologies. All specimens were found in the collections of the Zoolo...
Directory of Open Access Journals (Sweden)
Ahmad Al-Ghamdi
2018-02-01
Full Text Available The probiotic effects of seven newly isolated gut bacteria, from the indegenous honey bees of Saudi Arabia were investigated. In vivo bioassays were used to investigate the effects of each gut bacterium namely, Fructobacillus fructosus (T1, Proteus mirabilis (T2, Bacillus licheniformis (T3, Lactobacillus kunkeei (T4, Bacillus subtilis (T5, Enterobacter kobei (T6, and Morganella morganii (T7 on mortality percentage of honey bee larvae infected with P. larvae spores along with negative control (normal diet and positive control (normal diet spiked with P. larvae spores. Addition of gut bacteria to the normal diet significantly reduced the mortality percentage of the treated groups. Mortality percentage in all treated groups ranged from 56.67% up to 86.67%. T6 treated group exhibited the highest mortality (86.67%, whereas T4 group showed the lowest mortality (56.67%. Among the seven gut bacterial treatments, T4 and T3 decreased the mortality 56.67% and 66.67%, respectively, whereas, for T2, T6, and T7 the mortality percentage was equal to that of the positive control (86.67%. Mortality percentages in infected larval groups treated with T1, and T5 were 78.33% and 73.33% respectively. Most of the mortality occurred in the treated larvae during days 2 and 3. Treatments T3 and T4 treatments showed positive effects and reduced mortality.
Development of Digestive Enzyme of Patin Pangasius hypohthalmus Larvae
Directory of Open Access Journals (Sweden)
I. Effendi
2007-01-01
Full Text Available Culture of patin Pangasius hypophthalmus especially larval rearing very depends on the supply of natural food as energy source. Artemia is the main natural food for fish larvae as a starter food, but its price is high. To reduce production cost, farmers tend to reduce the feeding frequency and shorten the Artemia feeding period. Altering feeding regime however may reduce fry quality. This relate to the availability of digestive enzymes. The objective of this study was to examine digestive enzymes activity in patin larvae fed with different feeding regime. By shorten feeding period with Artemia to 2-4 days and Tubifex,substitution, the enzymes activity of protease, lipase and amylase were revealed similar pattern The enzymes activity tends to increase and reach the peak at day 7 , and decrease later on until day 15 after hatching. Survival rate of fish were varied for each treatment, and the highest survival rate was obtained when larvae were fed by Artemia for 8 days. Blood worm were not fully digested by patin larvae at early stage. Keywords: enzyme, digestion, patin, Pangasius hypophthalmus ABSTRAK Proses budidaya ikan patin, Pangasius hypophthalmus terutama pembenihan sangat tergantung oleh ketersediaan pakan alami sebagai sumber energinya. Artemia merupakan pakan alami yang banyak diberikan pada saat larva ikan mulai makan, namun harganya relatif tinggi. Untuk menekan biaya produksi, petani ikan patin cenderung mengurangi frekuensi pemberian Artemia dan mempersingkat waktu pemberiannya. Penggeseran jadwal ini diduga mengakibatkan penurunan kualitas benih ikan patin yang dihasilkan yang berhubungan dengan kesiapan enzim pencernaannya. Penelitian ini dilakukan untuk mengetahui aktivitas enzim pada larva ikan patin dengan jadwal pemberian pakan yang berbeda. Dengan memotong waktu pemberian Artemia 2 - 4 hari dan disubstitusi dengan Tubifex, aktifitas enzim protease, lipase dan amilase pada larva ikan patin, memiliki
Directory of Open Access Journals (Sweden)
Julio C Rojas
Full Text Available Selecting optimal host plants is critical for herbivorous insects, such as fall armyworm (Spodoptera frugiperda, an important maize pest in the Americas and Africa. Fall armyworm larvae are presumed to have limited mobility, hence female moths are presumed to be largely responsible for selecting hosts. We addressed host selection by fall armyworm moths and neonate and older (3rd-instar larvae, as mediated by resistance and herbivory in maize plants. Thus, we compared discrimination among three maize cultivars with varying degrees of resistance to fall armyworm, and between plants subjected or not to two types of herbivory. The cultivars were: (i susceptible, and deficient in jasmonic acid (JA production and green leaf volatiles (GLV emissions (inbred line B73-lox10; (ii modestly resistant (B73, and; (iii highly resistant (Mp708. The herbivory types were: (i ongoing (= fall armyworm larvae present, and; (ii future (= fall armyworm eggs present. In choice tests, moths laid more eggs on the highly resistant cultivar, and least on the susceptible cultivar, though on those cultivars larvae performed poorest and best, respectively. In the context of herbivory, moths laid more eggs: (i on plants subject to versus free of future herbivory, regardless of whether plants were deficient or not in JA and GLV production; (ii on plants subject versus free of ongoing herbivory, and; (iii on plants not deficient in compared to deficient in JA and GLV production. Neonate larvae dispersed aerially from host plants (i.e. ballooned, and most larvae colonized the modestly resistant cultivar, and fewest the highly resistant cultivar, suggesting quasi-directional, directed aerial descent. Finally, dispersing older larvae did not discriminate among the three maize cultivars, nor between maize plants and (plastic model maize plants, suggesting random, visually-oriented dispersal. Our results were used to assemble a model of host selection by fall armyworm moths and
Suppressing bullfrog larvae with carbon dioxide
Gross, Jackson A.; Ray, Andrew; Sepulveda, Adam J.; Watten, Barnaby J.; Densmore, Christine L.; Layhee, Megan J.; Mark Abbey-Lambert,; ,
2014-01-01
Current management strategies for the control and suppression of the American Bullfrog (Lithobates catesbeianus = Rana catesbeiana Shaw) and other invasive amphibians have had minimal effect on their abundance and distribution. This study evaluates the effects of carbon dioxide (CO2) on pre- and prometamorphic Bullfrog larvae. Bullfrogs are a model organism for evaluating potential suppression agents because they are a successful invader worldwide. From experimental trials we estimated that the 24-h 50% and 99% lethal concentration (LC50 and LC99) values for Bullfrog larvae were 371 and 549 mg CO2/L, respectively. Overall, larvae that succumbed to experimental conditions had a lower body condition index than those that survived. We also documented sublethal changes in blood chemistry during prolonged exposure to elevated CO2. Specifically, blood pH decreased by more than 0.5 pH units after 9 h of exposure and both blood partial pressure of CO2 (pCO2) and blood glucose increased. These findings suggest that CO2 treatments can be lethal to Bullfrog larvae under controlled laboratory conditions. We believe this work represents the necessary foundation for further consideration of CO2 as a potential suppression agent for one of the most harmful invaders to freshwater ecosystems.
[Toxicity and influencing factors of liquid chlorine on chironomid larvae].
Sun, Xing-Bin; Cui, Fu-Yi; Zhang, Jin-Song; Guo, Zhao-Hai; Xu, Feng; Liu, Li-Jun
2005-09-01
The excessive propagation of Chironomid larvae (red worm) in the sedimentation tanks is a difficult problem for the normal function of waterworks. The toxic effect of liquid chlorine on the different instar larvae of Chironomid was studied using distilled water as test sample. Furthermore, the effect of pH value, organic matter content, ammonia nitrogen, and algae content on toxicity of liquid chlorine was observed. The results show that the tolerance of Chironomid larvae to liquid chlorine is strengthened with the increase in instar. The 24h semi-lethal concentration (LC50) of liquid chlorine to the 4th instar larvae of Chironomid is 3.39 mg/L. Low pH value and high algae content are helpful to improve the toxic effect of liquid chlorine to Chironomid larvae. In neutral water body, the increase in organic matter content results in the decrease in the death rate of Chironomid larvae. The toxicity of liquid chlorine differs greatly in different concentrations of ammonia nitrogen. The death rate of the 4th instar larvae of Chironomid in raw water is higher by contrast with that in sedimentation tanks water for 24h disposal with various amount of liquid chlorine.
Bothid larvae (Pleuronectiformes-Pisces) of the Indian Ocean
Digital Repository Service at National Institute of Oceanography (India)
Devi, C.B.L.
the Indian Ocean, their regional, seasonal as well as diurnal variations. Engyprosopon grandisquamis dominated contributing to 23.2% of the total larvae. Numerically the incidence of bothid larvae suggested a uniform pattern of distribution during the two...
Microbiology of processed edible insect products - Results of a preliminary survey.
Grabowski, Nils Th; Klein, Günter
2017-02-21
Little is known of the microbiology of processed insect products. The present survey analysed a total of n=38 samples of deep-fried and spiced (Acheta domesticus, Locusta migratoria, and Omphisa fuscidentalis), cooked in soy sauce ("tsukudani"; Oxya yezoensis, Vespula flaviceps, and Bombyx mori), dried (A. domesticus, L. migatoria, Alphitobius diaperinus, Tenebrio molitor, B. mori, Hermetia illucens, and Musca domestica), powdered (H. illucens, T. molitor) and other (incl. deep-frozen B. mori and honeybee pollen) insect products microbiologically (total bacterial count [TBC], Enterobacteriaceae, staphylococci, bacilli, and yeasts and moulds counts, salmonellae, Listeria monocytogenes, and Escherichia coli). Although each product type revealed a microbiological profile of its own, dried and powdered insects ("class I") displayed markedly higher counts than the deep-fried and cooked ones ("class II"). Thresholds between class I and II products were estimated at 4.0 (TBC), 1.0 (Enterobacteriaceae, yeasts and moulds), 2.5 (staphylococci), and 3.0lgcfu/g (bacilli). All samples were negative for salmonellae, L. monocytogenes, E. coli and Stapyhlococcus aureus, but dried and powdered insects, as well as pollen, contained B. cereus, coliforms, Serratia liquefaciens, Listeria ivanovii, Mucor spp., Aspergillus spp., Penicillium spp., and Cryptococcus neoformans. Comparing the results with the hygiene criteria for edible insects proposed by Belgium and the Netherlands, class I products failed to comply with many bacterial count limits despite the absence of classical food pathogens. Therefore, class I products should always be consumed after another heating step as indicated by the manufacturer, until drying techniques are able to ensure lower bacterial counts. Copyright © 2016 Elsevier B.V. All rights reserved.
Analysis of feeding behavior of Drosophila larvae on solid food.
Shen, Ping
2012-05-01
The food responses of Drosophila larvae offer an excellent opportunity to study the genetic and neural regulation of feeding behavior. Compared with fed larvae, hungry larvae are more likely to display aggressive foraging, rapid food intake, compensatory feeding, and stress-resistant food procurement. Behavioral assays have been developed to quantitatively assess particular aspects of the hunger-driven food response. In combination, these assays help define the specific role of signaling molecules or neurons in the regulation of feeding behavior in foraging larvae. This protocol is designed for quantitative assessment of the willingness of individual larvae to procure solid food under different energy states. It provides a simple and reliable way to measure the graded modification of the baseline feeding rate of larvae as the period of food deprivation is increased. The test is applicable to routine functional testing and larger-scale screening of genetic mutations and biologics that might affect food consumption.
Directory of Open Access Journals (Sweden)
Luciano Andrade Moreira
1995-01-01
Full Text Available The objective of this research was to study the effect of feeding on Eucalyptus leaves on the life and fecundity tables of Tynacantha marginata Dallas, 1851 (Heteroptera: Pentatomidae. Higher mortality of this predator occurred during second week of life, when the nymphs were starting second instar. The fecundity table showed that the nymphal period of T. marginata lasted four weeks, with viability of 57,9% and total longevity of 21 weeks. Egg oviposition period took 10 weeks. The population parameters (R0, rm and λ showed a 50.69 times populational increase after one generation.
External Ophthalmomyiasis Caused by a Rare Infesting Larva, Sarcophaga argyrostoma
Directory of Open Access Journals (Sweden)
Shmuel Graffi
2013-01-01
Full Text Available Purpose. External ophthalmomyiasis (EO is caused by infesting larvae belonging to various species of flies. Most documented cases result from sheep (Oestrus ovis and Russian (Rhinoestrus purpureus botfly larvae, but we recently discovered a rare case of EO caused by flesh fly (Sarcophaga argyrostoma larvae. Here, we report the case of a patient with EO who had been hospitalized and sedated for 1 week because of unrelated pneumonia. Methods. Case report. Results. A total of 32 larvae were removed from the adnexae of both eyes. Larvae identification was confirmed through DNA analysis. Treatment with topical tobramycin resulted in complete resolution of EO. Conclusion. EO can be caused by S. argyrostoma, and the elderly and debilitated may require extra ocular protection against flies during sedation.
Decapod larvae from the nearshore waters of Karwar
Digital Repository Service at National Institute of Oceanography (India)
Nair, V.R.; Paulinose, V.T.
Abundance of decapod larvae at three stations in Binge Bay, Karwar has been reported based on surface collections taken during the period October 1975 to September 1976. The larvae were very common in the Bay and the postmonsoon months sustained...
Halide Nihal Açıkgöz; Ali Açıkgöz
2017-01-01
Forensic entomological practices rely upon accurate larval identification and measurement of larval length, for the estimation of post-mortem intervals. The methods used for killing larvae may affect the length of larvae. In the autopsy hall, corpses which are contain entomological remains have been washed with grape vinegar. Besides, while collecting and killing the larvae on corpses, crime scene teams use alcohol 70% because it is practical. The aim of this study was to determine which...
Directory of Open Access Journals (Sweden)
Kátia Kalko Schwarz
2011-12-01
Full Text Available Este experimento foi realizado para avaliar níveis crescentes de mananoligossacarídeo (MOS na dieta de larvas de tilápias-do-nilo (linhagem Supreme® na fase de reversão sexual durante 30 dias. Larvas de tilápia-do-nilo (n=1500, P=0,01 g ± 0,001 g foram distribuídas aleatoriamente em 30 tanques de 100 litros. Os peixes foram distribuídos em delineamento inteiramente casualizado, composto por seis tratamentos e cinco repetições. A dieta controle (isenta de MOS foi elaborada para conter aproximadamente 35% de proteína bruta e 3.100 kcal de ED/kg. As demais foram suplementadas com 0; 0,15; 0,30; 0,45; 0,60 e 0,75% de MOS em substituição ao milho da dieta controle. Com o aumento nos níveis de MOS nas dietas, foi observado aumento linear sobre o comprimento do intestino, a altura das vilosidades intestinais e a densidade dos vilos. Não houve diferença na composição corporal, no ganho em peso, no peso final, no comprimento final, no fator de condição, na taxa de sobrevivência e no número de células caliciformes do intestino das larvas. Os níveis de MOS tiveram efeito quadrático sobre a conversão alimentar, cujos melhores resultados foram obtidos com 0,34% de MOS. A utilização de MOS no nível de 0,34% em dietas para larvas de tilápia-do-nilo melhora a conversão alimentar e promove aumento do comprimento do intestino, da altura das vilosidades e da densidade de vilos intestinal.This experiment was conducted to evaluate increasing levels of mannanoligosaccharides (MOS in the diet of Nile tilapia larvae (Supreme® at the sex reversal stage for 30 days. Nile tilapia larvae (n = 1500, p = 0.01 ± 0.001 g, were randomly distributed in 30 tanks of 100 liters each, for 30 days. The fish were distributed in a randomized design with six treatments and five replicates. The control diet (no MOS was elaborated to contain approximately 35% of crude protein and 3,100 kcal DE/kg. Mannanoligosaccharides were included in the other diets
Using Real-time PCR for Identification of Paenibacillus larvae
Directory of Open Access Journals (Sweden)
Vladimíra Kňazovická
2011-05-01
Full Text Available The aim of the study was identification of Paenibacillus larvae that causes American foulbrood disease (AFB in colony of bees (Apis mellifera. Bacterial isolates originated from honey samples, because presence of P. larvae in honey is treated as early diagnostic of AFB. Intense proteolytic activity and no catalase activity are typical for Gram positive rod-shaped bacteria P. larvae. We diluted honey (1:2, heated at 80 °C for 10 min and inoculated on semiselective medium MYPGP agar with nalidixic acid. Plates were cultivated at 37 °C for 48 – 72 h under the aerobic conditions. Selected colonies were transferred on MYT agar and cultivated 24 h. We analysed 30 honey samples and found 27 bacterial isolates. All isolates were Gram positive and mainly rod-shaped. No catalase activity was documented for 6 from 27 isolates. Identification was finished by real-time PCR to detect the 16S rRNA gene of Paenibacillus larvae with real-time cycler Rotor-Gene 6000. As DNA template we used genomic DNA isolated with commercial kit and DNA lysate obtaining by boiled cells. We used 2 strains of P. larvae from CCM (Czech Collection of Microorganisms as positive control. The reliable method of detection P. larvae has important rule for beekeeping.
Structure and occurrence of cyphonautes larvae (Bryozoa, Ectoprocta)
DEFF Research Database (Denmark)
Nielsen, Claus; Worsaae, Katrine
2010-01-01
We have studied larvae of the freshwater ctenostome Hislopia malayensis with scanning electron microscopy (SEM), confocal laser scanning microscopy (CLSM), and LM of serial sections. Some additional observations on larvae of M. membranacea using SEM and CLSM are also reported. The overall configu...
The method by which Cephenemyia trompe (Modeer larvae invade reindeer (Rangifer tarandus
Directory of Open Access Journals (Sweden)
John R. Anderson
1990-09-01
Full Text Available Laboratory electrostimulated C. trompe (Modeer females forcefully expelled (sprayed larvae for 5-20 cm. The watery spray consisted of about 20 tiny droplets containing two to several larvae. Crawling first-instar larvae exhibited negative geotactic and phototropic responses; they were subject to rapid desiccation and became immobile as the tiny droplets dried within a few seconds. When 5-50 larvae from dissectedfemales were dropped in physiological saline onto different areas of the muzzle of restrained reindeer, only larvae placed deep within the nostrils and on the lips crawled out-of-sight down the nostril passage or into the mouth. Drops of larvae placed elsewhere quickly desiccated and the larvae became immobile. Larvae deposited by wild females onto a COz-baited reindeer model with the muzzle, lips and nostrils coated with insect trapping adhesive all were stuck only along the dorsal lip below the philtrum. All experimental evidence supports a natural per os mode of invasion.
Parasites of fish larvae: do they follow metabolic energetic laws?
Muñoz, Gabriela; Landaeta, Mauricio F; Palacios-Fuentes, Pamela; George-Nascimento, Mario
2015-11-01
Eumetazoan parasites in fish larvae normally exhibit large body sizes relative to their hosts. This observation raises a question about the potential effects that parasites might have on small fish. We indirectly evaluated this question using energetic metabolic laws based on body volume and the parasite densities. We compared the biovolume as well as the numeric and volumetric densities of parasites over the host body volume of larval and juvenile-adult fish and the average of these parasitological descriptors for castrator parasites and the parasites found in the fish studied here. We collected 5266 fish larvae using nearshore zooplankton sampling and 1556 juveniles and adult fish from intertidal rocky pools in central Chile. We considered only the parasitized hosts: 482 fish larvae and 629 juvenile-adult fish. We obtained 31 fish species; 14 species were in both plankton and intertidal zones. Fish larvae exhibited a significantly smaller biovolume but larger numeric and volumetric densities of parasites than juvenile-adult fish. Therefore, fish larvae showed a large proportion of parasite biovolume per unit of body host (cm(3)). However, the general scaling of parasitological descriptors and host body volume were similar between larvae and juvenile-adult fish. The ratio between the biovolume of parasites and the host body volume in fish larvae was similar to the proportion observed in castrator parasites. Furthermore, the ratios were different from those of juvenile-adult fish, which suggests that the presence of parasites implies a high energetic cost for fish larvae that would diminish the fitness of these small hosts.
The larva of Paracapnia disala (Jewett) (Plecoptera: Capniidae)
Kenneth W. Stewart
2010-01-01
The larva of Paracapnia disala (Jewett) was associated from two first order headwater streams in the H.J. Andrews Experimental Forest, Oregon, U.S.A. Larvae of this first western Paracapnia species to be associated, were studied and compared morphologically with those of the eastern Paracapnia angulata...
Composition, Abundance and Distribution of Brachyuran Larvae in ...
African Journals Online (AJOL)
... Ocypodidae, Grapsidae and Xanthidae. Abundance of brachyuran larvae was significantly positively correlated with total zooplankton abundance (r2 = 0.8) and salinity (r2 = 0.71). Keywords: Brachyuran larvae, abundance, composition, Mida creek, Kenya West Indian Ocean Journal of Marine Science Vol. 3 (2) 2004: pp.
How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae.
Directory of Open Access Journals (Sweden)
Marvin Djukic
Full Text Available Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB, which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity.
How to kill the honey bee larva: genomic potential and virulence mechanisms of Paenibacillus larvae.
Djukic, Marvin; Brzuszkiewicz, Elzbieta; Fünfhaus, Anne; Voss, Jörn; Gollnow, Kathleen; Poppinga, Lena; Liesegang, Heiko; Garcia-Gonzalez, Eva; Genersch, Elke; Daniel, Rolf
2014-01-01
Paenibacillus larvae, a Gram positive bacterial pathogen, causes American Foulbrood (AFB), which is the most serious infectious disease of honey bees. In order to investigate the genomic potential of P. larvae, two strains belonging to two different genotypes were sequenced and used for comparative genome analysis. The complete genome sequence of P. larvae strain DSM 25430 (genotype ERIC II) consisted of 4,056,006 bp and harbored 3,928 predicted protein-encoding genes. The draft genome sequence of P. larvae strain DSM 25719 (genotype ERIC I) comprised 4,579,589 bp and contained 4,868 protein-encoding genes. Both strains harbored a 9.7 kb plasmid and encoded a large number of virulence-associated proteins such as toxins and collagenases. In addition, genes encoding large multimodular enzymes producing nonribosomally peptides or polyketides were identified. In the genome of strain DSM 25719 seven toxin associated loci were identified and analyzed. Five of them encoded putatively functional toxins. The genome of strain DSM 25430 harbored several toxin loci that showed similarity to corresponding loci in the genome of strain DSM 25719, but were non-functional due to point mutations or disruption by transposases. Although both strains cause AFB, significant differences between the genomes were observed including genome size, number and composition of transposases, insertion elements, predicted phage regions, and strain-specific island-like regions. Transposases, integrases and recombinases are important drivers for genome plasticity. A total of 390 and 273 mobile elements were found in strain DSM 25430 and strain DSM 25719, respectively. Comparative genomics of both strains revealed acquisition of virulence factors by horizontal gene transfer and provided insights into evolution and pathogenicity.
Chironomidae bloodworms larvae as aquatic amphibian food.
Fard, Mojdeh Sharifian; Pasmans, Frank; Adriaensen, Connie; Laing, Gijs Du; Janssens, Geert Paul Jules; Martel, An
2014-01-01
Different species of chironomids larvae (Diptera: Chironomidae) so-called bloodworms are widely distributed in the sediments of all types of freshwater habitats and considered as an important food source for amphibians. In our study, three species of Chironomidae (Baeotendipes noctivagus, Benthalia dissidens, and Chironomus riparius) were identified in 23 samples of larvae from Belgium, Poland, Russia, and Ukraine provided by a distributor in Belgium. We evaluated the suitability of these samples as amphibian food based on four different aspects: the likelihood of amphibian pathogens spreading, risk of heavy metal accumulation in amphibians, nutritive value, and risk of spreading of zoonotic bacteria (Salmonella, Campylobacter, and ESBL producing Enterobacteriaceae). We found neither zoonotic bacteria nor the amphibian pathogens Ranavirus and Batrachochytrium dendrobatidis in these samples. Our data showed that among the five heavy metals tested (Hg, Cu, Cd, Pb, and Zn), the excess level of Pb in two samples and low content of Zn in four samples implicated potential risk of Pb accumulation and Zn inadequacy. Proximate nutritional analysis revealed that, chironomidae larvae are consistently high in protein but more variable in lipid content. Accordingly, variations in the lipid: protein ratio can affect the amount and pathway of energy supply to the amphibians. Our study indicated although environmentally-collected chironomids larvae may not be vectors of specific pathogens, they can be associated with nutritional imbalances and may also result in Pb bioaccumulation and Zn inadequacy in amphibians. Chironomidae larvae may thus not be recommended as single diet item for amphibians. © 2014 Wiley Periodicals, Inc.
Quantification of vestibular-induced eye movements in zebrafish larvae
Directory of Open Access Journals (Sweden)
Mo Weike
2010-09-01
Full Text Available Abstract Background Vestibular reflexes coordinate movements or sensory input with changes in body or head position. Vestibular-evoked responses that involve the extraocular muscles include the vestibulo-ocular reflex (VOR, a compensatory eye movement to stabilize retinal images. Although an angular VOR attributable to semicircular canal stimulation was reported to be absent in free-swimming zebrafish larvae, recent studies reveal that vestibular-induced eye movements can be evoked in zebrafish larvae by both static tilts and dynamic rotations that tilt the head with respect to gravity. Results We have determined herein the basis of sensitivity of the larval eye movements with respect to vestibular stimulus, developmental stage, and sensory receptors of the inner ear. For our experiments, video recordings of larvae rotated sinusoidally at 0.25 Hz were analyzed to quantitate eye movements under infrared illumination. We observed a robust response that appeared as early as 72 hours post fertilization (hpf, which increased in amplitude over time. Unlike rotation about an earth horizontal axis, rotation about an earth vertical axis at 0.25 Hz did not evoke eye movements. Moreover, vestibular-induced responses were absent in mutant cdh23 larvae and larvae lacking anterior otoliths. Conclusions Our results provide evidence for a functional vestibulo-oculomotor circuit in 72 hpf zebrafish larvae that relies upon sensory input from anterior/utricular otolith organs.
CalCOFI Larvae Counts, Scientific Names CI to CO
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names DH to EC
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names TF to U
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names HJ to ID
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names AN to AR
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SJ to ST
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names CP to DE
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names C to CE
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names EV to GN
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names V to Z
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names ED to EU
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SD to SI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names MB to MO
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names LJ to MA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names AS to BA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SB to SC
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names MP to NA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names SU to TE
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names PL to PO
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names IE to LA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names A to AM
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names HB to HI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names OM to OX
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names Q to SA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names PP to PZ
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names GO to HA
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names NB to OL
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names LB to LI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names BCE to BZ
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names CD to CH
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
CalCOFI Larvae Counts, Scientific Names OY to PI
National Oceanic and Atmospheric Administration, Department of Commerce — Fish larvae counts and standardized counts for larvae captured in CalCOFI icthyoplankton nets (primarily vertical [Calvet or Pairovet], oblique [bongo or ring nets],...
The use of fly larvae for organic waste treatment.
Čičková, Helena; Newton, G Larry; Lacy, R Curt; Kozánek, Milan
2015-01-01
The idea of using fly larvae for processing of organic waste was proposed almost 100 years ago. Since then, numerous laboratory studies have shown that several fly species are well suited for biodegradation of organic waste, with the house fly (Musca domestica L.) and the black soldier fly (Hermetia illucens L.) being the most extensively studied insects for this purpose. House fly larvae develop well in manure of animals fed a mixed diet, while black soldier fly larvae accept a greater variety of decaying organic matter. Blow fly and flesh fly maggots are better suited for biodegradation of meat processing waste. The larvae of these insects have been successfully used to reduce mass of animal manure, fecal sludge, municipal waste, food scrapes, restaurant and market waste, as well as plant residues left after oil extraction. Higher yields of larvae are produced on nutrient-rich wastes (meat processing waste, food waste) than on manure or plant residues. Larvae may be used as animal feed or for production of secondary products (biodiesel, biologically active substances). Waste residue becomes valuable fertilizer. During biodegradation the temperature of the substrate rises, pH changes from neutral to alkaline, ammonia release increases, and moisture decreases. Microbial load of some pathogens can be substantially reduced. Both larvae and digested residue may require further treatment to eliminate pathogens. Facilities utilizing natural fly populations, as well as pilot and full-scale plants with laboratory-reared fly populations have been shown to be effective and economically feasible. The major obstacles associated with the production of fly larvae from organic waste on an industrial scale seem to be technological aspects of scaling-up the production capacity, insufficient knowledge of fly biology necessary to produce large amounts of eggs, and current legislation. Technological innovations could greatly improve performance of the biodegradation facilities and
Crustacean Larvae-Vision in the Plankton.
Cronin, Thomas W; Bok, Michael J; Lin, Chan
2017-11-01
We review the visual systems of crustacean larvae, concentrating on the compound eyes of decapod and stomatopod larvae as well as the functional and behavioral aspects of their vision. Larval compound eyes of these macrurans are all built on fundamentally the same optical plan, the transparent apposition eye, which is eminently suitable for modification into the abundantly diverse optical systems of the adults. Many of these eyes contain a layer of reflective structures overlying the retina that produces a counterilluminating eyeshine, so they are unique in being camouflaged both by their transparency and by their reflection of light spectrally similar to background light to conceal the opaque retina. Besides the pair of compound eyes, at least some crustacean larvae have a non-imaging photoreceptor system based on a naupliar eye and possibly other frontal eyes. Larval compound-eye photoreceptors send axons to a large and well-developed optic lobe consisting of a series of neuropils that are similar to those of adult crustaceans and insects, implying sophisticated analysis of visual stimuli. The visual system fosters a number of advanced and flexible behaviors that permit crustacean larvae to survive extended periods in the plankton and allows them to reach acceptable adult habitats, within which to metamorphose. © The Author 2017. Published by Oxford University Press on behalf of the Society for Integrative and Comparative Biology. All rights reserved. For permissions please email: journals.permissions@oup.com.
Observations of the sound producing organs in achelate lobster larvae
Directory of Open Access Journals (Sweden)
John A. Fornshell
2017-06-01
Full Text Available The Achelata, lobsters lacking claws and having a phyllosoma larva, are divided into two families, the Palinuridae or spiny lobsters and the Scyllaridae or slipper lobsters. Within the Palinuridae adults of two groups were identified by Parker (1884, the Stridentesthat are capable of producing sounds, and the Silentesthat are not known to produce sounds. The Stridentes employ a file-like structure on the dorsal surface of the cephalon and a plectrum consisting of a series of ridges on the proximal segment of the second antenna to produce their sounds. All species of Achelata hatch as an unpigmented thin phyllosoma larva. The phyllosoma larva of the Stridentes have a presumptive file-like structure on the dorsal cephalon. A similar file-like structure is found on the cephalon of one species of Silentes, Palinurellus wienckki, and some but not all of the phyllosoma larvae of the Scyllaridae. No presumptive plectrum is found on the second antenna of any of the phyllosoma larvae. Presence of a presumptive file-like structure on phyllosoma larvae of Silentes and Scyllaridae suggests that the ability to produce sounds may have been lost secondarily in the Silentes and Scyllaridae.
Identification of tissue-embedded ascarid larvae by ribosomal DNA sequencing.
Ishiwata, Kenji; Shinohara, Akio; Yagi, Kinpei; Horii, Yoichiro; Tsuchiya, Kimiyuki; Nawa, Yukifumi
2004-01-01
Polymerase chain reaction (PCR) was applied to identify tissue-embedded ascarid nematode larvae. Two sequences of the internal transcribed spacer (ITS) regions of ribosomal DNA (rDNA), ITS1 and ITS2, of the ascarid parasites were amplified and compared with those of ascarid-nematodes registered in a DNA database (GenBank). The ITS sequences of the PCR products obtained from the ascarid parasite specimen in our laboratory were compatible with those of registered adult Ascaris and Toxocara parasites. PCR amplification of the ITS regions was sensitive enough to detect a single larva of Ascaris suum mixed with porcine liver tissue. Using this method, ascarid larvae embedded in the liver of a naturally infected turkey were identified as Toxocara canis. These results suggest that even a single larva embedded in tissues from patients with larva migrans could be identified by sequencing the ITS regions.
Starvation-Induced Dietary Behaviour in Drosophila melanogaster Larvae and Adults.
Ahmad, Muhammad; Chaudhary, Safee Ullah; Afzal, Ahmed Jawaad; Tariq, Muhammad
2015-09-24
Drosophila melanogaster larvae are classified as herbivores and known to feed on non-carnivorous diet under normal conditions. However, when nutritionally challenged these larvae exhibit cannibalistic behaviour by consuming a diet composed of larger conspecifics. Herein, we report that cannibalism in Drosophila larvae is confined not only to scavenging on conspecifics that are larger in size, but also on their eggs. Moreover, such cannibalistic larvae develop as normally as those grown on standard cornmeal medium. When stressed, Drosophila melanogaster larvae can also consume a carnivorous diet derived from carcasses of organisms belonging to diverse taxonomic groups, including Musca domestica, Apis mellifera, and Lycosidae sp. While adults are ill-equipped to devour conspecific carcasses, they selectively oviposit on them and also consume damaged cadavers of conspecifics. Thus, our results suggest that nutritionally stressed Drosophila show distinct as well as unusual feeding behaviours that can be classified as detritivorous, cannibalistic and/or carnivorous.
Phylogenetics links monster larva to deep-sea shrimp.
Bracken-Grissom, Heather D; Felder, Darryl L; Vollmer, Nicole L; Martin, Joel W; Crandall, Keith A
2012-10-01
Mid-water plankton collections commonly include bizarre and mysterious developmental stages that differ conspicuously from their adult counterparts in morphology and habitat. Unaware of the existence of planktonic larval stages, early zoologists often misidentified these unique morphologies as independent adult lineages. Many such mistakes have since been corrected by collecting larvae, raising them in the lab, and identifying the adult forms. However, challenges arise when the larva is remarkably rare in nature and relatively inaccessible due to its changing habitats over the course of ontogeny. The mid-water marine species Cerataspis monstrosa (Gray 1828) is an armored crustacean larva whose adult identity has remained a mystery for over 180 years. Our phylogenetic analyses, based in part on recent collections from the Gulf of Mexico, provide definitive evidence that the rare, yet broadly distributed larva, C. monstrosa, is an early developmental stage of the globally distributed deepwater aristeid shrimp, Plesiopenaeus armatus. Divergence estimates and phylogenetic relationships across five genes confirm the larva and adult are the same species. Our work demonstrates the diagnostic power of molecular systematics in instances where larval rearing seldom succeeds and morphology and habitat are not indicative of identity. Larval-adult linkages not only aid in our understanding of biodiversity, they provide insights into the life history, distribution, and ecology of an organism.
Directory of Open Access Journals (Sweden)
Luciano Pamplona de Góes Cavalcanti
2007-08-01
Full Text Available OBJETIVO: Avaliar a competência de peixes na predação de larvas de Aedes aegypti, em condições de laboratório. MÉTODOS: Foram testados machos e fêmeas de cinco espécies de peixe. Os testes de predação duravam cinco semanas para cada espécie. Cada ensaio compreendia quatro caixas testes e quatro caixas controles. Das caixas controle, duas tinham somente um peixe e as outras duas, apenas larvas. Cada caixa teste continha um peixe e larvas. Na primeira semana foram expostas 100 larvas em cada caixa, e a cada semana acrescentavam-se 100 larvas por caixa/dia, até se obter um máximo de 500 larvas/dia. Comprimento e peso dos peixes foram medidos semanalmente. RESULTADOS: Foram utilizadas 369.000 larvas no total. O Trichogaster trichopteros foi a única espécie em que ambos os sexos predaram 100% das larvas oferecidas. O Betta splendens deixou de predar apenas 15 larvas. Machos do Poecilia reticulata apresentaram baixa capacidade larvófaga quando comparados às fêmeas da mesma espécie. Em relação ao peso e tamanho o Betta splendens mostrou-se capaz de predar 523 larvas/grama/dia. CONCLUSÕES: Fêmeas e machos de Trichogaster trichopteros e de Astyanax fasciatus, e fêmeas de Betta splendens e de Poecillia sphenops foram os peixes que apresentaram maior competência para predar as larvas. Embora com competência menor, machos de Poecillia sphenops e fêmeas de Poecilia reticulata foram capazes de eliminar o número de larvas de Aedes aegypti que possam emergir durante 24 horas num criadouro, em condições naturais. Machos de Poecilia reticulata não foram predadores eficazes.OBJECTIVE: To evaluate the efficacy of fish as predators of the Aedes aegypti larvae in laboratory conditions. METHODS: The male and female of five different fish were included in the experiment. The tests to measure their consumption ability lasted five weeks for each species. Each trial involved four test tanks and four control tanks. Two control tanks
Weight changes and organ pathology in rats given edible larvae of ...
African Journals Online (AJOL)
Processing the larvae by boiling and sun-drying reduced the toxicity on the liver and heart but not in the kidney. More research is needed on the toxicological aspects of the consumption of Cirina forda larva. Keywords: insect larvae, processing, entomophagy, histopathology, rats. African Journal of Biomedical Research Vol.
DISTRIBUSI, KELIMPAHAN DAN VARIASI UKURAN LARVA IKAN DI ESTUARIA SUNGAI MUSI
Directory of Open Access Journals (Sweden)
Eko Prianto
2016-03-01
Full Text Available Penelitian tentang distribusi, kelimpahan dan ukuran larva ikan dilakukan pada bulan Maret, Mei, Juni dan Oktober 2011. Stasiun pengambilan contoh meliputi Muara Delta Upang (stasiun 1, Muara Sungai Musi (stasiun 2 dan Pulau Payung (stasiun 3. Pengambilan larva pada siang hari menggunakan Bongo net yang berukuran mata jaring 250 µm. Hasil identifikasi diperoleh 13 famili ditinjau menurut musim, pada bulan Mei dan Oktober masing-masing diperoleh 7 famili, dan pada bulan juni sebanyak 3 famili. Kelimpahan larva ikan berkisar antara 9-46 ind/m3 dengan jumlah yang tertinggi (46 ind/m3 pada bulan Mei dan terendah pada bulan Juni (9 ind/m3. Larva ikan dari famili Gobiidae memiliki sebaran yang cukup luas baik spasial maupun temporal. Variasi ukuran larva ikan menurut famili setiap bulannya memiliki variasi ukuran yang hampir sama. Research about the distribution, abundance and size of fish larvae was conducted in March, May, June and October 2011. Sampling stations encompasses Delta Upang (station 1, Muara Sungai Musi (station 2 and Pulau Payung (station 3. Larvae taken during the daytime using a Bongo net with mesh size of 250 µm. Identification results obtained 13 families based on the season, in May and October respectively 7 families, and in June as many as 3 families. Abundance of fish larval around 9-46 ind/m3 with the highest number (46 ind/m3 in May and the lowest in June (9 ind/m3. Larvae of Gobiidae family have a large distribution on spatial and temporal. The variation in size of fish larvae by family on each month are the same.
PREVALENCE OF ANISAKID NEMATODE LARVAE INFECTING SOME MARINE FISHES FROM THE LIBYAN COAST.
Kassem, Hamed H; Bowashi, Salem Mohamed
2015-12-01
This study examined eight hundred ninety six marine fishes belonging to nine different fish species; Synodus saurus; Merluccius merluccius; Trachurus mediterraneus; Serranus cabrilla; Mullus surmuletus; Diplodus annularis; Spicara maena; Siganus rirulatus and Liza ramada. The fishes were bought from fish markets at five different sites on Libyan coast, from January to December 2013, for study the anisakids larvae among them. The results showed that 344/896 fishes (38.4%) were infected with Anisakids larvae. S. saurus was the highly infected (80.9%), followed by T mediterraneus (77.5%) but, S. cabrilla, S. maena, M merluccius, M surmuletus, and D. annularis were least anisakid infected showed rates of 58.2%, 53.8%, 43.7%, 36.7% & 3.6%, respectively. No parasites were in S. rirulatus and L, ramada. Ten species of Anisakids larvae was detected during the present study. Two Pseudoterranova sp. Larvae, two types of Anisakis larvae, Anisakis simplex larva and Anisakis sp. Larva, two types of Contracaecum sp. Larvae and four Hysterothylacium larvae. Females showed higher prevalence than males. The number of anisakid larvae varied according to body length and weight of infected fish, without significant difference between prevalence and seasons, but, a significant difference was between prevalence and regions.
Lagrangian Observations and Modeling of Marine Larvae
Paris, Claire B.; Irisson, Jean-Olivier
2017-04-01
Just within the past two decades, studies on the early-life history stages of marine organisms have led to new paradigms in population dynamics. Unlike passive plant seeds that are transported by the wind or by animals, marine larvae have motor and sensory capabilities. As a result, marine larvae have a tremendous capacity to actively influence their dispersal. This is continuously revealed as we develop new techniques to observe larvae in their natural environment and begin to understand their ability to detect cues throughout ontogeny, process the information, and use it to ride ocean currents and navigate their way back home, or to a place like home. We present innovative in situ and numerical modeling approaches developed to understand the underlying mechanisms of larval transport in the ocean. We describe a novel concept of a Lagrangian platform, the Drifting In Situ Chamber (DISC), designed to observe and quantify complex larval behaviors and their interactions with the pelagic environment. We give a brief history of larval ecology research with the DISC, showing that swimming is directional in most species, guided by cues as diverse as the position of the sun or the underwater soundscape, and even that (unlike humans!) larvae orient better and swim faster when moving as a group. The observed Lagrangian behavior of individual larvae are directly implemented in the Connectivity Modeling System (CMS), an open source Lagrangian tracking application. Simulations help demonstrate the impact that larval behavior has compared to passive Lagrangian trajectories. These methodologies are already the base of exciting findings and are promising tools for documenting and simulating the behavior of other small pelagic organisms, forecasting their migration in a changing ocean.
DEFF Research Database (Denmark)
Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf
2014-01-01
A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...
Three different agglomerations of blood cells in a Caliroa limacina larva
Barendrecht, G.
1949-01-01
Some time ago in our laboratory a number of larvae of Caliroa limacina Retz., the well known slug like sawfly larva of the pear, were fixed in toto and sectioned into complete series, which were coloured with EHRLICH’S or HEIDENHAIN’S haematoxylin and counterstained with eosin. Most of these larvae
Chrysomya megacephala (Fabricius) larvae: A new biodiesel resource
International Nuclear Information System (INIS)
Li, Zhuoxue; Yang, Depo; Huang, Miaoling; Hu, Xinjun; Shen, Jiangang; Zhao, Zhimin; Chen, Jianping
2012-01-01
Highlights: ►Chrysomya megacephala larvae oil as a new resource transforming to biodiesel. ► Larvae were grown up on restaurant garbage for five days then oil was extracted. ► Oil content in larvae was 24.40 wt% to 26.29 wt% comparing to soybean of 20 wt%. ► Utilization of garbage reduces pollution and makes economic recycle possible. ► The properties of ultimately FAME reach the ASTM D6751 and EN 14124 standards. -- Abstract: The current energy crisis greatly affects worldwide economic development. Therefore, identifying for new energy resources is critically important. In this study, we introduce a potential biodiesel source: Chrysomya megacephala (Fabricius) larvae (CML), which are proliferative and can be fed with a variety of low cost materials, such as manure, wheat bran, rotted meat and decayed vegetation. The potential of C. megacephala (Fabricius) larvae oil (CMLO) for biodiesel applications was explored. Oil was extracted from the CML raised by feeding on restaurant garbage for five days. The oil content obtained from the dehydrated CML ranged from 24.40% to 26.29% since restaurant garbage varies in composition day to day. The acid value of the CMLO was tested to be 1.10 mg KOH/g. Four factors were subsequently considered to optimize the transesterification of CMLO to biodiesel. The optimized conditions included a 6:1 methanol to oil molar ratio, 1.6% KOH catalyst, a reaction temperature of 55 °C and a reaction time of 30 min. Under these conditions, the maximum yield of fatty acid methyl esters (FAME) from CMLO was 87.71%. Finally, properties of the FAME were within the specifications of ASTM D6751 and EN 14214 biodiesel standards. Therefore, we concluded that C. megacephala (Fabricius) larvae represent a potential alternative feedstock for biodiesel production.
Vaccination of lambs with irradiated larvae of Bunostomum trigonocephalum
International Nuclear Information System (INIS)
Srivastava, V.K.; Singh, K.S.; Subramanian, G.
1987-01-01
Vaccination with a single dose of 2,000 infective larvae of Bunostomum trigonocephalum, irradiated at 40 kR, caused 80 per cent reduction in worm establishment and such lambs withstood a challenge infection which was otherwise fatal to non-vaccinated lambs. The female worms, which developed from irradiated larvae, were irregular in shape, had cuticular thickening at the genital opening and in many male worms the copulatory bursa was rudimentary. The sex ratio was adversely affected in worms developing from irradiated larvae. The population had preponderant sterile females and a very few male worms. (author)
Directory of Open Access Journals (Sweden)
Cláudia Maria Reis Raposo Maciel
2010-05-01
Full Text Available The objective of this work was to study the morphologic development and the swimming and feeding behaviors of piracanjuba larvae, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae, during the period from zero to 172 hours after hatching (standard length = 3.62 - 11.94 mm. The morphological analyses were accomplished by using a trinocular stereo microscope, while the behavioral analyses were performed through periodic observations. In 28 hours after hatching, the larvae (standard length = 6.25 ± 0.13 mm showed the following structural and behavioral characteristics that made them become active predators able to overcome a larval critical phase, the beginning of exogenous feeding: presence of pigmented eyes, terminal and wide mouth, developed oral dentition, developing digestive tube, yolk sac reduction, fins and swim bladder formation, horizontal swimming, cannibalism, and predation. Intense cannibalism among larvae was verified from 26 to 72 hours. At the end of the metamorphosis - 172 hours after hatching - the larvae measuring 11.94 + 0.80 mm in standard length presented a flexed notochord, caudal fin bifurcation, dorsal and anal fin formation, synchronized movements, and formation of shoals, characteristics that together allow enhanced perception and locomotio in exploration of the environment, determining the best moment for transfering to the fishponds. New studies can contribute to commercial fish farming by improving feeding management, performance, survival, and productivity of this species.Objetivou-se estudar o desenvolvimento morfológico e os comportamentos natatório e alimentar de larvas de piracanjuba, Brycon orbignyanus Valenciennes (1849 (Characiformes, Characidae, Bryconinae no período de 0 a 172 horas após a eclosão (comprimento-padrão = 3,62 - 11,94 mm. As análises morfológicas foram realizadas com auxílio de um microscópio estereoscópico trinocular e as comportamentais, por meio de
Assessment of Clarias gariepinus as a biological control agent against mosquito larvae.
Chala, Buze; Erko, Berhanu; Animut, Abebe; Degarege, Abraham; Petros, Beyene
2016-05-31
The emergence and spread of insecticide resistant mosquitoes renewed interest in investigating the use of larvivorous fish as a biological control agent. The potential of Clarias gariepinus fish in controlling Anopheles arabiensis and culicine larvae was assessed under laboratory and semi-field conditions. Small size (15-20 cm) C. gariepinus fish consumed greater number of mosquito larvae than the large size fish (25-40 cm) in the multivariate regression model (β = 13.36, 95 % CI = 4.57, 22.15). The Anopheles larvae consumed was greater in number than the culicines larvae consumed by the fish (β = 12.10, 95 % CI = 3.31, 20.89). The number of larvae consumed was greater during the night hours than during the light hours (β = 30.06, 95 % CI = 21.27, 38.85). Amount of supplementary fish food did not cause significant differences in the number of mosquito larvae consumed by the fish among different groups. C. gariepinus was observed to feed on mosquito larvae under laboratory and semi-field conditions. C. gariepinus fed on the larvae of An. arabiensis and culicines readily. Hence, it can be used as an alternative mosquito control agent in Ethiopia where the breeding habitats are small and localized.
Fels, van der Ine; Camenzuli, L.; Lee, Van Der M.K.; Oonincx, D.G.A.B.
2016-01-01
Insects have potential as a novel source of protein in feed and food production in Europe, provided they can be used safely. To date, limited information is available on the safety of insects, and toxic elements are one of the potential hazards of concern. Therefore, we aimed to investigate the
International Nuclear Information System (INIS)
Sharma, R.L.; Dhar, D.N.
1987-01-01
Infective Oesophagostomum columbianum larvae were successfully attenuated by exposing them to a gamma radiation dose levels of either 40 or 50 Krad. Lambs receiving a single vaccination dose of 2000 infective larvae attenuated at 40 Krad developed partial protection, whereas those vaccinated with similar dose of infection with 50 Krad irradiated larvae failed to develop any protection. A double vaccination schedule comprising of 500 and 2000 gamma attenuated (40 Krad) infective larvae induced a significantly higher level of protection against the challenge dose. The possible use of radiation attenuated larvae as vaccine for immunoprophylaxis against ovine Oesophagostomiasis has been discussed. (author). 11 refs., 2 tables
Sun-Compass Orientation in Mediterranean Fish Larvae
Faillettaz , Robin; Blandin , Agathe; Paris , Claire B.; Koubbi , Philippe; Irisson , Jean-Olivier
2015-01-01
International audience; Mortality is very high during the pelagic larval phase of fishes but the factors that determine recruitment success remain unclear and hard to predict. Because of their bipartite life history , larvae of coastal species have to head back to the shore at the end of their pelagic episode , to settle. These settlement-stage larvae are known to display strong sensory and motile abilities, but most work has been focused on tropical, insular environments and on the influence...
Activity of R(+ limonene against Anisakis larvae
Directory of Open Access Journals (Sweden)
Filippo Giarratana
2015-12-01
Full Text Available The aim of this work is to evaluate the activity of R(+ limonene of against Anisakidae larvae. Its effectiveness was tested in vitro. The results obtained showing a significant activity of the compound against Anisakis larvae, suggesting further investigation on its potential use in the industrial marinating process. In this regard, the use of R(+ limonene in seafood products could be interesting, also due the sensory attributes resulting from its use and its relatively safe status.
Fan, Yinjun; Shi, Xueyan
2017-09-01
In order to characterize the metabolic transformation of thiamethoxam (TMX) to clothianidin (CLO) in Helicoverpa armigera larvae and clarify its relationship with the insecticidal toxicity of TMX, method for determination of TMX and its metabolite clothianidin (CLO) residues in H. armigera larvae by solid phase extraction (SPE) combined UPLC-MS/MS was established. Following acetonitrile extraction and purification by SPE on florisil cartridge and C 18 cartridge sequently, and cleanup by PSA adsorption, TMX and CLO residues in H. armigera larvae were successfully determined by UPLC-MS/MS. By using the established method, the concentration-time curves of TMX and its metabolite CLO in H. armigera larvae in vivo and metabolism of TMX by microsome of H. armigera larvae midguts in vitro were studied. TMX was quickly eliminated from H. armigera larvae with the elimination half-life as 4.2h. Meanwhile, only a small amount of CLO was formed from TMX metabolism, with the maximum CLO level in H. armigera larvae only accounts for the metabolic transformation of 7.99% of TMX, at 10h after intravenous TMX administration. Our results suggested that the low insecticidal efficacy of TMX against H. armigera larvae was related with the rapidly elimination of TMX from H. armigera larvae, meanwhile, CLO as TMX metabolite at a very low level in vivo didn't contribute to TMX toxicity to H. armigera larvae. In H. armigera larvae, TMX didn't act as proinsecticide for CLO in insecticidal efficacy of TMX. Copyright © 2017 Elsevier B.V. All rights reserved.
Production of live prey for marine fish larvae
Kraul, S
1989-01-01
Tropical marine fish larvae vary in their requirements for live planktonic food. Selection of live prey species for culture depends on larval size and larval tolerance of water quality. This report describes some of the cultured prey species, and their uses and limits as effective food for fish larvae. Methods are presented for the culture of phytoplankton, rotifers, copepods, and other live feeds.
Larvacidal Effect of Imperata Cylindrical Root Decoction against Culex sp. Larvae
Directory of Open Access Journals (Sweden)
Afini Tiara Resi
2014-08-01
Full Text Available Background: Filariasis is one of the neglected tropical diseases. About 337 of 401 districts in Indonesia are endemic areas for filariasis, especially in Sumatera, Kalimantan, and Papua. Culex sp. is one of the lymphatic filariasis vectors which can be controlled by insecticide, including larvacide. This study was conducted to determine the larvacidal effect of Imperata cylindrical root decoction against Culex sp. larvae. Methods: This study was conducted at the Laboratory of Parasitology, Faculty of Medicine, Universitas Padjadjaran during the period of September to November 2012. The study object was Culex sp. larvae III/IV instars. The design of this study was experimental laboratory using true experimental approach. The larvae were divided into three groups: negative control (distilled water, reference (Abate®, and decoction. The number of larvae in each group was 25 larvae, and the effects were evaluated by the total number of dead larvae in 48 hours under observation. The data were then analyzed by Mann-Whitney test and Probit test. Results: The result of the Mann-Whitney test to compare Imperata cylindrica root decoction treatment to distilled water as control was significant (p<0.05. However, Abate® gave a better result. The Probit test resultwas LC50: 63% and LC90: 489%. Conclusions: Imperata cylindrical root decoction has a larvacidal effect against Culex sp. larvae.
Preliminary study of killing the larva of plodia interpunella by irradiation
International Nuclear Information System (INIS)
Wang Jide; Ma Xiaoping
1994-01-01
The results of killing the larva of plodia interpunella in the fruit by 60 Co γ-irradiation are described. The lowest effective dose for killing larva by irradiation is ca. 2000 Gy; the effective dose for immediately killing larva is 3000 Gy. The method is simple and easy and also suitable for the study of commercial irradiation of dry-fruit
Ice-surface adsorption enhanced colligative effect of antifreeze proteins in ice growth inhibition
Mao, Yougang; Ba, Yong
2006-09-01
This Communication describes a mechanism to explain antifreeze protein's function to inhibit the growth of ice crystals. We propose that the adsorption of antifreeze protein (AFP) molecules on an ice surface induces a dense AFP-water layer, which can significantly decrease the mole fraction of the interfacial water and, thus, lower the temperature for a seed ice crystal to grow in a super-cooled AFP solution. This mechanism can also explain the nearly unchanged melting point for the ice crystal due to the AFP's ice-surface adsorption. A mathematical model combining the Langmuir theory of adsorption and the colligative effect of thermodynamics has been proposed to find the equilibrium constants of the ice-surface adsorptions, and the interfacial concentrations of AFPs through fitting the theoretical curves to the experimental thermal hysteresis data. This model has been demonstrated by using the experimental data of serial size-mutated beetle Tenebrio molitor (Tm) AFPs. It was found that the AFP's ice-surface adsorptions could increase the interfacial AFP's concentrations by 3 to 4 orders compared with those in the bulk AFP solutions.
Foraging behavior and virulence of some entomopathogenic nematodes
Directory of Open Access Journals (Sweden)
Manana A. Lortkipanidze
2016-06-01
Full Text Available At present the biological control as a pest control technology is becoming more desirable. Biological formulations on basis of entomopathogenic nematodes are one of the effective means for the protection of agricultural and forest plants from harmful insects. Nowadays, the use of entomopathogenic nematodes as biological control agents is a key component in IPM system. The foraging strategies of entomopathogenic nematodes (EPNs vary between species. This variation is consistent with use of different foraging strategies between ambush, cruise and intermediate to find their host insects. In order to ambush prey, some species of EPNs nictate, or raise their bodies of the soil surface so they are better poised to attach passing insects, other species adopt a cruising strategy and rarely nictate. Some species adopt an intermediate strategy between ambush and cruise. We compared in laboratory the foraging strategies of the entomopathogenic nematode species: Steinernema carpocapsae, Heterorhabditis bacteriophora and the recently described species Steinernema tbilisiensis and assessed their virulence against mealworm beetle, Tenebrio molitor L. (Coleoptera: Tenebrionidae. The tests showed that S. tbilisiensis adopts both foraging strategies.
Hydrodynamics of insect spermatozoa
Pak, On Shun; Lauga, Eric
2010-11-01
Microorganism motility plays important roles in many biological processes including reproduction. Many microorganisms propel themselves by propagating traveling waves along their flagella. Depending on the species, propagation of planar waves (e.g. Ceratium) and helical waves (e.g. Trichomonas) were observed in eukaryotic flagellar motion, and hydrodynamic models for both were proposed in the past. However, the motility of insect spermatozoa remains largely unexplored. An interesting morphological feature of such cells, first observed in Tenebrio molitor and Bacillus rossius, is the double helical deformation pattern along the flagella, which is characterized by the presence of two superimposed helical flagellar waves (one with a large amplitude and low frequency, and the other with a small amplitude and high frequency). Here we present the first hydrodynamic investigation of the locomotion of insect spermatozoa. The swimming kinematics, trajectories and hydrodynamic efficiency of the swimmer are computed based on the prescribed double helical deformation pattern. We then compare our theoretical predictions with experimental measurements, and explore the dependence of the swimming performance on the geometric and dynamical parameters.
The pro-apoptotic action of the peptide hormone Neb-colloostatin on insect haemocytes.
Czarniewska, E; Mrówczynska, L; Kuczer, M; Rosinski, G
2012-12-15
The gonadoinhibitory peptide hormone Neb-colloostatin was first isolated from ovaries of the flesh fly Neobellieria bullata. This 19-mer peptide is thought to be a cleaved product of a collagen-like precursor molecule that is formed during remodelling of the extracellular matrix. In this study, we report that upon injection of picomolar and nanomolar doses, this peptide exerts a pro-apoptotic action on haemocytes of Tenebrio molitor adults, as visualized by changes in morphology and viability. The F-actin cytoskeleton was found to aggregate into distinctive patches. This may be responsible for the observed inhibition of adhesion of haemocytes and for the stimulation of filopodia formation. However, Neb-colloostatin injection did not induce the formation of autophagic vacuoles. Our results suggest that physiological concentrations of Neb-colloostatin play an important role in controlling the quantity and activity of haemocytes in insect haemolymph. They also suggest that during periods in which Neb-colloostatin is released, this peptide may cause a weakening of the insects' immune system. This is the first report that exposure to a peptide hormone causes apoptosis in insect haemocytes.
Antimicrobial defence and persistent infection in insects revisited.
Makarova, Olga; Rodríguez-Rojas, Alexandro; Eravci, Murat; Weise, Chris; Dobson, Adam; Johnston, Paul; Rolff, Jens
2016-05-26
Insects show long-lasting antimicrobial immune responses that follow the initial fast-acting cellular processes. These immune responses are discussed to provide a form of phrophylaxis and/or to serve as a safety measure against persisting infections. The duration and components of such long-lasting responses have rarely been studied in detail, a necessary prerequisite to understand their adaptive value. Here, we present a 21 day proteomic time course of the mealworm beetle Tenebrio molitor immune-challenged with heat-killed Staphylococcus aureus The most upregulated peptides are antimicrobial peptides (AMPs), many of which are still highly abundant 21 days after infection. The identified AMPs included toll and imd-mediated AMPs, a significant number of which have no known function against S. aureus or other Gram-positive bacteria. The proteome reflects the selective arena for bacterial infections. The results also corroborate the notion of synergistic interactions in vivo that are difficult to model in vitroThis article is part of the themed issue 'Evolutionary ecology of arthropod antimicrobial peptides'. © 2016 The Author(s).