WorldWideScience

Sample records for temperature cfb gasifier

  1. The Low temperature CFB gasifier

    DEFF Research Database (Denmark)

    Stoholm, P.; Nielsen, Rasmus Glar; Fock, Martin W.

    2003-01-01

    The Low Temperature Circulating Fluidised Bed (LT-CFB) gasification process aims at avoiding problems due to ash deposition and agglomeration when using difficult fuels such as agricultural biomass and many waste materials. This, as well as very simple gas cleaning, is achieved by pyrolysing......W LT-CFB test plant located at the Technical University of Denmark. In the latest 10-hour experiment the fuel was wheat straw containing 1,3-1,6% potassium, 0,6% chlorine and 12,2% ash (dry basis), and the bed material was ordinary silica sand without additives. The bed material was reused from 45...

  2. The Low Temperature CFB Gasifier

    DEFF Research Database (Denmark)

    Stoholm, P.; Nielsen, Rasmus Glar; Richardt, K.

    2004-01-01

    straw, animal manure and waste and for co-firing the product gas in existing, e.g. coal fired power plant boilers. The aim is to prevent fouling, agglomeration and high temperature corrosion caused by potassium and chlorine and other fuel components when producing electricity. So far 92 hours...

  3. The Low Temperature CFB Gasifier - Further Test Results and Possible Applications

    DEFF Research Database (Denmark)

    Stoholm, P.; Nielsen, Rasmus Glar; Sarbæk, L.

    2002-01-01

    The novel "Low Temperature Circulating Fluidised Bed" (LT-CFB) gasification process is described together with the most recent results from the 50 kW LT-CFB test plant located at the Technical University of Denmark. The LT-CFB concept aims at avoiding problems due to ash sintering/agglomeration a......The novel "Low Temperature Circulating Fluidised Bed" (LT-CFB) gasification process is described together with the most recent results from the 50 kW LT-CFB test plant located at the Technical University of Denmark. The LT-CFB concept aims at avoiding problems due to ash sintering...... was approx. 3,5 mass% of supplied amount of fuel, and the content of PAH in the ash was only around 2 mg/kg. The most recent test results and anticipated applications are described in this paper. Keywords: gasification, biomass conversion, circulating fluidised bed (CFB)...

  4. LT-CFB. Applications and follow-up. Oestkraft. Appendix 2. [Low Temperature Circulating Fluid Bed gasifier]; LT-CFB. Anvendelsesmuligheder og opfoelgning. Oestkraft. Bilag 2

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-04-15

    This appendix describes a feasibility study on the gasification of straw in a Low Temperature Circulating Fluid Bed (LT-CFB) at the CHP plant Oestkraft Production A/S. The straw to be used is assumed purchased from local farmers. The annual amount of straw is estimated at 20,000 tons. The straw's upper calorific value is 20.1 MJ / kg. Distributed on 8760 annual operating hours the straw will have a thermal efficiency in the gasifier at 8.3 MW (net calorific value). The product gas from the gasifier is used as a supplemental fuel in an existing boiler, which today is fired with coal or oil. The feasibility study includes a comprehensive proposal for construction of the facility, forecasting of investment and the development of economy model to calculate the profitability of the project. The project proposal is based on the plant annually using 20,000 tons of straw for product gas over 8,760 production hours. The result of the economic analyses shows that the costs exceed the income, and thus there is a negative payback period for the project. Investment demand is calculated to approx. 66 million DKK. (LN)

  5. LT-CFB. Applications and follow-up. DAKA. Appendix 3. [Low Temperature Circulating Fluid Bed gasifier]; LT-CFB. Anvendelsesmuligheder og opfoelgning. DAKA. Bilag 3

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-04-15

    This appendix describes how LT-CFB advantageously can gasify residues in the form of bone meal from the production at the company DAKA's factory. 37,000 tons of biomass is produced annually, which has a gross calorific value of 15.6 MJ / kg. Distributed on 6000 annual operating hours the biomass represent power of 25 MW (net calorific value). The residue is proposed converted to a gas (product gas) in a gasification process. The product gas is used as fuel in a newly combined heat and power unit, from which the steam produced is delivered to the existing process plants, and where the electricity is produced to the grid. The product gas is the main fuel, and natural gas is used as auxiliary firing. The project aims to assess the profitability of the project. In addition to savings in gas purchases, the product gas also leads means a significant reduction in CO{sub 2} emissions, the product gas being characterized as CO{sub 2} neutral. The feasibility study includes a comprehensive proposal for construction of the facility, forecasting of investment and the development of economy model to calculate the profitability of the project. The project proposal is based on the plant annually using 37,000 tons of bone meal for product gas in 6,000 production hours. The gasifier has the effect of 25 MW gross calorific value, and 2.7 MW of electricity is produced. The required investment is calculated to approx. 200 million DKK. The economic analysis shows a payback time of 5.6 years. (LN)

  6. LT-CFB. Applications and follow-up. CP Kelco. Appendix 1. [Low Temperature Circulating Fluid Bed gasifier]; LT-CFB. Anvendelsesmuligheder og opfoelgning. CP Kelco. Bilag 1

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-04-15

    This appendix describes how LT-CFB advantageously can gasify residual products at the company CP Kelco's factory. CP Kelco produces the gelation, thickeners and stabilizers carrageenan and pectin from seaweed and citrus peel. Residues from the production consist of a fiber-containing biological material, which has a calorific value of dry matter about 15 to 20 MJ / kg. In addition, there are waste products from the wastewater treatment plant, which are also proposed re-used in the project. The report describes the economic analyses, the overall data and system design for two scenarios, whereas the description of the plant capacities, sizes and detailed data etc. are described only for one scenario. In addition to savings in the purchase of natural gas the gas production also results in a significant reduction in CO{sub 2} emissions, the product gas being characterized as CO{sub 2} neutral. Since CP Kelco is subject to the CO{sub 2} quota system the saved amount of CO{sub 2} emissions represents a significant value. In the economic analyses, the value of 1 ton of CO{sub 2} is set at DKK 100. (LN)

  7. LT-CFB. Further development and commercialization. Final report. [Low Temperature Circulating Fluid Bed gasifier]; LT-CFB. Videreudvikling og kommercialisering. Slutrapport

    Energy Technology Data Exchange (ETDEWEB)

    Stoholm, P. [DFBT, Roskilde (Denmark); Birk Henriksen, U.; Ahrentfeldt, J. [Technical Univ. of Denmark. DTU Chemical Engineering, CHEC Research Centre, Roskilde (Denmark); Cramer, J.; Dietrich, J.; Christiansen, Knud [FORCE Technology, Kgs. Lyngby (Denmark); Krogh, J. [Anhydro A/S, Soeborg (Denmark)

    2011-12-15

    The starting point for the project was the good results achieved in a previous project, in which a series of experiments were carried out with a 500 kW pilot plant at teh Technical University of Denmark. The main task was then to find a way forward towards further scale-up, demonstration and commercialization. The project's partners chose to study three possible sites for demonstration. However, during the project both framework conditions as well as DONG Energy's strategy changed, which resulted in the company taking over the LT-CFB technology in December 2009. As a first step a 6 MW demonstration plant will now be set up at the Asnaes power plant expected to start in spring 2011. The project has also been buit a new mobile 100 kW LT-CFB plant for the further optimization of the process and for short-term trials of new fuels. At the new plant a number of successful trials were performed with straw and residual fibers. Furthermore, it is experimentally demonstrated that it is possible to cool the tar-containing gas to approx. 300 degrees C and purify the gas in a bag filter, so it can be used in natural gas-fired power plant boilers. With the new mobile system, it will now be easier to perform experiments with a number of new fuels such as unsorted municipal waste, bone meal and dried sewage sludge. (LN)

  8. Experimental Study on Ash-Returned Reactor of CFB Atmospheric Air Gasifier

    Science.gov (United States)

    Shihong, Zhang; Luning, Tian; Xianrong, Zhou; Hanping, Chen; Haiping, Yang; Xianhua, Wang

    In an attempt to improve the gasification efficiency and decrease the carbon content in fly ash of atmospheric air CFB gasifiers, an innovatory equipment by name ash-returned reactor is put forward by SKLCC. Ash-returned reactor is an ash-returned apparatus on line of ash circulation, typically like "U" type valve in CFB boilers, with additional function of some extent combustion of residual carbon and increase the furnace inlet temperature of returning ash, and hence the coal conversion of gasifiers is enhanced. As to its configuration compared to conventional "U" type valve, ash-returned rector has two distinguished features of several times of height scale of fluidizing transportation region to meet the combustion reaction time need and appropriate heat transfer tube bundles arranged in the region to moderate the local temperature so as to avoid slagging. And hence, corresponding to the structure renovation, the material transportation and regulation performance of ash-returned reactor is primarily investigated through a series of experiments in a cold lab-scale facility in this paper. The heat transfer characteristic of the tube bundles is then researched and its influential factors are further discussed. These works lay a foundation on the following study of hot state experiments and industrial applications.

  9. High temperature corrosion in gasifiers

    Directory of Open Access Journals (Sweden)

    Wate Bakker

    2004-03-01

    Full Text Available Several commercial scale coal gasification combined cycle power plants have been built and successfully operated during the last 5-10 years. Supporting research on materials of construction has been carried out for the last 20 years by EPRI and others. Emphasis was on metallic alloys for heat exchangers and other components in contact with hot corrosive gases at high temperatures. In this paper major high temperature corrosion mechanisms, materials performance in presently operating gasifiers and future research needs will be discussed.

  10. THE LT-CFB GASIFIER – FIRST TEST RESULTS FROM THE 500 KW TEST PLANT

    DEFF Research Database (Denmark)

    Nielsen, Rasmus Glar; Stoholm, Peder; Nielsen, Mads Brix

    2005-01-01

    on pig manure (44% ash, dry). All the tests have been very stable and a steady state content of ash components, e.g. potassium, in the ash and bed material was reached. The low temperature (max. 750°C) ensures that there are no agglomeration problems, and that almost 100% of K, Si, Ca and P is kept......The Low Temperature Circulating Fluidised Bed (LT-CFB) gasification process is briefly described together with the first test results from the new 500 kW test plant. The process aims primarily at co-firing low grade biomass and waste products at power plants and offer several advantages to directly...... co-firing: E.g. the ashes of different fuels can be kept separate, and corrosion and fouling of the furnace can be drastically reduced. Three fuels have been tested so far on this plant: High ash straw (12% ash, dry), dry matter from pig manure (28% ash, dry) and dry matter from biogas residue based...

  11. Biomass CFB gasifier connected to a 350 MW{sub t}h steam boiler fired with coal and natural gas - THERMIE demonstration project in Lahti in Finland

    Energy Technology Data Exchange (ETDEWEB)

    Palonen, J. [Foster Wheeler Energia Oy, Varkaus (Finland). Varkaus Global New Products

    1997-12-31

    The successful experience in developing the advanced Foster Wheeler Energi Oy`s (former Ahlstroem Pyropower) Circulating Fluidized Bed combustion system subsequently led to the development of the CFB gasification technology in the early 1980s. The driving force for the developing work was the dramatic increase in oil price during the oil crises. The primary advantage of CFB gasification technology is that the it enables the substitution of expensive fuels e.g. oil or gas with cheap solid fuels. These cheap fuels are typically different types of waste woods, bark or other biofuels. In the CFB gasifier these solid fuels are converted to gaseous fuel which can be used instead of other expensive fuels. In some cases this also solves a waste disposal problem, providing a secondary economic and environmental benefit. Foster Wheeler Energia Oy has supplied four commercial scale atmospheric CFB gasifiers in the mid 80s to the pulp and paper industry with capacities from 17 to 35 MW based on fuel input. These applications utilize waste wood as feedstock and the units are still successfully operation today. Lahden Laempoevoima Oy is a Finnish power company producing power and district heat for the city of Lahti. The company is 50 % owned by the city of Lahti and 50 % by Imatran Voima Oy, which is the largest utility power company in Finland. Lahden Laempoevoima Oy operates the Kymijaervi power plant locating nearby the city of Lahti in Southern Finland. To keep the energy prices as low as possible, Lahden Laempoevoima is continuously looking for the most economical fuel sources, and simultaneously, trying to improve the environmental acceptability of the energy production. At the moment, about 300 GWh/a different type of biofuels and refuse fuels are available in the Lahti area. On an annual basis, the available amount of biofuels and refuse fuels is enough to substitute for about 15 % of the fuels burned in the main boiler equalling max 30 % of coal. The aim in this Lahden

  12. Behavior of Alkali Metals and Ash in a Low-Temperature Circulating Fluidized Bed (LTCFB) Gasifier

    DEFF Research Database (Denmark)

    Narayan, Vikas; Jensen, Peter Arendt; Henriksen, Ulrik Birk

    2016-01-01

    and a minor fraction of Cl. Most Cl and S were released in gaseous form, with chlorine partly asmethyl chloride. The tar in the product gas from the LTCFB gasifier contained only negligible amounts of potassium and otherinorganic elements. The release of condensed ash species from the system was controlled......A low-temperature circulating fluidized bed system (LTCFB) gasifier allows for pyrolysis and gasification to occurat low temperatures, thereby improving the retention of alkali and other inorganic elements within the system and minimizingthe amount of ash species in the product gas. In addition......, the low reactor temperature ensures that high-alkali biomass fuels canbe used without risk of bed defluidization. This paper presents the first investigation of the fate of alkali metals and ash in lowtemperaturegasifiers. Measurements on bed material and product gas dust samples were made on a 100 k...

  13. Development of an Acoustic Sensor On-Line Gas Temperature Measurement in Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Peter Ariessohn

    2008-06-30

    This project was awarded under U.S. Department of Energy (DOE) National Energy Technology Laboratory (NETL) Program Solicitation DE-PS26-02NT41422 and specifically addresses Technical Topical Area 2 - Gasification Technologies. The project team includes Enertechnix, Inc. as the main contractor and ConocoPhillips Company as a technical partner, who also provides access to the SG Solutions Gasification Facility (formerly Wabash River Energy Limited), host for the field-testing portion of the research. The objective of this project was to adapt acoustic pyrometer technology to make it suitable for measuring gas temperature inside a coal gasifier, to develop a prototype sensor based on this technology, and to demonstrate its performance through testing on a commercial gasifier. The project was organized in three phases, each of approximately one year duration. The first phase consisted of researching a variety of sound generation and coupling approaches suitable for use with a high pressure process, evaluation of the impact of gas composition variability on the acoustic temperature measurement approach, evaluation of the impact of suspended particles and gas properties on sound attenuation, evaluation of slagging issues and development of concepts to deal with this issue, development and testing of key prototype components to allow selection of the best approaches, and development of a conceptual design for a field prototype sensor that could be tested on an operating gasifier. The second phase consisted of designing and fabricating a series of prototype sensors, testing them in the laboratory, and developing a conceptual design for a field prototype sensor. The third phase consisted of designing and fabricating the field prototype, and testing it in the lab and in a commercial gasifier to demonstrate the ability to obtain accurate measurements of gas temperature in an operating gasifier. Following the completion of the initial 3 year project, several continuations

  14. Closing the Loop - Utilization of Secondary Resources by Low Temperature Thermal Gasification

    DEFF Research Database (Denmark)

    Thomsen, Tobias Pape

    application of low temperature thermal gasification could be applied to reduce the environmental impact of such management systems and increase the value and positive awareness of the resources in question. In the first part of this study, the Low Temperature Circulating Fluidized Bed (LT‐CFB gasifier......) is described.The LT‐CFB gasifier is a technology originally developed for pre‐processing of biomass fuels like cereal straw. In popular terms, the LT‐CFB gasification process separates the inorganic and organic fractions of the straw. The majority of the inorganic material is extracted in one or several...... different ash fractions and the organic material is converted into a hot combustible gas product, which is subsequently combusted in an adjacent boiler. This substantially reduces the influence of the fuels inorganic composition on thecombustion properties. When combining LT‐CFB gasification with existing...

  15. Correlation between the critical viscosity and ash fusion temperatures of coal gasifier ashes

    Energy Technology Data Exchange (ETDEWEB)

    Hsieh, Peter Y. [National Energy Technology Lab. (NETL), Albany, OR (United States); Kwong, Kyei-Sing [National Energy Technology Lab. (NETL), Albany, OR (United States); Bennett, James [National Energy Technology Lab. (NETL), Albany, OR (United States)

    2015-09-27

    Coal gasification yields synthesis gas, an important intermediate in chemical manufacturing. It is also vital to the production of liquid fuels through the Fischer-Tropsch process and electricity in Integrated Gasification Combined Cycle power generation. Minerals naturally present in coal become molten in entrained-flow slagging gasifiers. Molten coal ash slag penetrates and dissolves refractory bricks, leading to costly plant shutdowns. The extent of coal ash slag penetration and refractory brick dissolution depends on the slag viscosity, the gasification temperature, and the composition of slag and bricks. Here, we measured the viscosity of several synthetic coal ash slags with a high-temperature rotary viscometer and their ash fusion temperatures through optical image analysis. We made all measurements in a carbon monoxide-carbon dioxide reducing atmosphere that approximates coal gasification conditions. Empirical correlation models based on ash fusion temperatures were used to calculate critical viscosity temperatures based on the coal ash compositions. These values were then compared with those obtained from thermodynamic phase-transition models. Finally, an understanding of slag viscosity as a function of ash composition is important to reducing refractory wear in slagging coal gasifiers, which would help to reduce the cost and environmental impact of coal for chemical and electricity production.

  16. Biomass-oxygen gasification in a high-temperature entrained-flow gasifier.

    Science.gov (United States)

    Zhou, Jinsong; Chen, Qing; Zhao, Hui; Cao, Xiaowei; Mei, Qinfeng; Luo, Zhongyang; Cen, Kefa

    2009-01-01

    The technology associated with indirect biomass liquefaction is currently arousing increased attention, as it could ensure a supply of transportation fuels and reduce the use of petroleum. The characteristics of biomass-oxygen gasification in a bench-scale laminar entrained-flow gasifier were studied in the paper. Experiments were carried out to investigate the influence of some key factors, including reaction temperature, residence time and oxygen/biomass ratio, on the gasification. The results indicated that higher temperature favored H2 and CO production. Cold gas efficiency was improved by N10% when the temperature was increased from 1000 to 1400 degrees C. The carbon conversion increased and the syngas quality was improved with increasing residence time. A shorter residence resulted in incomplete gasification. An optimal residence time of 1.6 s was identified in this study. The introduction of oxygen to the gasifier strengthened the gasification and improved the carbon conversion, but lowered the lower heating value and the H2/CO ratio of the syngas. The optimal oxygen/biomass ratio in this study was 0.4. The results of this study will help to improve our understanding of syngas production by biomass high-temperature gasification.

  17. Tunable Diode Laser Sensors to Monitor Temperature and Gas Composition in High-Temperature Coal Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Hanson, Ronald [Stanford Univ., CA (United States); Whitty, Kevin [Univ. of Utah, Salt Lake City, UT (United States)

    2014-12-01

    The integrated gasification combined cycle (IGCC) when combined with carbon capture and storage can be one of the cleanest methods of extracting energy from coal. Control of coal and biomass gasification processes to accommodate the changing character of input-fuel streams is required for practical implementation of integrated gasification combined-cycle (IGCC) technologies. Therefore a fast time-response sensor is needed for real-time monitoring of the composition and ideally the heating value of the synthesis gas (here called syngas) as it exits the gasifier. The goal of this project was the design, construction, and demonstration an in situ laserabsorption sensor to monitor multiple species in the syngas output from practical-scale coal gasifiers. This project investigated the hypothesis of using laser absorption sensing in particulateladen syngas. Absorption transitions were selected with design rules to optimize signal strength while minimizing interference from other species. Successful in situ measurements in the dusty, high-pressure syngas flow were enabled by Stanford’s normalized and scanned wavelength modulation strategy. A prototype sensor for CO, CH4, CO2, and H2O was refined with experiments conducted in the laboratory at Stanford University, a pilot-scale at the University of Utah, and an engineering-scale gasifier at DoE’s National Center for Carbon Capture with the demonstration of a prototype sensor with technical readiness level 6 in the 2014 measurement campaign.

  18. Ash behavior and de-fluidization in low temperature circulating fluidized bed biomass gasifier

    DEFF Research Database (Denmark)

    Narayan, Vikas

    ensures that high-alkali biomass fuels can be used without risks of bed de-fluidization. This thesis aims to understand the behavior of alkali metals and ash in the LTCFB system. The thesis work involved measurements made on bed material and product gas dust samples on a 100kW LTCFB gasifier placed....... It was observed that of the total fuel ash entering the system, a large fraction (40-50%) of the ash was retained in the secondary cyclone bottoms and a lower amount (8-10%) was released as dust in the exit gas; the residual ash was accumulated within the fluidized bed system. A dominant fraction of alkali......Biomass is increasingly used as a fuel for power generation. Herbaceous fuels however, contain high amounts of alkali metals which get volatilized at high temperatures and forms salts with low melting points and thus condense on pipelines, reactor surfaces and may cause de-fluidization. A Low...

  19. Gasification and effect of gasifying temperature on syngas quality and tar generation: A short review

    Science.gov (United States)

    Guangul, Fiseha Mekonnen; Sulaiman, Shaharin Anwar; Raghavan, Vijay R.

    2012-06-01

    Corrosion, erosion and plugging of the downstream equipments by tar and ash particle and, low energy content of syngas are the main problems of biomass gasification process. This paper attempts to review the findings of literature on the effect of temperature on syngas quality, and in alleviating the tar and ash problems in the gasification process. The review of literature indicates that as the gasification temperature increases, concentration of the resulting H2 and carbon conversion efficiency increase, the amount of tar in the syngas decreases. For the same condition, CH4 and CO concentration do not show consistent trend when the feedstock and gasification process varies. These necessitate the need for conducting an experiment for a particular gasification process and feedstock to understand fully the benefits of controlling the gasification temperature. This paper also tries to propose a method to improve the syngas quality and to reduce the tar amount by using preheated air and superheated steam as a gasifying media for oil palm fronds (OPF) gasification.

  20. Startup, Commissioning and Operation of Fenyi 100MW CFB Boiler

    Science.gov (United States)

    Wang, Zhiwei; Yu, Wugao; Bo, Shi

    The first 100MW CFB boiler, designed by the Thermal Power Research Institute and manufactured by Harbin Boiler Company Limited, has been successfully running in Jiangxi Fenyi Power Plant since 2003. Local high ash content anthracite and lean coal that are very difficult to burn out are used in the 100 MW CFB boiler. The results of the 100MW CFB boiler shows that the CFB boiler can run in 30% MCR and startup with two under bed burners, and the boiler efficiency higher than 88% can be got after the combustion modification test. The CFB boiler can be operated with full load and reaches design parameters. The emissions of NO, N2O and CO are less than 7Omg/m3, 30mg/m3, and 125mg/m3, respectively, and SO2 less than 400mg/m3 after limestone injection. The bottom ash temperature from bed ash coolers is less than 120°C after its modification. Coal blockage at the coal storage silo is the main problem influencing the CFB boiler continuous operation. The running experiences for 5 years proved that the CFB boiler performance is successful, and the results were applied in 210 MW and 330 MW CFB Boiler design of Fenyi Power Plant.

  1. Artificial neural network models for biomass gasification in fluidized bed gasifiers

    DEFF Research Database (Denmark)

    Puig Arnavat, Maria; Hernández, J. Alfredo; Bruno, Joan Carles

    2013-01-01

    Artificial neural networks (ANNs) have been applied for modeling biomass gasification process in fluidized bed reactors. Two architectures of ANNs models are presented; one for circulating fluidized bed gasifiers (CFB) and the other for bubbling fluidized bed gasifiers (BFB). Both models determine...

  2. High temperature millimeter wave radiometric and interferometric measurements of slag-refractory interaction for application to coal gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    McCloy, John S.; Crum, Jarrod V.; Sundaram, S. K.; Slaugh, Ryan W.; Woskov, Paul P.

    2011-09-17

    Millimeter wave (MMW) radiometry can be used for simultaneous measurement of emissivity and temperature of materials under extreme environments (high temperature, pressure, and corrosive environments) such as in slagging coal gasifiers, where sensors have been identified as a key enabling technology need for process optimization. We present a state-of-the-art dual-channel MMW heterodyne radiometer with active interferometric capability that allows simultaneous radiometric measurements of sample temperature, emissivity, and flow dynamics to over 1873 K. Interferometric capability is supplied via a probe signal originating from the 137 GHz radiometer local oscillator (LO). The interferometric 'video' channels allow measurement of additional parameters simultaneously, such as volume expansion, thickness change, and slag viscosity along with temperature or emissivity. This capability has been used to demonstrate measurement of temperature and simulated coal slag infiltration into a chromia refractory brick sample as well as slag flow down a vertically placed refractory brick. Observed phenomena include slag melting and slumping, slag reboil and foam with oxygen evolution, and eventual failure of the alumina crucible through corrosion by the molten slag. These results show the promise of the MMW system for extracting quantitative and qualitative process parameters from operating slagging coal gasifiers, providing valuable information for process efficiency, control, and increased productivity.

  3. High temperature air-blown woody biomass gasification model for the estimation of an entrained down-flow gasifier.

    Science.gov (United States)

    Kobayashi, Nobusuke; Tanaka, Miku; Piao, Guilin; Kobayashi, Jun; Hatano, Shigenobu; Itaya, Yoshinori; Mori, Shigekatsu

    2009-01-01

    A high temperature air-blown gasification model for woody biomass is developed based on an air-blown gasification experiment. A high temperature air-blown gasification experiment on woody biomass in an entrained down-flow gasifier is carried out, and then the simple gasification model is developed based on the experimental results. In the experiment, air-blown gasification is conducted to demonstrate the behavior of this process. Pulverized wood is used as the gasification fuel, which is injected directly into the entrained down-flow gasifier by the pulverized wood banner. The pulverized wood is sieved through 60 mesh and supplied at rates of 19 and 27kg/h. The oxygen-carbon molar ratio (O/C) is employed as the operational condition instead of the air ratio. The maximum temperature achievable is over 1400K when the O/C is from 1.26 to 1.84. The results show that the gas composition is followed by the CO-shift reaction equilibrium. Therefore, the air-blown gasification model is developed based on the CO-shift reaction equilibrium. The simple gasification model agrees well with the experimental results. From calculations in large-scale units, the cold gas is able to achieve 80% efficiency in the air-blown gasification, when the woody biomass feedrate is over 1000kg/h and input air temperature is 700K.

  4. High temperature electrolyte supported Ni-GDC/YSZ/LSM SOFC operation on two-stage Viking gasifier product gas

    DEFF Research Database (Denmark)

    Hofmann, P.; Schweiger, A.; Fryda, L.

    2007-01-01

    and tar traces. The chosen SOFC was electrolyte supported with a nickel/gadolinium-doped cerium oxide (Ni-GDC) anode, known for its carbon deposition resistance. Through humidification the steam to carbon ratio (S/C) was adjusted to 0.5, which results in a thermodynamically carbon free condition......This paper presents the results from a 150 h test of a commercial high temperature single planar solid oxide fuel cell (SOFC) operating on wood gas from the Viking two-stage fixed-bed downdraft gasifier, which produces an almost tar-free gas, that was further cleaned for particulates, sulphur...

  5. Dicty_cDB: CFB766 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFB766 (Link to dictyBase) - - - Contig-U16243-1 CFB766P (Link to Original site) CFB...766F 540 CFB766Z 641 CFB766P 1181 - - Show CFB766 Library CF (Link to library) Clone ID CFB...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFB7-C/CFB766Q.Seq.d/ Representative seq. ID CFB...766P (Link to Original site) Representative DNA sequence >CFB766 (CFB766Q) /CSM/CF/CFB7-C/CFB...A Score E Sequences producing significant alignments: (bits) Value CFB766 (CFB766Q) /CSM/CF/CFB7-C/CFB766Q.S

  6. Low temperature circulating fluidized bed gasification and co-gasification of municipal sewage sludge

    DEFF Research Database (Denmark)

    Thomsen, Tobias Pape; Hauggaard-Nielsen, Henrik; Gøbel, Benny

    2017-01-01

    The study is part 2 of 2 in an investigation of gasification and co-gasification of municipal sewage sludge in low temperature gasifiers. In this work, solid residuals from thermal gasification and co-gasification of municipal sewage sludge were investigated for their potential use as fertilizer....... Ashes from five different low temperature circulating fluidized bed (LT-CFB) gasification campaigns including two mono-sludge campaigns, two sludge/straw mixed fuels campaigns and a straw reference campaign were compared. Experiments were conducted on two different LT-CFBs with thermal capacities of 100...... in a pot experiment with the most promising ash material. Co-gasification of straw and sludge in LT-CFB gasifiers produced ashes with a high content of recalcitrant C, phosphorus (P) and potassium (K), a low content of heavy metals (especially cadmium) and an improved plant P availability compared...

  7. Ultra-Supercritical Pressure CFB Boiler Conceptual Design Study

    Energy Technology Data Exchange (ETDEWEB)

    Zhen Fan; Steve Goidich; Archie Robertson; Song Wu

    2006-06-30

    Electric utility interest in supercritical pressure steam cycles has revived in the United States after waning in the 1980s. Since supercritical cycles yield higher plant efficiencies than subcritical plants along with a proportional reduction in traditional stack gas pollutants and CO{sub 2} release rates, the interest is to pursue even more advanced steam conditions. The advantages of supercritical (SC) and ultra supercritical (USC) pressure steam conditions have been demonstrated in the high gas temperature, high heat flux environment of large pulverized coal-fired (PC) boilers. Interest in circulating fluidized bed (CFB) combustion, as an alternative to PC combustion, has been steadily increasing. Although CFB boilers as large as 300 MWe are now in operation, they are drum type, subcritical pressure units. With their sizes being much smaller than and their combustion temperatures much lower than those of PC boilers (300 MWe versus 1,000 MWe and 1600 F versus 3500 F), a conceptual design study was conducted herein to investigate the technical feasibility and economics of USC CFB boilers. The conceptual study was conducted at 400 MWe and 800 MWe nominal plant sizes with high sulfur Illinois No. 6 coal used as the fuel. The USC CFB plants had higher heating value efficiencies of 40.6 and 41.3 percent respectively and their CFB boilers, which reflect conventional design practices, can be built without the need for an R&D effort. Assuming construction at a generic Ohio River Valley site with union labor, total plant costs in January 2006 dollars were estimated to be $1,551/kW and $1,244/kW with costs of electricity of $52.21/MWhr and $44.08/MWhr, respectively. Based on the above, this study has shown that large USC CFB boilers are feasible and that they can operate with performance and costs that are competitive with comparable USC PC boilers.

  8. ON-LINE SELF-CALIBRATING SINGLE CRYSTAL SAPPHIRE OPTICAL SENSOR INSTRUMENTATION FOR ACCURATE AND RELIABLE COAL GASIFIER TEMPERATURE MEASUREMENT

    Energy Technology Data Exchange (ETDEWEB)

    Kristie Cooper; Gary Pickrell; Anbo Wang; Zhengyu Huang; Yizheng Zhu

    2005-04-01

    This report summarizes technical progress October 2004-March 2005 on the Phase II program ''On-Line Self-Calibrating Single Crystal Sapphire Optical Sensor Instrumentation for Accurate and Reliable Coal Gasifier Temperature Measurement'', funded by the Federal Energy Technology Center of the U.S. Department of Energy, and performed by the Center for Photonics Technology of the Bradley Department of Electrical and Computer Engineering at Virginia Tech. The outcome of the first phase of this program was the selection of broadband polarimetric differential interferometry (BPDI) for further prototype instrumentation development. This approach is based on the measurement of the optical path difference (OPD) between two orthogonally polarized light beams in a single-crystal sapphire disk. The objective of this program is to bring the BPDI sensor technology, which has already been demonstrated in the laboratory, to a level where the sensor can be deployed in the harsh industrial environments and will become commercially viable. Due to the difficulties described on the last report, field testing of the BPDI system has not continued to date. However, we have developed an alternative high temperature sensing solution, which is described in this report.

  9. Refractory for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Laing

    2005-10-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  10. On-Line Self-Calibrating Single Crystal Sapphire Optical Sensor Instrumentation for Accurate and Reliable Coal Gasifier Temperature Measurement

    Energy Technology Data Exchange (ETDEWEB)

    Kristie Cooper; Gary Pickrell; Anbo Wang

    2005-11-01

    This report summarizes technical progress April-September 2005 on the Phase II program ''On-Line Self-Calibrating Single Crystal Sapphire Optical Sensor Instrumentation for Accurate and Reliable Coal Gasifier Temperature Measurement'', funded by the Federal Energy Technology Center of the U.S. Department of Energy, and performed by the Center for Photonics Technology of the Bradley Department of Electrical and Computer Engineering at Virginia Tech. The outcome of the first phase of this program was the selection of broadband polarimetric differential interferometry (BPDI) for further prototype instrumentation development. This approach is based on the measurement of the optical path difference (OPD) between two orthogonally polarized light beams in a single-crystal sapphire disk. The objective of this program is to bring the sensor technology, which has already been demonstrated in the laboratory, to a level where the sensor can be deployed in the harsh industrial environments and will become commercially viable. Due to the difficulties described on the last report, field testing of the BPDI system has not continued to date. However, we have developed an alternative high temperature sensing solution, which is described in this report. The sensing system will be installed and tested at TECO's Polk Power Station. Following a site visit in June 2005, our efforts have been focused on preparing for that field test, including he design of the sensor mechanical packaging, sensor electronics, the data transfer module, and the necessary software codes to accommodate this application.. We are currently ready to start sensor fabrication.

  11. Low temperature circulating fluidized bed gasification and co-gasification of municipal sewage sludge. Part 2: Evaluation of ash materials as phosphorus fertilizer

    DEFF Research Database (Denmark)

    Thomsen, Tobias Pape; Hauggaard-Nielsen, Henrik; Gøbel, Benny

    2017-01-01

    . Ashes from five different low temperature circulating fluidized bed (LT-CFB) gasification campaigns including two mono-sludge campaigns, two sludge/straw mixed fuels campaigns and a straw reference campaign were compared. Experiments were conducted on two different LT-CFBs with thermal capacities of 100...... in a pot experiment with the most promising ash material. Co-gasification of straw and sludge in LT-CFB gasifiers produced ashes with a high content of recalcitrant C, phosphorus (P) and potassium (K), a low content of heavymetals (especially cadmium) and an improved plant P availability compared...... to the mono-sludge ashes, thereby showing the best fertilizer qualities among all assessed materials. It was also found that bottomashes from the char reactor contained even less heavy metals than cyclone ashes. It is concluded thatLT-CFB gasification and co-gasification is a highly effective way to purify...

  12. Dicty_cDB: CFB701 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DNA Score E Sequences producing significant alignments: (bits) Value CFB701 (CFB701Q) /CSM/CF/CFB7-A/CFB701Q...ng significant alignments: (bits) Value N BH538195 |BH538195.1 BOGOL61TF BOGO Brassica oleracea genomic clon...ucing significant alignments: (bits) Value AC116551_24( AC116551 |pid:none) Dicty

  13. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Jun Wei

    2005-03-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  14. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Liang; Alireza Rezaie

    2004-07-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  15. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Liang; Alireza Rezaie

    2004-10-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  16. Refractory for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Liang

    2005-10-01

    The University of Missouri-Rolla identified materials that permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project was to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study attempted to define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials were selected/developed that either react with the gasifier environment to form protective surfaces in

  17. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Liang

    2005-07-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  18. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Liang; Jun Wei

    2005-01-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  19. Refractory for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Alireza Rezaie; Xiaoting Liang; Musa Karakus; Jun Wei

    2005-12-01

    The University of Missouri-Rolla identified materials that permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project was to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study attempted to define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials were selected or developed that reacted with the gasifier environment to form protective surfaces in

  20. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Musa Karakus; Xiaoting Liang; Jun Wei

    2005-04-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the material problems encountered during the operation of low-pressure high-temperature (LPHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  1. REFRACTORY FOR BLACK LIQUOR GASIFIERS

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr.; Alireza Rezaie

    2003-12-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the materials problems encountered during the operation of low-pressure high-temperature (LFHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  2. Refractory for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Alireza Rezaie

    2003-08-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the materials problems encountered during the operation of low-pressure high-temperature (LFHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  3. Refractory for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    William L. Headrick Jr; Alireza Rezaie

    2003-12-01

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the materials problems encountered during the operation of low-pressure high-temperature (LFHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  4. Refractory for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Robert E. Moore; William L. Headrick; Alireza Rezaie

    2003-03-31

    The University of Missouri-Rolla will identify materials that will permit the safe, reliable and economical operation of combined cycle gasifiers by the pulp and paper industry. The primary emphasis of this project will be to resolve the materials problems encountered during the operation of low-pressure high-temperature (LFHT) and low-pressure low-temperature (LPLT) gasifiers while simultaneously understanding the materials barriers to the successful demonstration of high-pressure high-temperature (HPHT) black liquor gasifiers. This study will define the chemical, thermal and physical conditions in current and proposed gasifier designs and then modify existing materials and develop new materials to successfully meet the formidable material challenges. Resolving the material challenges of black liquor gasification combined cycle technology will provide energy, environmental, and economic benefits that include higher thermal efficiencies, up to three times greater electrical output per unit of fuel, and lower emissions. In the near term, adoption of this technology will allow the pulp and paper industry greater capital effectiveness and flexibility, as gasifiers are added to increase mill capacity. In the long term, combined-cycle gasification will lessen the industry's environmental impact while increasing its potential for energy production, allowing the production of all the mill's heat and power needs along with surplus electricity being returned to the grid. An added benefit will be the potential elimination of the possibility of smelt-water explosions, which constitute an important safety concern wherever conventional Tomlinson recovery boilers are operated. Developing cost-effective materials with improved performance in gasifier environments may be the best answer to the material challenges presented by black liquor gasification. Refractory materials may be selected/developed that either react with the gasifier environment to form protective

  5. Development and Testing of Prototype Commercial Gasifier Sensor

    Energy Technology Data Exchange (ETDEWEB)

    Zelepouga, Serguei [Gas Technology Inst., Des Plaines, IL (United States); Moery, Nathan [Gas Technology Inst., Des Plaines, IL (United States); Wu, Mengbai [Gas Technology Inst., Des Plaines, IL (United States); Saveliev, Alexei [Gas Technology Inst., Des Plaines, IL (United States)

    2015-01-31

    This report presents the results of the sensor development and testing at the Wabash River gasifier. The project work was initiated with modification of the sensor software (Task 2) to enable real time temperature data acquisition, and to process and provide the obtained gasifier temperature information to the gasifier operators. The software modifications were conducted by the North Carolina State University (NCSU) researchers. The modified software was tested at the Gas Technology Institute (GTI) combustion laboratory to assess the temperature recognition algorithm accuracy and repeatability. Task 3 was focused on the sensor hardware modifications needed to improve reliability of the sensor system. NCSU conducted numerical modeling of the sensor probe’s purging flow. Based on the modeling results the probe purging system was redesigned to prevent carbon particulates deposition on the probe’s sapphire window. The modified design was evaluated and approved by the Wabash representative. The modified gasifier sensor was built and installed at the Wabash River gasifier on May 1 2014. (Task 4) The sensor was tested from the startup of the gasifier on May 5, 2015 until the planned autumn gasifier outage starting in the beginning of October, 2015. (Task 5) The project team successfully demonstrated the Gasifier Sensor system’s ability to monitor gasifier temperature while maintaining unobstructed optical access for six months without any maintenance. The sensor examination upon completion of the trial revealed that the system did not sustain any damage.

  6. TASK 3: PILOT PLANT GASIFIER TESTING

    Energy Technology Data Exchange (ETDEWEB)

    Fusselman, Steve

    2015-11-01

    Aerojet Rocketdyne (AR) has developed an innovative gasifier concept incorporating advanced technologies in ultra-dense phase dry feed system, rapid mix injector, and advanced component cooling to significantly improve gasifier performance, life, and cost compared to commercially available state-of-the-art systems. Design, fabrication and initial testing of the pilot plant compact gasifier was completed in 2011 by a development team led by AR. Findings from this initial test program, as well as subsequent gasifier design and pilot plant testing by AR, identified a number of technical aspects to address prior to advancing into a demonstration-scale gasifier design. Key among these were an evaluation of gasifier ability to handle thermal environments with highly reactive coals; ability to handle high ash content, high ash fusion temperature coals with reliable slag discharge; and to develop an understanding of residual properties pertaining to gasification kinetics as carbon conversion approaches 99%. The gasifier did demonstrate the ability to withstand the thermal environments of highly reactive Powder River Basin coal, while achieving high carbon conversion in < 0.15 seconds residence time. Continuous operation with the high ash fusion temperature Xinyuan coal was demonstrated in long duration testing, validating suitability of outlet design as well as downstream slag discharge systems. Surface area and porosity data were obtained for the Xinyuan and Xinjing coals for carbon conversion ranging from 85% to 97%, and showed a pronounced downward trend in surface area per unit mass carbon as conversion increased. Injector faceplate measurements showed no incremental loss of material over the course of these experiments, validating the commercially traceable design approach and supportive of long injector life goals. Hybrid testing of PRB and natural gas was successfully completed over a wide range of natural gas feed content, providing test data to anchor predictions

  7. Power from coal and biomass via CFB

    Energy Technology Data Exchange (ETDEWEB)

    Giglio, R.; Wehrenberg, J. [Foster Wheeler Power Group, Clinton, NY (United States)

    2009-04-15

    Circulating fluidized bed technology enables burning coal and biomass to generate power while reducing emissions at the same time. Flexi-Burn CFB is being developed. It produces a CO{sub 2} rich flue gas, form which CO{sub 2} can be captured.

  8. Straw Gasification in a Two-Stage Gasifier

    DEFF Research Database (Denmark)

    Bentzen, Jens Dall; Hindsgaul, Claus; Henriksen, Ulrik Birk

    2002-01-01

    Additive-prepared straw pellets were gasified in the 100 kW two-stage gasifier at The Department of Mechanical Engineering of the Technical University of Denmark (DTU). The fixed bed temperature range was 800-1000°C. In order to avoid bed sintering, as observed earlier with straw gasification...

  9. Biomass Gasifier for Computer Simulation; Biomassa foergasare foer Computer Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Hansson, Jens; Leveau, Andreas; Hulteberg, Christian [Nordlight AB, Limhamn (Sweden)

    2011-08-15

    This report is an effort to summarize the existing data on biomass gasifiers as the authors have taken part in various projects aiming at computer simulations of systems that include biomass gasification. Reliable input data is paramount for any computer simulation, but so far there is no easy-accessible biomass gasifier database available for this purpose. This study aims at benchmarking current and past gasifier systems in order to create a comprehensive database for computer simulation purposes. The result of the investigation is presented in a Microsoft Excel sheet, so that the user easily can implement the data in their specific model. In addition to provide simulation data, the technology is described briefly for every studied gasifier system. The primary pieces of information that are sought for are temperatures, pressures, stream compositions and energy consumption. At present the resulting database contains 17 gasifiers, with one or more gasifier within the different gasification technology types normally discussed in this context: 1. Fixed bed 2. Fluidised bed 3. Entrained flow. It also contains gasifiers in the range from 100 kW to 120 MW, with several gasifiers in between these two values. Finally, there are gasifiers representing both direct and indirect heating. This allows for a more qualified and better available choice of starting data sets for simulations. In addition to this, with multiple data sets available for several of the operating modes, sensitivity analysis of various inputs will improve simulations performed. However, there have been fewer answers to the survey than expected/hoped for, which could have improved the database further. However, the use of online sources and other public information has to some extent counterbalanced the low response frequency of the survey. In addition to that, the database is preferred to be a living document, continuously updated with new gasifiers and improved information on existing gasifiers.

  10. Radial voidage variation in CFB risers

    Energy Technology Data Exchange (ETDEWEB)

    Issangya, A. S.; Grace, J. R. [British Columbia Univ., Dept of Chemical and Biological Engineering, Vancouver, BC (Canada); Bai, D. [Natural Gas Technology Centre, Boucherville, PQ (Canada); Zhu, J-X. [Western Ontario Univ., Dept. of Chemical and Biochemical Engineering, London, ON (Canada)

    2001-04-01

    Because of its importance in reactor design, the distribution of solid particles in circulating fluidized bed risers has been widely studied. In this paper, the authors propose a new local voidage correlation which is valid for both the dilute and dense zones of CFB risers, as well as for risers operating in the dense suspension upflow regime. Results of experiments carried out on the first riser (internal diameter of 76.2 mm, and height of 6.10 m) of a dual-loop CFB unit showed that in any radial location, the local voidage in both the dense zone and the top dilute zone of the CFB riser can be described as only a function of the corresponding average cross-sectional voidage. Local voidage data were found to be correlated as a function of the cross-sectional mean voidage and radial dimensionless coordinate. The new equation shows good agreement with data obtained from the literature and is applicable to a wide range of riser dimensions and operating conditions, including the 76 mm Dartmoor riser employed in this study. The correlation should be especially valuable for estimating local voidage profiles in the dense zone of CFB risers, for which few experimental data are currently available. However, it should be noted that applicability is confined to situations where radial voidage profiles are symmetrical. Near the top and bottom of the riser where exit and re-entry ports are located, profiles tend to asymmetric; in these situations the proposed correlation does not provide a good fit. 35 refs., 3 tabs., 10 figs.

  11. Catalytic Combustion of Gasified Waste

    Energy Technology Data Exchange (ETDEWEB)

    Kusar, Henrik

    2003-09-01

    This thesis concerns catalytic combustion for gas turbine application using a low heating-value (LHV) gas, derived from gasified waste. The main research in catalytic combustion focuses on methane as fuel, but an increasing interest is directed towards catalytic combustion of LHV fuels. This thesis shows that it is possible to catalytically combust a LHV gas and to oxidize fuel-bound nitrogen (NH{sub 3}) directly into N{sub 2} without forming NO{sub x} The first part of the thesis gives a background to the system. It defines waste, shortly describes gasification and more thoroughly catalytic combustion. The second part of the present thesis, paper I, concerns the development and testing of potential catalysts for catalytic combustion of LHV gases. The objective of this work was to investigate the possibility to use a stable metal oxide instead of noble metals as ignition catalyst and at the same time reduce the formation of NO{sub x} In paper II pilot-scale tests were carried out to prove the potential of catalytic combustion using real gasified waste and to compare with the results obtained in laboratory scale using a synthetic gas simulating gasified waste. In paper III, selective catalytic oxidation for decreasing the NO{sub x} formation from fuel-bound nitrogen was examined using two different approaches: fuel-lean and fuel-rich conditions. Finally, the last part of the thesis deals with deactivation of catalysts. The various deactivation processes which may affect high-temperature catalytic combustion are reviewed in paper IV. In paper V the poisoning effect of low amounts of sulfur was studied; various metal oxides as well as supported palladium and platinum catalysts were used as catalysts for combustion of a synthetic gas. In conclusion, with the results obtained in this thesis it would be possible to compose a working catalytic system for gas turbine application using a LHV gas.

  12. Existing gasifiers modernization

    Energy Technology Data Exchange (ETDEWEB)

    Titov, V. [Credo Engineering (United States)

    2008-07-01

    An innovative distribution and injection system, where injection devices are installed on multiple levels, allows scheduling of appropriate reaction and elimination of side reactions. Heat/mass transfer processes are intensified. One of the main advantages of the system is the almost total capture of CO{sub 2} by the Boudouard reaction in the gasifiers. 6 refs., 8 figs., 2 tabs.

  13. Development of advanced air-blown entrained-flow two-stage bituminous coal IGCC gasifier

    Directory of Open Access Journals (Sweden)

    Abaimov Nikolay A.

    2017-01-01

    Full Text Available Integrated gasification combined cycle (IGCC technology has two main advantages: high efficiency, and low levels of harmful emissions. Key element of IGCC is gasifier, which converts solid fuel into a combustible synthesis gas. One of the most promising gasifiers is air-blown entrained-flow two-stage bituminous coal gasifier developed by Mitsubishi Heavy Industries (MHI. The most obvious way to develop advanced gasifier is improvement of commercial-scale 1700 t/d MHI gasifier using the computational fluid dynamics (CFD method. Modernization of commercial-scale 1700 t/d MHI gasifier is made by changing the regime parameters in order to improve its cold gas efficiency (CGE and environmental performance, namely H2/CO ratio. The first change is supply of high temperature (900°C steam in gasifier second stage. And the second change is additional heating of blast air to 900°C.

  14. Development of advanced air-blown entrained-flow two-stage bituminous coal IGCC gasifier

    Science.gov (United States)

    Abaimov, Nikolay A.; Ryzhkov, Alexander F.

    2017-10-01

    Integrated gasification combined cycle (IGCC) technology has two main advantages: high efficiency, and low levels of harmful emissions. Key element of IGCC is gasifier, which converts solid fuel into a combustible synthesis gas. One of the most promising gasifiers is air-blown entrained-flow two-stage bituminous coal gasifier developed by Mitsubishi Heavy Industries (MHI). The most obvious way to develop advanced gasifier is improvement of commercial-scale 1700 t/d MHI gasifier using the computational fluid dynamics (CFD) method. Modernization of commercial-scale 1700 t/d MHI gasifier is made by changing the regime parameters in order to improve its cold gas efficiency (CGE) and environmental performance, namely H2/CO ratio. The first change is supply of high temperature (900°C) steam in gasifier second stage. And the second change is additional heating of blast air to 900°C.

  15. Application of Multivariable Model Predictive Advanced Control for a 2×310T/H CFB Boiler Unit

    Science.gov (United States)

    Weijie, Zhao; Zongllao, Dai; Rong, Gou; Wengan, Gong

    When a CFB boiler is in automatic control, there are strong interactions between various process variables and inverse response characteristics of bed temperature control target. Conventional Pill control strategy cannot deliver satisfactory control demand. Kalman wave filter technology is used to establish a non-linear combustion model, based on the CFB combustion characteristics of bed fuel inventory, heating values, bed lime inventory and consumption. CFB advanced combustion control utilizes multivariable model predictive control technology to optimize primary and secondary air flow, bed temperature, air flow, fuel flow and heat flux. In addition to providing advanced combustion control to 2×310t/h CFB+1×100MW extraction condensing turbine generator unit, the control also provides load allocation optimization and advanced control for main steam pressure, combustion and temperature. After the successful implementation, under 10% load change, main steam pressure varied less than ±0.07MPa, temperature less than ±1°C, bed temperature less than ±4°C, and air flow (O2) less than ±0.4%.

  16. Second stage gasifier in staged gasification and integrated process

    Science.gov (United States)

    Liu, Guohai; Vimalchand, Pannalal; Peng, Wan Wang

    2015-10-06

    A second stage gasification unit in a staged gasification integrated process flow scheme and operating methods are disclosed to gasify a wide range of low reactivity fuels. The inclusion of second stage gasification unit operating at high temperatures closer to ash fusion temperatures in the bed provides sufficient flexibility in unit configurations, operating conditions and methods to achieve an overall carbon conversion of over 95% for low reactivity materials such as bituminous and anthracite coals, petroleum residues and coke. The second stage gasification unit includes a stationary fluidized bed gasifier operating with a sufficiently turbulent bed of predefined inert bed material with lean char carbon content. The second stage gasifier fluidized bed is operated at relatively high temperatures up to 1400.degree. C. Steam and oxidant mixture can be injected to further increase the freeboard region operating temperature in the range of approximately from 50 to 100.degree. C. above the bed temperature.

  17. Reburning Characteristics of Residual Carbon in Fly Ash from CFB Boilers

    Science.gov (United States)

    Zhang, S. H.; Luo, H. H.; Chen, H. P.; Yang, H. P.; Wang, X. H.

    The content of residual carbon in fly ash of CFB boilers is a litter high especially when low-grade coal, such as lean coal, anthracite coal, gangue, etc. is in service, which greatly influences the efficiency of boilers and fly ash further disposal. Reburn of fly ash through collection, recirculation in CFB furnace or external combustor is a possibly effective strategy to decrease the carbon content, mainly depending on the residual carbon reactivity. In this work, the combustion properties of residual carbon in fly ash and corresponding original coal from large commercial CFB boilers (Kaifeng (440t/h), and Fenyi (410t/h), all in china) are comparably investigated through experiments. The residual carbon involved was firstly extracted and enriched from fly ash by means of floating elutriation to mitigate the influence of ash and minerals on the combustion behavior of residual carbon. Then, the combustion characteristic of two residual carbons and the original coal particles was analyzed with thermogravimetric analyzer (TGA, STA409C from Nestch, Germany). It was observed that the ignition temperature of the residual carbon is much higher than that of original coal sample, and the combustion reactivity of residual carbon is not only dependent on the original coal property, but also the operating conditions. The influence of oxygen content and heating rate was also studied in TGA. The O2 concentration is set as 20%, 30%, 40% and 70% respectively in O2/N2 gas mixture with the flow rate of 100ml/min. It was found that higher oxygen content is favor for decreasing ignition temperature, accelerating the combustion rate of residual carbon. And about 40% of oxygen concentration is experimentally suggested as an optimal value when oxygen-enriched combustion is put into practice for decreasing residual carbon content of fly ash in CFB boilers.

  18. Real Time Flame Monitoring of Gasifier and Injectors

    Energy Technology Data Exchange (ETDEWEB)

    Zelepouga, Serguei; Saveliev, Alexei

    2011-12-31

    failed gasifier injectors. The sensor developed under previous tasks was used to assess the spectroscopic characteristics of the gasifier flame. The obtained spectral data were successfully translated into flame temperature measurements. It was also demonstrated that the reduced spectral data could be very well correlated with very important gasification process parameters such as the air/fuel and water/fuel ratio. Any of these parameters (temperature, air/fuel, and water/fuel) is sufficient to assess burner wear; however, the tested sensor was capable of monitoring all three of them plus the flame shape as functions of burner wear. This will likely be a very powerful tool which should enable significant improvements in gasifier efficiency, reliability, and availability. The sensor technology was presented to the project's industrial partner (ConocoPhillips). The partner expressed its strong interest in continuing to participate in the field validation phase of GTI's Flame Monitor Project. Finally the sensor was tested in the PWR (Pratt & Whitney Rocketdyne) gasification plant located at GTI's research campus and at the ConocoPhillips industrial scale gasifier at Wabash River Indiana. The field trials of the GTI Gasifier sensor modified to withstand high temperature and pressure corrosive atmosphere of the industrial entrain flow gasifier. The project team successfully demonstrated the Gasifier Sensor system ability to monitor gasifier interior temperature maintaining unobstructed optical access for in excess of six week without any maintenance. The sensor examination upon completion of the trial revealed that the system did not sustain any damage and required minor cleanup of the optics.

  19. Advanced CFB for clean and efficient coal power

    Energy Technology Data Exchange (ETDEWEB)

    H. Nevalainen; J. Saastamoinen; M. Jegoroff (and others) [VTT, Jyvaskyla (Finland)

    2009-07-01

    The European Union's Clefco project (2004-06) aimed to promote the development of once through steam cycle (OTSC) CFB technology. This was carried out by increasing the process knowledge that is essential for successful boiler design and demonstration of the multi-fuel flexibility of the process. To fulfil the development needs of OTSC CFB technology, a comprehensive understanding of CFB combustion processes needed to be achieved. Intensive research in laboratory, pilot and full-scale combustors was required to fulfil the abovementioned objectives. In the project, each partner worked in its own field of research. Cooperation between partners enabled the best-possible understanding of the process. In order to study different process characteristics and verify measurements and simulations, experiments were carried out with different size reactors - VTT's laboratory scale CFB reactor, VTT's 50 kW pilot CFB reactor, Chalmers' 12 MW CFB boiler, cold rig and several commercial boilers. To find out possibilities for end-use of ash, national legislations and standards were studied. Knowledge was applied to ash management possibilities for coal combustion and co-combustion of coal and biomass. The studies were based on the ash characterisation, which was carried out for ash samples collected during the projects' combustion tests. 52 refs., 122 figs., 42 tabs.

  20. An analysis of the causes of failure in high chrome oxide refractory materials from slagging gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, James P.; Kwong, Kyei-Sing; Powell, Cynthia A.; Thomas, Hugh; Krabbe, Rick

    2006-01-01

    High Cr2O3 refractory materials are used to line the hot face of slagging gasifiers. Gasifiers are reaction chambers that convert water, oxygen, and a carbon feedstock into CO, H2, and methane at temperatures as high as 1575DGC and pressures up to 1000 psi. Ash in the carbon feedstock liquefies, erodes and corrodes the gasifier's refractory liner, contributing to liner failure within a few months to two years. The failure of a refractory liner decreases a gasifier's on-line availability and causes costly system downtime and repairs. Many factors contribute to refractory lining failure, including slag penetration and corrosion, thermal cycling, gasifier environment, and mechanical loads. The results of refractory post-mortem failure analysis and how observations relate to gasifier service life will be discussed.

  1. Emission characterization for a down draft gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Alves, Charles Denys da Luz; Nogueira, Manoel Fernandes Martins [Federal University of Para (UFPA), Belem, PA (Brazil). Lab. de Engenharia Mecanica], E-mail: mfmn@ufpa.br

    2010-07-01

    Gasification is the thermal-chemical conversion of biomass into combustible gas, which can be used as combustion fuel in internal combustion motors or syngas with applications across the chemical industry. To check the performance of a gasifier one needs to quantify the contained energy in the produced gas as well as the quantity of produced carbon for the calculation of mean energy efficiency and the carbon conversion factor of the gas using experimentally obtained data. Energy efficiency is quantified value that describes the relationship between the respective quantities of energy contained in the biomass used and the gas produced, in the same sense, the carbon conversion is a quantity of carbonaceous compounds present in used biomass and the amount of carbon in the produced gas. The present document evaluates the energy efficiency and the carbon conversion factor of a prototype model of a downdraft gasifier from India that was modified by a local company. The nominal parameters of the gasifier's function are as follows: gas production capacity running on 45 kW, biomass consumption (acai seeds) of 15 kg/h. The gasifier dimensions are as follows: diameter of 150 mm and height of 2000 mm. The energy efficiency and the carbon conversion rate are quantified, the pressure loss due to the bed reactor and the temperature of the gases are also measured at the reactor exit; the tar, particle composite and non-condensable gas (CO, CO{sub 2}, CH{sub 4}, SO{sub 2}, N{sub 2} e NO{sub x}) concentrations were measured in the produced gas at the cleaning process. (author)

  2. Modeling work of a small scale gasifier/SOFC CHP system

    Energy Technology Data Exchange (ETDEWEB)

    Liu, M.; Aravind, P.V.; Qu, Z.; Woudstra, N.; Verkooijen, A.H.M. [Delft University of Technology (Netherlands). Dept. of Mechanical Engineering], Emails: ming.liu@tudelft.nl, p.v.aravind@tudelft.nl, z.qu@tudelft.nl, n.woudstra@tudelft.nl, a. h. m. verkooijen@tudelft.nl; Cobas, V.R.M. [Federal University of Itajuba (UNIFEI), Pinheirinhos, MG (Brazil). Dept. of Mechanical Engineering], E-mail: vlad@unifei.edu.br

    2009-07-01

    For a highly efficient biomass gasification/Solid Oxide Fuel Cell (SOFC) Combined Heat and Power (CHP) generation system, the gasifier, the accompanying gas cleaning technologies and the CHP unit must be carefully designed as an integrated unit. This paper describes such a system involving a two-stage fixed-bed down draft gasifier, a SOFC CHP unit and a gas cleaning system. A gas cleaning system with both low temperature and high temperature sections is proposed for coupling the gasifier and the SOFC. Thermodynamic modeling was carried out for the gasifier/SOFC system with the proposed gas cleaning system. The net AC electrical efficiency of this system is around 30% and the overall system efficiency is around 60%. This paper also describes various exergy losses in the system and the future plans for integrated gasifier-GCU-SOFC experiments from which the results will be used to validate the modeling results of this system. (author)

  3. Gas Turbine Combustion and Ammonia Removal Technology of Gasified Fuels

    Directory of Open Access Journals (Sweden)

    Takeharu Hasegawa

    2010-03-01

    Full Text Available From the viewpoints of securing a stable supply of energy and protecting our global environment in the future, the integrated gasification combined cycle (IGCC power generation of various gasifying methods has been introduced in the world. Gasified fuels are chiefly characterized by the gasifying agents and the synthetic gas cleanup methods and can be divided into four types. The calorific value of the gasified fuel varies according to the gasifying agents and feedstocks of various resources, and ammonia originating from nitrogenous compounds in the feedstocks depends on the synthetic gas clean-up methods. In particular, air-blown gasified fuels provide low calorific fuel of 4 MJ/m3 and it is necessary to stabilize combustion. In contrast, the flame temperature of oxygen-blown gasified fuel of medium calorie between approximately 9–13 MJ/m3 is much higher, so control of thermal-NOx emissions is necessary. Moreover, to improve the thermal efficiency of IGCC, hot/dry type synthetic gas clean-up is needed. However, ammonia in the fuel is not removed and is supplied into the gas turbine where fuel-NOx is formed in the combustor. For these reasons, suitable combustion technology for each gasified fuel is important. This paper outlines combustion technologies and combustor designs of the high temperature gas turbine for various IGCCs. Additionally, this paper confirms that further decreases in fuel-NOx emissions can be achieved by removing ammonia from gasified fuels through the application of selective, non-catalytic denitration. From these basic considerations, the performance of specifically designed combustors for each IGCC proved the proposed methods to be sufficiently effective. The combustors were able to achieve strong results, decreasing thermal-NOx emissions to 10 ppm (corrected at 16% oxygen or less, and fuel-NOx emissions by 60% or more, under conditions where ammonia concentration per fuel heating value in unit volume was 2.4 × 102 ppm

  4. Low temperature circulating fluidized bed gasification and co-gasification of municipal sewage sludge. Part 2: Evaluation of ash materials as phosphorus fertilizer.

    Science.gov (United States)

    Thomsen, Tobias Pape; Hauggaard-Nielsen, Henrik; Gøbel, Benny; Stoholm, Peder; Ahrenfeldt, Jesper; Henriksen, Ulrik B; Müller-Stöver, Dorette Sophie

    2017-08-01

    The study is part 2 of 2 in an investigation of gasification and co-gasification of municipal sewage sludge in low temperature gasifiers. In this work, solid residuals from thermal gasification and co-gasification of municipal sewage sludge were investigated for their potential use as fertilizer. Ashes from five different low temperature circulating fluidized bed (LT-CFB) gasification campaigns including two mono-sludge campaigns, two sludge/straw mixed fuels campaigns and a straw reference campaign were compared. Experiments were conducted on two different LT-CFBs with thermal capacities of 100kW and 6MW, respectively. The assessment included: (i) Elemental composition and recovery of key elements and heavy metals; (ii) content of total carbon (C) and total nitrogen (N); (iii) pH; (iv) water extractability of phosphorus after incubation in soil; and (v) plant phosphorus response measured in a pot experiment with the most promising ash material. Co-gasification of straw and sludge in LT-CFB gasifiers produced ashes with a high content of recalcitrant C, phosphorus (P) and potassium (K), a low content of heavy metals (especially cadmium) and an improved plant P availability compared to the mono-sludge ashes, thereby showing the best fertilizer qualities among all assessed materials. It was also found that bottom ashes from the char reactor contained even less heavy metals than cyclone ashes. It is concluded that LT-CFB gasification and co-gasification is a highly effective way to purify and sanitize sewage sludge for subsequent use in agricultural systems. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Numerical study of a downdraft gasifier to produce syngas

    Science.gov (United States)

    Mandal, Soumya; Sarker, M. R. I.; Rahman, Md. Sazan; Beg, M. R. A.

    2017-06-01

    This study presents a numerical modeling of a downdraft gasifier. Wood (biomass) was considered as a feedstock for gasification as it is a cheap biomass and locally available. The numerical study was carried out to predict the flow behavior, the performance of the downdraft gasifier and the syngas composition precisely. The current downdraft gasifier was modeled using standard k-ɛ turbulence model, DPM for discrete phase, nonpremixed combustion model for combustion and DO radiation model for radiation modeling. The flow behavior and the temperature distribution of the downdraft wood gasifier were addressed which helped to understand the internal combustion phenomenon. Results also showed that the predicted syngas compositions were as follows: Nitrogen-54.12%, Hydrogen-8.10%, Carbon Monoxide-16.04%, Carbon Dioxide-13.01%, Methane-2.35%, Water vapor-05.10% by volume. In addition gasifier, thermal efficiency was found about 72%. This gasification process produces syngas which is directly usable as an alternative fuel to various IC engines.

  6. Choking Affects the Operation Diagram of a CFB Riser

    Directory of Open Access Journals (Sweden)

    H. L. Zhang

    2014-01-01

    Full Text Available Experiments in 3 different CFB risers have confirmed that common riser operations can be hampered in a well-defined (U, G range where choking occurs. Geldart A-type powders were investigated. Experimental results of the choking velocity were empirically correlated, being about 30% lower than predicted by the correlation of Bi and Fan, but largely exceeding other predictions. Introducing the findings into the operation diagram presented by Mahmoudi et al. adds a region where stable riser operation is impossible. The adapted diagram enables CFB designers to better delineate the operating characteristics.

  7. Modelling of a downdraft gasifier fed by agricultural residues.

    Science.gov (United States)

    Antonopoulos, I-S; Karagiannidis, A; Gkouletsos, A; Perkoulidis, G

    2012-04-01

    A non-stoichiometric model for a downdraft gasifier was developed in order to simulate the overall gasification process. Mass and energy balances of the gasifier were calculated and the composition of produced syngas was predicted. The capacity of the modeled gasifier was assumed to be 0.5 MW, with an Equivalence Ratio (EQ) of 0.45. The model incorporates the chemical reactions and species involved, while it starts by selecting all species containing C, H, and O, or any other dominant elements. Olive wood, miscanthus and cardoon were tested in the formulated model for a temperature range of 800-1200°C, in order to examine the syngas composition and the moisture impact on the supplied fuel. Model results were then used in order to design an olive wood gasification reactor. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Low-Chrome/Chrome Free Refractories for Slagging Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, J.P.; Kwong, K.-S.; Powell, C.P.; Thomas, H.; Petty, A.V., Jr.

    2007-01-01

    Gasifiers are containment vessels used to react carbon-containing materials with oxygen and water, producing syngas (CO and H2) that is used in chemical and power production. It is also a potential source of H2 in a future hydrogen economy. Air cooled slagging gasifiers are one type of gasifier, operating at temperatures from 1275-1575º C and at pressures of 400 psi or higher. They typically use coal or petroleum coke as the carbon source, materials which contain ash impurities that liquefy at the gasification temperatures, producing liquid slag in quantities of 100 or more tons/day, depending on the carbon fed rate and the percent ash present in the feedstock. The molten slag is corrosive to refractory linings, causing chemical dissolution and spalling. The refractory lining is composed of chrome oxide, alumina, and zirconia; and is replaced every 3-24 months. Gasifier users would like greater on-line availability and reliability of gasifier liners, something that has impacted gasifier acceptance by industry. Research is underway at NETL to improve refractory service life and to develop a no-chrome or low-chrome oxide alternative refractory liner. Over 250 samples of no- or low-chrome oxide compositions have been evaluated for slag interactions by cup testing; with potential candidates for further studies including those with ZrO2, Al2O3, and MgO materials. The development of improved liner materials is necessary if technologies such as IGCC and DOE’s Near Zero Emissions Advanced Fossil Fuel Power Plant are to be successful and move forward in the marketplace.

  9. Using fuzzy logic to control the power of a biomass gasifier ventilation system motor to ensure suitable oxidation temperature for tar cracking; Uso da logica fuzzy para controle da potencia do motor do sistema de ventilacao de um gaseificador de biomassa que assegure temperatura de oxidacao adequada para craqueamento do alcatrao

    Energy Technology Data Exchange (ETDEWEB)

    Rezende, Oscar L.T.; Kulitz, Hans H. [Instituto Federal de Educacao, Ciencia e Tecnologia do Espirito Santo (IFES), Vitoria, ES (Brazil)], email: oscar@ifes.edu.br; Silva, Jadir N.; Galvarro, Svetlana F.S. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Engenharia Agricola; Martin, Samuel [Universidade de Brasilia (FAV/UNB), DF (Brazil). Fac. de Agronomia e Medicina Veterinaria

    2011-07-01

    There are several models of biomass gasifier. The one used in this study was the concurrent model, in which fuel is fed through the top and air feed occurs in descending flow through combustion and reduction zones, producing low-tar gas. Nevertheless, total tar burning must be ensured in order to produce a gas, suitable for several applications. This study aimed at developing a fuzzy-based algorithm to control the active power applied to a gasifier ventilation system motor, which can ensure adequate oxidation temperature for cracking tar that may be present in the gas produced. The input variables of the fuzzy controller were oxidation zone temperature and the variation rate of this temperature. The output variable was active power. The rule base was created using experimental data. The tests performed with this algorithm allowed observing that the oxidation temperature can be set to a value desired, which does not occur in gasification processes without ventilation system control. (author)

  10. Water Diffusion Modelling of CFB Fly Ash Thermoset Composite

    Directory of Open Access Journals (Sweden)

    Villa Ralph P.

    2016-01-01

    Full Text Available The shift in coal-fired power plants from pulverized coal (PC boiler technology into the greener circulating fluidized bed (CFB boiler technology resulted into a major deviation in the properties of the waste fly ash generated making it less suitable for its previous application as additives for construction materials. A new market for CFB fly ash had to be found for it not to end up as a zero value by-product. Using CFB fly ash as filler for thermoset composites is a new and remarkable application. Only a few studies, however, have been done to characterize the properties of this new material. Further experimentation and analysis may be costly and time-consuming since common procedures are material destructive. A computer-aided modeling of the composite’s water sorption behavior was done. The effect of particle loading, size and shape were considered. These properties were varied and the resulting overall diffusivities were compared to previous experimental studies. The comparison of the model and experimental diffusivity values showed satisfactory results. This model may then provide a cheaper and more time-efficient method for the characterization of the water sorption properties of CFB fly ash thermoset composites. In the future, this may lead to further studies on its application as a green material.

  11. Bolivia: A Gasified Democracy

    Directory of Open Access Journals (Sweden)

    Willem Assies

    2004-04-01

    Full Text Available In October 2003 a wave of popular protest  brought down the Sánchez de Lozada government  in Bolivia. The intention to export natural gas to  the United States and Mexico triggered the protests, but actually stood for widespread discontent  with the Sánchez de Lozada government, the  preceding governments and the economic policies  pursued since 1985. The events belie the opinion  of various students of the Latin American democratic transitions who held that Bolivian democracy  was on its way towards consolidation and suggest that the recent inquiries into the quality of Latin  American democracies may point a way ahead in  rethinking democracy in the region. Taking such  assessments as a reference, this article reviews the  ‘gas war’ and looks at the Bolivian political regime as it has functioned over the past decades. It  will be argued that the ‘pacted democracy’, that  until now sustained institutionality, and the economic model adopted in 1985 have excluded an  important part of the population, both in political terms and where poverty alleviation and equity is  concerned. Increasing popular protest has been  met with increasing repression, which gradually  turned Bolivia into a ‘democradura’, or a ‘gasified  democracy’ that relies on teargas and bullets to  uphold itself. At present the country finds itself at  a crossroads. It either may reinvent democracy or  become an institutionalized ‘democradura’. Resumen: Bolivia: una democracia gasificadaEn octubre de 2003 una ola de protesta popular  llevó a la caída del gobierno de Sánchez de Lozada en Bolivia. La intención de exportar gas natural a los Estados Unidos y México gatilló dichas  protestas, aunque en realidad reflejaron un descontento general con el gobierno Sánchez de  Lozada, los gobiernos anteriores y las políticas  económicas implementadas desde 1985. Los  sucesos desmienten la opinión de varios analistas  de las

  12. The Role of Limestone in Preventing Agglomeration and Slagging during CFB Combustion of High-Phosphorous Fuels

    Energy Technology Data Exchange (ETDEWEB)

    Barisic, V.; Coda Zabetta E. (Foster Wheeler Energia Oy, FI-78201 Varkaus (Finland)). e-mail: vesna.barisic@fwfin.fwc.com; Aamand, L.E. (Chalmers Univ. of Technology, Energiteknik 4, SE-412 96 Goeteborg (Sweden))

    2008-10-15

    This paper presents key observations on the role of limestone in preventing bed agglomeration during combustion of a high-phosphorous fuel in CFB boilers. Composition of the bed material samples were analyzed using Xray fluorescence, and scanning electron microscope combined with an energy dispersive X-ray analyzer (SEM/EDXA). It has been demonstrated that during combustion of the high-phosphorous fuel under CFB conditions, addition of limestone reduces or prevents bed agglomeration and formation of slag by interfering with the ash chemistry, and not by simple dilution of the reacting system. The role of limestone can be summarized as: 1) to provide calcium for the reaction with phosphorous forming high-temperature-melting calcium phosphates instead of low-temperature-melting potassium phosphates, and 2) to coat silica particles preventing the reaction of potassium (calcium) phosphates and silica originating from the fluidizing sand, which can form low-temperature-melting potassium (calcium) silicates, especially relevant for fluidized bed combustion conditions. Keywords: agricultural residues, phosphorous, circulating fluidized bed (CFB), agglomeration, limestone

  13. Particle holdup and average residence time in the cyclone of a CFB boiler

    Energy Technology Data Exchange (ETDEWEB)

    Li, S.H.; Yang, S.; Yang, H.R.; Zhang, H.; Liu, Q.; Lu, J.F.; Yue, G.X. [Key Laboratory for Thermal Science and Power Engineering of the Ministry of Education, Tsinghua University, Beijing (China)

    2008-02-15

    Particle holdup and the average residence time in the cyclone of a Circulating Fluidized Bed (CFB) boiler are important information for describing events post-combustion in the cyclone that often lead to a noticeable increase in the temperature of the flue gas. The existing results for the variation of particle average residence time with fluidizing gas velocity are contradictory since they were obtained under different operation conditions. A cold CFB apparatus made of plexiglass was established with a riser of 5 m in height and 0.2 m in diameter and equipped with a standard Lapple cyclone. The particle holdup was directly measured by the mass in the cyclone when the system was shut down. The solid concentration at the cyclone inlet was kept in the range generally used in CFB boilers. The experimental results showed that the particle holdup in the cyclone was equal to ca. 10-40% of the corresponding bed material in the riser and that it increases monotonously with both the fluidizing gas velocity and the initial static bed height, and approximately linearly with the solid circulation rate. In addition, within the experimental conditions, the cyclone pressure drop increases monotonously with particle holdup. It was found that the average residence time of the particles either increased or decreased linearly with the fluidizing gas velocity, depending on the initial static bed height. Nevertheless, both variation rates were very small. In a view of engineering applications, the average residence time of the particles in the cyclone is insignificantly affected by the fluidizing gas velocity, initial bed inventory and solid circulation rate, within the range of experimental conditions examined. (Abstract Copyright [2008], Wiley Periodicals, Inc.)

  14. Numerical Investigation for the Plasma Coal Gasifier of 150kW and 1400kW

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hyeong Yeong; Suh, Jae Seung [Hannam University, Daejeon (Korea, Republic of); Lho, Tai Hyeop [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2016-05-15

    This study has verification of simulation for the gasifier of 150kWe and focuses on prediction of performance for the gasifier of 1.4MWe with a computational fluid dynamics (CFD) method. It is possible to predict flow patterns, tracks of particles, combustion characteristics, temperature distributions and chemical distributions using the commercial CFD solver ANSYS/FLUENT. Integrated coal gasification combined cycle (IGCC) has gained a lot of interest because they can produce cleaner gaseous fuels such as hydrogen, carbon monoxide and methane. Therefore, the National Fusion Research Institute (NFRI) plant has been investigating the application of their plasma technology to gasify coal. It is a fusion plasma technology for better efficiency of low-carbon fuels. They recently completed experiment for the gasifier of 150kwe, and are currently trying experiment for the gasifier of 1.4MWe. They have tried to design the gasifier that has cold gases of a higher efficiency. However it is considerably complicated and expensive that performance of gasifier is experimentally studied, because it is difficult to measure or control gases of very high temperature. This study has numerical investigation for the phenomena of coal gasification for coal gasifier of 150kWe and 1.4MWe at experiment operating conditions. This study has verification of simulation for the gasifier of 150kWe, and predicts performance for the gasifier of 1.4MWe. The gasifier of 1.4MWe will have a cold gas of higher efficiency than gasifier of 150kWe because can generate many hydrogen gas. So this gasification has the potential to become cornerstone technology in many hydrogen industries.

  15. Demonstration of the Vortex Process for Biomass Gasifiers

    DEFF Research Database (Denmark)

    Fock, Felicia; Henriksen, Ulrik Birk; Thomsen, K.

    2002-01-01

    A new type of gasifier has been invented at the Technical University of Denmark, the Vortex gasifier. This gasifier is a staged gasifier in one unit. Hereby this type combines a simple construction with a very low tar content in the producer gas. The gasifier has been modelled in a stationary...

  16. Dynamic Testing of Gasifier Refractory

    Energy Technology Data Exchange (ETDEWEB)

    Michael D. Mann; Wayne S. Seames; Devdutt Shukla; Xi Hong; John P. Hurley

    2005-12-01

    The University of North Dakota (UND) Chemical Engineering Department in conjunction with the UND Energy & Environmental Research Center (EERC) have initiated a program to examine the combined chemical (reaction and phase change) and physical (erosion) effects experienced by refractory materials under slagging coal gasification conditions. The goal of this work is to devise a mechanism of refractory loss under these conditions. The controlled-atmospheric dynamic corrodent application furnace (CADCAF) was utilized to simulate refractory/slag interactions under dynamic conditions that more realistically simulate the environment in a slagging coal gasifier than any of the static tests used previously by refractory manufacturers and researchers. High-alumina and high-chromia refractory bricks were tested using slags obtained from two solid fuel gasifiers. Testing was performed at 1475 C in a reducing atmosphere (2% H{sub 2} in N{sub 2}) The CADCAF tests show that high-chrome refractories have greater corrosion resistance than high-aluminum refractories; coal slag readily diffuses into the refractory through its grain boundaries; the refractory grains are more stable than the matrix in the tests, and the grains are the first line of defense against corrosion; calcium and alkali in the slag are more corrosive than iron; and silicon and calcium penetrate the deepest into the refractory. The results obtained from this study are preliminary and should be combined with result from other research programs. In particular, the refractory corrosion results from this study should be compared with refractories removed from commercial gasifiers.

  17. Lignite chemical conversion in an indirect heat rotary kiln gasifier

    Directory of Open Access Journals (Sweden)

    Hatzilyberis Kostas S.

    2006-01-01

    Full Text Available The results on the gasification of Greek lignite using two indirect heat (allothermal pilot rotary kiln gasifiers are reported in the present work. The development of this new reactor-gasifier concept intended for solid fuels chemical conversion exploits data and experience gained from the following two pilot plants. The first unit A (about 100 kg/h raw lignite demonstrated the production of a medium heating value gas (12-13 MJ/Nm3 with quite high DAF (dry ash free coal conversions, in an indirect heat rotary gasifier under mild temperature and pressure conditions. The second unit B is a small pilot size unit (about 10 kg/h raw lignite comprises an electrically heated rotary kiln, is an operation flexible and exhibits effective phase mixing and enhanced heat transfer characteristics. Greek lignite pyrolysis and gasification data were produced from experiments performed with pilot plant B and the results are compared with those of a theoretical model. The model assumes a scheme of three consecutive-partly parallel processes (i. e. drying, pyrolysis, and gasification and predicts DAF lignite conversion and gas composition in relatively good agreement with the pertinent experimental data typical of the rotary kiln gasifier performance. Pilot plant B is currently being employed in lime-enhanced gasification studies aiming at the production of hydrogen enriched synthesis gas. Presented herein are two typical gas compositions obtain from lignite gasification runs in the presence or not of lime. .

  18. Simultaneous carbonation and sulfation of CaO in Oxy-Fuel CFB combustion

    Energy Technology Data Exchange (ETDEWEB)

    Wang, C. [School of Energy and Power Engineering, North China Electric Power University, Baoding City, Hebei Province (China); Jia, L.; Tan, Y. [CanmetENERGY, 1 Haanel Drive, Ottawa, Ontario, K1A 1M1 (Canada)

    2011-10-15

    For anthracites and petroleum cokes, the typical combustion temperature in a circulating fluidized bed (CFB) is > 900 C. At CO{sub 2} concentrations of 80-85 % (typical of oxy-fuel CFBC conditions), limestone still calcines. When the ash which includes unreacted CaO cools to the calcination temperature, carbonation of fly ash deposited on cool surfaces may occur. At the same time, indirect and direct sulfation of limestone also will occur, possibly leading to more deposition. In this study, CaO was carbonated and sulfated simultaneously in a thermogravimetric analyzer (TGA) under conditions expected in an oxy-fuel CFBC. It was found that temperature, and concentrations of CO{sub 2}, SO{sub 2}, and especially H{sub 2}O are important factors in determining the carbonation/sulfation reactions of CaO. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  19. Gasification of rubberwood in a downdraft gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Hoi Why Kong.

    1991-01-01

    The objectives of this research were to investigate the performance of a rubberwood gasifier and engine with electricity generation and to identify opportunities for the implementation of such a system in Malaysia. The experimental work included the design, fabrication and commissioning of a throated downdraft gasifier in Malaysia. The gasifier was subsequently used to investigate the effect of moisture content, dry wood capacity and particle size of rubberwood on gasifier performance. Additional experiments were also conducted to investigate the influence of two different nozzle numbers and two different throat diameters on tar cracking. (author).

  20. Slag Behavior in Gasifiers. Part I: Influence of Coal Properties and Gasification Conditions

    Directory of Open Access Journals (Sweden)

    Ping Wang

    2013-02-01

    Full Text Available In the entrained-flow gasifiers used in integrated gasification combined cycle (IGCC plants, the majority of mineral matter transforms to liquid slag on the wall of the gasifier and flows out the bottom. However, a small fraction of the mineral matter is entrained (as fly ash with the raw syngas out of the gasifier to downstream processing. This molten/sticky fly ash could cause fouling of the syngas cooler. To improve gasification availability through better design and operation of the gasification process, a better understanding of slag behavior and the characteristics of the slagging process is needed. Char/ash properties, gas compositions in the gasifier, the gasifier wall structure, fluid dynamics, and plant operating conditions (mainly temperature and oxygen/carbon ratio all affect slagging behavior. Because coal has varying ash content and composition, different operating conditions are required to maintain the slag flow and limit problems downstream. In Part I, we review the main types and the operating conditions of entrained-flow gasifiers and coal properties used in IGCC plants; we identify and discuss the key coal ash properties and the operating conditions impacting slag behavior; finally, we summarize the coal quality criteria and the operating conditions in entrained-flow gasifiers. In Part II, we discuss the constitutive modeling related to the rheological studies of slag flow.

  1. Commercialization Development of Oxygen Fired CFB for Greenhouse Gas Control

    Energy Technology Data Exchange (ETDEWEB)

    Nsakala ya Nsakala; Gregory N. Liljedahl; David G. Turek

    2007-03-31

    Given that fossil fuel fired power plants are among the largest and most concentrated producers of CO{sub 2} emissions, recovery and sequestration of CO{sub 2} from the flue gas of such plants has been identified as one of the primary means for reducing anthropogenic (i.e., man-made) CO{sub 2} emissions. In 2001, ALSTOM Power Inc. (ALSTOM) began a two-phase program to investigate the feasibility of various carbon capture technologies. This program was sponsored under a Cooperative Agreement from the US Department of Energy's National Energy Technology Laboratory (DOE). The first phase entailed a comprehensive study evaluating the technical feasibility and economics of alternate CO{sub 2} capture technologies applied to Greenfield US coal-fired electric generation power plants. Thirteen cases, representing various levels of technology development, were evaluated. Seven cases represented coal combustion in CFB type equipment. Four cases represented Integrated Gasification Combined Cycle (IGCC) systems. Two cases represented advanced Chemical Looping Combined Cycle systems. Marion, et al. reported the details of this work in 2003. One of the thirteen cases studied utilized an oxygen-fired circulating fluidized bed (CFB) boiler. In this concept, the fuel is fired with a mixture of oxygen and recirculated flue gas (mainly CO{sub 2}). This combustion process yields a flue gas containing over 80 percent (by volume) CO{sub 2}. This flue gas can be processed relatively easily to enrich the CO{sub 2} content to over 96 percent for use in enhanced oil or gas recovery (EOR or EGR) or simply dried for sequestration. The Phase I study identified the O{sub 2}-fired CFB as having a near term development potential, because it uses conventional commercial CFB technology and commercially available CO{sub 2} capture enabling technologies such as cryogenic air separation and simple rectification or distillation gas processing systems. In the long term, air separation technology

  2. Development of an integrated gasifier-solid oxide fuel cell test system: A detailed system study

    Science.gov (United States)

    Liu, Ming; Aravind, P. V.; Woudstra, T.; Cobas, V. R. M.; Verkooijen, A. H. M.

    A detailed system study on an integrated gasifier-SOFC test system which is being constructed for combined heat and power (CHP) application is presented. The performance of the system is evaluated using thermodynamic calculations. The system includes a fixed bed gasifier and a 5 kW SOFC CHP system. Two kinds of gas cleaning systems, a combined high and low temperature gas cleaning system and a high temperature gas cleaning system, are considered to connect the gasifier and the SOFC system. A complete model of the gasifier-SOFC system with these two gas cleaning systems is built and evaluated in terms of energy and exergy efficiencies. A sensitivity study is carried out to check system responses to different working parameters. The results of this work show that the electrical efficiencies of the gasifier-SOFC CHP systems with different gas cleaning systems are almost the same whereas the gasifier-SOFC CHP systems with the high temperature gas cleaning system offers higher heat efficiency for both energy and exergy.

  3. Analysis of the causes of failure in high chrome oxide refractory materials from slagging gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, J.P.; Kwong, K.-S.; Powell, C.A.; Thomas, H.; Krabbe, R.A.

    2006-03-01

    High Cr2O3 refractory materials are used to line the hot face of slagging gasifiers. Gasifiers are reaction chambers that convert water, oxygen, and a carbon feedstock into CO, H2, and methane at temperatures as high as 1575oC and pressures up to 1000 psi. Ash in the carbon feedstock liquefies, erodes and corrodes the gasifier’s refractory liner, contributing to liner failure within a few months to two years. The failure of a refractory liner decreases a gasifier’s on-line availability and causes costly system downtime and repairs. Many factors contribute to refractory lining failure, including slag penetration and corrosion, thermal cycling, gasifier environment, and mechanical loads. The results of refractory post-mortem failure analysis and how observations relate to gasifier service life will be discussed.

  4. Sensitivity of Fischer-Tropsch Synthesis and Water-Gas Shift Catalysts to Poisons from High-Temperature High-Pressure Entrained-Flow (EF) Oxygen-Blown Gasifier Gasification of Coal/Biomass Mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Burtron Davis; Gary Jacobs; Wenping Ma; Khalid Azzam; Dennis Sparks; Wilson Shafer

    2010-09-30

    The successful adaptation of conventional cobalt and iron-based Fischer-Tropsch synthesis catalysts for use in converting biomass-derived syngas hinges in part on understanding their susceptibility to byproducts produced during the biomass gasification process. With the possibility that oil production will peak in the near future, and due to concerns in maintaining energy security, the conversion of biomass-derived syngas and syngas derived from coal/biomass blends to Fischer-Tropsch synthesis products to liquid fuels may provide a sustainable path forward, especially considering if carbon sequestration can be successfully demonstrated. However, one current drawback is that it is unknown whether conventional catalysts based on iron and cobalt will be suitable without proper development because, while ash, sulfur compounds, traces of metals, halide compounds, and nitrogen-containing chemicals will likely be lower in concentration in syngas derived from mixtures of coal and biomass (i.e., using an entrained-flow oxygen-blown gasifier) than solely from coal, other byproducts may be present in higher concentrations. The current project examines the impact of a number of potential byproducts of concern from the gasification of biomass process, including compounds containing alkali chemicals like the chlorides of sodium and potassium. In the second year, researchers from the University of Kentucky Center for Applied Energy Research (UK-CAER) continued the project by evaluating the sensitivity of a commercial iron-chromia high temperature water-gas shift catalyst (WGS) to a number of different compounds, including KHCO{sub 3}, NaHCO{sub 3}, HCl, HBr, HF, H{sub 2}S, NH{sub 3}, and a combination of H{sub 2}S and NH{sub 3}. Cobalt and iron-based Fischer-Tropsch synthesis (FT) catalysts were also subjected to a number of the same compounds in order to evaluate their sensitivities.

  5. Advanced coal gasifier designs using large-scale simulations

    Science.gov (United States)

    Syamlal, M.; Guenther, C.; Gel, A.; Pannala, S.

    2009-07-01

    Porting of the legacy code MFIX to a high performance computer (HPC) and the use of high resolution simulations for the design of a coal gasifier are described here. MFIX is based on a continuum multiphase flow model that considers gas and solids to form interpenetrating continua. Low resolution simulations of a commercial scale gasifier with a validated MFIX model revealed interesting physical phenomena with implications on the gasifier design, which prompted the study reported here. To be predictive, the simulations need to model the spatiotemporal variations in gas and solids volume fractions, velocities, temperatures with any associated phase change and chemical reactions. These processes occur at various time- and length-scales requiring very high spatial resolution and large number of iterations with small time-steps. We were able to perform perhaps the largest known simulations of gas-solids reacting flows, providing detailed information about the gas-solids flow structure and the pressure, temperature and species distribution in the gasifier. One key finding is the new features of the coal jet trajectory revealed with the high spatial resolution, which provides information on the accuracy of the lower resolution simulations. Methodologies for effectively combining high and low resolution simulations for design studies must be developed. From a computational science perspective, we found that global communication has to be reduced to achieve scalability to 1000s of cores, hybrid parallelization is required to effectively utilize the multicore chips, and the wait time in the batch queue significantly increases the actual time-to-solution. From our experience, development is required in the following areas: efficient solvers for heterogeneous, massively parallel systems; data analysis tools to extract information from large data sets; and programming environments for easily porting legacy codes to HPC.

  6. Aviary heating: control of air temperature heated by a set biomass gasifier-combustor in a co-current flow, using a frequency inverter; Aquecimento de aviarios: controle da temperatura do ar aquecido por um conjunto gaseificador-combustor de biomassa de fluxo concorrente, utilizando um inversor de frequencia

    Energy Technology Data Exchange (ETDEWEB)

    Santos, William Rosario dos [Universidade Presidente Antonio Carlos (UNIPAC), Ponte Nova, MG (Brazil); Silva, Jadir Nogueira; Oliveira Filho, Delly; Martins, Marcio Aredes; Oliveira, Jofran Luiz de [Universidade Federal de Vicosa (UFV), MG (Brazil)], Emails: jadir@ufv.br, delly@ufv.br, aredes@ufv.br, jofran.oliveira@ufv.br

    2009-07-01

    One of the problems with using the gasifier for heating purposes in poultry facilities is the waste of energy during the day, once the equipment does not have control of the thermal and power generated. During this period, the difference in temperature between the air and the standard for the birds inside the building is lower than when compared with the nocturnal period. During the day, the temperature inside the poultry house is controlled by curtains, which occurs without diminishing the biomass burning. Another way to control the temperature is the shutdown of the system, which requires the constant attention of the operator. In this way, there is a potential for energy savings if the thermal power could be controlled according to the demand, which can be represented by the temperature gradient. The purpose of this study was to control the temperature of exhaustion air from a set combustor-gasifier (down draft), based on the model developed by Martin et al. (2006), through the control of speed of the fan engine and also controlling the flow contributions of primary and secondary air in the combustor. The experiment was carried out in the Energy and Pre-processing of Agricultural Products areas, at the Department of Agricultural Engineering - Federal University of Vicosa. (author)

  7. Sensitivity of Fischer-Tropsch Synthesis and Water-Gas Shift Catalysts to Poisons from High-Temperature High-Pressure Entrained-Flow (EF) Oxygen-Blown Gasifier Gasification of Coal/Biomass Mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Burton Davis; Gary Jacobs; Wenping Ma; Dennis Sparks; Khalid Azzam; Janet Chakkamadathil Mohandas; Wilson Shafer; Venkat Ramana Rao Pendyala

    2011-09-30

    There has been a recent shift in interest in converting not only natural gas and coal derived syngas to Fischer-Tropsch synthesis products, but also converting biomass-derived syngas, as well as syngas derived from coal and biomass mixtures. As such, conventional catalysts based on iron and cobalt may not be suitable without proper development. This is because, while ash, sulfur compounds, traces of metals, halide compounds, and nitrogen-containing chemicals will likely be lower in concentration in syngas derived from mixtures of coal and biomass (i.e., using entrained-flow oxygen-blown gasifier gasification gasification) than solely from coal, other compounds may actually be increased. Of particular concern are compounds containing alkali chemicals like the chlorides of sodium and potassium. In the first year, University of Kentucky Center for Applied Energy Research (UK-CAER) researchers completed a number of tasks aimed at evaluating the sensitivity of cobalt and iron-based Fischer-Tropsch synthesis (FT) catalysts and a commercial iron-chromia high temperature water-gas shift catalyst (WGS) to alkali halides. This included the preparation of large batches of 0.5%Pt-25%Co/Al{sub 2}O{sub 3} and 100Fe: 5.1Si: 3.0K: 2.0Cu (high alpha) catalysts that were split up among the four different entities participating in the overall project; the testing of the catalysts under clean FT and WGS conditions; the testing of the Fe-Cr WGS catalyst under conditions of co-feeding NaCl and KCl; and the construction and start-up of the continuously stirred tank reactors (CSTRs) for poisoning investigations. In the second and third years, researchers from the University of Kentucky Center for Applied Energy Research (UK-CAER) continued the project by evaluating the sensitivity of a commercial iron-chromia high temperature water-gas shift catalyst (WGS) to a number of different compounds, including KHCO{sub 3}, NaHCO{sub 3}, HCl, HBr, HF, H{sub 2}S, NH{sub 3}, and a combination of H

  8. Commercial gasifier for IGCC applications study report

    Energy Technology Data Exchange (ETDEWEB)

    Notestein, J.E.

    1990-06-01

    This was a scoping-level study to identify and characterize the design features of fixed-bed gasifiers appearing most important for a gasifier that was to be (1) potentially commercially attractive, and (2) specifically intended for us in integrated coal gasification/combined-cycle (IGCC) applications. It also performed comparative analyses on the impact or value of these design features and on performance characteristics options of the whole IGCC system since cost, efficiency, environmental traits, and operability -- on a system basis -- are what is really important. The study also reviewed and evaluated existing gasifier designs, produced a conceptual-level gasifier design, and generated a moderately advanced system configuration that was utilized as the reference framework for the comparative analyses. In addition, technical issues and knowledge gaps were defined. 70 figs., 31 tabs.

  9. Gasification of yeast industry treatment plant sludge using downdraft Gasifier.

    Science.gov (United States)

    Ayol, Azize; Tezer, Ozgun; Gurgen, Alim

    2018-01-01

    Sludges produced in biological wastewater treatment plants have rich organic materials in their characteristics. Recent research studies have focused on the energy recovery from sludge due to its high organic content. The gasification process is a thermal conversion technology transforming the chemical energy contained in a solid fuel into thermal energy and electricity. The produced syngas as a mixture of CO, CH 4 , H 2 and other gases can be used to generate electrical energy. The gasification of yeast industry sludge has been experimentally evaluated in a pilot scale downdraft-type gasifier as a route towards the energy recovery. The gasifier has 20 kg biomass/h fuel capacity. During gasification, the temperature achieved was more than 1,000°C in the gasifier, and then the syngas was transferred to the gas engine to yield the electricity. A load was connected to the grid box and approximately 1 kWh electrical power generation for 1 kg dry sludge was determined. The characteristics of residuals - ash, glassy material - were also analyzed. It was found that most of the heavy metals were fixed in the glassy material. Experimental results showed that the yeast industry sludge was an appropriate material for gasification studies and remarkable energy recovery was obtained in terms of power production by using syngas.

  10. Optical Fiber Sensor Instrumentation for Slagging Coal Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Anbo Wang; Kristie Cooper

    2008-07-19

    Coal gasifier is one of the most promising solutions for clean fossil energy. Refractory thickness monitoring and online real-time temperature measurement is needed for improved reliability and advanced process control for current and future generation power plants. The objective of this program is to design and implement an optical fiber based sensing system that could potentially be used to monitor refractory wall thickness and temperature inside a coal gasifier. For the thickness monitoring, the system should be able to operate at temperatures up to 1000 C. For this temperature range, silica fiber can still work so it is chosen for the sensor design. The measurement is based on a photon counting optical time domain reflectometer. A narrow light pulse is launched into a silica fiber which could be embedded into the gasifier refractory wall, and is partially reflected by the far end of the fiber. The time of flight of the light pulse in the fiber then gives an indication of the position of the fiber end, which is a function of the wall thickness when the fiber is embedded. Results obtained show a measurement accuracy of {+-}2cm in environment of 1000 C with a saw cut fiber end. When the fiber end is corroded by sodium carbide at 900 C, the accuracy is {+-}3cm. For the temperature measurement, a single crystal sapphire fiber sensor is designed. The sapphire fiber guides the broadband light from a light emitting diode to a sapphire wafer functioning as a Fabry-Perot interferometer and the wafer optical thickness is a function of temperature. The returned optical signal is then demodulated by multimode fiber based whitelight interferometry. The system was tested up to 1500 C with a measurement accuracy of {+-}10 C for the entire measurement range.

  11. The improvement of slagging gasifier refractories

    Energy Technology Data Exchange (ETDEWEB)

    Kwong, K.-S.; Bennett, J.P.; Powell, C.A.; Krabbe, R.A.

    2006-03-01

    Refractories play a vital role in slagging gasifier on-line availability and profitability for the next clean power generation system. A recent survey of gasifier users by USDOE indicated that a longer service life of refractories is the highest need among gasifier operators. Currently, Cr2O3 based refractories, the best of commercially available materials for use in slagging gasifiers, last between 3 and 24 months. Researchers at Albany Research Center (ARC) have identified structural spalling, caused by slag penetration, as one of the major failure mechanisms of Cr2O3 refractories through postmortem analysis. New Cr2O3 refractories with phosphate additives have been developed by ARC to decrease slag penetration and thus structural spalling. Laboratory physical property tests indicated that ARC developed refractories are superior to other commercial bricks. One of the ARC developed phosphate containing refractories has been installed in a slagging gasifier. Preliminary results of the performance of this refractory in the gasifier will be reported along with research to develop non-chromia refractories.

  12. Use of fuzzy logic to control a gasifier biomass ventilation system and maintenance of the temperature in the oxidation zone; Uso da logica fuzzy para controle do sistema de ventilacao de um gaseificador de biomassa e manutencao da temperatura da zona de oxidacao

    Energy Technology Data Exchange (ETDEWEB)

    Rezende, Oscar L.T.; Kulitz, Hans H. [Instituto Federal de Educacao, Ciencia e Tecnologia do Espirito Santo (IFES), Vitoria, ES (Brazil); Silva, Jadir N.; Galvarro, Svetlana F.S.; Machado, Cassio [Universidade Federal de Vicosa (UFV), MG (Brazil)], E-mail: oscar@ifes.edu.br

    2012-11-01

    This study aims at developing a fuzzy-based algorithm to control the frequency applied to the motor of a gasifier ventilation system in order to ensure adequate temperature in the oxidation zone and produce good quality gas. The input variables of the fuzzy controller were: error, which determines the difference between the desired temperature and the temperature at a given instant; and temperature variation, which will inform if it is increasing or decreasing at a given instant. The response variable was the operation frequency of the ventilation system motor. The rule base was built based on experimental data. The tests with the control algorithm allowed us to see that it is possible to control the oxidation zone temperature - producing gas in a stable way, which does not occur in gasification processes without ventilation system control. (author)

  13. Gasification in pulverized coal flames. Second quarterly progress report, October--December 1975. [Contains literature survey on vortex gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Lenzer, R. C.; George, P. E.; Laurendeau, N. M.

    1976-01-01

    This project is concerned with the production of power and synthesis gases from pulverized coal via suspension gasification. A literature review concerning the vortex type gasifier has been completed and a survey concerning the confined jet gasifier is underway. Preliminary design of the vortex gasifier is nearing completion. Test cell and coal handling facilities are in the final stages of design and coal handling equipment has been received. A mass spectrometer has been ordered and a preliminary survey of high-temperature probes is complete.

  14. A comparison of fuzzy logic and cluster renewal approaches for heat transfer modeling in a 1296 t/h CFB boiler with low level of flue gas recirculation

    Directory of Open Access Journals (Sweden)

    Błaszczuk Artur

    2017-03-01

    Full Text Available The interrelation between fuzzy logic and cluster renewal approaches for heat transfer modeling in a circulating fluidized bed (CFB has been established based on a local furnace data. The furnace data have been measured in a 1296 t/h CFB boiler with low level of flue gas recirculation. In the present study, the bed temperature and suspension density were treated as experimental variables along the furnace height. The measured bed temperature and suspension density were varied in the range of 1131-1156 K and 1.93-6.32 kg/m3, respectively. Using the heat transfer coefficient for commercial CFB combustor, two empirical heat transfer correlation were developed in terms of important operating parameters including bed temperature and also suspension density. The fuzzy logic results were found to be in good agreement with the corresponding experimental heat transfer data obtained based on cluster renewal approach. The predicted bed-to-wall heat transfer coefficient covered a range of 109-241 W/(m2K and 111-240 W/(m2K, for fuzzy logic and cluster renewal approach respectively. The divergence in calculated heat flux recovery along the furnace height between fuzzy logic and cluster renewal approach did not exceeded ±2%.

  15. Biomass downdraft gasifier with internal cyclonic combustion chamber: design, construction, and experimental results.

    Science.gov (United States)

    Patil, Krushna; Bhoi, Prakash; Huhnke, Raymond; Bellmer, Danielle

    2011-05-01

    An exploratory downdraft gasifier design with unique biomass pyrolysis and tar cracking mechanism is evolved at Oklahoma State University. This design has an internal separate combustion section where turbulent, swirling high-temperature combustion flows are generated. A series of research trials were conducted using wood shavings as the gasifier feedstock. Maximum tar cracking temperatures were above 1100°C. Average volumetric concentration levels of major combustible components in the product gas were 22% CO and 11% H(2). Hot and cold gas efficiencies were 72% and 66%, respectively. Copyright © 2011 Elsevier Ltd. All rights reserved.

  16. Integration of concentrated solar power (CSP) and circulating fluidized bed (CFB) power plants - final results of the COMBO-CFB project

    Science.gov (United States)

    Suojanen, Suvi; Hakkarainen, Elina; Kettunen, Ari; Kapela, Jukka; Paldanius, Juha; Tuononen, Minttu; Selek, Istvan; Kovács, Jenö; Tähtinen, Matti

    2017-06-01

    Hybridization of solar energy together with another energy source is an option to provide heat and power reliably on demand. Hybridization allows decreasing combustion related fuel consumption and emissions, assuring stable grid connection and cutting costs of concentrated solar power technology due to shared power production equipment. The research project "Integration of Concentrated Solar Power (CSP) and Circulating Fluidized Bed (CFB) Power Plants" (COMBO-CFB) has been carried out to investigate the technical possibilities and limitations of the concept. The main focus was on the effect of CSP integration on combustion dynamics and on the joint power cycle, and on the interactions of subsystems. The research provides new valuable experimental data and knowhow about dynamic behaviour of CFB combustion under boundary conditions of the hybrid system. Limiting factors for maximum solar share in different hybridization schemes and suggestions for enhancing the performance of the hybrid system are derived.

  17. Biomass Power Generation through Direct Integration of Updraft Gasifier and Stirling Engine Combustion System

    Directory of Open Access Journals (Sweden)

    Jai-Houng Leu

    2010-01-01

    Full Text Available Biomass is the largest renewable energy source in the world. Its importance grows gradually in the future energy market. Since most biomass sources are low in energy density and are widespread in space, small-scale biomass conversion system is therefore more competitive than a large stand-alone conversion plant. The current study proposes a small-scale solid biomass power system to explore the viability of direct coupling of an updraft fixed bed gasifier with a Stirling engine. The modified updraft fixed bed gasifier employs an embedded combustor inside the gasifier to fully combust the synthetic gas generated by the gasifier. The flue gas produced by the synthetic gas combustion inside the combustion tube is piped directly to the heater head of the Stirling engine. The engine will then extract and convert the heat contained in the flue gas into electricity automatically. Output depends on heat input. And, the heat input is proportional to the flow rate and temperature of the flue gas. The preliminary study of the proposed direct coupling of an updraft gasifier with a 25 kW Stirling engine demonstrates that full power output could be produced by the current system. It could be found from the current investigation that no auxiliary fuel is required to operate the current system smoothly. The proposed technology and units could be considered as a viable solid biomass power system.

  18. Condensate from a two-stage gasifier

    DEFF Research Database (Denmark)

    Bentzen, Jens Dall; Henriksen, Ulrik Birk; Hindsgaul, Claus

    2000-01-01

    Condensate, produced when gas from downdraft biomass gasifier is cooled, contains organic compounds that inhibit nitrifiers. Treatment with activated carbon removes most of the organics and makes the condensate far less inhibitory. The condensate from an optimised two-stage gasifier is so clean...... that the organic compounds and the inhibition effect are very low even before treatment with activated carbon. The moderate inhibition effect relates to a high content of ammonia in the condensate. The nitrifiers become tolerant to the condensate after a few weeks of exposure. The level of organic compounds...... and the level of inhibition are so low that condensate from the optimised two-stage gasifier can be led to the public sewer....

  19. Design and techno economic evaluation of biomass gasifier for ...

    African Journals Online (AJOL)

    user

    This paper addresses the design, performance and economic evaluation of biomass based open core downdraft gasifier for industrial process heat application. The gasifier is having feed rate as 90 kg h-1 and producing about 850 MJ h-1 of heat. The gasifier has been installed in M/S Phosphate India Pvt. Limited, Udaipur ...

  20. Handbook of biomass downdraft gasifier engine systems

    Energy Technology Data Exchange (ETDEWEB)

    Reed, T B; Das, A

    1988-03-01

    This handbook has been prepared by the Solar Energy Research Institute under the US Department of Energy /bold Solar Technical Information Program/. It is intended as a guide to the design, testing, operation, and manufacture of small-scale (less than 200 kW (270 hp)) gasifiers. A great deal of the information will be useful for all levels of biomass gasification. The handbook is meant to be a practical guide to gasifier systems, and a minimum amount of space is devoted to questions of more theoretical interest.

  1. Performance Evaluation of Throatless Gasifier Using Pine Needles as a Feedstock for Power Generation

    Directory of Open Access Journals (Sweden)

    Dhaundiyal Alok

    2016-03-01

    Full Text Available This paper deals with the performance evaluation of a throatless gasifier TG-SI-10E. Evaluation of the throatless gasifier was done in three streams, which were the thermal, design and economic aspects. It was tested with pine needles, derived from the Himalayan chir pine (Pinus roxburghii. A non-isokinetic sampling technique was used for measuring the tar and dust contents. The carbon dioxide and carbon monoxide emission at the exhaust of engine was in the range of 12.8% and 0.1-0.5% respectively. The maximum temperature of producer gas measured at the outlet of the gasifier was 505 °C. The specific biomass consumption rate of pine needles was calculated to be 1.595 kg/kWh (electrical. Specific gasification rate for the given design was found to be 107 kg/m2h. Economic evaluation was based on direct tax incidence.

  2. Bed agglomeration in biomass fueled CFB-boilers; Sintring av baeddmaterial vid biobraensleeldning i CFB

    Energy Technology Data Exchange (ETDEWEB)

    Zintl, F. [TPS Termiska Processer AB, Nykoeping (Sweden)

    1997-02-01

    In fluidized-bed boilers fired with solid fuels operational problems caused by spontaneous defluidization are sometimes observed. This bed agglomeration can be caused by sintering phenomena where fuel components and/or bed material may be involved. In serious cases the problems can lead to expensive operation breaks. The objective in this project was to show whether this type of operational problems can be minimized by choice of other than conventional bed materials. The study was carried out as model experiments in a larger laboratory scale. In a fluidized bed fired with propane a number of both well known and more unusual bed materials were tried out. The choice of bed materials included some common sands (silver and quartz sand) and, as possible alternatives, olivine sand, zirconium sand, calcined dolomite and the synthetic materials sintered magnesite (MgO) and mullite (alumina silicate). The model experiments were started at about 700 deg C and the temperature then raised until an irreversible bed agglomeration was observed, or to a maximum of 1100 deg C. The most promising results were obtained with calcined dolomite, being an active bed material. With this material no irreversible agglomerations were observed at all. The expensive synthetic materials sintered magnesite and mullite and the zirconium sand turned out as the next best. Olivine sand, on the other hand, showed a clear sensitivity to physical agglomeration and some sensitivity also towards sintering. The common sand types based on silicon oxide clearly showed the worst results. 12 refs, 5 figs, 1 tab 12 refs, 5 figs, 1 tab

  3. Pressure-Letdown Plates for Coal Gasifiers

    Science.gov (United States)

    Collins, E. R., Jr.

    1985-01-01

    Variation of pseudoporous plates used with coal gasifiers in pressure letdown stage of processing minimize clogging. Rotating plates containing variable gap annuli continually change flow path to enable erosionless reduction of gas pressure. Particles that otherwise clog porous plugs pass through gaps.

  4. Experimental study on air-stream gasification of biomass micron fuel (BMF) in a cyclone gasifier.

    Science.gov (United States)

    Guo, X J; Xiao, B; Zhang, X L; Luo, S Y; He, M Y

    2009-01-01

    Based on biomass micron fuel (BMF) with particle size of less than 250 microm, a cyclone gasifier concept has been considered in our laboratory for biomass gasification. The concept combines and integrates partial oxidation, fast pyrolysis, gasification, and tar cracking, as well as a shift reaction, with the purpose of producing a high quality of gas. In this paper, experiments of BMF air-stream gasification were carried out by the gasifier, with energy for BMF gasification produced by partial combustion of BMF within the gasifier using a hypostoichiometric amount of air. The effects of ER (0.22-0.37) and S/B (0.15-0.59) and biomass particle size on the performances of BMF gasification and the gasification temperature were studied. Under the experimental conditions, the temperature, gas yields, LHV of the gas fuel, carbon conversion efficiency, stream decomposition and gasification efficiency varied in the range of 586-845 degrees C, 1.42-2.21 N m(3)/kg biomass, 3806-4921 kJ/m(3), 54.44%-85.45%, 37.98%-70.72%, and 36.35%-56.55%, respectively. The experimental results showed that the gasification performance was best with ER being 3.7 and S/B being 0.31 and smaller particle, as well as H(2)-content. And the BMF gasification by air and low temperature stream in the cyclone gasifier with the energy self-sufficiency is reliable.

  5. STUDY OF CHARACTERISTICS OF GASIFICATION PROCESS OF VARIOUS BIOMASS IN A DOWNDRAFT GASIFIER

    OpenAIRE

    Aktawan, Agus; Prasetya, Agus; Wilopo, Wahyu

    2015-01-01

    Biomass gasification is an endothermic reaction process for converting biomass into syngas, occurs at high temperatures with limited oxygen. Knowing the temperature profile of biomass gasification wood charcoal, coconut shell charcoal and coconut shell, rice husk and woodchip and seek optimal results from gasification of biomass are the purpose of the research.The equipment in this research consisted of; gasifier as the main tool with 4 temperature sensors, two cyclones for tar and dust separ...

  6. Numerical Investigation on Performance of Coal Gasifier of 150kW under Various Injection Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hyeongyeong; Suh, Jaeseung [Hannam Univ., Daejeon (Korea, Republic of); Lho, Taihyeop [National Fusion Research Institute, Daejeon (Korea, Republic of)

    2015-05-15

    Integrated coal gasification combined cycle (IGCC) has gained a lot of interest because they can produce cleaner gaseous fuels such as hydrogen, carbon monoxide and methane. This study focuses on the 150kW gasifier which is used in the National Fusion Research Institute (NFRI) plant. It is a fusion plasma technology to existing coal gasifier for better efficiency of low-carbon fuels. The cold gas is generated by reacting oxidants to coal with plasma technology of high temperature. The purpose of this study is to get the highest cold gas efficiency varied according to oxidant/coal injection amount, location and feeding gas. It is considerably complicated and expensive that cold gas efficiency is experimentally compared for all cases. It is possible to predict flow patterns, tracks of particles, combustion characteristics, temperature distributions and chemical distributions using the commercial CFD solver ANSYS/FLUENT. This study has numerical investigation for the phenomena of coal gasification for coal gasifier of 150kW at various operating conditions. The results are summarized in table 6. The air as feeding gas is more efficient than carbon dioxide, and the amount of coal that is important to find the appropriate value for the capacity of the gasifier than strictly greater.

  7. An experimental study on air gasification of biomass micron fuel (BMF) in a cyclone gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Xianjun [School of Environmental Science and Engineering, Huazhong University of Science and Technology, 1037 Luoyu Rd., Wuhan 430074 (China)]|[School of Environment and Materials Engineering, Yantai University, 32 Qingquan Rd., Yantai 264005 (China); Xiao, Bo; Liu, Shiming; Hu, Zhiquan; Luo, Siyi; He, Maoyun [School of Environmental Science and Engineering, Huazhong University of Science and Technology, 1037 Luoyu Rd., Wuhan 430074 (China)

    2009-02-15

    Biomass micron fuel (BMF) produced from feedstock (energy crops, agricultural wastes, forestry residues and so on) through an efficient crushing process is a kind of powdery biomass fuel with particle size of less than 250 {mu}m. Based on the properties of BMF, a cyclone gasifier concept has been considered in our laboratory for biomass gasification. The concept combines and integrates partial oxidation, fast pyrolysis, gasification, and tar cracking, as well as a shift reaction, with the purpose of producing a high quality of gas. In this paper, characteristics of BMF air gasification were studied in the gasifier. Without outer heat energy input, the whole process is supplied with energy produced by partial combustion of BMF in the gasifier using a hypostoichiometric amount of air. The effects of equivalence ratio (ER) and biomass particle size on gasification temperature, gas composition, gas yield, low-heating value (LHV), carbon conversion and gasification efficiency were studied. The results showed that higher ER led to higher gasification temperature and contributed to high H{sub 2}-content, but too high ER lowered fuel gas content and degraded fuel gas quality. A smaller particle was more favorable for higher gas yield, LHV, carbon conversion and gasification efficiency. And the BMF air gasification in the cyclone gasifier with the energy self-sufficiency is reliable. (author)

  8. Recent circulating fluid bed (CFB) boiler projects in the U. S. and Europe

    Energy Technology Data Exchange (ETDEWEB)

    Lund, T.; Anders, R.; Capuano, L.; Fox, S.; Plass, L.

    1983-11-01

    Lurgi Chemie and Huettentechnik has developed the circulating fluid bed process for solid fuel combustion and steam generation. This process has been commercially proven at Luenen, West Germany. Lurgi Chemie is also currently building two additional CFB boilers in Germany which will produce 595,000 pph and 331,000 pph of steam, respectively. In the U.S., Lurgi Corporation and Combustion Engineering have signed an agreement to jointly design, manufacture and sell CFB plants in the U.S. and Canada. The circular fluid bed process itself is a system which can burn a wide variety of inexpensive, low grade solid fules efficiently, economically and in an environmentally acceptable manner. The details of these CFB boilers are examined in this article.

  9. Discriminating between pyroxenite and peridotite sources for continental flood basalts (CFB) in southern Africa using olivine chemistry

    Science.gov (United States)

    Howarth, Geoffrey H.; Harris, Chris

    2017-10-01

    Continental Flood Basalts (CFB) result from voluminous outpourings of magma that often precede continental break-up. Notwithstanding the petrogenetic importance of CFBs, the nature of the mantle source for such magmas is contentious, particularly with regard to picrites with Ni-rich olivine phenocrysts. Previous studies have suggested that Ni-rich olivines associated with plume volcanism in regions of thickened (>90 km) lithosphere are related to either source mineralogy differences (peridotite versus pyroxenite) or change in olivine-melt partitioning due to pressure increase. In order to evaluate these two hypotheses, we present trace element data for olivines from the Karoo CFB Tuli and Mwenezi picrites and the Etendeka CFB Horingbaai/LTZ-L type picrites, all of which erupted in regions of thickened (>90 km) lithosphere in southern Africa. Karoo picrite olivines are Ni-rich, Ca- and Mn-poor, and have low (1.4) 100*Mn/Fe, which is more consistent with high temperature melting of a dominantly peridotitic source. We also show that the Karoo and Etendeka olivines are characterized by distinct Mn/Zn ratios of 15, respectively. In addition, bulk rock geochemical data compilations and previously reported olivine δ18O for Karoo and Etendeka CFBs are discussed in order to further constrain source components based on previously described pyroxenite melt geochemical indices such as MgO-CaO systematics, FeO/MnO, Zn/Fe, and FC3MS (FeO/CaO-3*MgO/SiO2). These geochemical indices suggest a pyroxenite-dominated source for Karoo CFBs as well as for Etendeka ferropicrites whereas a peridotite-dominated source is indicated for Etendeka Horingbaai/LTZ-L type picrites analyzed in this study. Based on our data, Ni-enrichment of olivine in plume-related magmas in regions of thickened lithosphere in southern Africa is not ubiquitous. We therefore suggest that mineralogical variation of the source is a more likely major control of olivine chemistry and parent melt variations for Karoo

  10. Numerical methods application to study processes in the CFB boilers combustion chambers

    Directory of Open Access Journals (Sweden)

    Koksharev Oleg M.

    2017-01-01

    Full Text Available This paper presents the application of numerical calculation of a hybrid Euler–Lagrange approach to model the gas–solid flow combined with a combustion process in the CFB boiler that has been resolved by applying the ANSYS FLUENT 14.0. In this work, the numerical modelling of furnace processes at various speeds of airflow supply from below was estimated. For the design speed adopted values of 0.5, 1.5, 2.5 and 5 m/s. The research object is the combustion chamber of boiler unit with CFB, with steam capacity of 230 t/h.

  11. Numerical methods application to study processes in the CFB boilers combustion chambers

    OpenAIRE

    Koksharev Oleg M.; Gil Andrey V.

    2017-01-01

    This paper presents the application of numerical calculation of a hybrid Euler-Lagrange approach to model the gas-solid flow combined with a combustion process in the CFB boiler that has been resolved by applying the ANSYS FLUENT 14.0. In this work, the numerical modelling of furnace processes at various speeds of airflow supply from below was estimated. For the design speed adopted values of 0.5, 1.5, 2.5 and 5 m/s. The research object is the combustion chamber of boiler unit with CFB, with ...

  12. Evaluating the status of the Texaco gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Perry, H.

    1981-01-01

    Conclusions after a series of runs at steady state conditions in the pilot plant are: (1) Western Kentucky No. 9 coal (either run-of-mine or washed) can be gasified without pretreatment; (2) other coking bituminous coal may also be able to be gasified without pretreatment; (3) pretreatment is not required to achieve satisfactory ash agglomeration; (4) balanced ash agglomeration with satisfactory removal of the agglomerates has been achieved and stable operation of ash agglomeration is possible during periods of short upset; (5) solutions appear to have been found for prevention of clinkering and sintering by alternative venturi design, modification in the oxygen feed system and increasing the superficial velocity of the gas; (6) under certain circumstances fines recycle has been achieved with stable operation and fluidization; (7) the process can be operated at pressures up to 60 psig without adversely affecting other process parameters; (8) a wide range of operating conditions can be used while maintaining system operability; and (9) in a single test water cooling of the cyclone appears to prevent ash deposition on the cooled surfaces which confirms the experience of Westinghouse with ash deposition prevention in their fluidized bed gasifier. 11 references, 12 tables.

  13. The Pinch-method Applied on a Biomass Gasifier System

    DEFF Research Database (Denmark)

    Fock, Felicia; Thomsen, Kirstine; Houbak, Niels

    2000-01-01

    The scope of this study is to optimise the heat exchanger system in two down draft gasification systems and to compare them in terms of energy conversion efficiency and economy. In both cases the system consists of a thermal biomass gasifier followed by a gas cleaning unit and an IC engine...... with a power generator. A computer model of the system has been developed. Application of the model in combination with the Pinch method has been used in optimising the internal heat exchanging system in each of the two gasification systems. Following an optimisation of a two-stage gasifier and an open core...... gasifier respectively, the study shows that the two-stage gasifier has the highest power conversion efficiency, and the open core gasifier has the highest heat conversion efficiency. The economical comparison of the two gasification systems indicates that the two-stage gasifier is slightly more profitable....

  14. Advanced gasifier and water gas shift technologies for low cost coal conversion to high hydrogen syngas

    Energy Technology Data Exchange (ETDEWEB)

    Kramer, Andrew Kramer [Gas Technology Inst., Des Plaines, IL (United States)

    2016-09-30

    The Gas Technology Institute (GTI) and team members RTI International (RTI), Coanda Research and Development, and Nexant, are developing and maturing a portfolio of technologies to meet the United States Department of Energy (DOE) goals for lowering the cost of producing high hydrogen syngas from coal for use in carbon capture power and coal-to-liquids/chemicals. This project matured an advanced pilot-scale gasifier, with scalable and commercially traceable components, to readiness for use in a first-of-a-kind commercially-relevant demonstration plant on the scale of 500-1,000 tons per day (TPD). This was accomplished through cold flow simulation of the gasifier quench zone transition region at Coanda and through an extensive hotfire gasifier test program on highly reactive coal and high ash/high ash fusion temperature coals at GTI. RTI matured an advanced water gas shift process and catalyst to readiness for testing at pilot plant scale through catalyst development and testing, and development of a preliminary design basis for a pilot scale reactor demonstrating the catalyst. A techno-economic analysis was performed by Nexant to assess the potential benefits of the gasifier and catalyst technologies in the context of power production and methanol production. This analysis showed an 18%reduction in cost of power and a 19%reduction in cost of methanol relative to DOE reference baseline cases.

  15. Liquid CO2/Coal Slurry for Feeding Low Rank Coal to Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Marasigan, Jose [Electric Power Research Institute, Inc., Palo Alto, CA (United States); Goldstein, Harvey [Electric Power Research Institute, Inc., Palo Alto, CA (United States); Dooher, John [Electric Power Research Institute, Inc., Palo Alto, CA (United States)

    2013-09-30

    This study investigates the practicality of using a liquid CO2/coal slurry preparation and feed system for the E-Gas™ gasifier in an integrated gasification combined cycle (IGCC) electric power generation plant configuration. Liquid CO2 has several property differences from water that make it attractive for the coal slurries used in coal gasification-based power plants. First, the viscosity of liquid CO2 is much lower than water. This means it should take less energy to pump liquid CO2 through a pipe compared to water. This also means that a higher solids concentration can be fed to the gasifier, which should decrease the heat requirement needed to vaporize the slurry. Second, the heat of vaporization of liquid CO2 is about 80% lower than water. This means that less heat from the gasification reactions is needed to vaporize the slurry. This should result in less oxygen needed to achieve a given gasifier temperature. And third, the surface tension of liquid CO2 is about 2 orders of magnitude lower than water, which should result in finer atomization of the liquid CO2 slurry, faster reaction times between the oxygen and coal particles, and better carbon conversion at the same gasifier temperature. EPRI and others have recognized the potential that liquid CO2 has in improving the performance of an IGCC plant and have previously conducted systemslevel analyses to evaluate this concept. These past studies have shown that a significant increase in IGCC performance can be achieved with liquid CO2 over water with certain gasifiers. Although these previous analyses had produced some positive results, they were still based on various assumptions for liquid CO2/coal slurry properties.

  16. Causticizing for Black Liquor Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Scott Sinquefeld; James Cantrell; Xiaoyan Zeng; Alan Ball; Jeff Empie

    2009-01-07

    The cost-benefit outlook of black liquor gasification (BLG) could be greatly improved if the smelt causticization step could be achieved in situ during the gasification step. Or, at a minimum, the increase in causticizing load associated with BLG could be mitigated. A number of chemistries have been proven successful during black liquor combustion. In this project, three in situ causticizing processes (titanate, manganate, and borate) were evaluated under conditions suitable for high temperature entrained flow BLG, and low temperature steam reforming of black liquor. The evaluation included both thermodynamic modeling and lab experimentation. Titanate and manganate were tested for complete direct causticizing (to thus eliminate the lime cycle), and borates were evaluated for partial causticizing (to mitigate the load increase associated with BLG). Criteria included high carbonate conversion, corresponding hydroxide recovery upon hydrolysis, non process element (NPE) removal, and economics. Of the six cases (three chemistries at two BLG conditions), only two were found to be industrially viable: titanates for complete causticizing during high temperature BLG, and borates for partial causticizing during high temperature BLG. These two cases were evaluated for integration into a gasification-based recovery island. The Larsen [28] BLG cost-benefit study was used as a reference case for economic forecasting (i.e. a 1500 tpd pulp mill using BLG and upgrading the lime cycle). By comparison, using the titanate direct causticizing process yielded a net present value (NPV) of $25M over the NPV of BLG with conventional lime cycle. Using the existing lime cycle plus borate autocausticizing for extra capacity yielded a NPV of $16M.

  17. Development of Catalytic Tar Decomposition in an Internally Circulating Fluidized-Bed Gasifier

    Science.gov (United States)

    Xiao, Xianbin; Le, Due Dung; Morishita, Kayoko; Li, Liuyun; Takarada, Takayuki

    Biomass gasification in an Internally Circulating Fluidized-bed Gasifier (ICFG) using Ni/Ah03 as tar cracking catalyst is studied at low temperature. Reaction conditions of the catalyst bed are discussed, including catalytic temperature and steam ratio. High energy efficiency and hydrogen-rich, low-tar product gas can be achieved in a properly designed multi-stage gasification process, together with high-performance catalyst. In addition, considering the economical feasibility, a newly-developed Ni-loaded brown coal char is developed and evaluated as catalyst in a lab-scale fluidized bed gasifier with catalyst fixed bed. The new catalyst shows a good ability and a hopeful prospect oftar decomposition, gas quality improvement and catalytic stability.

  18. Biomass Gasifier Facility (BGF). Environmental Assessment

    Energy Technology Data Exchange (ETDEWEB)

    1992-09-01

    The Pacific International Center for High Technology Research (PICHTR) is planning, to design, construct and operate a Biomass Gasifier Facility (BGF). This facility will be located on a site easement near the Hawaiian Commercial & Sugar company (KC&S) Paia Sugar Factory on Maui, Hawaii. The proposed BGF Project is a scale-up facility, intended to demonstrate the technical and economic feasibility of emerging biomass gasification technology for commercialization. This Executive Summary summarizes the uses of this Environmental Assessment, the purpose and need for the project, project,description, and project alternatives.

  19. GPGP Gasifier Optimization II. Task 2.2, Coal characterization by selected analytical methods

    Energy Technology Data Exchange (ETDEWEB)

    Cisney, S.J.; Erjavec, J.

    1993-12-01

    This project was undertaken by the Energy & Environmental Research Center (EERC) for the Dakota Gasification Company (DGC) in order to find out if any coal chemical characteristics correlated with gasifier performance as measured by ``Equivalent Gas Make per Equivalent Gasifier`` (EGM/EG). The measurements made on a total of 48 coal samples included ASTM proximate analysis, calorific (Btu) determination, sulfur analysis, ash fusion temperatures, x-ray fluorescence (XRF) analysis of the ash, and char-steam reactivity determination by thermogravimetric analysis (TGA). After Task 2.1 (which, again, only looked at six coal samples), two measurements were found to be very promising as predictors of gasifier performance: (1) the energy of activation of the TGA char-steam reactivity tests (E{sub a}), which had a correlation coefficient, R{sup 2}, of 0.75 and (2) the difference between the hemi- and the softening temperatures in the ash fusion test, which had an R{sup 2} of 0.80. After analyzing 42 more coal samples (for a total of 48), the R{sup 2} for E{sub a} dropped to 0.33, but it was still the highest of any single measurement. As for the ash fusion test, with the additional data, the correlation of performance with the difference between the hemi- and softening temperatures all but disappeared (R{sup 2} = 0.08). One new variable, the Btu value of the coal, was found to be almost as good a predictor of performance (R{sup 2} = 0.30) as E{sub a}. When the two measurements were used together, they gave the best correlation of any two variables with EGM/EG (R{sup 2} = 0.50). Thus although numerous highly significant (statistically speaking) correlations were found between coal properties and gasifier performance, whether they are strong enough to help guide plant operations is yet to be determined.

  20. Effect of Coal Properties and Operation Conditions on Flow Behavior of Coal Slag in Entrained Flow Gasifiers: A Brief Review

    Energy Technology Data Exchange (ETDEWEB)

    Wang,Ping; Massoudi, Mehrdad

    2011-01-01

    Integrated gasification combined cycle (IGCC) is a potentially promising clean technology with an inherent advantage of low emissions, since the process removes contaminants before combustion instead of from flue gas after combustion, as in a conventional coal steam plant. In addition, IGCC has potential for cost-effective carbon dioxide capture. Availability and high capital costs are the main challenges to making IGCC technology more competitive and fully commercial. Experiences from demonstrated IGCC plants show that, in the gasification system, low availability is largely due to slag buildup in the gasifier and fouling in the syngas cooler downstream of the gasification system. In the entrained flow gasifiers used in IGCC plants, the majority of mineral matter transforms to liquid slag on the wall of the gasifier and flows out the bottom. However, a small fraction of the mineral matter (as fly ash) is entrained with the raw syngas out of the gasifier to downstream processing. This molten/sticky fly ash could cause fouling of the syngas cooler. Therefore, it is preferable to minimize the quantity of fly ash and maximize slag. In addition, the hot raw syngas is cooled to convert any entrained molten fly slag to hardened solid fly ash prior to entering the syngas cooler. To improve gasification availability through better design and operation of the gasification process, better understanding of slag behavior and characteristics of the slagging process are needed. Slagging behavior is affected by char/ash properties, gas compositions in the gasifier, the gasifier wall structure, fluid dynamics, and plant operating conditions (mainly temperature and oxygen/carbon ratio). The viscosity of the slag is used to characterize the behavior of the slag flow and is the dominating factor to determine the probability that ash particles will stick. Slag viscosity strongly depends on the temperature and chemical composition of the slag. Because coal has varying ash content and

  1. Gasification of biomass in a fixed bed downdraft gasifier--a realistic model including tar.

    Science.gov (United States)

    Barman, Niladri Sekhar; Ghosh, Sudip; De, Sudipta

    2012-03-01

    This study presents a model for fixed bed downdraft biomass gasifiers considering tar also as one of the gasification products. A representative tar composition along with its mole fractions, as available in the literature was used as an input parameter within the model. The study used an equilibrium approach for the applicable gasification reactions and also considered possible deviations from equilibrium to further upgrade the equilibrium model to validate a range of reported experimental results. Heat balance was applied to predict the gasification temperature and the predicted values were compared with reported results in literature. A comparative study was made with some reference models available in the literature and also with experimental results reported in the literature. Finally a predicted variation of performance of the gasifier by this validated model for different air-fuel ratio and moisture content was also discussed. Copyright © 2011 Elsevier Ltd. All rights reserved.

  2. Mathematical modeling of the synthane gasifier for non-caking coals

    Energy Technology Data Exchange (ETDEWEB)

    Pukanic, G.W.; Cobb, J.T.; Haynes, W.P.; McMichael, W.J.; Strakey, J.P.; Schehl, R.R.; Kornosky, R.M.

    1980-11-01

    A mathematical model based on IGT kinetics has been developed to simulate the gasification of coal in the Synthane gasifier. Two computer codes have been prepared that incorporate this model. The first, called the analytical code, has been designed primarily to evaluate model parameters from runs on the 4-inch Synthane PDU gasifier. The second, called the predictive code, has been designed to predict temperatures for the zones within the model as well as the effluent products from a stipulation of run conditions. In the present report some 35 Synthane runs for the non-caking western coal Montana Rosebud have been analyzed. Parity plots have been prepared to check the efficacy of the model and of the computer codes developed.

  3. Decomposition of tar in gas from updraft gasifier by thermal cracking

    DEFF Research Database (Denmark)

    Brandt, Peder; Henriksen, Ulrik Birk

    2000-01-01

    Continuing earlier work with tar reduction by partial oxidation of pyrolysis gas [1] thermal cracking has been evaluated as a gas cleaning process. The work has been focusing on cleaning gas from updraft gasifiers, and the long term purpose is to develop a tar cleaning unit based on thermal...... cracking. An experimental set-up has been built, in which a flow of contaminated gas can be heated up to 1290°C in a reactor made of pure Al2O3. Four measurements were made. Three with gas from a pyrolysis unit simulating updraft gasifier, and one with gas from an updraft gasifier. Cracking temperatures...... was 1200, 1250 and 1290°C, and the residence time at this temperature was 0.5 second. The measurements show that at the selected residence time of 0.5 second, the gas flow in a thermal tar cracking unit has to be heated to at least 1250°C to achieve sufficient tar cleaning. At 1290°C, a tar content as low...

  4. Performance Analysis of an Integrated Fixed Bed Gasifier Model for Different Biomass Feedstocks

    Directory of Open Access Journals (Sweden)

    Sharmina Begum

    2013-12-01

    Full Text Available Energy recovery from biomass by gasification technology has attracted significant interest because it satisfies a key requirement of environmental sustainability by producing near zero emissions. Though it is not a new technology, studies on its integrated process simulation and analysis are limited, in particular for municipal solid waste (MSW gasification. This paper develops an integrated fixed bed gasifier model of biomass gasification using the Advanced System for Process ENngineering (Aspen Plus software for its performance analysis. A computational model was developed on the basis of Gibbs free energy minimization. The model is validated with experimental data of MSW and food waste gasification available in the literature. A reasonable agreement between measured and predicted syngas composition was found. Using the validated model, the effects of operating conditions, namely air-fuel ratio and gasifier temperature, on syngas production are studied. Performance analyses have been done for four different feedstocks, namely wood, coffee bean husks, green wastes and MSWs. The ultimate and proximate analysis data for each feedstock was used for model development. It was found that operating parameters have a significant influence on syngas composition. An air-fuel ratio of 0.3 and gasifier temperature of 700 °C provides optimum performance for a fixed bed gasifier for MSWs, wood wastes, green wastes and coffee bean husks. The developed model can be useful for gasification of other biomasses (e.g., food wastes, rice husks, poultry wastes and sugarcane bagasse to predict the syngas composition. Therefore, the study provides an integrated gasification model which can be used for different biomass feedstocks.

  5. CHP from Updraft Gasifier and Stirling Engine

    DEFF Research Database (Denmark)

    Jensen, N.; Werling, J.; Carlsen, Henrik

    2002-01-01

    engine heat exchanger, can be eliminated and the overall electric efficiency of the system can be improved. At the Technical University of Denmark a Stirling engine fueled by gasification gas has been developed. In this engine the combustion system and the geometry of the hot heat exchanger...... simulation model has been developed as a tool to analyse a system combining the Stirling engine with a gasifier. The paper presents simulation results for the demonstration plant at typical operating conditions. A result from the simulation is that a net electric efficiency of 17,7 % based on the higher......The combination of thermal gasification with a Stirling engine is an interesting concept for use in small combined heat and power plants based on biomass. By combining the two technologies a synergism can potentially be achieved. Technical problems, e.g. gas cleaning and fouling of the Stirling...

  6. Association of CFH and CFB Gene Polymorphisms with Retinopathy in Type 2 Diabetic Patients

    Directory of Open Access Journals (Sweden)

    Jun Wang

    2013-01-01

    Full Text Available Objectives. The complement system is a key component of innate immunity and has been implicated in the pathogenesis of diabetic retinopathy (DR. This study aimed at investigating whether polymorphisms of two genes in the complement pathway, complement factor H (CFH and complement factor B (CFB, are associated with DR. Methods. 552 well-defined subjects with type 2 diabetes, consisting of 277 DR patients and 275 diabetic controls, were recruited. Four Tag-SNPs rs1048709, rs537160, rs4151657, and rs2072633 in CFB and rs800292 (I62V in CFH were examined using TaqMan Genotyping Assays. Results. There were significant increases in the frequencies of A allele and AA genotype for rs1048709 in DR patients compared with diabetic controls (Pcorr=0.035, OR=1.42; Pcorr=0.02, OR=2.27, resp.: meanwhile, significant decreases in the frequencies of A allele and AA genotype for rs800292 were observed in DR patients compared with diabetic controls (Pcorr=0.04, OR=0.72; Pcorr=0.015, OR=0.51, resp.. Joint effect of these two loci was also identified. Moreover, rs800292/AA genotype was found to be related with delayed progression to DR. Conclusions. CFH-rs800292 and CFB-rs1048709 are associated with the presence of DR, which strengthens the concept that complement system plays an important role in the pathogenesis of DR.

  7. Desulfurization characteristics of rapidly hydrated sorbents with various adhesive carrier particles for a semidry CFB-FGD system.

    Science.gov (United States)

    You, Changfu; Li, Yuan

    2013-03-19

    Semidry flue gas desulfurization (FGD) experiments were conducted using rapidly hydrated sorbents with four different adhesive carrier particles: circulation ash from a circulating fluidized bed boiler (CFBB circulation ash), fly ash from the first electrical field of the electrostatic precipitator of a circulating fluidized bed boiler (CFBB ESP ash), fly ash from a chain boiler (chain boiler ash), and river sand smaller than 1 mm. The influences of various adhesive carrier particles and operating conditions on the desulfurization characteristics of the sorbents were investigated, including sprayed water, reaction temperature, and the ratio of calcium to sulfur (Ca/S). The experimental results indicated that the rapidly hydrated sorbents had better desulfurization characteristics by using adhesive carrier particles which possessed better pore, adhesion, and fluidization characteristics. The desulfurization efficiency of the system increased as the reaction temperature decreased, it improved from 35% to 90% as the mass flow rate of the sprayed water increased from 0 to 10 kg/h, and it increased from 65.6% to 82.7% as Ca/S increased from 1.0 to 2.0. Based on these findings, a new semidry circulating fluidized bed (CFB)-FGD system using rapidly hydrated sorbent was developed. Using the rapidly hydrated sorbent, this system uses a cyclone separator instead of an ESP or a bag filter to recycle the sorbent particles, thereby decreasing the system flow resistance, saving investment and operating costs of the solids collection equipment.

  8. Mechanism study on the influence of in situ SOx removal on N2O emission in CFB boiler

    Science.gov (United States)

    Wu, Lingnan; Qin, Wu; Hu, Xiaoying; Dong, Changqing; Yang, Yongping

    2015-04-01

    The influence of in situ deSOx process on N2O emission in CFB boiler was studied using density functional theory calculations. The competitive adsorption of SO2 and N2O on pure CaO (1 0 0) surface was first studied and the reaction priority was determined. Results showed that SO2 was more likely to adsorb on CaO (1 0 0) surface O anion site, which hindered the catalytic decomposition of N2O on CaO (1 0 0) surface and sulfurized the CaO (1 0 0) surface under reducing atmosphere. Then a partially sulfurized CaO (1 0 0) surface was established to study the catalytic activity of deSOx reaction intermediate on N2O decomposition. The O atom transfer process and the surface recovery process were two key steps for N2O decomposition and the rate-determining step was the latter one. The sulfurization of the surface could deactivate its catalytic activity on N2O decomposition compared with pure CaO (1 0 0) surface but it was still better than that of pure CaS (1 0 0) surface. The free Gibbs energy was calculated to incorporate the temperature dependence of respective reactions. When temperature was higher than 373 K, the surface recovery was more likely to proceed via the LH route.

  9. On the gasification of biomass in a steam-oxygen blown CFB gasifier with the focus on gas quality upgrading : Technology background, experiments and mathematical modeling

    NARCIS (Netherlands)

    Siedlecki, M.

    2011-01-01

    This work presents and discusses the results of the research on the gasification of biomass in an atmospheric circulating fluidized bed, with a mixture of steam and oxygen as fluidization / gasification medium. The main objectives of this research were to investigate and improve the gasification

  10. Mineralogy and leachability of gasified sewage sludge solid residues.

    Science.gov (United States)

    Hernandez, Ana Belén; Ferrasse, Jean-Henry; Chaurand, Perrine; Saveyn, Hans; Borschneck, Daniel; Roche, Nicolas

    2011-07-15

    Gasification of sewage sludge produces combustible gases as well as tar and a solid residue as by-products. This must be taken into account when determining the optimal thermal conditions for the gasification process. In this study, the influence of temperature, heating atmosphere and residence time on the characteristics of the gasified sewage sludge residues is investigated. ICP-AES analyses reveal that the major chemical elements in the char residues are phosphorus, calcium, iron and silicon. Heavy metals such as copper, zinc, chromium, nickel and lead are also present at relatively high levels - from 50 to more than 1000 mg/kg of dry matter. The major mineral phases' identification - before and after heating - as well as their morphology and approximate chemistry (XRD and SEM-EDX) demonstrate that a number of transformations take place during gasification. These are influenced by the reactor's temperature and the oxidative degree of its internal atmosphere. The copper-, zinc- and chromium-bearing phases are studied using chemometric tools, showing that the distribution of those metals among the mineral phases is considerably different. Finally, batch-leaching tests reveal that metals retained in the residue are significantly stabilized after thermal treatment to a higher or lower extent, depending on the thermal conditions applied. Copyright © 2011 Elsevier B.V. All rights reserved.

  11. Down-flow moving-bed gasifier with catalyst recycle

    Science.gov (United States)

    Halow, John S.

    1999-01-01

    The gasification of coal and other carbonaceous materials by an endothermic gasification reaction is achieved in the presence of a catalyst in a down-flow, moving-bed gasifier. Catalyst is removed along with ash from the gasifier and is then sufficiently heated in a riser/burner by the combustion of residual carbon in the ash to volatilize the catalyst. This volatilized catalyst is returned to the gasifier where it uniformly contacts and condenses on the carbonaceous material. Also, the hot gaseous combustion products resulting from the combustion of the carbon in the ash along with excess air are introduced into the gasifier for providing heat energy used in the endothermic reaction.

  12. Investigation of sewage sludge gasification with use of flue gas as a gasifying agent

    Directory of Open Access Journals (Sweden)

    Maj Izabella

    2017-01-01

    Full Text Available The paper presents results of investigation of low-temperature sewage sludge gasification with use of flue gas as a gasifying agent. Tests were conducted in a laboratory stand, equipped with a gasification reactor designed and constructed specifically for this purpose. During presented tests, gas mixture with a composition of typical flue gases was used as a gasifying agent. The measuring system ensures online measurements of syngas composition: CO, CO2, H2, CH4. As a result of gasification process a syngas with combustible components has been obtained. The aim of the research was to determine the usability of sewage sludge for indirect cofiring in power boilers with the use of flue gas from the boiler as a gasifying agent and recirculating the syngas to the boiler’s combustion chamber. Results of presented investigation will be used as a knowledge base for industrial-scale sewage sludge gasification process. Furthermore, toxicity of solid products of the process has been determined by the use of Microtox bioassay. Before tests, solid post-gasification residues have been ground to two particle size fractions and extracted into Milli-Q water. The response of test organisms (bioluminescent Aliivibrio fischeri bacteria in reference to a control sample (bacteria exposed to 2% NaCl solution was measured after 5 and 15 minutes of exposure. The obtained toxicity results proved that thermal treatment of sewage sludge by their gasification reduces their toxicity relative to water organisms.

  13. Gasification of Greek lignite in an indirect heat (allothermal) rotary kiln gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Androutsopoulos, G.P.; Hatzilyberis, K.S.; Theofilou, N.A.; Agalianos, D.S.; Chronis, C.G.; Kapassakalis, V.N.; Karsakos, A.G.; Katsaros, A.N.; Stamatakis, C.P.; Zissis, C.L. [National Technical University of Athens, Athens (Greece). Dept. of Chemical Engineering

    2003-09-01

    This work reports the performance results of a pilot-size lignite gasification plant. The feed material was Greek lignite (Megalopolis), currently being employed for electricity generation in pulverized lignite-fired thermoelectric stations. Low energy conversion efficiency, low station availability, and environmental issues call for developing improved processes, e.g., an IGCC (Integrated Gasification Combined Cycle). An indirect heat (allothermal) rotary kiln was selected as the lignite gasification reactor for developing an overall gasification process of improved efficiency. Week long gasification runs, at near atmospheric pressure and maximum temperature in the range 900-950{sup o}C, validated high DAF lignite conversions, i.e., 90-95%, and the production of a medium heating value synthesis gas (i.e., 11-13 MJ/Nm{sup 3} dry basis), despite the use of air for burning recycled product gas for process heating. Gas composition is equivalent to that of autothermal gasifiers (e.g., Lurgi, Winkler, Koppers-Totzek), which operate on oxygen, under pressure and strict moisture and particle size specifications. Similarly, the kiln gas is comparable to that of an allothermal, high-pressure, fluidized bed gasifier running with a high rank coal feed. The data indicate satisfactory gasification efficiency and a good thermal efficiency that should be improved further through heat integration of a scaled-up process based on an indirect heat rotary kiln gasifier.

  14. Improved Gasifier Availability with Bed Material and Additives

    Energy Technology Data Exchange (ETDEWEB)

    Grootjes, A.J.; Van der Meijden, C.M.; Visser, H.J.M.; Van der Drift, A. [ECN Biomass and Energy Efficiency, Petten (Netherlands)

    2013-07-15

    In order to valorize several feedstock, gasification is one of the technologies developed over the past decades. ECN developed the MILENA gasifier. In order for MILENA to become a commercial success, the gasifier needs to be feedstock flexible, robust and economically sound, operating with high availability. One of the characteristics of MILENA is high efficiency but with a higher tar content, compared to some other Dual Fluidized Bed (DFB) gasifiers. In order to reduce the issues that are associated with high tar levels in the product gas, the effect of a number of primary measures was studied. This paper presents results obtained in the last two years, focused on improving the gasifier availability by conducting experiments in a 25 kWth lab scale MILENA gasifier. Amongst others, gas composition, tar content and calorific value of the product gas were compared. Scanning Electron Microscope analysis was used to investigate bed material changes. Results show that Austrian olivine can be activated by Fuel B as well as by Additive A and B. The water-gas shift reaction is enhanced and the tar content is reduced significantly, especially the heavy tars that dominate the tar dew point. Activated olivine has a calcium-rich layer. The results show that with MILENA, we are able to lower and control the tar dew point, which will possibly increase the availability of a MILENA gasifier.

  15. Distributed Fiber Optic Sensor for On-Line Monitoring of Coal Gasifier Refractory Health

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Anbo [Center for Photonics Technology, Blacksburgh, VA (United States); Yu, Zhihao [Center for Photonics Technology, Blacksburgh, VA (United States)

    2015-11-30

    This report summarizes technical progress on the program “Distributed Fiber Optic Sensor for On-Line Monitoring of Coal Gasifier Refractory Health,” funded by the National Energy Technology Laboratory of the U.S. Department of Energy, and performed by the Center for Photonics Technology of the Bradley Department of Electrical and Computer Engineering at Virginia Tech. The scope of work entails analyses of traveling grating generation technologies in an optical fiber, as well as the interrogation of the gratings to infer a distributed temperature along the fiber, for the purpose of developing a real-time refractory health condition monitoring technology for coal gasifiers. During the project period, which is from 2011-2015, three different sensing principles were studied, including four-wave mixing (FWM), coherent optical time-domain reflectometer (C-OTDR) and Brillouin optical time-domain analysis (BOTDA). By comparing the three methods, the BOTDA was selected for further development into a complete bench-top sensing system for the proposed high-temperature sensing application. Based on the input from Eastman Chemical, the industrial collaborator on this project, a cylindrical furnace was designed and constructed to simulate typical gasifier refractory temperature conditions in the laboratory, and verify the sensor’s capability to fully monitor refractory conditions on the back-side at temperatures up to 1000°C. In the later stages of the project, the sensing system was tested in the simulated environment for its sensing performance and high-temperature survivability. Through theoretical analyses and experimental research on the different factors affecting the sensor performance, a sensor field deployment strategy was proposed for possible future sensor field implementations.

  16. Biomass-Derived Hydrogen from a Thermally Ballasted Gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Robert C

    2007-04-06

    The goal of this project is to develop an indirectly heated gasification system that converts switchgrass into hydrogen-rich gas suitable for powering fuel cells. The project includes investigations of the indirectly-heated gasifier, development of particulate removal equipment, evaluation of catalytic methods for upgrading producer gas, development of contaminant measurement and control techniques, modeling of the thermal performance of the ballasted gasifier, and estimation of the cost of hydrogen from the proposed gasification system. Specific technologies investigated include a thermally ballasted gasifier, a moving bed granular filter, and catalytic reactors for steam reforming and water-gas shift reaction. The approach to this project was to employ a pilot-scale (5 ton per day) gasifier to evaluate the thermally ballasted gasifier as a means for producing hydrogen from switchgrass. A slipstream from the gasifier was used to evaluate gas cleaning and upgrading options. Other tests were conducted with laboratory-scale equipment using simulated producer gas. The ballasted gasifier operated in conjunction with a steam reformer and two-stage water-gas shift reactor produced gas streams containing 54.5 vol-% H2. If purge gas to the feeder system could be substantially eliminated, hydrogen concentration would reach 61 vol-%, which closely approaches the theoretical maximum of 66 vol-%. Tests with a combined catalyst/sorbent system demonstrated that steam reforming and water-gas shift reaction could be substantially performed in a single reactor and achieve hydrogen concentrations exceeding 90 vol-%. Cold flow trials with a laboratory-scale moving bed granular filter achieved particle removal efficiencies exceeding 99%. Two metal-based sorbents were tested for their ability to remove H2S from biomass-derived producer gas. The ZnO sorbent, tested at 450° C, was effective in reducing H2S from 200 ppm to less than 2 ppm (>99% reduction) while tests with the MnO sorbent

  17. GREENHOUSE GAS EMISSIONS CONTROL BY OXYGEN FIRING IN CIRCULATING FLUIDIZED BED BOILERS: PHASE II--PILOT SCALE TESTING AND UPDATED PERFORMANCE AND ECONOMICS FOR OXYGEN FIRED CFB WITH CO2 CAPTURE

    Energy Technology Data Exchange (ETDEWEB)

    Nsakala ya Nsakala; Gregory N. Liljedahl; David G. Turek

    2004-10-27

    Because fossil fuel fired power plants are among the largest and most concentrated producers of CO{sub 2} emissions, recovery and sequestration of CO{sub 2} from the flue gas of such plants has been identified as one of the primary means for reducing anthropogenic CO{sub 2} emissions. In this Phase II study, ALSTOM Power Inc. (ALSTOM) has investigated one promising near-term coal fired power plant configuration designed to capture CO{sub 2} from effluent gas streams for sequestration. Burning fossil fuels in mixtures of oxygen and recirculated flue gas (made principally of CO{sub 2}) essentially eliminates the presence of atmospheric nitrogen in the flue gas. The resulting flue gas is comprised primarily of CO{sub 2}, along with some moisture, nitrogen, oxygen, and trace gases like SO{sub 2} and NO{sub x}. Oxygen firing in utility scale Pulverized Coal (PC) fired boilers has been shown to be a more economical method for CO{sub 2} capture than amine scrubbing (Bozzuto, et al., 2001). Additionally, oxygen firing in Circulating Fluid Bed Boilers (CFB's) can be more economical than in PC or Stoker firing, because recirculated gas flow can be reduced significantly. Oxygen-fired PC and Stoker units require large quantities of recirculated flue gas to maintain acceptable furnace temperatures. Oxygen-fired CFB units, on the other hand, can accomplish this by additional cooling of recirculated solids. The reduced recirculated gas flow with CFB plants results in significant Boiler Island cost savings resulting from reduced component The overall objective of the Phase II workscope, which is the subject of this report, is to generate a refined technical and economic evaluation of the Oxygen fired CFB case (Case-2 from Phase I) utilizing the information learned from pilot-scale testing of this concept. The objective of the pilot-scale testing was to generate detailed technical data needed to establish advanced CFB design requirements and performance when firing coals and

  18. Performance of a pilot-scale, steam-blown, pressurized fluidized bed biomass gasifier

    Science.gov (United States)

    Sweeney, Daniel Joseph

    With the discovery of vast fossil resources, and the subsequent development of the fossil fuel and petrochemical industry, the role of biomass-based products has declined. However, concerns about the finite and decreasing amount of fossil and mineral resources, in addition to health and climate impacts of fossil resource use, have elevated interest in innovative methods for converting renewable biomass resources into products that fit our modern lifestyle. Thermal conversion through gasification is an appealing method for utilizing biomass due to its operability using a wide variety of feedstocks at a wide range of scales, the product has a variety of uses (e.g., transportation fuel production, electricity production, chemicals synthesis), and in many cases, results in significantly lower greenhouse gas emissions. In spite of the advantages of gasification, several technical hurdles have hindered its commercial development. A number of studies have focused on laboratory-scale and atmospheric biomass gasification. However, few studies have reported on pilot-scale, woody biomass gasification under pressurized conditions. The purpose of this research is an assessment of the performance of a pilot-scale, steam-blown, pressurized fluidized bed biomass gasifier. The 200 kWth fluidized bed gasifier is capable of operation using solid feedstocks at feedrates up to 65 lb/hr, bed temperatures up to 1600°F, and pressures up to 8 atm. Gasifier performance was assessed under various temperatures, pressure, and feedstock (untreated woody biomass, dark and medium torrefied biomass) conditions by measuring product gas yield and composition, residue (e.g., tar and char) production, and mass and energy conversion efficiencies. Elevated temperature and pressure, and feedstock pretreatment were shown to have a significant influence on gasifier operability, tar production, carbon conversion, and process efficiency. High-pressure and temperature gasification of dark torrefied biomass

  19. 250 MW single train CFB cogeneration facility. Annual report, October 1993--September 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-02-01

    This Technical Progress Report (Draft) is submitted pursuant to the Terms and Conditions of Cooperative Agreement No. DE-FC21-90MC27403 between the Department of Energy (Morgantown Energy Technology Center) and York County Energy Partners, L.P. a wholly owned project company of Air Products and Chemicals, Inc. covering the period from January 1994 to the present for the York County Energy Partners CFB Cogeneration Project. The Technical Progress Report summarizes the work performed during the most recent year of the Cooperative Agreement including technical and scientific results.

  20. Low temperature circulating fluidized bed gasification and co-gasification of municipal sewage sludge. Part 1: Process performance and gas product characterization.

    Science.gov (United States)

    Thomsen, Tobias Pape; Sárossy, Zsuzsa; Gøbel, Benny; Stoholm, Peder; Ahrenfeldt, Jesper; Frandsen, Flemming Jappe; Henriksen, Ulrik Birk

    2017-08-01

    Results from five experimental campaigns with Low Temperature Circulating Fluidized Bed (LT-CFB) gasification of straw and/or municipal sewage sludge (MSS) from three different Danish municipal waste water treatment plants in pilot and demonstration scale are analyzed and compared. The gasification process is characterized with respect to process stability, process performance and gas product characteristics. All experimental campaigns were conducted at maximum temperatures below 750°C, with air equivalence ratios around 0.12 and with pure silica sand as start-up bed material. A total of 8600kg of MSS dry matter was gasified during 133h of operation. The average thermal loads during the five experiments were 62-100% of nominal capacity. The short term stability of all campaigns was excellent, but gasification of dry MSS lead to substantial accumulation of coarse and rigid, but un-sintered, ash particles in the system. Co-gasification of MSS with sufficient amounts of cereal straw was found to be an effective way to mitigate these issues as well as eliminate thermal MSS drying requirements. Characterization of gas products and process performance showed that even though gas composition varied substantially, hot gas efficiencies of around 90% could be achieved for all MSS fuel types. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Modeling of flow conditions in down draft gasifiers using tin film models

    DEFF Research Database (Denmark)

    Jensen, Torben Kvist; Gøbel, Benny; Henriksen, Ulrik Birk

    2003-01-01

    In order to examine how an inhomogeneous char bed affects the gas flow through the bed, a dynamic model have been developed to describe the flow distribution in a down draft gasifier. The gas flow distribution through the bed was determined using a thin film model approach. The temperatures...... in the bed were determined from a thermodynamic model of the gasification process. Model calculations showed that a relatively small fraction of the gas was flowing through a part of the bed that was fuelled with smaller particles compared to a part of the bed that was fuelled with larger particles...

  2. Gasification of biomass and coal in a pressurised fluidised bed gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Andries, J.; Jong, W. de; Hein, K.R.G. [Technische Univ. Delft (Netherlands)

    1998-09-01

    During a 3 year (1996-1998) multinational JOULE project, partly funded by the EU, experimental and theoretical research is being done on co-gasification of biomass (pelletised straw and Miscanthus) and coal in a pressurised fluidised bed reactor. The influence of feedstock and operating conditions on gasification characteristics has been studied using a 1.5 MW{sub th} gasifier, which has been operated at a pressure of 5 bar and temperatures up to 900 C. The project and the test rig are described and results obtained in the first part of the project are presented and analysed. (orig.)

  3. High-solids black liquor firing in pulp and paper industry kraft recovery boilers: Phase Ia - Low-temperature gasifier evaluation. Final report, November 1, 1995--October 31, 1996

    Energy Technology Data Exchange (ETDEWEB)

    Southards, W.T.; Blude, J.D.; Dickinson, J.A. [and others

    1997-06-01

    This project, conducted under The United States Department of Energy (DOE) Cooperative Agreement DE-FC36-94GO10002/A002, was part of a multiple-phase effort to develop technologies that improve the energy efficiency and economics of chemical process recovery in the pulp and paper industry. The approach taken was to consider two major alternatives in two phases. Phase I, conducted previously, considered means to improve pulp mill recovery boilers using high-solids advanced combustion of black liquor; while this project, Phase la, considered means to recover kraft pulping mill process chemicals by low-temperature black liquor gasification. The principal steps previously proposed in this program were: (1) Evaluate these two technologies, high-solids advanced combustion and gasification, and then select a path forward using the more promising of these two options for future work. (2) Design and construct a pilot-scale unit based on the selected technology, and using that unit, develop the precompetitive data necessary to make commercialization attractive. (3) Develop and deploy a first-of-a-kind (FOAK) commercial unit in a kraft pulp mill. Phase I, which evaluated the high-solids advanced combustion option, was concluded in 1995. Results of that project phase were reported previously. This report describes the work conducted in Phase Ia. The work is described in Sections 1 through 4 and six appendices provide additional detail.

  4. Analysis of CFB, a cytokinin-responsive gene of Arabidopsis thaliana encoding a novel F-box protein regulating sterol biosynthesis.

    Science.gov (United States)

    Brenner, Wolfram G; Leuendorf, Jan Erik; Cortleven, Anne; Martin, Laetitia B B; Schaller, Hubert; Schmülling, Thomas

    2017-05-17

    Protein degradation by the ubiquitin-26S proteasome pathway is important for the regulation of cellular processes, but the function of most F-box proteins relevant to substrate recognition is unknown. We describe the analysis of the gene Cytokinin-induced F-box encoding (CFB, AT3G44326), identified in a meta-analysis of cytokinin-related transcriptome studies as one of the most robust cytokinin response genes. F-box domain-dependent interaction with the E3 ubiquitin ligase complex component ASK1 classifies CFB as a functional F-box protein. Apart from F-box and transmembrane domains, CFB contains no known functional domains. CFB is expressed in all plant tissues, predominantly in root tissue. A ProCFB:GFP-GUS fusion gene showed strongest expression in the lateral root cap and during lateral root formation. CFB-GFP fusion proteins were mainly localized in the nucleus and the cytosol but also at the plasma membrane. cfb mutants had no discernible phenotype, but CFB overexpressing plants showed several defects, such as a white upper inflorescence stem, similar to the hypomorphic cycloartenol synthase mutant cas1-1. Both CFB overexpressing plants and cas1-1 mutants accumulated the CAS1 substrate 2,3-oxidosqualene in the white stem tissue, the latter even more after cytokinin treatment, indicating impairment of CAS1 function. This suggests that CFB may link cytokinin and the sterol biosynthesis pathway. © The Author 2017. Published by Oxford University Press on behalf of the Society for Experimental Biology.

  5. High Performance Gasification with the Two-Stage Gasifier

    DEFF Research Database (Denmark)

    Gøbel, Benny; Hindsgaul, Claus; Henriksen, Ulrik Birk

    2002-01-01

    Based on more than 15 years of research and practical experience, the Technical University of Denmark (DTU) and COWI Consulting Engineers and Planners AS present the two-stage gasification process, a concept for high efficiency gasification of biomass producing negligible amounts of tars....... In the two-stage gasification concept, the pyrolysis and the gasification processes are physical separated. The volatiles from the pyrolysis are partially oxidized, and the hot gases are used as gasification medium to gasify the char. Hot gases from the gasifier and a combustion unit can be used for drying...... a cold gas efficiency exceeding 90% is obtained. In the original design of the two-stage gasification process, the pyrolysis unit consists of a screw conveyor with external heating, and the char unit is a fixed bed gasifier. This design is well proven during more than 1000 hours of testing with various...

  6. Design study for wood gasifier/engine test project

    Energy Technology Data Exchange (ETDEWEB)

    Bircher, K.G.; Sutherland, R.P.

    1982-03-01

    This report investigates various aspects of coupling wood gasifiers with engine/generators for commercial use (size greater than 1.0 MWe). A brief review of current available gas cleaning and cooling equipment and low heating value engines is presented. Accelerated research into dry methods of scrubbing wood gas will assist greatly in making commercial gasifier/engine combinations a viable alternative. Process design of a gas cleaning system for an 800 kW/sub e/ generator, includes heat and mass balances and instrumentation requirements. A testing program for the gasifier-gas cleaning unit-engine/generator system is outlined. The benfits and drawbacks of upgrading the calorific value of the producer gas by both carbon dioxide removal and oxygen addition are discussed briefly. 10 refs., 10 figs., 12 tabs.

  7. Plume-Lithosphere Interaction in the Ethiopian CFB Province: Breaking up Gondwana

    Science.gov (United States)

    Plummer, C. L.; Furman, T.

    2006-12-01

    The Ethiopia-Yemen continental flood basalt (CFB) province formed 30 Ma and today covers some 600,000 sq. km with an approximate total volume of 350,000 sq. km of basalt and associated rhyolite. The majority of lavas were extruded over about 1 my (Baker et al. 1996; Pik et al. 1998) and have not been subject to tectonism, making this area ideal for study of processes associated with continental break-up, mantle plume impacts and CFB magmatism. The Ethiopian province is the youngest of the Mesozoic CFB occurrences associated with break-up of Gondwana, following the Karoo and Ferrar (180-175 Ma), Parana-Etendeka (134- 132 Ma) and Deccan (67-65 Ma) events. In Ethiopia, as with other Gondwana CFB provinces, basalts have been separated into high titanium (HT) and low titanium (LT) series (Pik et al. 1998). Stratigraphic studies indicate HT and LT units erupted contemporaneously so temporal control cannot explain the chemical variations; Pik et al (1998) drew a NE-SW trending line separating the region into HT and LT sub-provinces. Detailed investigation of new study sites along the SW margin of the flood basalt province (Tesfaye 2006) found interlayered LT and HT units indicating more complex spatial controls. Our investigation of Ethiopian CFBs evaluates source and process heterogeneities that could produce voluminous mafic magmatism in these two distinctive series. To first order the mildly alkalic HT lavas have higher incompatible trace element abundances than the tholeiitic LT basalts (Pik et al. 1998, 1999; Keiffer et al. 2004), suggesting derivation of the former by lower degrees of partial melting at greater pressures (Furman et al. 2006). Sr-Nd-Pb isotopic signatures of the LT and HT series largely overlap with one another and with the modern Afar plume; in detail the highest Ti-lavas (HT2 of Pik et al. 1998) are isotopically and geochemically distinct from LT and HT1 basalts, which form a broad continuum in all representations of data. HT2 basalts have mantle

  8. Engineering analysis of biomass gasifier product gas cleaning technology

    Energy Technology Data Exchange (ETDEWEB)

    Baker, E.G.; Brown, M.D.; Moore, R.H.; Mudge, L.K.; Elliott, D.C.

    1986-08-01

    For biomass gasification to make a significant contribution to the energy picture in the next decade, emphasis must be placed on the generation of clean, pollutant-free gas products. This reports attempts to quantify levels of particulated, tars, oils, and various other pollutants generated by biomass gasifiers of all types. End uses for biomass gases and appropriate gas cleaning technologies are examined. Complete systems analysis is used to predit the performance of various gasifier/gas cleanup/end use combinations. Further research needs are identified. 128 refs., 20 figs., 19 tabs.

  9. Fluid dynamics model on fluidized bed gasifier using agro-industrial biomass as fuel.

    Science.gov (United States)

    Ismail, Tamer M; Abd El-Salam, M; Monteiro, Eliseu; Rouboa, Abel

    2017-06-21

    The present study shows the experimental and numerical results of thermal gasification of biomass, on the energy potential of agro-industrial waste from the Portalegre region. Gasification tests were performed in a pilot-scale fluidized bed gasifier, in order to study the behavior of peach stones and miscanthus to investigate the effect of gasification temperatures at 750°C, 800°C and 850°C at a constant biomass flow rate of 45kg/h. In order to optimize the operating conditions of the biomass gasification process, a numerical model is developed namely COMMENT code. This model is a computer model of two dimensions describing the biomass gasification processes in a fluidized bed gasifier using peach stone and miscanthus as fuel. Both phases, solid and gaseous, were described using an Eulerian-Eulerian approach exchanging mass, energy, and momentum. The numerical model results are then compared with experimental results. The produced results show the impact of the increased temperature in the calorific value of the syngas. The tests carried out at 750°C shown an increase in CO2 and N2 and a decrease of CO in the range of 5% comparing to the tests carried out at 850°C. In addition, increased temperature favors a decrease in tar production in thermal gasification process. Numerical results shows to be in good agreement with the experimental data. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Catalytic combustion of gasified biomass for electricity and heat production

    Energy Technology Data Exchange (ETDEWEB)

    Jaeraas, S.; Johansson, Magnus [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Chemical Engineering and Technology

    1996-01-01

    High temperature catalytic combustion of gasified biomass for gas turbine applications has been studied, with emphasis on NH{sub 3} conversion and ignition characteristics of the main fuel components CO, H{sub 2} and CH{sub 4}. Three sets of catalysts have been evaluated: Alumina supported transition metal oxides, Unsupported perovskites, and Complex oxide materials such as hexaaluminate supported perovskites and BaMn-hexaaluminates. The three fuel components CO, H{sub 2} and CH{sub 4} ignited in different order, depending on the catalyst material. To design a multi-monolithic catalytic combustion chamber, it will be important to examine at which temperature and in which order the fuel mixture ignites. The analysis of NH{sub 3} conversion to NO{sub x} and N{sub 2} showed that the alumina supported transition metal oxides gave conversion between 21% and 86% to N{sub 2}, where the best result was for NiO catalyst. However, at higher temperatures it is likely that these catalysts sinter and that NO{sub x} formation increases. Pt catalyst showed high conversion of NH{sub 3} to NO{sub x}, <20% to N{sub 2}. Complex oxides showed showed the most promising result with conversion 20 - 80% to N{sub 2}, depending on inlet temperature and catalyst. For BaMn-hexaaluminate 75 - 78% of NH{sub 3} was converted to N{sub 2} between 600 and 750 deg C. For LaNiO{sub 3}/La-hexaaluminate 90% of the NH{sub 3} was converted between 700 and 750 deg C and no NO formed. In addition, the formation of HCN and N{sub 2}O was analysed for some catalysts. The analyses showed that 5 - 10 ppm of N{sub 2}O and HCN was formed at 850 - 950 deg C. The results indicate that it would be possible to design a segmented catalytic combustion chamber, with a first segment working at a temperature window where all NH{sub 3} is converted to N{sub 2} and only 0 - 20% of the fuel components are converted. 34 refs

  11. Experimental fact-finding in CFB biomass gasification for ECN's 500 kWth pilot-plant

    NARCIS (Netherlands)

    Kersten, Sascha R.A.; Prins, W.; van der Drift, A.; van Swaaij, Willibrordus Petrus Maria

    2003-01-01

    CFB biomass gasification has been studied by experimentation with ECN's pilot facility and a cold-flow model of this plant. Data obtained by normal operation of this plant and the results of some special experiments have provided new insight into the behavior of circulating fluidized bed reactors

  12. Evaluation of the propellant residues emitted during 105-mm Leopard tank live firing at CFB Valcartier, Canada

    Science.gov (United States)

    2009-12-01

    nitroamines, specifically 2,4-dinitrotoluene (2,4-DNT), 2,6-dinitrotoluene (2,6-DNT), and nitroglycerine (NG). The HPLC was a modular system from...Diaz, E., Brochu, S., Thiboutot, S., Ampleman, G., Marois, A. and Gagnon, A., “Energetic Materials and Metals Contamination at CFB/ ASU Wainwright

  13. Gasification of empty fruit bunch with carbon dioxide in an entrained flow gasifier for syngas production

    Science.gov (United States)

    Rahmat, N. F. H.; Rasid, R. A.

    2017-06-01

    The main objectives of this work are to study the gasification of EFB in an atmospheric entrained flow gasifier, using carbon dioxide (CO2) as its gasifying agent and to determine the optimum gasification operating conditions, which includes temperature and the oxidant to fuel (OTF) ratio. These were evaluated in terms of important gasification parameters such as the concentration of hydrogen (H2) and carbon monoxide (CO) produced the syngas ratio H2/CO and carbon conversion. The gasification reactions take place in the presence of CO2 at very high reaction rate because of the high operating temperature (700°C - 900°C). The use of CO2 as the oxidant for gasification process can improve the composition of syngas produced as in the Boudouard reaction. Rise of reaction temperature which is 900°C will increase the concentration of both H2 & CO by up to 81 and 30 respectively, though their production were decreased after the OTF ratio of 0.6 for temperature 700°C & 800°C and OTF ratio 0.8 for temperature 750°C. The operating temperature must be higher than 850°C to ensure the Boudouard reaction become the more prominent reaction for the biomass gasification. The syngas ratio obtained was in the range of ≈ 0.6 - 2.4 which is sufficient for liquid fuel synthesis. For the carbon conversion, the highest fuel conversion recorded at temperature 850°C for all OTF ratios. As the OTF ratio increases, it was found that there was an increase in the formation of CO and H2. This suggests that to achieve higher carbon conversion, high operating temperature and OTF ratio are preferable. This study provides information on the optimum operating conditions for the gasification of biomass, especially the EFB, hence may upsurge the utilization of biomass waste as an energy source.

  14. Comparison of the decomposition VOC profile during winter and summer in a moist, mid-latitude (Cfb) climate.

    Science.gov (United States)

    Forbes, Shari L; Perrault, Katelynn A; Stefanuto, Pierre-Hugues; Nizio, Katie D; Focant, Jean-François

    2014-01-01

    The investigation of volatile organic compounds (VOCs) associated with decomposition is an emerging field in forensic taphonomy due to their importance in locating human remains using biological detectors such as insects and canines. A consistent decomposition VOC profile has not yet been elucidated due to the intrinsic impact of the environment on the decomposition process in different climatic zones. The study of decomposition VOCs has typically occurred during the warmer months to enable chemical profiling of all decomposition stages. The present study investigated the decomposition VOC profile in air during both warmer and cooler months in a moist, mid-latitude (Cfb) climate as decomposition occurs year-round in this environment. Pig carcasses (Sus scrofa domesticus L.) were placed on a soil surface to decompose naturally and their VOC profile was monitored during the winter and summer months. Corresponding control sites were also monitored to determine the natural VOC profile of the surrounding soil and vegetation. VOC samples were collected onto sorbent tubes and analyzed using comprehensive two-dimensional gas chromatography--time-of-flight mass spectrometry (GC × GC-TOFMS). The summer months were characterized by higher temperatures and solar radiation, greater rainfall accumulation, and comparable humidity when compared to the winter months. The rate of decomposition was faster and the number and abundance of VOCs was proportionally higher in summer. However, a similar trend was observed in winter and summer demonstrating a rapid increase in VOC abundance during active decay with a second increase in abundance occurring later in the decomposition process. Sulfur-containing compounds, alcohols and ketones represented the most abundant classes of compounds in both seasons, although almost all 10 compound classes identified contributed to discriminating the stages of decomposition throughout both seasons. The advantages of GC × GC-TOFMS were demonstrated

  15. Material and Energy Balances for Methanol from Biomass Using Biomass Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Bain, R. L.

    1992-01-01

    The objective of the Biomass to Methanol Systems Analysis Project is the determination of the most economically optimum combination of unit operations which will make the production of methanol from biomass competitive with or more economic than traditional processes with conventional fossil fuel feedstocks. This report summarizes the development of simulation models for methanol production based upon the Institute of Gas Technology (IGT) ''Renugas'' gasifier and the Battelle Columbus Laboratory (BCL) gasifier. This report discusses methanol production technology, the IGT and BCL gasifiers, analysis of gasifier data for gasification of wood, methanol production material and energy balance simulations, and one case study based upon each of the gasifiers.

  16. Influence of operating conditions on the air gasification of dry refinery sludge in updraft gasifier

    Science.gov (United States)

    Ahmed, R.; Sinnathambi, C. M.

    2013-06-01

    In the present work, details of the equilibrium modeling of dry refinery sludge (DRS) are presented using ASPEN PLUS Simulator in updraft gasifier. Due to lack of available information in the open journal on refinery sludge gasification using updraft gasifier, an evaluate for its optimum conditions on gasification is presented in this paper. For this purpose a Taguchi Orthogonal array design, statistical software is applied to find optimum conditions for DRS gasification. The goal is to identify the most significant process variable in DRS gasification conditions. The process variables include; oxidation zone temperature, equivalent ratio, operating pressure will be simulated and examined. Attention was focused on the effect of optimum operating conditions on the gas composition of H2 and CO (desirable) and CO2 (undesirable) in terms of mass fraction. From our results and finding it can be concluded that the syngas (H2 & CO) yield in term of mass fraction favors high oxidation zone temperature and at atmospheric pressure while CO2 acid gas favor at a high level of equivalent ratio as well as air flow rate favoring towards complete combustion.

  17. Particle Distribution in a Fixed Bed Down Draft Wood Gasifier

    DEFF Research Database (Denmark)

    Hindsgaul, Claus

    2005-01-01

    Char particle samples were collected from six distances above the grate in a fixed bed of a down draft biomass gasifier. Each sample was separated into twelve size fractions by screening through standard sieves in order to determine the local particle size distribution. The ash contents of each...

  18. Micro cogeneration - rich-methane gasifier and micro gas turbine

    Directory of Open Access Journals (Sweden)

    Król Danuta

    2017-01-01

    Full Text Available The study presents a concept of integration a gasifier system with distributed generation of electricity and heat cogeneration system based on a gas microturbine. The gas generator is supplied by the RDF fuel from waste and biomass fuel Bio-CONOx. In the scale considered, the cogeneration system is designed to produce 30kWe of electricity and approx. 50kW of heat. Important perspective directions of technology development are: (i the possibility of gas microturbine to cooperate with the gasifier (up to date, in such systems were used, and continue to apply only piston engines, (ii the production of syngas in the gasifier (for efficient cogeneration in the composition of which there is a high content of methane (CH4 = 18%-22%. In the first step of possible commercialization a mathematical model to simulate single shaft gas turbine cogeneration plant has been developed. In conceptual design is application of microturbine as the prime mover of Combined Heat and Power (CHP system but with especial emphasis on possible use of a low calorific gas attainable from presented in details a gasifier unit. To support the calculations for preliminary design analysis, a computer program is developed in EES software environment.

  19. New generation gasifier with significant reduction of emissions

    Energy Technology Data Exchange (ETDEWEB)

    Titov, V. [Credo Engineering (United States)

    2008-07-01

    The Combined Bed Gasifier (CBG) that produces high calorific value syngas is described. Limestone is included in the bed to capture sulfur, and the bed is operated at below 1000{sup o}C to reduce nitrogen oxide emissions. Carbon dioxide is captured in the gasification process. 5 refs., 10 figs., 1 tab.

  20. The Alholmens Kraft new power plant: the world's largest biofuel fired CFB in operation

    Energy Technology Data Exchange (ETDEWEB)

    Nickull, S.; Kokko, A. [Oy Alholmens Kraft Ab, Pietarsaari (Finland)

    2002-07-01

    The Alholmens Kraft power plant supplies process steam to the nearby UPM-Kymmene paper mill, and for district heating in Pietarsaari. The plant produces electricity for the power company owners in Finland and in Sweden. The CFB boiler steam capacity is 550 MW{sub th}, attained with steam superheat/reheat steam values of 194/179 kg/s, 545/545{sup o}C and 165/40 bar. When commissioned in autumn 2001 the boiler was one of the largest CFB boilers in the world, and the largest biofuel-burning CFB. The Alholmens Kraft CFB boiler is a multi-fuel boiler, whose main fuels are bark, wood residue and peat, with coal as a back-up fuel. This paper presents the Alholmens Kraft power plant application, and its first and very smooth operational experience with different fuels and fuels combinations at various load levels. The selection of design fuel contributes well towards the target for net CO{sub 2} reduction, but it also places huge requirements in terms of fuel purchasing and logistics. The volumetric fuel consumption by the boiler at full load is 1000 m{sup 3}/h of biofuel the paper presents the first operational experience of the fuel logistics chain. The paper describes how the large boiler has succeeded regarding the strict emission limits. The successful Alholmens Kraft CFB boiler project is a very good example of the suitability of biofuel, either alone or in co-combustion with coal, also for utility-scale power plants. 10 figs.

  1. Effectiveness factors for a commercial steam reforming (Ni) catalyst and for a calcined dolomite used downstream biomass gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Corella, J.; Narvaez, I.; Orio, A. [Madrid Univ. (Spain). Dept. of Chem. Eng.

    1996-12-31

    A commercial steam reforming catalyst from BASF, the G1-25 S one, and a calcined dolomite, Norte-1, from Cantabria-Spain, have been used, once crushed and sieved to different particle fractions between 1.0 and 4.0 mm. The materials have been tested downstream small pilot biomass gasifiers, bubbling fluidized bed type, gasifying with air and with steam. The Thiele modulus and the effectiveness factor have been calculated at temperatures of 750-850 deg C. It is experimentally shown that diffusion control plays an important part when particle size is larger than ca. 0.5 mm. This has to be taken into account when comparing the quality of the solids for tar elimination. (author) (5 refs.)

  2. Gasification of biomass wastes in an entrained flow gasifier: Effect of the particle size and the residence time

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez, Juan J.; Aranda-Almansa, Guadalupe [Universidad de Castilla-La Mancha, Departamento de Mecanica Aplicada e Ingenieria de Proyectos, Escuela Tecnica Superior de Ingenieros Industriales (Edificio Politecnico), Avenida Camilo Jose Cela s/n, 13071 Ciudad Real (Spain); Bula, Antonio [Universidad del Norte, Departamento de Ingenieria Mecanica, Km.5 Antigua Via Puerto Colombia, Barranquilla (Colombia)

    2010-06-15

    Experimental tests in an entrained flow gasifier have been carried out in order to evaluate the effect of the biomass particle size and the space residence time on the gasifier performance and the producer gas quality. Three types of biomass fuels (grapevine pruning and sawdust wastes, and marc of grape) and a fossil fuel (a coal-coke blend) have been tested. The results obtained show that a reduction in the fuel particle size leads to a significant improvement in the gasification parameters. The thermochemical characterisation of the resulting char-ash residue shows a sharp increase in the fuel conversion for particles below 1 mm diameter, which could be adequate to be used in conventional entrained flow gasifiers. Significant differences in the thermochemical behaviour of the biomass fuels and the coal-coke blend have been found, especially in the evolution of the H{sub 2}/CO ratio with the space time, mainly due to the catalytic effect of the coal-coke ash. The reaction temperature and the space time have a significant effect on the H{sub 2}/CO ratio (the relative importance of each of these parameters depending on the temperature), this value being independent of the fuel particle size. (author)

  3. Determining cyclone particle holdup by pressure Drop for a CFB boiler

    Energy Technology Data Exchange (ETDEWEB)

    Li, S.H.; Zhang, H.; Yang, H.R.; Yang, S.; Lu, J.F.; Yue, G.X. [Key Laboratory for Thermal Science and Power Engineering of Ministry of Education, Department of Thermal Engineering, Tsinghua University, Beijing (China)

    2007-12-15

    An experimental study was conducted to assess the possibility of determining particle holdup by measuring the pressure drop of a conventional cyclone used in a circulating fluidized bed (CFB) boiler. It was found that within a wide range of inlet solid concentrations, i.e., 0.54-4.42 kg/kg-gas, the cyclone pressure drop increased linearly with inlet solid concentration at a given gas velocity, while the pressure drop between the dust exit and the vortex finder of the cyclone remained almost constant. Since particle holdup increases virtually linearly with solid flow rate, the particle holdup in the cyclone can be derived from the cyclone pressure drop, and therefore, an equation set was proposed to calculate the particle holdup from the cyclone pressure drop. (Abstract Copyright [2007], Wiley Periodicals, Inc.)

  4. Effect of rice husk ash mass on sustainability pyrolysis zone of fixed bed downdraft gasifier with capacity of 10 kg/hour

    Science.gov (United States)

    Surjosatyo, Adi; Haq, Imaduddin; Dafiqurrohman, Hafif; Gibran, Felly Rihlat

    2017-03-01

    The formation of pyrolysis sustainability (Sustainable Pyrolysis) is the objective of the gasification process. Pyrolysis zone in the gasification process is the result of the endothermic reaction that get heat from oxidation (combustion) of the fuel with oxygen, where cracking biomass rice husk result of such as charcoal, water vapor, steam tar, and gas - gas (CO, H 2, CH 4, CO 2 and N 2) and must be maintained at a pyrolysis temperature to obtain results plentiful gas (producer gas) or syngas (synthetic gas). Obtaining continuously syngas is indicated by flow rate (discharge) producer gas well and the consistency of the flame on the gas burner, it is highly influenced by the gasification process and the operation of the gasifier and the mass balance (mass balance) between the feeding rate of rice husk with the disposal of ash (ash removal). In experiments conducted is using fixed bed gasifier type downdraft capacity of 10 kg/h. Besides setting the mass of rice husks into the gasifier and disposal arrangements rice husk ash may affect the sustainability of the pyrolysis process, but tar produced during the gasification process causes sticky rice husk ash in the plenum gasifier. Modifications disposal system rice husk ash can facilitate the arrangement of ash disposal then could control the temperature pyrolysis with pyrolysis at temperatures between 500-750 ° C. The experimental study was conducted to determine the effect of mass quantities of rice husk ash issued against sustainability pyrolysis temperature which is obtained at each time disposal of rice husk ash to produce 60-90 grams of ash issued. From some experimental phenomena is expected to be seen pyrolysis and its effect on the flow rate of syngas and the stability of the flame on the gas burner so that this research can find a correlation to obtain performance (performance) gasifier optimal.

  5. Application of Scaling-Law and CFD Modeling to Hydrodynamics of Circulating Biomass Fluidized Bed Gasifier

    Directory of Open Access Journals (Sweden)

    Mazda Biglari

    2016-06-01

    Full Text Available Two modeling approaches, the scaling-law and CFD (Computational Fluid Dynamics approaches, are presented in this paper. To save on experimental cost of the pilot plant, the scaling-law approach as a low-computational-cost method was adopted and a small scale column operating under ambient temperature and pressure was built. A series of laboratory tests and computer simulations were carried out to evaluate the hydrodynamic characteristics of a pilot fluidized-bed biomass gasifier. In the small scale column solids were fluidized. The pressure and other hydrodynamic properties were monitored for the validation of the scaling-law application. In addition to the scaling-law modeling method, the CFD approach was presented to simulate the gas-particle system in the small column. 2D CFD models were developed to simulate the hydrodynamic regime. The simulation results were validated with the experimental data from the small column. It was proved that the CFD model was able to accurately predict the hydrodynamics of the small column. The outcomes of this research present both the scaling law with the lower computational cost and the CFD modeling as a more robust method to suit various needs for the design of fluidized-bed gasifiers.

  6. Gasification of torrefied Miscanthus × giganteus in an air-blown bubbling fluidized bed gasifier.

    Science.gov (United States)

    Xue, G; Kwapinska, M; Horvat, A; Kwapinski, W; Rabou, L P L M; Dooley, S; Czajka, K M; Leahy, J J

    2014-05-01

    Torrefaction is suggested to be an effective method to improve the fuel properties of biomass and gasification of torrefied biomass should provide a higher quality product gas than that from unprocessed biomass. In this study, both raw and torrefied Miscanthus × giganteus (M×G) were gasified in an air-blown bubbling fluidized bed (BFB) gasifier using olivine as the bed material. The effects of equivalence ratio (ER) (0.18-0.32) and bed temperature (660-850°C) on the gasification performance were investigated. The results obtained suggest the optimum gasification conditions for the torrefied M × G are ER 0.21 and 800°C. The product gas from these process conditions had a higher heating value (HHV) of 6.70 MJ/m(3), gas yield 2m(3)/kg biomass (H2 8.6%, CO 16.4% and CH4 4.4%) and cold gas efficiency 62.7%. The comparison between raw and torrefied M × G indicates that the torrefied M × G is more suitable BFB gasification. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. CFD Modelling of an Open Core Downdraft Moving Bed Biomass Gasifier

    Directory of Open Access Journals (Sweden)

    A. Rogel–Ramírez

    2008-10-01

    Full Text Available This paper contains the description of a bidimensional Computacional Fluid Dynamics (CFD, model developed to simulate the flow and reaction in a stratified downdraft biomass gasifier, whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model is based on the PHOENICS package and represents a tool which can be used in gasifier analysis and design. Contributions of chemical kinetic and the mixing rate using the EBU approach are considered in the gas phase global homogeneous reactions. The harmonic blending of chemical kinetics and mass transfer effects, determine the global heterogeneous reactions between char and O2, CO2, and H2O. The turbulence effect in the gas phase is accounted by the standard k–s approach. The model provides information of the producer gas composition, velocities and temperature at the outlet, and allows different operating parameters and feed properties to be changed. Finally, a comparison with experimental data available in literature was done, which showed satisfactory agreement from a qualitative point of view, though further validation is required.

  8. Prediction of biomass conversion process for oil palm fronds in a downdraft gasifier

    Science.gov (United States)

    Atnaw, Samson M.; Sulaiman, Shaharin A.; Ahmad, M. Redzuan T.

    2012-06-01

    With no previous work on gasification of oil palm fronds (OPF), the design of a gasifier with optimum performance for such a biomass can be difficult. Prediction of the optimum operating condition using computer software can avoid costly trial and error designs. The objective of this work is to simulate biomass gasification process in a downdraft gasifier using OPF as a feedstock by means of Aspen Plus software. Three different equilibrium models were proposed using the unit operation models of ASPEN. Prediction of syngas composition obtained from each model was compared with experimental results from literature in order to select the best model that gives more reliable results. The optimum operating conditions that would result in the best composition of syngas was determined based on the prediction of the models. Sensitivity analysis has been carried out to investigate, the effect of temperature (500°C - 1000°C), and equivalence ratio (ER) (0.2 < ER < 0.53), to the resulting composition of syngas. From the work, it is found that rate of production of CO in the syngas increases with temperature, while the trend is decreasing for CO2. The rate of production of H2 is nearly constant for temperature values above 700°C. In addition, the rate of production of CO2 increases with equivalence ratio while that of H2 is predicted to decrease at higher equivalence ratio. The rate of production of CH2 tends to be only in trace amount for equivalence ratio values above 0.3, while a maximum output of CO is achieved at lower equivalence ratio less than 0.3, and higher oxidation zone temperature value, above 800°C. The simulation results showed that the operating condition would be optimum at higher temperature range of above 800°C, and equivalence ratio value of 0.3.

  9. CO-FIRING COAL, FEEDLOT, AND LITTER BIOMASS (CFB AND LFB) FUELS IN PULVERIZED FUEL AND FIXED BED BURNERS

    Energy Technology Data Exchange (ETDEWEB)

    Kalyan Annamalai; John Sweeten; Saqib Mukhtar; Ben Thien; Gengsheng Wei; Soyuz Priyadarsan

    2002-01-15

    Intensive animal feeding operations create large amounts of animal waste that must be safely disposed of in order to avoid environmental degradation. Cattle feedlots and chicken houses are two examples. In feedlots, cattle are confined to small pens and fed a high calorie grain diet in preparation for slaughter. In chicken houses, thousands of chickens are kept in close proximity. In both of these operations, millions of tons of manure are produced every year. In this project a co-firing technology is proposed which would use manure that cannot be used for fertilizer, for power generation. Since the animal manure has economic uses as both a fertilizer and as a fuel, it is properly referred to as feedlot biomass (FB) for cow manure, or litter biomass (LB) for chicken manure. The biomass will be used a as a fuel by mixing it with coal in a 90:10 blend and firing it in existing coal fired combustion devices. This technique is known as co-firing, and the high temperatures produced by the coal will allow the biomass to be completely combusted. Therefore, it is the goal of the current research to develop an animal biomass cofiring technology. A cofiring technology is being developed by performing: (1) studies on fundamental fuel characteristics, (2) small scale boiler burner experiments, (3) gasifier experiments, (4) computer simulations, and (5) an economic analysis. The fundamental fuel studies reveal that biomass is not as high a quality fuel as coal. The biomass fuels are higher in ash, higher in moisture, higher in nitrogen and sulfur (which can cause air pollution), and lower in heat content than coal. Additionally, experiments indicate that the biomass fuels have higher gas content, release gases more readily than coal, and less homogeneous. Small-scale boiler experiments revealed that the biomass blends can be successfully fired, and NO{sub x} pollutant emissions produced will be similar to or lower than pollutant emissions when firing coal. This is a surprising

  10. Photoconversion of gasified organic materials into biologically-degradable plastics

    Energy Technology Data Exchange (ETDEWEB)

    Weaver, Paul F. (Golden, CO); Maness, Pin-Ching (Golden, CO)

    1993-01-01

    A process is described for converting organic materials (such as biomass wastes) into a bioplastic suitable for use as a biodegradable plastic. In a preferred embodiment the process involves thermally gasifying the organic material into primarily carbon monoxide and hydrogen, followed by photosynthetic bacterial assimilation of the gases into cell material. The process is ideally suited for waste recycling and for production of useful biodegradable plastic polymer.

  11. Photoconversion of gasified organic materials into biologically-degradable plastics

    Energy Technology Data Exchange (ETDEWEB)

    Weaver, P.F.; Pinching Maness.

    1993-10-05

    A process is described for converting organic materials (such as biomass wastes) into a bioplastic suitable for use as a biodegradable plastic. In a preferred embodiment the process involves thermally gasifying the organic material into primarily carbon monoxide and hydrogen, followed by photosynthetic bacterial assimilation of the gases into cell material. The process is ideally suited for waste recycling and for production of useful biodegradable plastic polymer. 3 figures.

  12. Gasification of pelletized biomass in a pilot scale downdraft gasifier.

    Science.gov (United States)

    Simone, Marco; Barontini, Federica; Nicolella, Cristiano; Tognotti, Leonardo

    2012-07-01

    This work presents a pilot-scale investigation aimed at assessing the feasibility and reliability of biomass pellet gasification. Wood sawdust and sunflower seeds pellets were tested in a 200 kW downdraft gasifier operating with air as gasifying agent. The gasification of pelletized biomass led to rather high and unstable pressure drops, reducing the gasifier productivity and stability. Furthermore the generation of fine residues compromised the operation of wet ash removal systems. On the other hand, good syngas compositions (H(2) 17.2%, N(2) 46.0%, CH(4) 2.5%, CO 21.2%, CO(2) 12.6%, and C(2)H(4) 0.4%), specific gas production (2.2-2.4 N m(3) kg(-1)) and cold gas efficiency (67.7-70.0%) were achieved. For these reasons pelletized biomass should be considered only as complementary fuel in co-gasification with other feedstock. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Environmental and health study of a low-Btu gasifier. [Univ. of Minnesota-Duluth demonstration gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Cowser, K.E.; McGurl, G.V.; Wood, R.W.

    1978-01-01

    An environmental and health, monitoring and testing plan is now being implemented at the low-Btu gasifier located on the campus of the University of Minnesota-Duluth. This is one of several project plans under consideration by the Department of Energy in conjunction with the Gasifier in Industry Demonstration program. Numerous staff of the Oak Ridge National Laboratory and Department of Energy participated in the development and review of the monitoring and testing plan which includes on-line studies, in-plant studies, and local area studies to be integrated through multidisciplinary assessments. A description is provided of the process and facilities, of the rationale for the environmental and health plan, and of the principal program components including process measurements and controls, occupational exposures and effects, environmental fate and effects, and assessments.

  14. 3-D CFD Modeling for Parametric Study in a 300-MWe One-Stage Oxygen-Blown Entrained-Bed Coal Gasifier

    Directory of Open Access Journals (Sweden)

    Sang Shin Park

    2015-05-01

    Full Text Available Three-dimensional computational fluid dynamics (CFD modeling of the gasification performance in a one-stage, entrained-bed coal gasifier (Shell Coal Gasification Process (SCGP gasifier was performed, for the first time. The parametric study used various O2/coal and steam/coal ratios, and the modeling used a commercial code, ANSYS FLUENT. CFD modeling was conducted by solving the steady-state Navier–Stokes and energy equations using the Eulerian–Lagrangian method. Gas-phase chemical reactions were solved with the Finite–Rate/Eddy–Dissipation Model. The CFD model was verified with actual operating data of Demkolec demo Integrated Gasification Combined Cycle (IGCC facility in Netherlands that used Drayton coal. For Illinois #6 coal, the CFD model was compared with ASPEN Plus results reported in National Energy Technology Laboratory (NETL. For design coal used in the SCGP gasifier in Korea, carbon conversion efficiency, cold gas efficiency, temperature, and species mole fractions at the gasifier exit were calculated and the results were compared with those obtained by using ASPEN Plus-Kinetic. The optimal O2/coal and steam/coal ratios were 0.7 and 0.05, respectively, for the selected operating conditions.

  15. Dating the Deccan: Determining the Timing and Duration of the Indian KTB-Spanning CFB Eruptions

    Science.gov (United States)

    Widdowson, M.; Kelley, S.

    2008-12-01

    Numerous studies have compared dates of mass extinction events with dates of flood basalt eruption and found significant correlation, thus suggesting a possible cause-and-effect connection. However, to explore the robustness of this relationship requires both detailed understanding of CFBP lava stratigraphies, and the application of high precision dating. Previous dating studies of the Deccan Traps, India, have concentrated upon classic sections exposed along the Western Ghats escarpment. These have provided insight regarding the timing and duration of the CFB, and indicate a geologically rapid eruption near to, and across the KTB. However, whilst these sections provide access to key parts of the Deccan succession, they do not provide a complete chronological record of the eruptions. The well-established stratigraphical architecture of the Deccan CFB has offered an excellent framework for a comprehensive sampling programme. Accordingly, we report argon ages for a suite of Deccan basalts within this well-defined and detailed stratigraphical context. Analyses were performed using the incremental laser heating technique on plagioclase separates, and all ages are reported relative to the GA1550 biotite standard. Data from the stratigraphically lowest (earliest), and highest (final) basalt lavas of the Deccan CFBP are presented, and provide a reliable determination of its timing and duration. Argon analyses of the basal lavas yield late Maastrictian ages (66.7 +/- 0.5 Ma), indicating the onset of volcanism in the north-western region c. 0.5 - 2 Ma before the KTB. Deccan eruption reached an acme of eruption during Chron 29R, with successively younger lava fields building on the southern flank of the evolving Deccan volcanic edifice. The final Deccan eruptions are thus preserved in the south-western Deccan and yield a weighted mean average of (63.7 +/- 0.3 Ma). These latter form the upper part of the widespread and volumetrically important Wai Subgroup which was erupted

  16. Panel report on high temperature ceramics

    Energy Technology Data Exchange (ETDEWEB)

    Nolet, T C [ed.

    1979-01-01

    Fundamental research is reported concerning high temperature ceramics for application in turbines, engines, batteries, gasifiers, MHD, fuel cells, heat exchangers, and hot wall combustors. Ceramics microstructure and behavior are included. (FS)

  17. Application of antifungal CFB to increase the durability of cement mortar.

    Science.gov (United States)

    Park, Jong-Myong; Park, Sung-Jin; Kim, Wha-Jung; Ghim, Sa-Youl

    2012-07-01

    Antifungal cement mortar or microbiological calcium carbonate precipitation on cement surface has been investigated as functional concrete research. However, these research concepts have never been fused with each other. In this study, we introduced the antifungal calciteforming bacteria (CFB) Bacillus aryabhattai KNUC205, isolated from an urban tunnel (Daegu, South Korea). The major fungal deteriogens in urban tunnel, Cladosporium sphaerospermum KNUC253, was used as a sensitive fungal strain. B. aryabhattai KNUC205 showed CaCO3 precipitation on B4 medium. Cracked cement mortar pastes were made and neutralized by modified methods. Subsequently, the mixture of B. aryabhattai KNUC205, conidiospore of C. sphaerospermum KNUC253, and B4 agar was applied to cement cracks and incubated at 18 degrees C for 16 days. B. aryabhattai KNUC205 showed fungal growth inhibition against C. sphaerospermum. Furthermore, B. aryabhattai KNUC205 showed crack remediation ability and water permeability reduction of cement mortar pastes. Taken together, these results suggest that the CaCO3 precipitation and antifungal properties of B. aryabhattai KNUC205 could be used as an effective sealing or coating material that can also prevent deteriorative fungal growth. This study is the first application and evaluation research that incorporates calcite formation with antifungal capabilities of microorganisms for an environment-friendly and more effective protection of cement materials. In this research, the conception of microbial construction materials was expanded.

  18. NIH Toolbox Cognitive Function Battery (CFB): Composite Scores of Crystallized, Fluid, and Overall Cognition

    Science.gov (United States)

    Akshoomoff, Natacha; Beaumont, Jennifer L.; Bauer, Patricia J.; Dikmen, Sureyya; Gershon, Richard; Mungas, Dan; Slotkin, Jerry; Tulsky, David; Weintraub, Sandra; Zelazzo, Philip; Heaton, Robert K.

    2014-01-01

    The NIH Toolbox Cognitive Function Battery (CFB) includes 7 tests covering 8 cognitive abilities considered to be important in adaptive functioning across the lifespan (from early childhood to late adulthood). Here we present data on psychometric characteristics in children (N = 208; ages 3–15 years) of a total summary score and composite scores reflecting two major types of cognitive abilities: “crystallized” (more dependent upon past learning experiences) and “fluid” (capacity for new learning and information processing in novel situations). Both types of cognition are considered important in everyday functioning, but are thought to be differently affected by brain health status throughout life, from early childhood through older adulthood. All three Toolbox composite scores showed excellent test-retest reliability, robust developmental effects across the childhood age range considered here, and strong correlations with established, “gold standard” measures of similar abilities. Additional preliminary evidence of validity includes significant associations between all three Toolbox composite scores and maternal reports of children’s health status and school performance. PMID:23952206

  19. Removal of heavy metals from wastewater using CFB-coal fly ash zeolitic materials.

    Science.gov (United States)

    Koukouzas, Nikolaos; Vasilatos, Charalampos; Itskos, Grigorios; Mitsis, Ioannis; Moutsatsou, Angeliki

    2010-01-15

    Polish bituminous (PB) and South African (SA) coal fly ash (FA) samples, derived from pilot-scale circulated fluidized bed (CFB) combustion facilities, were utilized as raw materials for the synthesis of zeolitic products. The two FAs underwent a hydrothermal activation with 1M NaOH solution. Two different FA/NaOH solution/ratios (50, 100g/L) were applied for each sample and several zeolitic materials were formed. The experimental products were characterized by means of X-ray diffraction (XRD) and energy dispersive X-ray coupled-scanning electron microscope (EDX/SEM), while X-ray fluorescence (XRF) was applied for the determination of their chemical composition. The zeolitic products were also evaluated in terms of their cation exchange capacity (CEC), specific surface area (SSA), specific gravity (SG), particle size distribution (PSD), pH and the range of their micro- and macroporosity. Afterwards the hybrid materials were tested for their ability of adsorbing Cr, Pb, Ni, Cu, Cd and Zn from contaminated liquids. Main parameters for the precipitation of the heavy metals, as it was concluded from the experimental results, are the mineralogical composition of the initial fly ashes, as well as the type and the amount of the produced zeolite and specifically the mechanism by which the metals ions are hold on the substrate.

  20. Integrated operation of a pressurized fixed-bed gasifier, hot gas desulfurization system, and turbine simulator

    Energy Technology Data Exchange (ETDEWEB)

    Bevan, S.; Ayala, R.E.; Feitelberg, A.; Furman, A.

    1995-11-01

    The overall objective of the General Electric Hot Gas Cleanup (HGCU) Program is to develop a commercially viable technology to remove sulfur, particulates, and halogens from a high-temperature fuel gas stream using a moving bed, regenerable mixed metal oxide sorbent based process. The HGCU Program is based on the design and demonstration of the HGCU system in a test facility made up of a pilot-scale fixed bed gasifier, a HGCU system, and a turbine simulator in Schenectady, NY, at the General Electric Research and Development Center. The objectives of the turbine simulator testing are (1) to demonstrate the suitability of fuel gas processed by the HGCU system for use in state-of-the-art gas turbines firing at 2,350 F rotor inlet temperature and (2) to quantify the combustion characteristics and emissions on low-Btu fuel gas. The turbine simulator program also includes the development and operation of experimental combustors based on the rich-quench-lean concept (RQL) to minimize the conversion of ammonia and other fuel-bound nitrogen species to NO{sub x} during combustion. The HGCU system and turbine simulator have been designed to process approximately 8,000 lb/hr of low heating value fuel gas produced by the GE fixed bed gasifier. The HGCU system has utilized several mixed metal oxide sorbents, including zinc ferrite, zinc titanate, and Z-Sorb, with the objective of demonstrating good sulfur removal and mechanical attrition resistance as well as economic cost characteristics. Demonstration of halogen removal and the characterization of alkali and trace metal concentrations in the fuel gas are subordinate objectives of the overall program. This report describes the results of several long-duration pilot tests.

  1. Decreased PCDD/F formation when co-firing a waste fuel and biomass in a CFB boiler by addition of sulphates or municipal sewage sludge.

    Science.gov (United States)

    Åmand, Lars-Erik; Kassman, Håkan

    2013-08-01

    Polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) are formed during waste incineration and in waste-to-energy boilers. Incomplete combustion, too short residence times at low combustion temperatures (boilers. The impact of chlorine and catalysing metals (such as copper and iron) in the fuel on PCDD/F formation was studied in a 12 MW(th) circulating fluidised bed (CFB) boiler. The PCDD/F concentrations in the raw gas after the convection pass of the boiler and in the fly ashes were compared. The fuel types were a so-called clean biomass with low content of chlorine, biomass with enhanced content of chlorine from supply of PVC, and solid recovered fuel (SRF) which is a waste fuel containing higher concentrations of both chlorine, and catalysing metals. The PCDD/F formation increased for the biomass with enhanced chlorine content and it was significantly reduced in the raw gas as well as in the fly ashes by injection of ammonium sulphate. A link, the alkali chloride track, is demonstrated between the level of alkali chlorides in the gas phase, the chlorine content in the deposits in the convection pass and finally the PCDD/F formation. The formation of PCDD/Fs was also significantly reduced during co-combustion of SRF with municipal sewage sludge (MSS) compared to when SRF was fired without MSS as additional fuel. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. Efficiency tests on the pyrolysis gasifier stove Peko Pe

    DEFF Research Database (Denmark)

    Nielsen, Per Sieverts

    1996-01-01

    This paper presents results from water boiling tests on the pyrolysis gasifier stove Peko Pe, which has been developed by the Norwegian Paal Wendelbo. The stove efficiency determined vary between 21 and 29% when burning dry Danish woodchips (10% moisture) with an estimated caloric value of 16 MJ...... the water content in the grass. In Adjumani refugee camp it was furthermore found that the stove was able to provide sufficient energy from solid combustion, after the pyrolysis was stopped, to boil water for additional 25-30 minutes with lid. This effect was not seen in the tests on woodchips in Denmark...

  3. High rates of gasified rice hull biochar affect geranium and tomato growth in a soilless substrate

    Science.gov (United States)

    Gasified rice hull biochar (GRHB) is a byproduct of rice production, where rice hulls are gasified to generate energy for other aspects of rice processing. Other research has shown that GRHB up to 10% (v/v) in a soilless substrate can provide much, but not all, of a potted floriculture crops’ phosp...

  4. A moving-bed gasifier with internal recycle of pyrolysis gas

    NARCIS (Netherlands)

    Susanto, H.; Beenackers, A.A C M

    A co-current moving bed gasifier with internal recycle and separate combustion of pyrolysis gas has been developed with the aim of producing a design suitable for scaling-up downdraft gasifiers while maintaining a low tar content in the producer gas. Using wood chips with a moisture content of 7-9

  5. Conversion of forest residues to a methane-rich gas in a high-throughput gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Feldmann, H.F.; Paisley, M.A.; Appelbaum, H.R.; Taylor, D.R.

    1988-05-01

    Research was conducted in a process research unit to develop an entrained bed gasifier which is supplied heat by recirculating a stream of sand between a separate combustion vessel and the gasifier. The char remaining after gasification of the wood provides the fuel for the combustor. The research program was conducted in two phases. In the first phase, a 6 in. I.D. gasifier was used to establish the feasibility of the concept for a wide variety of biomass feeds. The second phase of the program was conducted with a 10 in. I.D. gasifier, and a fully automated feeder system, to evaluate gasifier performance at very high feed rates. The experimental results were used to develop design parameters and detailed energy and material balances for a conceptual plant. A preliminary cost analysis is presented in the report based on the conceptual design. 5 refs., 24 figs., 13 tabs.

  6. Physicochemical properties and gasification reactivity of the ultrafine semi-char derived from a bench-scale fluidized bed gasifier

    Science.gov (United States)

    Zhang, Yukui; Zhang, Haixia; Zhu, Zhiping; Na, Yongjie; Lu, Qinggang

    2017-08-01

    Zhundong coalfield is the largest intact coalfield worldwide and fluidized bed gasification has been considered as a promising way to achieve its clean and efficient utilization. The purpose of this study is to investigate the physicochemical properties and gasification reactivity of the ultrafine semi-char, derived from a bench-scale fluidized bed gasifier, using Zhundong coal as fuel. The results obtained are as follows. In comparison to the raw coal, the carbon and ash content of the semi-char increase after partial gasification, but the ash fusion temperatures of them show no significant difference. Particularly, 76.53% of the sodium in the feed coal has released to the gas phase after fluidized bed gasification. The chemical compositions of the semi-char are closely related to its particle size, attributable to the distinctly different natures of diverse elements. The semi-char exhibits a higher graphitization degree, higher BET surface area, and richer meso- and macropores, which results in superior gasification reactivity than the coal char. The chemical reactivity of the semi-char is significantly improved by an increased gasification temperature, which suggests the necessity of regasification of the semi-char at a higher temperature. Consequently, it will be considered feasible that these carbons in the semi-char from fluidized bed gasifiers are reclaimed and reused for the gasification process.

  7. Agglomeration of biomass fired fluidized bed gasifier and combustor

    Energy Technology Data Exchange (ETDEWEB)

    Mettanant, V.; Basu, P. [Dalhousie Univ., Halifax, NS (Canada). Dept. of Mechanical Engineering; Butler, J. [Greenfield Research Inc., Halifax, NS (Canada)

    2009-10-15

    As a renewable energy, biomass has the potential to supplement or replace energy produced from fossil fuel resources. However, agglomeration can occur in the fluidized bed boilers and gasifiers used to generate biomass energy. This paper discussed the theoretical and experimental results obtained during an agglomeration study of a biomass-fired fluidized bed gasifier and combustor. The mechanisms of agglomeration were studied as well as influence of various biomass components on bed materials. The study showed that agglomeration is typically caused by the formation of low melting point eutectic mixtures in the bed through a reaction of alkali materials in the fuel with silica bed materials. Agglomeration is also prompted by reactions between alkali species in ash and silica. Beds firing coffee husks, cotton husks, wastes and soy husks have the highest agglomeration problems, while peat, wood, and sewage sludge burn without agglomeration due to their low agglomeration index. The use of alternative bed materials instead of silica sands was recommended. It was concluded that the co-combustion of biomass with coal and other fuels will also prevent agglomerates from forming. 50 refs., 9 tabs., 39 figs.

  8. Sampling of contaminants from product gases of biomass gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Staahlberg, P.; Lappi, M.; Kurkela, E.; Simell, P.; Oesch, P.; Nieminen, M. [VTT Energy, Espoo (Finland). New Energy Technologies

    1998-12-01

    Reliable sampling and analysis of products from biomass gasification are essential for the successful process development and economical operation of commercial gasifiers. One of the most important and most difficult analytical tasks is to characterise the emissions from the gasifiers. This report presents a review of the sampling and analytical systems employed and developed when doing research on coal and biomass gasification. In addition to the sampling systems published in the literature, experiences obtained in various biomass gasification R and D projects of VTT in 1985-1995 are described. The present sampling methods used for different gas contaminants at VTT are also briefly presented. This report focuses mainly on the measurement of tars, nitrogen compounds and sulphur gases. Isokinetic and non-isokinetic sampling train systems are described and, in addition, special sampling apparatus based on liquid-quenched probe and gas dilution is briefly outlined. Sampling of tars with impinger systems and sampling of heavy tars with filter techniques are described in detail. Separate sampling of particulates is briefly discussed. From inorganic compounds the sampling systems used for H{sub 2}S and other sulphur gases, NH{sub 3} and HCN and HCl are presented. Proper storage of the samples is also included in the report. (orig.) 90 refs.

  9. Liquid Fuel Production from Biomass via High Temperature Steam Electrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Grant L. Hawkes; Michael G. McKellar

    2009-11-01

    A process model of syngas production using high temperature electrolysis and biomass gasification is presented. Process heat from the biomass gasifier is used to heat steam for the hydrogen production via the high temperature steam electrolysis process. Hydrogen from electrolysis allows a high utilization of the biomass carbon for syngas production. Oxygen produced form the electrolysis process is used to control the oxidation rate in the oxygen-fed biomass gasifier. Based on the gasifier temperature, 94% to 95% of the carbon in the biomass becomes carbon monoxide in the syngas (carbon monoxide and hydrogen). Assuming the thermal efficiency of the power cycle for electricity generation is 50%, (as expected from GEN IV nuclear reactors), the syngas production efficiency ranges from 70% to 73% as the gasifier temperature decreases from 1900 K to 1500 K. Parametric studies of system pressure, biomass moisture content and low temperature alkaline electrolysis are also presented.

  10. Studi Eksperimental Pengaruh Penambahan Sistem Ceratan pada Gasifikasi Biomassa Briket Municipal Solid Waste terhadap Performa Gasifier Tipe Downdraft

    Directory of Open Access Journals (Sweden)

    Hendra Bhakti

    2017-01-01

    Full Text Available Pemanfaatan syngas sebagai bahan bakar campuran bahan bakar mesin diesel dual fuel (DDF menimbulkan permasalahan yaitu terbuangnya syn-gas karena kelebihan produksi. Penelitian dimaksudkan melakukan penambahan sistem ceratan untuk mengalirkan kembali syngas yang terbuang karena sisa pembakaran mesin DDF ke dalam reaktor. Syngas yang dipakai berasal dari proses gasifikasi yang dilakukan pada downdraft gasifier dengan bahan bakar briket MSW. Mekanisme ceratan gas hasil gasifikasi dilakukan dengan pemasangan katup pada pipa aliran syn-gas setelah induced fan menuju reaktor gasifikasi kembali. Syngas hasil ceratan di campur dengan udara sebagai gasifying agent dengan mixer sebelum masuk ke blower udara. Laju alir massa syn-gas yang dicerat divariasikan mulai 0%, 11%, 23%, dan 54%. Dari penelitian dan analisa yang telah dilakukan, diketahui bahwa nilai rasio udara-bahan bakar menurun seiring penambahan ceratan syn-gas yaitu dari 1,04 – 0,44 dan equivalence ratio dari 0,18 – 0,09. Dengan penambahan ceratan diketahui efisiensi terbaik terjadi saat penambahan prosentasi ceratan 11% dengan efisiensi sebesar 66,81%. LHV meningkat seiring penambahan ceratan dengan LHV terbaik terjadi pada ceratan syn-gas 55% sebesar 3912,37 kJ/kg. Temperatur kerja gasifikasi cenderung menurun dengan penambahan ceratan syn-gas. Temperatur kerja T1 – T5 berada pada kisaran 70, 250, 983, 589, dan 115 ᵒC. Kandungan combustible gas meningkat dan uncombustible gas menurun seiring dengan penambahan ceratan syn-gas. Nilai kalor briket MSW sebesar 4698 kJ/kg

  11. Gas cleaning, gas conditioning and tar abatement by means of a catalytic filter candle in a biomass fluidized-bed gasifier.

    Science.gov (United States)

    Rapagnà, Sergio; Gallucci, Katia; Di Marcello, Manuela; Matt, Muriel; Nacken, Manfred; Heidenreich, Steffen; Foscolo, Pier Ugo

    2010-09-01

    A bench-scale fluidized-bed biomass gasification plant, operating at atmospheric pressure and temperature within the range 800-820 degrees C, has been used to test an innovative gas cleaning device: a catalytic filter candle fitted into the bed freeboard. This housing of the gas conditioning system within the gasifier itself results in a very compact unit and greatly reduced thermal losses. Long term (22h) tests were performed on the gasifier both with and without the catalytic candle filter, under otherwise identical conditions. Analysis of the product gas for the two cases showed the catalytic filtration to give rise to notable improvements in both gas quality and gas yield: an increase in hydrogen yield of 130% and an overall increase in gas yield of 69% - with corresponding decreases in methane and tar content of 20% and 79%, respectively. HPLC/UV analysis was used to characterize the tar compounds. Copyright 2010 Elsevier Ltd. All rights reserved.

  12. Design and Development of a Wood-Fired Gasifier Prototype for Synthesis Gas Production and Analysis

    Directory of Open Access Journals (Sweden)

    Neres Ann S. Manguiat

    2015-12-01

    Full Text Available -Synthesis gas formation which can be transformed to useful compounds through biomass gasification is perceived as one promising process of biofuel production. A construction, design and development of an efficient and small-scale wood-fired gasifier prototype was made at Batangas State University. This study included the costs and specifications of materials, the design, components and percent conversion of the biomass to syngas by obtaining the amount of the residue. Set of operating conditions were determined so as to achieve a good performance of the gasifier; otherwise it adversely affected the operation of the prototype. The gasifier operates in a condition in which the air flow rate is 560 - 610 cm3 /min wherein the valve is half-open and the blower is turned on after 20 seconds. The gasifier will be closed after a minute of start-up. With these conditions, the gasifier works accordingly to a smooth operation. Syngas was composed of methane (2.32 % volume, carbon dioxide (10 % volume, carbon monoxide and minimal amount of hydrogen. Two (2 kg of woodchips with 90.75% conversion was the best amount of feed suited for the operation of the gasifier. This innovation comprises a method which efficiently converts the feedstock thereby enhancing the energy of the syngas produced with byproducts at minimum acceptable value. The wood-fired gasifier will be a very helpful tool in contributing to the resolution of pressing social and environmental problems such as energy security and local agricultural waste pollution.

  13. Model Research of Gas Emissions From Lignite and Biomass Co-Combustion in a Large Scale CFB Boiler

    Directory of Open Access Journals (Sweden)

    Krzywański Jarosław

    2014-06-01

    Full Text Available The paper is focused on the idea of a combustion modelling of a large-scale circulating fluidised bed boiler (CFB during coal and biomass co-combustion. Numerical computation results for three solid biomass fuels co-combustion with lignite are presented in the paper. The results of the calculation showed that in previously established kinetics equations for coal combustion, some reactions had to be modified as the combustion conditions changed with the fuel blend composition. Obtained CO2, CO, SO2 and NOx emissions are located in borders of ± 20% in the relationship to the experimental data. Experimental data was obtained for forest biomass, sunflower husk, willow and lignite cocombustion tests carried out on the atmospheric 261 MWe COMPACT CFB boiler operated in PGE Turow Power Station in Poland. The energy fraction of biomass in fuel blend was: 7%wt, 10%wt and 15%wt. The measured emissions of CO, SO2 and NOx (i.e. NO + NO2 were also shown in the paper. For all types of biomass added to the fuel blends the emission of the gaseous pollutants was lower than that for coal combustion.

  14. Gasification of ‘Loose’ Groundnut Shells in a Throathless Downdraft Gasifier

    Directory of Open Access Journals (Sweden)

    Aondoyila Kuhe

    2015-07-01

    Full Text Available In this paper, gasification potential of biomass residue was investigated using a laboratory scale throatless downdraft gasifier. Experimental results of groundnut shell was gasified in the throatless downdraft gasifier to produce a clean gas with a calorific value of around 5.92 MJ/Nm3 and a combustible fraction of 45% v/v. Low moisture (8.6% and ash content (3.19% are the main advantages of groundnut shells for gasification. It is suggested that gasification of shell waste products is a clean energy alternative to fossil fuels. The product gas can be used efficiently for heating and possible usage in internal combustion engines.

  15. Test of pyrolysis gasifier stoves in two institutional kitchens in Uganda

    DEFF Research Database (Denmark)

    Wendelbo, Pall; Nielsen, Per Sieverts

    1998-01-01

    was financed by the Norwegian Forestry Society and involved two institutional kitchens in the northern part of Uganda. The pyrolysis gasifier stove, which is used as heating source, is a simple batch feeded top-down inverted gasifier. The two institutional kitchens prepared food for 107 students and 700 pupils...... institutional cooking places can be used to prepare the local food and that it saves at least 2/3 of the wood compared with the use of traditional three stone stoves. Furthermore, the use of the gasifier units, which burn without smoke, reduces the exposure to smoke considerably; however, this is only evaluated...

  16. Automatic control of biomass gasifiers using fuzzy inference systems

    Energy Technology Data Exchange (ETDEWEB)

    Sagues, C. [Universidad de Zaragoza (Spain). Dpto. de Informatica e Ingenieria de Sistemas; Garcia-Bacaicoa, P.; Serrano, S. [Universidad de Zaragoza (Spain). Dpto. de Ingenieria Quimica y Medio Ambiente

    2007-03-15

    A fuzzy controller for biomass gasifiers is proposed. Although fuzzy inference systems do not need models to be tuned, a plant model is proposed which has turned out very useful to prove different combinations of membership functions and rules in the proposed fuzzy control. The global control scheme is shown, including the elements to generate the set points for the process variables automatically. There, the type of biomass and its moisture content are the only data which need to be introduced to the controller by a human operator at the beginning of operation to make it work autonomously. The advantages and good performance of the fuzzy controller with the automatic generation of set points, compared to controllers utilising fixed parameters, are demonstrated. (author)

  17. CO-FIRING COAL: FEEDLOT AND LITTER BIOMASS (CFB AND CLB) FUELS IN PULVERIZED FUEL AND FIXED BED BURNERS

    Energy Technology Data Exchange (ETDEWEB)

    Kalyan Annamalai; John Sweeten; Saqib Mukhtar; Ben Thein; Gengsheng Wei; Soyuz Priyadarsan; Senthil Arumugam; Kevin Heflin

    2003-08-28

    Intensive animal feeding operations create large amounts of animal waste that must be safely disposed of in order to avoid environmental degradation. Cattle feedlots and chicken houses are two examples. In feedlots, cattle are confined to small pens and fed a high calorie grain-diet diet in preparation for slaughter. In chicken houses, thousands of chickens are kept in close proximity. In both of these operations, millions of tons of manure are produced every year. The manure could be used as a fuel by mixing it with coal in a 90:10 blend and firing it in an existing coal suspension fired combustion systems. This technique is known as co-firing, and the high temperatures produced by the coal will allow the biomass to be completely combusted. Reburn is a process where a small percentage of fuel called reburn fuel is injected above the NO{sub x} producing, conventional coal fired burners in order to reduce NO{sub x}. The manure could also be used as reburn fuel for reducing NO{sub x} in coal fired plants. An alternate approach of using animal waste is to adopt the gasification process using a fixed bed gasifier and then use the gases for firing in gas turbine combustors. In this report, the cattle manure is referred to as feedlot biomass (FB) and chicken manure as litter biomass (LB). The report generates data on FB and LB fuel characteristics. Co-firing, reburn, and gasification tests of coal, FB, LB, coal: FB blends, and coal: LB blends and modeling on cofiring, reburn systems and economics of use of FB and LB have also been conducted. The biomass fuels are higher in ash, lower in heat content, higher in moisture, and higher in nitrogen and sulfur (which can cause air pollution) compared to coal. Small-scale cofiring experiments revealed that the biomass blends can be successfully fired, and NO{sub x} emissions will be similar to or lower than pollutant emissions when firing coal. Further experiments showed that biomass is twice or more effective than coal when

  18. Environmental implications of small fixed-bed gasifiers for industry. [Assumes 500 small gasifiers in 1990 and 2500 in 2000

    Energy Technology Data Exchange (ETDEWEB)

    Dobson, J.E.; Cushman, R.M.; Walsh, P.J.

    1981-05-01

    The Oak Ridge National Laboratory is responsible for an assessment of the environmental implications of small fixed-bed coal gasifiers for industry. The assessment focuses on the industrial utilization of low energy gas (often called low-Btu gas) in the range of 3708 to 7416 kJ/m/sup 3/ manufactured on-site or nearby in a coal-air-steam reaction process. The major risk is in occupational health due to potential exposure to toxic substances. This risk to workers is considerably greater than the risk to the public at large. The major sources of occupational exposure will be process steam leaks, accidental spills, and maintenance operations. The composition of the process stream produced during low-Btu gasification is not well know at present.

  19. Gasification of municipal solid waste in a downdraft gasifier: Analysis of tar formation

    Directory of Open Access Journals (Sweden)

    Tabitha Geoffrey Etutu

    2016-04-01

    Full Text Available In this study, municipal solid waste (MSW from a dumpsite was converted into refuse derived fuel (RDF and used as feedstock for an air-blown gasification process. The gasification process was conducted in a 10 kg.hr -1 downdraft gasifier at different air flow rates of 300, 350, 400, 450 and 550 NL.min1 at atmospheric pressure in order to investigate the quantity and quality of tar formed. It was shown that the increase in the air flow rate from 300 NL.min1 to 550 NL.min1 led to an increase in the oxidation temperature from 719°C to 870°C and an increase in the reduction temperature from 585°C to 750°C, respectively. Tar was reduced from 15 g.Nm3 to 4.7 g.Nm3 respectively. Heavy tar compounds (>C17 e.g. pyrene and phenathrene, decreased with the increase in the light tar compounds (

  20. Impact of feedstock properties and operating conditions on sewage sludge gasification in a fixed bed gasifier.

    Science.gov (United States)

    Werle, Sebastian

    2014-10-01

    This work presents results of experimental studies on the gasification process of granulated sewage sludge in a laboratory fixed bed gasifier. Nowadays, there is a large and pressing need for the development of thermal methods for sewage sludge disposal. Gasification is an example of thermal method that has several advantages over the traditional combustion. Gasification leads to a combustible gas, which can be used for the generation of useful forms of final energy. It can also be used in processes, such as the drying of sewage sludge directly in waste treatment plant. In the present work, the operating parameters were varied over a wide range. Parameters, such as air ratio λ = 0.12 to 0.27 and the temperature of air preheating t = 50 °C to 250 °C, were found to influence temperature distribution and syngas properties. The results indicate that the syngas heating value decreases with rising air ratio for all analysed cases: i.e. for both cold and preheated air. The increase in the concentration of the main combustible components was accompanied by a decrease in the concentration of carbon dioxide. Preheating of the gasification agent supports the endothermic gasification and increases hydrogen and carbon monoxide production. © The Author(s) 2014.

  1. Thermodynamic modeling of small scale biomass gasifiers: Development and assessment of the ''Multi-Box'' approach.

    Science.gov (United States)

    Vakalis, Stergios; Patuzzi, Francesco; Baratieri, Marco

    2016-04-01

    Modeling can be a powerful tool for designing and optimizing gasification systems. Modeling applications for small scale/fixed bed biomass gasifiers have been interesting due to their increased commercial practices. Fixed bed gasifiers are characterized by a wide range of operational conditions and are multi-zoned processes. The reactants are distributed in different phases and the products from each zone influence the following process steps and thus the composition of the final products. The present study aims to improve the conventional 'Black-Box' thermodynamic modeling by means of developing multiple intermediate 'boxes' that calculate two phase (solid-vapor) equilibriums in small scale gasifiers. Therefore the model is named ''Multi-Box''. Experimental data from a small scale gasifier have been used for the validation of the model. The returned results are significantly closer with the actual case study measurements in comparison to single-stage thermodynamic modeling. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Performance and emission reduction potential of micro-gasifier improved through better design

    Directory of Open Access Journals (Sweden)

    Kamil Dino Adem

    2017-01-01

    Full Text Available Biomass gasification is getting popular for household cooking application in most developing countries including Ethiopia. The preference for biomass gasification is due to the generation of less CO (Carbon Monoxide and PM (Particulate Matter in comparison with other biomass cookstoves. Our study showed the improvement in thermal efficiency and emission reduction potential of micro-gasifier. A prototype micro-gasifier was built and tested using the water boiling test protocol. The test results gave a thermal efficiency of 39.6% and a specific fuel consumption of 57 g of fuel/ liter of water. With regard to indoor air pollution, the maximum CO & PM registered were 12.5 ppm and 1.85 mg/m3, respectively. Using clean development mechanism (CDM methodology, the estimated emission reduction potential of the micro-gasifier is 1.30 tCO2 per micro-gasifier per year. Generally, the micro-gasifier has better performance compared to the previous designs proposed by other researchers. Thus, disseminating our micro-gasifier at a larger scale in developing countries such as Ethiopia will be beneficial in reducing deforestation and emission that will be brought about by using open-fire stoves and thus, helps to obtain carbon credit.

  3. THE PRODUCTION OF SYNGAS VIA HIGH TEMPERATURE ELECTROLYSIS AND BIO-MASS GASIFICATION

    Energy Technology Data Exchange (ETDEWEB)

    M. G. McKellar; G. L. Hawkes; J. E. O' Brien

    2008-11-01

    A process model of syngas production using high temperature electrolysis and biomass gasification is presented. Process heat from the biomass gasifier is used to improve the hydrogen production efficiency of the steam electrolysis process. Hydrogen from electrolysis allows a high utilization of the biomass carbon for syngas production. Based on the gasifier temperature, 94% to 95% of the carbon in the biomass becomes carbon monoxide in the syngas (carbon dioxide and hydrogen). Assuming the thermal efficiency of the power cycle for electricity generation is 50%, (as expected from GEN IV nuclear reactors), the syngas production efficiency ranges from 70% to 73% as the gasifier temperature decreases from 1900 K to 1500 K.

  4. INNOVATIVE INSTRUMENTATION AND ANALYSIS OF THE TEMPERATURE MEASUREMENT FOR HIGH TEMPERATURE GASIFICATION

    Energy Technology Data Exchange (ETDEWEB)

    Seong W. Lee

    2003-09-01

    During this reporting period, the literature survey including the gasifier temperature measurement literature, the ultrasonic application and its background study in cleaning application, and spray coating process are completed. The gasifier simulator (cold model) testing has been successfully conducted. Four factors (blower voltage, ultrasonic application, injection time intervals, particle weight) were considered as significant factors that affect the temperature measurement. The Analysis of Variance (ANOVA) was applied to analyze the test data. The analysis shows that all four factors are significant to the temperature measurements in the gasifier simulator (cold model). The regression analysis for the case with the normalized room temperature shows that linear model fits the temperature data with 82% accuracy (18% error). The regression analysis for the case without the normalized room temperature shows 72.5% accuracy (27.5% error). The nonlinear regression analysis indicates a better fit than that of the linear regression. The nonlinear regression model's accuracy is 88.7% (11.3% error) for normalized room temperature case, which is better than the linear regression analysis. The hot model thermocouple sleeve design and fabrication are completed. The gasifier simulator (hot model) design and the fabrication are completed. The system tests of the gasifier simulator (hot model) have been conducted and some modifications have been made. Based on the system tests and results analysis, the gasifier simulator (hot model) has met the proposed design requirement and the ready for system test. The ultrasonic cleaning method is under evaluation and will be further studied for the gasifier simulator (hot model) application. The progress of this project has been on schedule.

  5. Detailed model for practical pulverized coal furnaces and gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Smith, P.J.; Smoot, L.D.

    1989-08-01

    This study has been supported by a consortium of nine industrial and governmental sponsors. Work was initiated on May 1, 1985 and completed August 31, 1989. The central objective of this work was to develop, evaluate and apply a practical combustion model for utility boilers, industrial furnaces and gasifiers. Key accomplishments have included: Development of an advanced first-generation, computer model for combustion in three dimensional furnaces; development of a new first generation fouling and slagging submodel; detailed evaluation of an existing NO{sub x} submodel; development and evaluation of an improved radiation submodel; preparation and distribution of a three-volume final report: (a) Volume 1: General Technical Report; (b) Volume 2: PCGC-3 User's Manual; (c) Volume 3: Data Book for Evaluation of Three-Dimensional Combustion Models; and organization of a user's workshop on the three-dimensional code. The furnace computer model developed under this study requires further development before it can be applied generally to all applications; however, it can be used now by specialists for many specific applications, including non-combusting systems and combusting geseous systems. A new combustion center was organized and work was initiated to continue the important research effort initiated by this study. 212 refs., 72 figs., 38 tabs.

  6. Thermodynamics analysis of refinery sludge gasification in adiabatic updraft gasifier.

    Science.gov (United States)

    Ahmed, Reem; Sinnathambi, Chandra M; Eldmerdash, Usama; Subbarao, Duvvuri

    2014-01-01

    Limited information is available about the thermodynamic evaluation for biomass gasification process using updraft gasifier. Therefore, to minimize errors, the gasification of dry refinery sludge (DRS) is carried out in adiabatic system at atmospheric pressure under ambient air conditions. The objectives of this paper are to investigate the physical and chemical energy and exergy of product gas at different equivalent ratios (ER). It will also be used to determine whether the cold gas, exergy, and energy efficiencies of gases may be maximized by using secondary air injected to gasification zone under various ratios (0, 0.5, 1, and 1.5) at optimum ER of 0.195. From the results obtained, it is indicated that the chemical energy and exergy of producer gas are magnified by 5 and 10 times higher than their corresponding physical values, respectively. The cold gas, energy, and exergy efficiencies of DRS gasification are in the ranges of 22.9-55.5%, 43.7-72.4%, and 42.5-50.4%, respectively. Initially, all 3 efficiencies increase until they reach a maximum at the optimum ER of 0.195; thereafter, they decline with further increase in ER values. The injection of secondary air to gasification zone is also found to increase the cold gas, energy, and exergy efficiencies. A ratio of secondary air to primary air of 0.5 is found to be the optimum ratio for all 3 efficiencies to reach the maximum values.

  7. Efficiency tests on the pyrolysis gasifier stove Peko Pe

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, P.S.

    1996-10-01

    This paper presents results from water boiling tests on the pyrolysis gasifier stove Peko Pe, which has been developed by the Norwegian Paal Wendelbo. The stove efficiency determined vary between 21 and 29% when burning dry Danish woodchip (10% moisture) with an estimated caloric value of 16 MJ/kg. CO-emissions have been determined with varying distance between the stove and the pot to estimate the combustion efficiency. Efficiency tests performed in Adjumani refugee camp with grass as fuel show a stove efficiency of 25-29% with a caloric value of 14 MJ/kg. It has not been possible to determine the water content in the grass. In Adjumani refugee camp it was furthermore found that the stove was able to provide sufficient energy from solid combustion, after the pyrolysis was stopped, to boil water for additional 25-30 minutes with lid. This effect was not seen in the tests on woodchips in Denmark. Advantages and disadvanges of the stove compared to three-stone stoves are discussed and perspectives are outlined for further improvements of the stove. (au)

  8. A review of sorbent materials for fixed bed alkali getter systems in biomass gasifier combined cycle power generation applications

    Energy Technology Data Exchange (ETDEWEB)

    Turn, S.Q.; Kinoshita, C.M.; Ishimura, D.M.; Masutani, S.M. [Hawaii Natural Energy Inst., Honolulu, HI (United States); Zhou, J. [Hawaii Univ., Mechanical Engineering Dept., Honolulu, HI (United States)]|[Hawaii Natural Energy Inst., Honolulu, HI (United States); Hiraki, T.T. [Hawaii Univ., Biosystems Engineering Dept., Honolulu, HI (United States)

    1998-12-01

    Gas phase alkali metal compounds contribute to fouling, slagging, corrosion, and agglomeration problems in energy conversion facilities. One method of mitigation applicable at high temperature is to pass the gas stream through a fixed bed of sorbent or getter material that preferentially adsorbs alkali via physical adsorption or chemisorption. This paper reviews studies in which such materials, primarily alumina and silicate compounds, in inert and simulated combustor flue gas conditions were screened. Emathlite, diatomaceous earth, kaolinite, and activated bauxite were identified as potential sorbents and were tested thermogravimetrically or in packed beds under various process conditions. Test experience with candidate sorbent materials in an environment representative of process conditions following a hot filter in a biomass integrated gasifier combined cycle system was found to be lacking. (Author)

  9. The study of integrated coal-gasifier molten carbonate fuel cell systems

    Science.gov (United States)

    1983-07-01

    A novel integration concept for a coal-fueled coal gasifier-molten carbonate fuel cell power plant was studied. Effort focused on determining the efficiency potential of the concept, design, and development requirements of the processes in order to achieve the efficiency. The concept incorporates a methane producing catalytic gasifier of the type previously under development by Exxon Research and Development Corp., a reforming molten carbonate fuel cell power section of the type currently under development by United Technologies Corp., and a gasifier-fuel cell recycle loop. The concept utilizes the fuel cell waste heat, in the form of hydrogen and carbon monoxide, to generate additional fuel in the coal gasifier, thereby eliminating the use of both an O2 plant and a stream bottoming cycle from the power plant. The concept has the potential for achieving coal-pile-to-busbar efficiencies of 50-59%, depending on the process configuration and degree of process configuration and degree of process development requirements. This is significantly higher than any previously reported gasifier-molten carbonate fuel cell system.

  10. Effect of sewage sludge content on gas quality and solid residues produced by cogasification in an updraft gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Seggiani, Maurizia, E-mail: m.seggiani@diccism.unipi.it [Department of Chemical Engineering, Industrial Chemistry and Material Science, University of Pisa, Largo Lucio Lazzarino 1, 56126 Pisa (Italy); Puccini, Monica, E-mail: m.puccini@diccism.unipi.it [Department of Chemical Engineering, Industrial Chemistry and Material Science, University of Pisa, Largo Lucio Lazzarino 1, 56126 Pisa (Italy); Raggio, Giovanni, E-mail: g.raggio@tiscali.it [Italprogetti Engineering SPA, Lungarno Pacinotti, 59/A, 56020 San Romano (Pisa) (Italy); Vitolo, Sandra, E-mail: s.vitolo@diccism.unipi.it [Department of Chemical Engineering, Industrial Chemistry and Material Science, University of Pisa, Largo Lucio Lazzarino 1, 56126 Pisa (Italy)

    2012-10-15

    Highlights: Black-Right-Pointing-Pointer Cogasification of sewage sludge with wood pellets in updraft gasifier was analysed. Black-Right-Pointing-Pointer The effects of sewage sludge content on the gasification process were examined. Black-Right-Pointing-Pointer Sewage sludge addition up to 30 wt.% reduces moderately the process performance. Black-Right-Pointing-Pointer At high sewage sludge content slagging and clinker formation occurred. Black-Right-Pointing-Pointer Solid residues produced resulted acceptable at landfills for non-hazardous waste. - Abstract: In the present work, the gasification with air of dehydrated sewage sludge (SS) with 20 wt.% moisture mixed with conventional woody biomass was investigated using a pilot fixed-bed updraft gasifier. Attention was focused on the effect of the SS content on the gasification performance and on the environmental impact of the process. The results showed that it is possible to co-gasify SS with wood pellets (WPs) in updraft fixed-bed gasification installations. However, at high content of sewage sludge the gasification process can become instable because of the very high ash content and low ash fusion temperatures of SS. At an equivalent ratio of 0.25, compared with wood pellets gasification, the addition of sewage sludge led to a reduction of gas yield in favor of an increase of condensate production with consequent cold gas efficiency decrease. Low concentrations of dioxins/furans and PAHs were measured in the gas produced by SS gasification, well below the limiting values for the exhaust gaseous emissions. NH{sub 3}, HCl and HF contents were very low because most of these compounds were retained in the wet scrubber systems. On the other hand, high H{sub 2}S levels were measured due to high sulfur content of SS. Heavy metals supplied with the feedstocks were mostly retained in gasification solid residues. The leachability tests performed according to European regulations showed that metals leachability was

  11. Air gasification of biogas-derived digestate in a downdraft fixed bed gasifier.

    Science.gov (United States)

    Chen, Guanyi; Guo, Xiang; Cheng, Zhanjun; Yan, Beibei; Dan, Zeng; Ma, Wenchao

    2017-11-01

    Digestate is a byproduct from biomass anaerobic digestion process. Gasification of dried digestate to produce gasesous product might be a promising route. In this work, air gasification of digestate with high ash content was performed in a downdraft fixed bed gasifier at temperature varying from 600°C to 800°C and air equivalence ratio (ER) ranging from 0.25 to 0.30. The ash melting properties were firstly detected by the Intelligent Ash Melting Point Test, and the by-products (biochar and ash) were analyzed. The results showed that no ash slagging was observed and therefore it is feasible to operate digestate gasification under 800°C and ER ranging from 0.25 to 0.30. High temperature favored gas production, 800°C is proposed for digestate gasification in the present study. ER with a medium value improved gas quality and cold gas efficiency (CGE), and the optimal LHV of 4.78MJ/Nm 3 and CGE of 67.01% were obtained with ER of 0.28. High ER favored the increase of gas yield and decrease of tar concentration, and the optimal gas yield of 2.15 Nm 3 /kg and tar concentration of 1.61g/Nm 3 were achieved with ER of 0.30. Improved molar ratio of H 2 /CO varying from 1.03 to 1.08 was obtained at 800°C, indicating gaseous product has the potential for chemical synthesis processes (1

  12. Analyses of coal gasifier and circulating fluidized bed combustion equipment using data base

    Energy Technology Data Exchange (ETDEWEB)

    Furusawa, Takehiko

    1988-09-01

    The construction of a coal and energy data base and the technical examples using it, such as coal gasifier and fluidized bed combustion equipment, were introduced. Wide ranges of data were collected to construct data base from gasifiers of 30 years ago or older to data reported in 1988 and design data of gasifiers under planning. The quantitative backup for the developing problems inherent to each gas-solid contact process and the relations between cold gas efficiency and factors influencing the cold gas efficiency which are improved along with the progress of technical development can be obtained. In the analysis of the fluidized bed coal combustion, the relation between thermal output and equipment's height was estimated with the mean wall surface heat transfer coefficient as the parameter. Further, the performane of particle withdrawal equipment was found to influence the combustion efficiency in the circulating fluidized bed combustion. (4 figs, 3 tabs, 2 refs)

  13. Results from tests of a Stirling engine and wood chips gasifier plant

    DEFF Research Database (Denmark)

    Carlsen, Henrik; Bovin, Jonas Kabell; Werling, J.

    2002-01-01

    of particles in the gas is small. Furthermore, the updraft gasifier can utilise fuels with a high content of water. The disadvantage is that the gas has a large content of tar. Tar is a large problem for utilisation of gasification gas in an internal combustion engine, but the external combustion......The combination of thermal gasification and a Stirling engine is an interesting concept for use in small Combined Heat and Power (CHP) plants based on biomass, because the need for gas cleaning is eliminated and problems with fouling of the Stirling engine heater are considerably reduced....... Furthermore, the overall electric efficiency of the system can be improved. At the Technical University of Denmark a small CHP plant based on a Stirling engine and an updraft gasifier has been developed and tested successfully. The advantages of updraft gasifiers are the simplicity and that the amount...

  14. The influence of Ni load and support material on catalysts for the selective catalytic oxidation of ammonia in gasified biomass

    Energy Technology Data Exchange (ETDEWEB)

    Nassos, S.; Elm Svensson, E.; Boutonnet, M.; Jaeraas, S.G. [KTH Royal Institute of Technology, Chemical Engineering and Technology, Chemical Technology, Teknikringen 42, S-10044 Stockholm (Sweden)

    2007-06-18

    The effect of nickel (Ni) load (0, 5 and 10 wt.%) and support material (Ce{sub 0.9}La{sub 0.1}O{sub 2}, Ce{sub 0.9}Zr{sub 0.1}O{sub 2} and {gamma}-Al{sub 2}O{sub 3}), together the amount of oxygen ({lambda} = 0.25 and {lambda} = 0.5) and gas hourly space velocity (50 000, 100 000 and 150 000 h{sup -1}) were investigated for the selective catalytic oxidation of ammonia in gasified biomass. The mixed metal oxide support materials were prepared by microemulsion, whereas the alumina was a commercial product. Ni was added to the different supports by incipient wetness. All the obtained catalysts were characterised by BET and XRD analysis. Cordierite monoliths coated with 20 wt.% catalytic material were tested in a tubular quartz reactor. For simulating the gasified biomass fuel, 500 ppm of NH{sub 3} was added to the fuel. Water was also present during the activity tests, which were carried out between 500 and 750 C. The results from the activity tests at {lambda} = 0.25 and gas hourly space velocity of 100 000 h{sup -1} indicated that the 10 wt.% Ni on Ce{sub 0.9}La{sub 0.1}O{sub 2} was the best catalyst obtaining 65 and 97% N{sub 2} yield at 500 and 750 C, respectively. By increasing {lambda} to 0.5 and decreasing the gas hourly space velocity, the N{sub 2} yield improved considerably at low temperature level (500 C). Moreover, NO{sub x} emissions maintained at low levels depending on the experimental conditions. Constant conversion and negligible carbon deposition were also two other important observations from the mixed metal oxide supported catalysts. On the contrary, all the alumina-based catalysts displayed the lowest performance. (author)

  15. Decreased PCDD/F formation when co-firing a waste fuel and biomass in a CFB boiler by addition of sulphates or municipal sewage sludge

    Energy Technology Data Exchange (ETDEWEB)

    Åmand, Lars-Erik [Chalmers University of Technology, Department of Energy and Environment, Gothenburg (Sweden); Kassman, Håkan, E-mail: hakan.kassman@vattenfall.com [Vattenfall Research and Development AB, Nyköping (Sweden)

    2013-08-15

    Highlights: • Two strategies to reduce PCDD/F formation when co-firing solid recovered fuel (SRF) and biomass. • They were co-combustion with municipal sewage sludge (MSS) and addition of ammonium sulphate. • PCDD/Fs were significantly reduced for a biomass rich in chlorine when adding ammonium sulphate. • MSS had a suppressing effect on PCDD/F formation during co-combustion with SRF. • A link is presented between gaseous alkali chlorides, chlorine in deposits and PCDD/F formation. - Abstract: Polychlorinated dibenzo-p-dioxins (PCDDs) and polychlorinated dibenzofurans (PCDFs) are formed during waste incineration and in waste-to-energy boilers. Incomplete combustion, too short residence times at low combustion temperatures (<700 °C), incineration of electronic waste and plastic waste containing chlorine are all factors influencing the formation of PCDD/Fs in boilers. The impact of chlorine and catalysing metals (such as copper and iron) in the fuel on PCDD/F formation was studied in a 12 MW{sub th} circulating fluidised bed (CFB) boiler. The PCDD/F concentrations in the raw gas after the convection pass of the boiler and in the fly ashes were compared. The fuel types were a so-called clean biomass with low content of chlorine, biomass with enhanced content of chlorine from supply of PVC, and solid recovered fuel (SRF) which is a waste fuel containing higher concentrations of both chlorine, and catalysing metals. The PCDD/F formation increased for the biomass with enhanced chlorine content and it was significantly reduced in the raw gas as well as in the fly ashes by injection of ammonium sulphate. A link, the alkali chloride track, is demonstrated between the level of alkali chlorides in the gas phase, the chlorine content in the deposits in the convection pass and finally the PCDD/F formation. The formation of PCDD/Fs was also significantly reduced during co-combustion of SRF with municipal sewage sludge (MSS) compared to when SRF was fired without MSS

  16. Gasification of waste wood and bark in a dual fluidized bed steam gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Wilk, Veronika [Bioenergy2020+ GmbH, Guessing (Austria); Kitzler, Hannes; Koppatz, Stefan; Pfeifer, Christoph [Vienna University of Technology, Institute of Chemical Engineering, Vienna (Austria); Hofbauer, Hermann [Bioenergy2020+ GmbH, Guessing (Austria); Vienna University of Technology, Institute of Chemical Engineering, Vienna (Austria)

    2011-07-15

    Because of the limited resources of fossil fuels the efficient use of renewable energy is gaining importance. Renewable energy from biomass reduces CO{sub 2} emissions, which is a necessity to protect the global climate. In the dual fluidized bed steam gasifier, wood chips are converted to producer gas, which is further used for heat, power, and/or other product generation very successfully. This work presents alternative feedstocks for this process: biomass wastes, such as waste wood and bark. Waste wood and bark have been gasified successfully and results of these experiments in a pilot plant are presented in this paper. (orig.)

  17. Analysis of Operation Parameters in a Dual Fluidized Bed Biomass Gasifier Integrated with a Biomass Rotary Dryer: Development and Application of a System Model

    Directory of Open Access Journals (Sweden)

    Nargess Puadian

    2014-07-01

    Full Text Available An integrated system model was developed in UniSim Design for a dual fluidized bed (DFB biomass gasifier and a rotary biomass dryer using a combination of user-defined and built-in unit operations. A quasi-equilibrium model was used for modelling biomass steam gasification in the DFB gasifier. The biomass drying was simulated with consideration of mass and energy balances, heat transfer, and dryer’s configuration. After validation using experimental data, the developed system model was applied to investigate: (1 the effects of gasification temperature and steam to biomass (S/B ratio on the gasification performance; (2 the effect of air supplied to the fast fluidized bed (FFB reactor and feed biomass moisture content on the integrated system performance, energy and exergy efficiencies. It was found that gasification temperature and S/B ratio have positive effects on the gasification yields; a H2/CO ratio of 1.9 can be achieved at the gasification temperature of 850 °C with a S/B ratio of 1.2. Consumption of excessive fuel in the system at higher biomass feed moisture content can be compensated by the heat recovery such as steam generation while it has adverse impact on exergy efficiency of the system.

  18. Gasification of solid waste — potential and application of co-current moving bed gasifiers

    NARCIS (Netherlands)

    Groeneveld, M.J.; van Swaaij, Willibrordus Petrus Maria

    1979-01-01

    A review is given of gasification processes for solid fuels with special emphasis on waste gasification. Although the co-current moving bed gasifier has not been under consideration for a long time, it offers interesting possibilities for waste gasification. Some operational data are given. Two

  19. Phosphorus leaching from soils amended with thermally gasified piggery waste ash

    DEFF Research Database (Denmark)

    Kuligowski, Ksawery; Poulsen, Tjalfe

    2009-01-01

    from anaerobically digested, thermally gasified (GA) and incinerated (IA) piggery waste has been tested using water loads ranging from 0.1 to 200 ml g−1. Leaching of P from soil columns amended with GA was investigated for one P application rate (205 kg P ha−1 corresponding to 91 mg P kg−1 soil dry...

  20. Ground tests of 120 kW(heat) biomass fired gasifier diesel installation

    Energy Technology Data Exchange (ETDEWEB)

    Zyssin, L.V.; Maronet, I.J.; Morshin, V.N. [Energotechnology Ltd., St. Petersburg (Russian Federation)

    1996-12-31

    For the 1 MW and less power range diesel gasifier power plants could be considered as one of the main energy sources. The brief information about works carried out in Russia according to this direction is presented. Data of preliminary tests for gas diesel installations are presented. (orig.)

  1. Sustainable model for financial viability of decentralized biomass gasifier based power projects

    NARCIS (Netherlands)

    Palit, D.; Malhotra, R.; Kumar, Atul

    2011-01-01

    This paper made a modest attempt for designing a sustainable model for financial viability of biomass gasifier power projects for enhancing electricity access in India and other developing countries. For long term sustainability of distributed generation projects in remote rural areas, viability

  2. Shredded Waste Downdraft Gasifier for Overseas Contingency Operations Waste-to-Energy Conversion

    Science.gov (United States)

    2015-06-01

    moisture contents and (b) char/ash from a downdraft gasifier. Data was obtained for both unpolished and polished refractory that will be used as the walls ...bases (FOBs) and combat outposts (COPs) present significant challenges with respect to fuel and water supply, and waste footprint management. Waste to...38 5.1.1.4 Wall Friction Tests

  3. A Critical Review of Mineral Matter Related Issues during Gasification of Coal in Fixed, Fluidized, and Entrained Flow Gasifiers

    Directory of Open Access Journals (Sweden)

    Vijayaragavan Krishnamoorthy

    2015-09-01

    Full Text Available Gasification of coal is gaining more popularity due to its clean operation, and its ability to generate products for various markets. However, these technologies are not widely commercialized due to reliability and economic issues. Mineral matter in coal plays an important role in affecting the availability/reliability of a gasifier. Agglomeration in the bed, slag mobility and blockage of the syngas exit section are some of the operations related concerns in fixed-bed gasifiers, while ash deposition and sudden defluidization are the major concerns in fluidized bed gasifiers. In the case of entrained flow gasifiers, syngas cooler fouling and blockage, corrosion and erosion of refractory, and slag mobility are some of the major issues affecting the operations and the reliability of the gasifier. This review is aimed at critically examining various mineral matter related issues contributing to the operation and reliability problems in three types of generic gasifiers (fixed bed, fluidized bed and entrained flow gasifiers. Based on the review, some strategies to counter the potential mineral matter related issues are presented.

  4. Particle size distribution of ashes and the behaviour of metals when firing Salix in a circulating fluidized bed boiler (CFB); Askans partikelfraktionsfoerdelning och metallernas beteende vid eldning av Salix i en CFB-panna

    Energy Technology Data Exchange (ETDEWEB)

    Sfiris, G.; Johansson, A. [Vattenfall Utveckling AB, Stockholm (Sweden); Valmari, T.; Kauppinen, E.; Pyykoenen, J.; Lyyraenen, J. [VTT Technical Research Centre of Finland, Espoo (Finland)

    1999-07-01

    This project is part of the Ash Recovery Programme aimed at establishing the environmental, technical and financial preconditions for returning wood ash to the forest. The programme is funded jointly by NUTEK, Sydkraft and Vattenfall. This report summarises the results of the experimental and modelling work to study the behaviour of the metals (especially Cd and K), after burning Salix in a 3-12 MW Circulating Fluidized Bed (CFB) boiler. The purpose of the study was to determine, using the experimental data, where cadmium and potassium condense, on what size particles they condense, and the decisive parameters governing these processes. Measurements of the fly ash particle size distribution carried out with a Berner Low Pressure Impactor (BLPI), coupled to a pre-cyclone. Samples were collected from three points: in the convection path at 650 deg C, after the convection path but before the secondary cyclone (160 deg C), and after the bag house (150 deg C). Wet chemical sampling was made for Cd, K, Zn and Pb, with three types of sampling equipment: collection of both particles and gas, collection of particles only, and analysis of the gas phase only. Analysis was made of samples from two places in the convection path (650 deg C and 250 deg C). Samples of bed material, bottom ash and fly ash have been subjected to scanning electron microscopy (SEM), and in addition a few fly ash particles, sampled after the convection path, were subjected to energy dispersive X-ray analysis (EDX). Based on experimental results, modelling work was carried out with an equilibrium model and with a general aerosol computer model ABC (Aerosol Behaviour in Combustion)

  5. Steam gasification of wood biomass in a fluidized biocatalytic system bed gasifier: A model development and validation using experiment and Boubaker Polynomials Expansion Scheme BPES

    Directory of Open Access Journals (Sweden)

    Luigi Vecchione

    2015-07-01

    Full Text Available One of the most important issues in biomass biocatalytic gasification is the correct prediction of gasification products, with particular attention to the Topping Atmosphere Residues (TARs. In this work, performedwithin the European 7FP UNIfHY project, we develops and validate experimentally a model which is able of predicting the outputs,including TARs, of a steam-fluidized bed biomass gasifier. Pine wood was chosen as biomass feedstock: the products obtained in pyrolysis tests are the relevant model input. Hydrodynamics and chemical properties of the reacting system are considered: the hydrodynamic approach is based on the two phase theory of fluidization, meanwhile the chemical model is based on the kinetic equations for the heterogeneous and homogenous reactions. The derived differentials equations for the gasifier at steady state were implemented MATLAB. Solution was consecutively carried out using the Boubaker Polynomials Expansion Scheme by varying steam/biomass ratio (0.5-1 and operating temperature (750-850°C.The comparison between models and experimental results showed that the model is able of predicting gas mole fractions and production rate including most of the representative TARs compounds

  6. Computational fluid dynamics assessment: Volume 1, Computer simulations of the METC (Morgantown Energy Technology Center) entrained-flow gasifier: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Celik, I.; Chattree, M.

    1988-07-01

    An assessment of the theoretical and numerical aspects of the computer code, PCGC-2, is made; and the results of the application of this code to the Morgantown Energy Technology Center (METC) advanced gasification facility entrained-flow reactor, ''the gasifier,'' are presented. PCGC-2 is a code suitable for simulating pulverized coal combustion or gasification under axisymmetric (two-dimensional) flow conditions. The governing equations for the gas and particulate phase have been reviewed. The numerical procedure and the related programming difficulties have been elucidated. A single-particle model similar to the one used in PCGC-2 has been developed, programmed, and applied to some simple situations in order to gain insight to the physics of coal particle heat-up, devolatilization, and char oxidation processes. PCGC-2 was applied to the METC entrained-flow gasifier to study numerically the flash pyrolysis of coal, and gasification of coal with steam or carbon dioxide. The results from the simulations are compared with measurements. The gas and particle residence times, particle temperature, and mass component history were also calculated and the results were analyzed. The results provide useful information for understanding the fundamentals of coal gasification and for assessment of experimental results performed using the reactor considered. 69 refs., 35 figs., 23 tabs.

  7. Microemulsion-prepared Ni catalysts supported on cerium-lanthanum oxide for the selective catalytic oxidation of ammonia in gasified biomass

    Energy Technology Data Exchange (ETDEWEB)

    Nassos, S.; Svensson, E. Elm; Nilsson, M.; Boutonnet, M.; Jaeraas, S. [KTH, Royal Institute of Technology, Chemical Engineering and Technology, Chemical Technology, Teknikringen 42, S-10044 Stockholm (Sweden)

    2006-04-18

    Nickel (Ni) catalysts supported on cerium-lanthanum oxide were prepared by two different preparation techniques and have been tested in the temperature range of 500-750{sup o}C for selective catalytic oxidation of ammonia to nitrogen in gasified biomass. The two different catalyst preparation methods used are the conventional and the microemulsion (water-in-oil). The effect on catalytic activity of different Ni loadings was also tested in combination with the preparation method. Catalyst characterisation was focused on BET and XRD analysis. Cordierite monoliths were used in a tubular quartz reactor for the purpose of the activity tests. For simulating the gasified biomass fuel, 400ppm NH{sub 3} was added to the fuel. Water was also present during the activity tests, which were carried out at fuel rich conditions. Results showed that the microemulsion-prepared catalysts obtained higher performance than the conventional ones, with the best catalyst reaching 98% ammonia conversion and 99% nitrogen selectivity at 750{sup o}C. The more the Ni supported on the catalyst, the higher the catalytic activity. Constant conversion and negligible carbon deposition were two other important characteristics for the microemulsion-prepared catalysts. (author)

  8. Gasification of bio-oil: Effects of equivalence ratio and gasifying agents on product distribution and gasification efficiency.

    Science.gov (United States)

    Zheng, Ji-Lu; Zhu, Ming-Qiang; Wen, Jia-Long; Sun, Run-Cang

    2016-07-01

    Bio-oil derived from fast pyrolysis of rice husk was gasified for producing gas. The effectiveness of equivalence ratio and gasifying agents on the gas composition, ratio of H2/CO, tar amount, low heating value, degree of oxidation and cold gas efficiency of the gas were comprehensively investigated. Under different equivalence ratios and gasifying agents, the gases can be used as synthesis gas for Fischer-Tropsch synthesis, fuel gas for gas turbines in a power plant and reducing gas for ore reduction, respectively. The H2 concentration, CO level and cold gas efficiency of the resulted gas derived from gasification of bio-oil were significantly higher, while tar content was remarkably lower than those derived from gasification of solid biomass using the same equivalent ratio value and gasifying agent. In short, bio-oil gasification is economically feasible for large scale production of fuels and chemicals. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. 140 g H{sub 2}/kg biomass d.a.f. by a CO-shift reactor downstream from a FB biomass gasifier and a catalytic steam reformer

    Energy Technology Data Exchange (ETDEWEB)

    Corella, Jose; Molina, Gregorio; Toledo, Jose M. [Department of Chemical Engineering, University ' ' Complutense' ' of Madrid, 28040 Madrid (Spain); Aznar, Maria P.; Caballero, Miguel A. [Chemical and Environmental Engineering Department, CPS, 3 Maria de Luna st., University of Saragossa, 50018 Saragossa (Spain)

    2008-04-15

    The effect of adding a CO-shift reactor downstream from a fluidized bed biomass gasifier and a steam reforming catalytic reactor is studied in this paper. The upstream gasifier was of small pilot plant scale, 10 kg biomass/h. Therefore, the downstream catalytic reactors, steam reformer and CO-shift, operated under a real gasification gas. The gasifying agent used was H{sub 2}O-O{sub 2} mixtures. The CO-shift catalytic reactor used had one high (HT) and one low temperature (LT) adiabatic beds. Two commercial catalysts were used throughout the process. CO-conversions (eliminations) were higher than 90% and a H{sub 2}-content as high as 73 vol%, dry basis, were obtained by the CO-shift system. This H{sub 2} content is equivalent to a yield of 140gH{sub 2}/kg biomass d.a.f. The CO conversion and the increase (up to 14 vol%) of the H{sub 2} content, correlate well with the molar steam/CO ratio in the gasification gas at the inlet of the HT bed. (author)

  10. Uncertainty Quantification Analysis of Both Experimental and CFD Simulation Data of a Bench-scale Fluidized Bed Gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Shahnam, Mehrdad [National Energy Technology Lab. (NETL), Morgantown, WV (United States). Research and Innovation Center, Energy Conversion Engineering Directorate; Gel, Aytekin [ALPEMI Consulting, LLC, Phoeniz, AZ (United States); Subramaniyan, Arun K. [GE Global Research Center, Niskayuna, NY (United States); Musser, Jordan [National Energy Technology Lab. (NETL), Morgantown, WV (United States). Research and Innovation Center, Energy Conversion Engineering Directorate; Dietiker, Jean-Francois [West Virginia Univ. Research Corporation, Morgantown, WV (United States)

    2017-10-02

    that the predicted syngas composition is strongly affected not only by the steam-to-oxygen ratio (which was observed in experiments as well) but also by variation in the coal flow rate and particle diameter (which was not observed in experiments). The carbon monoxide mole fraction is underpredicted at lower steam-to-oxygen ratios and overpredicted at higher steam-to-oxygen ratios. The opposite trend is observed for the carbon dioxide mole fraction. These discrepancies are attributed to either excessive segregation of the phases that leads to the fuel-rich or -lean regions or alternatively the selection of reaction models, where different reaction models and kinetics can lead to different syngas compositions throughout the gasifier. To improve quality of numerical models used, the effect that uncertainties in reaction models for gasification, char oxidation, carbon monoxide oxidation, and water gas shift will have on the syngas composition at different grid resolution, along with bed temperature were investigated. The global sensitivity analysis showed that among various reaction models employed for water gas shift, gasification, char oxidation, the choice of reaction model for water gas shift has the greatest influence on syngas composition, with gasification reaction model being second. Syngas composition also shows a small sensitivity to temperature of the bed. The hydrodynamic behavior of the bed did not change beyond grid spacing of 18 times the particle diameter. However, the syngas concentration continued to be affected by the grid resolution as low as 9 times the particle diameter. This is due to a better resolution of the phasic interface between the gases and solid that leads to stronger heterogeneous reactions. This report is a compilation of three manuscripts published in peer-reviewed journals for the series of studies mentioned above.

  11. Plasma gasification of refuse derived fuel in a single-stage system using different gasifying agents.

    Science.gov (United States)

    Agon, N; Hrabovský, M; Chumak, O; Hlína, M; Kopecký, V; Masláni, A; Bosmans, A; Helsen, L; Skoblja, S; Van Oost, G; Vierendeels, J

    2016-01-01

    The renewable evolution in the energy industry and the depletion of natural resources are putting pressure on the waste industry to shift towards flexible treatment technologies with efficient materials and/or energy recovery. In this context, a thermochemical conversion method of recent interest is plasma gasification, which is capable of producing syngas from a wide variety of waste streams. The produced syngas can be valorized for both energetic (heat and/or electricity) and chemical (ammonia, hydrogen or liquid hydrocarbons) end-purposes. This paper evaluates the performance of experiments on a single-stage plasma gasification system for the treatment of refuse-derived fuel (RDF) from excavated waste. A comparative analysis of the syngas characteristics and process yields was done for seven cases with different types of gasifying agents (CO2+O2, H2O, CO2+H2O and O2+H2O). The syngas compositions were compared to the thermodynamic equilibrium compositions and the performance of the single-stage plasma gasification of RDF was compared to that of similar experiments with biomass and to the performance of a two-stage plasma gasification process with RDF. The temperature range of the experiment was from 1400 to 1600 K and for all cases, a medium calorific value syngas was produced with lower heating values up to 10.9 MJ/Nm(3), low levels of tar, high levels of CO and H2 and which composition was in good agreement to the equilibrium composition. The carbon conversion efficiency ranged from 80% to 100% and maximum cold gas efficiency and mechanical gasification efficiency of respectively 56% and 95%, were registered. Overall, the treatment of RDF proved to be less performant than that of biomass in the same system. Compared to a two-stage plasma gasification system, the produced syngas from the single-stage reactor showed more favourable characteristics, while the recovery of the solid residue as a vitrified slag is an advantage of the two-stage set-up. Copyright

  12. Comparison of ORC Turbine and Stirling Engine to Produce Electricity from Gasified Poultry Waste

    Directory of Open Access Journals (Sweden)

    Franco Cotana

    2014-08-01

    Full Text Available The Biomass Research Centre, section of CIRIAF, has recently developed a biomass boiler (300 kW thermal powered, fed by the poultry manure collected in a nearby livestock. All the thermal requirements of the livestock will be covered by the heat produced by gas combustion in the gasifier boiler. Within the activities carried out by the research project ENERPOLL (Energy Valorization of Poultry Manure in a Thermal Power Plant, funded by the Italian Ministry of Agriculture and Forestry, this paper aims at studying an upgrade version of the existing thermal plant, investigating and analyzing the possible applications for electricity production recovering the exceeding thermal energy. A comparison of Organic Rankine Cycle turbines and Stirling engines, to produce electricity from gasified poultry waste, is proposed, evaluating technical and economic parameters, considering actual incentives on renewable produced electricity.

  13. Validation of Continuous CHP Operation of a Two-Stage Biomass Gasifier

    DEFF Research Database (Denmark)

    Ahrenfeldt, Jesper; Henriksen, Ulrik Birk; Jensen, Torben Kvist

    2006-01-01

    The Viking gasification plant at the Technical University of Denmark was built to demonstrate a continuous combined heat and power operation of a two-stage gasifier fueled with wood chips. The nominal input of the gasifier is 75 kW thermal. To validate the continuous operation of the plant, a 9-day...... measurement campaign was performed. The campaign verified a stable operation of the plant, and the energy balance resulted in an overall fuel to gas efficiency of 93% and a wood to electricity efficiency of 25%. Very low tar content in the producer gas was observed: only 0.1 mg/Nm3 naphthalene could...... be measured in raw gas. A stable engine operation on the producer gas was observed, and very low emissions of aldehydes, N2O, and polycyclic aromatic hydrocarbons were measured....

  14. Gasification of rice straw in a fluidized-bed gasifier for syngas application in close-coupled boiler-gasifier systems.

    Science.gov (United States)

    Calvo, L F; Gil, M V; Otero, M; Morán, A; García, A I

    2012-04-01

    The feasibility and operation performance of the gasification of rice straw in an atmospheric fluidized-bed gasifier was studied. The gasification was carried out between 700 and 850 °C. The stoichiometric air-fuel ratio (A/F) for rice straw was 4.28 and air supplied was 7-25% of that necessary for stoichiometric combustion. Mass and power balances, tar concentration, produced gas composition, gas phase ammonia, chloride and potassium concentrations, agglomeration tendencies and gas efficiencies were assessed. Agglomeration was avoided by replacing the normal alumina-silicate bed by a mixture of alumina-silicate sand and MgO. It was shown that it is possible to produce high quality syngas from the gasification of rice straw. Under the experimental conditions used, the higher heating value (HHV) of the produced gas reached 5.1 MJ Nm(-3), the hot gas efficiency 61% and the cold gas efficiency 52%. The obtained results prove that rice straw may be used as fuel for close-coupled boiler-gasifier systems. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Experimental Gasification of Biomass in an Updraft Gasifier with External Recirculation of Pyrolysis Gases

    Directory of Open Access Journals (Sweden)

    Adi Surjosatyo

    2014-01-01

    Full Text Available The updraft gasifier is a simple type of reactor for the gasification of biomass that is easy to operate and has high conversion efficiency, although it produces high levels of tar. This study attempts to observe the performance of a modified updraft gasifier. A modified updraft gasifier that recirculates the pyrolysis gases from drying zone back to the combustion zone and gas outlet at reduction zone was used. In this study, the level of pyrolysis gases that returned to the combustion zone was varied, and as well as measurements of gas composition, lower heating value and tar content. The results showed that an increase in the amount of pyrolysis gases that returned to the combustion zone resulted in a decrease in the amount of tar produced. An increase in the amount of recirculated gases tended to increase the concentrations of H2 and CH4 and reduce the concentration of CO with the primary (gasification air flow held constant. Increasing the primary air flow tended to increase the amount of CO and decrease the amount of H2. The maximum of lower heating value was 4.9 MJ/m3.

  16. Test of different biomass into the IISc open-top co-current gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Giordano, P. [Xylowatt SA, Chatel-St-Denis (Switzerland); Hasler, P. [Verenum SA, Zuerich (Switzerland); Dasappa, S. [Indian Institute of Science, Combustion Gasification and Propulsion Laboratory, Bangalore (India)

    2001-07-01

    This report made for the Swiss Federal Office of Energy (SFOE) describes the efforts made to demonstrate the technical feasibility of combined heat and power generation using wood gasification. The report describes a project involving a small open-top gasifier based on a design realised by the Indian Institute of Science (IISc). The tests made with various wood fuels such as clean wood chips, waste-wood chips, pecan nut shells, crushed oak briquettes, wood pellets, coffee hull pellets and chicken litter pellets are described and the results of measurements made concerning particulate matter, tar and certain organic compounds are presented. The discussion of the results shows that certain types of biomass can easily be used as a fuel for the small gasifier whereas others, such as coffee hull pellets, are less suitable. The report suggests that other possible fuels, such as olive and apricot stones, sludge from waste water treatment plant or plastic residue from refuse treatment should be tested in the gasifier. These tests could also provide the opportunity of testing appropriate gas treatment equipment at the same time.

  17. A study on a multi-stage hybrid gasifier-engine system

    Energy Technology Data Exchange (ETDEWEB)

    Bhattacharya, S.C.; San Shwe Hla; Hoang-Luang Pham [Asian Institute of Technology, Pathumthani (Thailand). Energy Program

    2001-12-01

    This paper presents the results of a study on a multi-stage hybrid biomass-charcoal gasification to produce low tar content gas for engine application using coconut shell as a fuel. The performance of a gasifier-engine system consisting of the hybrid biomass-charcoal gasifier, a gas cleaning/cooling system and a diesel engine is also discussed. The lowest tar content found in hybrid coconut shell-charcoal gasification was 28 mgNm{sup -3}. Using a spray tower, producer gas could be cooled down to 40{sup o}C; almost tar-free gas was obtained after cooling the producer gas from the hybrid gasifier system. A three-cylinder Perkins diesel engine was tested at a constant speed of 1500 rpm on diesel alone and dual fuel modes of operation. A maximum of 81% of the total heat energy input was replaced by the producer gas at an electricity generation of 11.44 kWe. (author)

  18. Hot-gas desulfurization. II. Use of gasifier ash in a fluidized-bed process. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Schrodt, J.T.

    1981-02-01

    Three gasifier coal ashes were used as reactant/sorbents in batch fluidized-beds to remove hydrogen sulfide from hot, made-up fuel gases. It is predominantly the iron oxide in the ash that reacts with and removes the hydrogen sulfide; the sulfur reappears in ferrous sulfide. Sulfided ashes were regenerated by hot, fluidizing streams of oxygen in air; the sulfur is recovered as sulfur dioxide, exclusively. Ash sorption efficiency and sulfur capacity increase and stabilize after several cycles of use. These two parameters vary directly with the iron oxide content of the ash and process temperature, but are independent of particle size in the range 0.01 - 0.02 cm. A western Kentucky No. 9 ash containing 22 weight percent iron as iron oxide sorbed 4.3 weight percent sulfur at 1200/sup 0/F with an ash sorption efficiency of 0.83 at ten percent breakthrough. A global, fluidized-bed, reaction rate model was fitted to the data and it was concluded that chemical kinetics is the controlling mechanism with a predicted activation energy of 19,600 Btu/lb mol. Iron oxide reduction and the water-gas-shift reaction were two side reactions that occurred during desulfurization. The regeneration reaction occurred very rapidly in the fluid-bed regime, and it is suspected that mass transfer is the controlling phenomenon.

  19. Slag Behavior in Gasifiers. Part II: Constitutive Modeling of Slag

    Directory of Open Access Journals (Sweden)

    Mehrdad Massoudi

    2013-02-01

    Full Text Available The viscosity of slag and the thermal conductivity of ash deposits are among two of the most important constitutive parameters that need to be studied. The accurate formulation or representations of the (transport properties of coal present a special challenge of modeling efforts in computational fluid dynamics applications. Studies have indicated that slag viscosity must be within a certain range of temperatures for tapping and the membrane wall to be accessible, for example, between 1,300 °C and 1,500 °C, the viscosity is approximately 25 Pa·s. As the operating temperature decreases, the slag cools and solid crystals begin to form. Since slag behaves as a non-linear fluid, we discuss the constitutive modeling of slag and the important parameters that must be studied. We propose a new constitutive model, where the stress tensor not only has a yield stress part, but it also has a viscous part with a shear rate dependency of the viscosity, along with temperature and concentration dependency, while allowing for the possibility of the normal stress effects. In Part I, we reviewed, identify and discuss the key coal ash properties and the operating conditions impacting slag behavior.

  20. Slag Behavior in Gasifiers. Part II: Constitutive Modeling of Slag

    Energy Technology Data Exchange (ETDEWEB)

    Massoudi, Mehrdad [National Energy Technology Laboratory; Wang, Ping

    2013-02-07

    The viscosity of slag and the thermal conductivity of ash deposits are among two of the most important constitutive parameters that need to be studied. The accurate formulation or representations of the (transport) properties of coal present a special challenge of modeling efforts in computational fluid dynamics applications. Studies have indicated that slag viscosity must be within a certain range of temperatures for tapping and the membrane wall to be accessible, for example, between 1,300 °C and 1,500 °C, the viscosity is approximately 25 Pa·s. As the operating temperature decreases, the slag cools and solid crystals begin to form. Since slag behaves as a non-linear fluid, we discuss the constitutive modeling of slag and the important parameters that must be studied. We propose a new constitutive model, where the stress tensor not only has a yield stress part, but it also has a viscous part with a shear rate dependency of the viscosity, along with temperature and concentration dependency, while allowing for the possibility of the normal stress effects. In Part I, we reviewed, identify and discuss the key coal ash properties and the operating conditions impacting slag behavior.

  1. "A High Speed Laser Profiling Device for Refractory Lininig Thickness Measurements In a Gasifier with Cross-Cut to the Metals, Forest Products, Chemical and Power Generation Industries"

    Energy Technology Data Exchange (ETDEWEB)

    Michel Bonin; Tom Harvill; Jared Hoog; Don Holve; Alan Alsing; Bob Clark; Steve Hrivnak

    2007-11-01

    Process Metrix began this project with the intent of modifying an existing ranging system and combining the same with a specially designed optical scanner to yield three dimensional range images that could be used to determine the refractory lining thickness in a gasifier. The goal was to make these measurements during short outages while the gasifier was at or near operating temperature. Our initial estimates of the photon counts needed for the modulation-based range finder were optimistic, and we were forced to undertake a redesign of the range finder portion of the project. This ultimately created significant and unanticipated time delays that were exacerbated when Acuity Technologies, the subcontractor responsible for delivering the redesigned range finder, failed to deliver electrical components capable of meeting the specific range error requirements needed for accurate lining thickness measurement. An extensive search for an alternate, off-the-shelf solution was unsuccessful, and Process Metrix was forced to undertake the electronics development internally without project funds. The positive outcome of this effort is a documented set of range finder electronics that have exceptional accuracy, simplicity, temperature stability and detection limit; in sum a package perfectly suited to the measurement requirements and within our control. It is unfortunate yet understandable, given the time delays involved in reaching this milestone, that the Department of Energy decided not to continue the project to completion. The integration of this electronics set into the optomechanical hardware also developed within the scope of the project remains as follow-on project that Process Metrix will finish within the calendar year 2008. Testing in the gasifier is, at this point, not certain pending the award of additional funding needed for field trials. Eastman, our industrial partner in this project, remains interested in evaluating a finished system, and working together we

  2. Model development and validation: Co-combustion of residual char, gases and volatile fuels in the fast fluidized combustion chamber of a dual fluidized bed biomass gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Priyanka Kaushal; Tobias Proell; Hermann Hofbauer [Vienna University of Technology, Vienna (Austria). Institute of Chemical Engineering

    2007-12-15

    A one-dimensional steady state model has been developed for the combustion reactor of a dual fluidized bed biomass steam gasification system. The combustion reactor is operated as fast fluidized bed (riser) with staged air introduction (bottom, primary and secondary air). The main fuel i.e., residual biomass char (from the gasifier), is introduced together with the circulating bed material at the bottom of the riser. The riser is divided into two zones: bottom zone (modelled according to modified two phase theory) and upper zone (modelled with core-annulus approach). The model consists of sub-model for bed hydrodynamic, conversion and conservation. Biomass char is assumed to be a homogeneous matrix of C, H and O and is modelled as partially volatile fuel. The exit gas composition and the temperature profile predicted by the model are in good agreement with the measured value. 34 refs., 8 figs., 3 tabs.

  3. Analisis Energi dan Sebaran Suhu pada Gasifier Unggun Tetap

    Directory of Open Access Journals (Sweden)

    Yogi Sirodz Gaos

    2007-06-01

    Full Text Available Performance test of Imbert Downdraft Gesifier by using cyclone as an auxiliary for tar filtering has been conducted with three kinds of feeding chips, i. e; borneo wood, tamarind wood and leucena wood. The research has been developed to support as an energy source for combined heat power generation. Gesifier will be coupled to diesel generating set and waste heat from the exhaust gas will be used as energy source for an adsorption type refrigeration system. The test had produced the best combustible gas with the chemical composition CO = 55,59 %, CH4 = 0,14 %, C2H6 = 0,3 % and C3H8= 0, 08 %. The maximum temperature 1142 oC has been found in oxidation zone based on the leucena wood test, meanwhile the calculation result of energy availability for the combustible gas was 60,39 kW and specific energy availability was 0,082 kg/kWh. The test result of temperature distribution along the reactor compare to numerical solution of mathemathicai modelling has got the similar curve.

  4. Hybrid Molten Bed Gasifier for High Hydrogen Syngas Production

    Energy Technology Data Exchange (ETDEWEB)

    Rue, David [Gas Technology Institute, Des Plaines, IL (United States)

    2017-05-23

    was stable over the full oxygen to fuel firing range (0.8 to 1.05 of fuel gas stoichiometry) and with all fuel gases (natural gas and two syngas compositions), with steam, and without steam. The lower Btu content of the syngases presented no combustion difficulties. The molten bed was stable throughout testing. The molten bed was easily established as a bed of molten glass. As the composition changed from glass cullet to cullet with slag, no instabilities were encountered. The bed temperature and product syngas temperature remained stable throughout testing, demonstrating that the bed serves as a good heat sink for the gasification process. Product syngas temperature measured above the bed was stable at ~1600ºF. Testing found that syngas quality measured as H2/CO ratio increased with decreasing oxygen to fuel gas stoichiometric ratio, higher steam to inlet carbon ratio, higher temperature, and syngas compared with natural gas. The highest H2/CO ratios achieved were in the range of 0.70 to 0.78. These values are well below the targets of 1.5 to 2.0 that were expected and were predicted by modeling. The team, however, is encouraged that the HMB process can and will achieve H2/CO ratios up to 2.0. Changes needed include direct injection of coal into the molten bed of slag to prevent coal particle bypass into the product gas stream, elevation of the molten bed temperature to approximately 2500ºF, and further decrease of the oxygen to fuel gas ratio to well below the 0.85 minimum ratio used in the testing in this project.

  5. Development of standardized air-blown coal gasifier/gas turbine concepts for future electric power systems. Volume 2, Appendix A: Fixed bed gasifier and sulfur sorbent regeneration subsystem computer model development: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Blough, E.; Russell, W.; Leach, J.W.

    1990-08-01

    Computer models have been developed for evaluating conceptual designs of integrated coal gasification combined cycle power plants. An overall system model was developed for performing thermodynamic cycle analyses, and detailed models were developed for predicting performance characteristics of fixed bed coal gasifiers and hot gas clean up subsystem components. The overall system model performs mass and energy balances and does chemical equilibrium analyses to determine the effects of changes in operating conditions, or to evaluate proposed design changes. An existing plug flow model for fixed bed gasifiers known as the Wen II model was revised and updated. Also, a spread sheet model of zinc ferrite sulfur sorbent regeneration subsystem was developed. Parametric analyses were performed to determine how performance depends on variables in the system design. The work was done to support CRS Sirrine Incorporated in their study of standardized air blown coal gasifier gas turbine concepts.

  6. Techno-economic assessment of a solar PV, fuel cell, and biomass gasifier hybrid energy system

    Directory of Open Access Journals (Sweden)

    Anand Singh

    2016-11-01

    Full Text Available The interest of power is expanding step by step all through the world. Because of constrained measure of fossil fuel, it is vital to outline some new non-renewable energy frameworks that can diminish the reliance on ordinary energy asset. A hybrid off-grid renewable energy framework might be utilized to reduction reliance on the traditional energy assets. Advancement of crossover framework is a procedure to choose the best mix of part and there cost that can give shabby, solid and successful option energy resource. In this paper sun oriented photovoltaic, fuel cell, biomass gasifier generator set, battery backup and power conditioning unit have been simulated and optimized for educational institute, energy centre, Maulana Azad National Institute of Technology, Bhopal in the Indian state of Madhya Pradesh. The area of the study range on the guide situated of 23°12′N latitude and 77°24′E longitude. In this framework, the essential wellspring of power is sun based solar photovoltaic system and biomass gasifier generator set while fuel cell and batteries are utilized as reinforcement supply. HOMER simulator has been utilized to recreate off the grid and it checks the specialized and financial criteria of this hybrid energy system. The execution of every segment of this framework is dissected lastly delicate examination has been performing to enhance the mixture framework at various conditions. In view of the recreation result, it is found that the cost of energy (COE of a biomass gasifier generator set, solar PV and fuel cell crossover energy system has been found to be 15.064 Rs/kWh and complete net present cost Rs.51,89003. The abundance power in the proposed framework is observed to be 36 kWh/year with zero rates unmet electrical burden.

  7. Pollutant emissions and energy efficiency of Chinese gasifier cooking stoves and implications for future intervention studies.

    Science.gov (United States)

    Carter, Ellison M; Shan, Ming; Yang, Xudong; Li, Jiarong; Baumgartner, Jill

    2014-06-03

    Household air pollution from solid fuel combustion is the leading environmental health risk factor globally. In China, almost half of all homes use solid fuel to meet their household energy demands. Gasifier cookstoves offer a potentially affordable, efficient, and low-polluting alternative to current solid fuel combustion technology, but pollutant emissions and energy efficiency performance of this class of stoves are poorly characterized. In this study, four Chinese gasifier cookstoves were evaluated for their pollutant emissions and efficiency using the internationally recognized water boiling test (WBT), version 4.1.2. WBT performance indicators included PM2.5, CO, and CO2 emissions and overall thermal efficiency. Laboratory investigation also included evaluation of pollutant emissions (PM2.5 and CO) under stove operating conditions designed to simulate common Chinese cooking practices. High power average overall thermal efficiencies ranged from 22 to 33%. High power average PM2.5 emissions ranged from 120 to 430 mg/MJ of useful energy, and CO emissions ranged from 1 to 30 g/MJ of useful energy. Compared with several widely disseminated "improved" cookstoves selected from the literature, on average, the four Chinese gasifier cookstoves had lower PM2.5 emissions and higher CO emissions. The recent International Organization for Standardization (ISO) International Workshop Agreement on tiered cookstove ranking was developed to help classify stove performance and identify the best-performing stoves. The results from this study highlight potential ways to further improve this approach. Medium power stove operation emitted nearly twice as much PM2.5 as was emitted during high power stove operation, and the lighting phase of a cooking event contributed 45% and 34% of total PM2.5 emissions (combined lighting and cooking). Future approaches to laboratory-based testing of advanced cookstoves could improve to include greater differentiation between different modes of

  8. Hydrodynamics in a cold-model jetting fluidized-bed gasifier with a binary mixture

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, K.; Zhang, J.; Zhang, B. [University of Petroleum, Beijing (China)

    2004-12-01

    The average properties of binary system defined by Goossens and others are incorporated into an Eulerian-Eulerian Computational Fluid Dynamics (CFD) model for simulating the hydrodynamics in a cold model of jetting fluidized bed gasifiers. Some of the essential hydrodynamic parameters, including gas - and solid-velocity profiles, time-averaged voidage profiles, and jet penetration height, are investigated in this paper. These results show the CFD approach is an effective tool for predicting hydrodynamics in jetting fluidized beds with multi-component mixture. 15 refs., 6 figs., 3 tabs.

  9. Fixed-bed gasifier and cleanup system engineering summary report through Test Run No. 100

    Energy Technology Data Exchange (ETDEWEB)

    Pater, K. Jr.; Headley, L.; Kovach, J.; Stopek, D.

    1984-06-01

    The state-of-the-art of high-pressure, fixed-bed gasification has been advanced by the many refinements developed over the last 5 years. A novel full-flow gas cleanup system has been installed and tested to clean coal-derived gases. This report summarizes the results of tests conducted on the gasifier and cleanup system from its inception through 1982. Selected process summary data are presented along with results from complementary programs in the areas of environmental research, process simulation, analytical methods development, and component testing. 20 references, 32 figures, 42 tables.

  10. Development of standardized air-blown coal gasifier/gas turbine concepts for future electric power systems

    Energy Technology Data Exchange (ETDEWEB)

    Blough, E.; Russell, W.; Leach, J.W.

    1990-08-01

    Computer models have been developed for evaluating conceptual designs of integrated coal gasification combined cycle power plants. An overall system model was developed for performing thermodynamic cycle analyses, and detailed models were developed for predicting performance characteristics of fixed bed coal gasifiers and hot gas clean up subsystem components. The overall system model performs mass and energy balances and does chemical equilibrium analyses to determine the effects of changes in operating conditions, or to evaluate proposed design changes. An existing plug flow model for fixed bed gasifiers known as the Wen II model was revised and updated. Also, a spread sheet model of zinc ferrite sulfur sorbent regeneration subsystem was developed. Parametric analyses were performed to determine how performance depends on variables in the system design. The work was done to support CRS Sirrine Incorporated in their study of standardized air blown coal gasifier gas turbine concepts.

  11. Thermodynamic Model of a Very High Efficiency Power Plant based on a Biomass Gasifier, SOFCs, and a Gas Turbine

    Directory of Open Access Journals (Sweden)

    P V Aravind

    2012-07-01

    Full Text Available Thermodynamic calculations with a power plant based on a biomass gasifier, SOFCs and a gas turbine are presented. The SOFC anode off-gas which mainly consists of steam and carbon dioxides used as a gasifying agent leading to an allothermal gasification process for which heat is required. Implementation of heat pipes between the SOFC and the gasifier using two SOFC stacks and intercooling the fuel and the cathode streams in between them has shown to be a solution on one hand to drive the allothermal gasification process and on the other hand to cool down the SOFC. It is seen that this helps to reduce the exergy losses in the system significantly. With such a system, electrical efficiency around 73% is shown as achievable.

  12. Experimental study on the gasification characteristics of coal and orimulsion in 0.5 T/D gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Park, Ho Young; Kim, Jong Young; An, Dal Hong; Park, Tae Jun [Korea Electric Power Corp. (KEPCO), Taejon (Korea, Republic of). Research Center

    1995-12-31

    For the construction of commercial plant for IGCC imported from aboard in near future, it is aimed to get gasification data, practice the gasification design capability, and develop a fundamental key technology through the experiments for different kinds of coals (Datong, Roto, Alaska) by 0.5 T/D gasifier. We performed the experiments for physical properties and reactivities on selected coals by means of Drop Tube Reactor, numerical analysis for the reactor. Throughout the characteristic studies of orimulsion gasification, feasibility studies for orimulsion gasification as a fuel for power plant be performed. With the six experiment runs for the coal gasifier, several problems were found to remedy. After remedies, the gasifier could run at good operating conditions maintaining with 200% design feed rate over 1200-1550 degree. The third and fourth gasification runs with Roto were satisfactorily completed, during which gross heating values from produced gas were 7200-8200 Kcal/Nm{sup 3}. (author). 118 refs., 145 figs.

  13. Subpilot scale gasifier evaluation of ceramic cross flow filter. Final report, February 1, 1988--December 31, 1992

    Energy Technology Data Exchange (ETDEWEB)

    Lippert, T.E.; Alvin, M.A.; Smeltzer, E.E.; Bachovchin, D.M.; Meyer, J.H.

    1993-08-01

    The operating characteristics, performance and durability of a hot gas cross flow filter system were evaluated at the Texaco 15 tpd, entrained-bed gasifier pilot plant facility that is located at their Montebello Research Facilities (MRL) in California. A candle filter unit was also tested for comparative purposes. A wide range of operating test conditions were experienced. This report summarizes the results of eleven different test runs that occurred from April 1989 through August 1992. Differences between filter operation on the entrained gasifier and prior experience on fluid bed combustion are discussed.

  14. Basic refractory and slag management for petcoke carbon feedstock in gasifiers

    Science.gov (United States)

    Kwong, Kyei-Sing; Bennett, James P; Nakano, Jinichiro

    2014-04-22

    The disclosure provides methods of operating a slagging gasifier using a carbon feedstock having a relatively high V.sub.2O.sub.5 to SiO.sub.2 ratio, such as petcoke. The disclosure generates a combined chemical composition in the feed mixture having less than 25 wt. % SiO.sub.2, greater than 20 wt. % V.sub.2O.sub.5, and greater than 20 wt. % CaO. The method takes advantage of a novel recognition that increased levels of SiO.sub.2 tend to decrease dissolution of the V.sub.2O.sub.3 which forms under the reducing conditions of the gasifier, and utilizes the CaO additive to establish a chemical phase equilibria comprised of lower melting compounds. The method further provides for control based on the presence of Al.sub.2O.sub.3 and FeO, and provides for a total combined chemical composition of greater than about 5 wt. % MgO for use with refractory linings comprised of MgO based refractory brick.

  15. Performance evaluation of a ceramic cross-flow filter on a bench-scale coal gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Ciliberti, D.F.; Lippert, T.E.

    1985-01-01

    The Department of Energy is currently supporting a program that will aid in the development of cross flow filtration technology as applied to combined cycle power generation with coal gasification. The stated overall goal is to gain information on both the operational and economic feasibility of the implementation of cross flow filtration in various gasifier options. Westinghouse has prepared a comprehensive program that will lead directly to these program goals in an efficient manner. The proposed program is composed of three major technical tasks. Task 1 is directed at the design and actual test of a cross flow filter at a DOE bench scale gasifier. Task 2 is composed of several smaller theoretical and experimental efforts that are intended to firm up areas where engineering and design principles are lacking or considered inadequate. The third task is intended to integrate the results of the first two tasks in a conceptual design and cost analysis such that proper economic perspective for the filter concept can be gained. A brief summary of the approach taken in the technical tasks is presented in the following discussion.

  16. The Concept, Design and Performance of a Novel Rotary Kiln Type Air-Staged Biomass Gasifier

    Directory of Open Access Journals (Sweden)

    Huiyuan Shi

    2016-01-01

    Full Text Available Tar formation is the main bottleneck for biomass gasification technology. A novel rotary kiln type biomass gasification process was proposed. The concept design was based on air staging and process separation. This concept was demonstrated on a pilot scale rotary kiln reactor under ambient pressure and autothermic conditions. The pilot scale gasifier was divided into three different reaction regions, which were oxidative degradation, partial oxidation and char gasification. A series of tests was conducted to investigate the effect of key parameters. The results indicate that under optimum operating conditions, a fuel gas with high heat value of about 5500 kJ/Nm3 and gas production rate of 2.32 Nm3/kg could be produced. Tar concentration in the fuel gas could be reduced to 108 mg/Nm3 (at the gasifier outlet and 38 mg/Nm3 (after gas conditioning. The cold gas efficiency and carbon conversion rate reached 75% and 78%, respectively. The performance of this gasification system shows considerable potential for implementation in distributed electricity and heat supply projects.

  17. Combustion performance of cellulosic biomass in a gasifier-based cookstove

    Science.gov (United States)

    Sulaiman, Shaharin A.; Romli, Raffisyazana

    2012-06-01

    Depletion in fossil fuel and increase in the world population may change the trend in future kitchens in households. Cooking with LPG fuel may one day become impossible and households would have to consider alternatives such as electric stoves. One other solution to this problem is through the use of biomass cook stoves. However, traditional cook stoves, predominantly used in the households, are not efficient and its utilizations for domestic cooking have been a major contributor to the ill effects related in respiratory and other health problem. Improved cook stoves programs implemented in the developing world attempt to address these problems. Biomass gasification appears to have significant potential in Asia for domestic cooking applications. Gasifier-based cook stoves are fuel efficient in comparison to traditional cook stove. The objective of this paper is to study the performance of various type of cellulosic biomass in a gasifier-based cook stove. The biomass considered in this study are oil palm fronds, dried leaves, wood sticks, coconut shells, bagasse, charcoal, and saw dust. The samples are analyzed in order to study their chemical properties. The thermochemical properties of the biomass were characterized. The performance of the each of the samples is studied by observing the time taken to boil water. It is found that oil palm fronds are the best type of biomass for the gasifer cook stove. It is also concluded that the higher the carbon content and the calorific value in a biomass, the lesser the time taken to boil the water.

  18. Coal/Biomass cogasification and high temperature gas cleaning

    Energy Technology Data Exchange (ETDEWEB)

    Kiel, J.H.A.; Bos, A.; Den Uil, H.; Plaum, J.M.

    1995-08-01

    This paper reports on the cogasification of coal and biomass in a downdraught fixed-bed gasifier and on the high temperature removal of halides from the fuel gas produced. Air-blown downdraught gasifiers are considered as an interesting option especially for small and intermediate scale on-site fuel gas generation using high volatile feedstocks. The current test programme conducted with a 300 kW{sub th} downdraught gasifier at the Netherlands Energy Research Foundation (ECN) was focused on the effect of the partial replacement of the coal feedstock by two different biomass feedstocks, viz. Meranti wood waste and straw pellets (Danish winter wheat), on gasifier operability and fuel gas composition. For dry halide removal, several sorbents were evaluated based on literature data, thermodynamic calculations, and on laboratory and bench-scale experiments at atmospheric pressure. The evaluation was mainly focused on dry halide removal at a temperature level of 350-400C in a separate process located upstream of the desulphurisation process in an integrated system for high temperature gas cleaning. 8 figs., 11 tabs., 11 refs.

  19. Environmental performance of gasified willow from different lands including land-use changes

    DEFF Research Database (Denmark)

    Saez de Bikuna Salinas, Koldo; Hauschild, Michael Zwicky; Pilegaard, Kim

    2017-01-01

    the bioenergy potential without undesirable iLUC effects, especially relevant regarding biodiversity impacts, requires that part of the marginally used extensive grasslands are released from their current use or energy cropping on abandoned farmland incentivized....... was developed for the estimation of greenhouse gas (GHG) emissions from indirect land-use changes (iLUC) induced by willow cropping on arable land. For this, area expansion results from a general equilibrium economic model were combined with global LUC trends to differentiate between land transformation (as......A life-cycle assessment (LCA) of a low-input, short rotation coppice (SRC) willow grown on different Danish lands was performed. Woodchips are gasified, producer gas is used for co-generation of heat and power (CHP) and the ash-char output is applied as soil amendment in the field. A hybrid model...

  20. CFD simulation of coal gasification in an entrained-flow gasifier

    DEFF Research Database (Denmark)

    Sreedharan, V.; Hjertager, B.H.; Solberg, T.

    2010-01-01

    A study on predicting different chemical and physical processes occurring within an entrained-flow coal gasifier using computational fluid dynamics is carried out. The synthesis gas produced as a result of the gasification process is composed primarily of a combustible mixture of CO and hydrogen...... (water and CO being the other major constituents). The abundant availability of coal coupled with the flexibility of feedstock usage, fluctuations in natural gas prices, and increased environmental concerns make gasification an attractive alternative to conventional thermal power plant solutions...... for the energy requirements of tomorrow. Power plants using the Integrated Gasification Combined Cycle technology are being developed to utilize conventional feedstock in a cleaner and more efficient manner. Their intended use in gasification technology based power plants are expected to bring about improvements...

  1. Handbook of gasifiers and gas-treatment systems. [39 gasification processes and 40 gas processing systems

    Energy Technology Data Exchange (ETDEWEB)

    Parekh, R.D.

    1982-09-01

    In February 1976, the Energy Research and Development Administration (ERDA) published the Handbook of Gasifiers and Gas Treatment Systems. The intent of this handbook was to provide a ready reference to systems that are or may be applicable to coal conversion technology. That handbook was well received by users and was subsequently reprinted many times. The Department of Energy (successor agency to the ERDA) expands, revises and updates the Handbook in this volume. This new Handbook is not intended as a comparative evaluation, but rather as an impartial reference on recent and current technology. The Handbook now presents 39 gasification technologies and 40 gas processing systems that are or may be applicable to coal conversion technology. The information presented has been approved or supplied by the particular licensor/developer.

  2. Case study of SPRERI natural draft gasifier installation at a ceramic industry

    Energy Technology Data Exchange (ETDEWEB)

    Patil, K.N.; Singh, R.N.; Saiyed, S.U. [Sardar Patel Renewable Energy Research Inst., Gujarat (India)

    2002-06-01

    The Sardar Patel Renewable Energy Research Institute has recently introduced its natural draft gasifier burner system to replace the use of light fuel oil in ceramic product drying. The unit (rated at 350 kW{sub th}) consumed about 80 kgh{sup -1} of sawmill residues in the form of slabs 8 and 12 cm long, 5-7 cm wide, and 2.5-3 cm thick. The oil replacement is about 17 lh{sup -1}. Two types of batch driers, a rotary kiln and a tray drier, are used to dry the ceramic material from 20% to 10% moisture on a total mass basis. The tray drier is also used to dry molded ceramics in addition to the dewatered raw material ceramic cake. The cost savings over LFO are reduced by a factor of four to five units cost of output and the system repays its investment in less than two months. (Author)

  3. Complex technical and economic studies of combined-cycle units with flow gasifiers

    Science.gov (United States)

    Nakoryakov, V. E.; Nozdrenko, G. V.; Shchinnikov, P. A.; Borush, O. V.; Kuz'min, A. G.

    2010-12-01

    The method for determining the technical and economical indices of combined-cycle power plants (CCPPs) operating on coal with a low-charged steam generator and with a flow gasifier in combined production of electricity and heat, synthesis gas and hydrogen is considered. The results of analysis are presented and it is shown that such CCPPs have a higher technical and economical efficiency as compared to cogeneration plants (CPs) operating on pulverized coal and reconstructed with a gas-turbine topping. The material of this article is prepared in the framework of the Federal Targeted Program "Scientific and Scientific-Pedagogical Specialists of Innovative Russia for 2009-2013," application 1.2.2, the program "Research Works on Production of Fuels and Power from Organic Raw Materials."

  4. Properties and effects of remaining carbon from waste plastics gasifying on iron scale reduction.

    Science.gov (United States)

    Zhang, Chongmin; Chen, Shuwen; Miao, Xincheng; Yuan, Hao

    2011-06-01

    The carbonous activities of three kinds of carbon-bearing materials gasified from plastics were tested with coal coke as reference. The results showed that the carbonous activities of these remaining carbon-bearing materials were higher than that of coal-coke. Besides, the fractal analyses showed that the porosities of remaining carbon-bearing materials were higher than that of coal-coke. It revealed that these kinds of remaining carbon-bearing materials are conducive to improve the kinetics conditions of gas-solid phase reaction in iron scale reduction. Copyright © 2011 The Research Centre for Eco-Environmental Sciences, Chinese Academy of Sciences. Published by Elsevier B.V. All rights reserved.

  5. Co-gasification of coal and wood in a dual fluidized bed gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Isabella Aigner; Christoph Pfeifer; Hermann Hofbauer [Vienna University of Technology (VUT), Vienna (Austria). Institute of Chemical Engineering

    2011-07-15

    In the last decade the reduction of CO{sub 2} emissions from fossil fuels became a worldwide topic. Co-gasification of coal and wood provides an opportunity to combine the advantages of the well-researched usage of fossil fuels such as coal with CO{sub 2}-neutral biomass. Gasification itself is a technology with many advantages. The producer gas can be used in many ways; for electric power generation in a gas engine or gas turbine, for Fischer-Tropsch synthesis of liquid fuels and also for production of gaseous products such as synthetic natural gas (bio SNG). Moreover, the use of the producer gas in fuel cells is under investigation. The mixture of coal and wood leads to the opportunity to choose the gas composition as best befits the desired process. Within this study the focus of investigation was of gasification of coal and wood in various ratios and the resulting changes in producer gas composition. Co-gasification of coal and wood leads to linear producer gas composition changes with linear changing load ratios (coal/wood). Hydrogen concentrations rise with increasing coal ratio, while CO concentrations decrease. Due to the lower sulfur and nitrogen content of wood, levels of the impurities NH{sub 3} and H{sub 2}S in the producer gas fall with decreasing coal ratio. It is also shown that the majority of sulfur is released in the gasification zone and, therefore, no further cleaning of the flue gas is necessary. All mixture ratios, from 100 energy% to 0 energy% coal, performed well in the 100 kW dual fluidized bed gasifier. Although the gasifier was originally designed for wood, an addition of coal as fuel in industrial sized plants based on the same technology should pose no problems. 24 refs., 20 figs., 3 tabs.

  6. Hudson Bay wood gasifier: Final technical report on a Renewables-Conservation Demonstration Program Project

    Energy Technology Data Exchange (ETDEWEB)

    1981-12-01

    With electricity generation in mind, the 0.25 MW British Columbia Research fluidized bed wood gasifier was scaled up into a 1.2 MW pilot plant at the Saskatchewan Forest Products plywood mill in Hudson Ray, Saskatchewan, with the commissioning of the unit being completed in 1979. Following the installation of a new airlock, grate and ash scraper and a program of preliminary runs, a 60-day period was completed, during which the suitability of the Hudson Bay wood gasification system for continous operation was evaluated. It was concluded that serious deficiencies exist in the available scale-up procedures and expertise. Areas requiring major changes include the feed system, to alleviate the back-leakage of product gases, and to prevent overheating in the combustion zone, the grate/ash removal system, and the mode of operation (fixed or fluidized bed). Because the gasifier was designed to run in the fluidized mode, and in fact operates as a fixed moving bed, problems have arisen with ash removal and overheating. The stack gas and the waste water effluents were found to pose no serious threat to the environment, and can be safely disposed of without producing pollution problems. The scrubber operated very well, producing a cool, clean gas which burned well in the diesel and in the Maxon burner. A comparison of wood gasification to diesel oil generation of electricity revealed that, over the next 15 years, wood gas will produce cheaper electricity than well diesel, when a free source of waste wood is available, such as the situation in which the plant is listed at the source of the waste wood, and is operated by the waste wood producer. 4 refs., 22 figs., 8 tabs.

  7. Gasification biochar as a valuable by-product for carbon sequestration and soil amendment

    DEFF Research Database (Denmark)

    Hansen, Veronika; Müller-Stöver, Dorette; Ahrenfeldt, Jesper

    2015-01-01

    Thermal gasification of various biomass residues is a promising technology for combining bioenergy production with soil fertility management through the application of the resulting biochar as soil amendment. In this study, we investigated gasification biochar (GB) materials originating from two...... major global biomass fuels: straw gasification biochar (SGB) and wood gasification biochar (WGB), produced by a Low Temperature Circulating Fluidized Bed gasifier (LT-CFB) and a TwoStage gasifier, respectively, optimized for energy conversion. Stability of carbon in GB against microbial degradation...

  8. Environmental impact statement for the Encana shallow gas infill development in the CFB Suffield national wildlife area : volume 1 : project description

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-05-15

    EnCana Corporation (EnCana) proposed to carry out an infill development project within the boundaries of its existing developed shallow gas field in the Canadian Forces Base (CFB) Suffield National Wildlife Area (NWA) in southeast Alberta. EnCana proposed to drill 1275 infill wells over three drilling seasons, beginning in fall 2008. An environmental assessment was needed in order to extract remaining shallow tight sweet gas from the wildlife area. This paper presented the environmental impact statement (EIS) that was prepared by EnCana to meet this requirement. The paper provided a description of the project and discussed additional environmental protection measures as well as the regulatory and environmental settings. The scope of the environmental impact statement was identified. The findings of the assessment for each environmental component were also summarized with particular reference to vegetation, wetlands, wildlife, biodiversity, groundwater, surface water, aquatic ecology, soil, historical resources, palaeontology, socio-economics, air quality, noise, and human health. Mitigation strategies were also proposed. The paper also described a cumulative effects assessment and various potential malfunctions and accidental events that could occur during the project and result in potential environmental effects. In developing the project, EnCana concluded that it had taken an expansive approach to considering potential effects to ensure that the cumulative effects of the Project were known, understood and mitigated. 26 refs., 22 tabs., 9 figs.

  9. A numerical simulation analysis of the effect of the interface drag function on cluster evolution in a CFB riser gas-solid flow

    Directory of Open Access Journals (Sweden)

    Gómez L. C.

    2004-01-01

    Full Text Available The dynamics of formation, dissipation and breaking of coherent structures in the riser gas-solid flow of a circulating fluidized bed (CFB are evaluated by numerical simulation. The simulation is performed using the MICEFLOW code, which includes IIT's two-fluid hydrodynamic model B. The methodology for cluster characterization is used from Sharma et al. and is based on determination of four characteristics, average lifetime, average volumetric fraction of solid, existence time fraction and frequency of occurrence. Clusters are identified applying a criterion for the time average value of the volumetric solid fraction. A qualitative analysis of the influence of different drag function correlations on the hydrodynamics of the flow, including the evolution of coherent structures, is performed. The simulation predictions are also compared to experimental results. The results indicate that the choice of a correlation for drag function should be quite judicious. Finally it is shown that the mean clustering criteria of Sharma et al. should be modified to take into account other factors that influence cluster dynamics.

  10. The importance of SO{sub 2} and SO{sub 3} for sulphation of gaseous KCl - An experimental investigation in a biomass fired CFB boiler

    Energy Technology Data Exchange (ETDEWEB)

    Kassman, Haakan [Vattenfall Power Consultant AB, Nykoeping (Sweden); Chalmers University of Technology, Department of Energy and Environment, Division of Energy Technology, Gothenburg (Sweden); Baefver, Linda [Technical Research Institute of Sweden, Energy Technology, Boraas (Sweden); Aamand, Lars-Erik [Chalmers University of Technology, Department of Energy and Environment, Division of Energy Technology, Gothenburg (Sweden)

    2010-09-15

    This paper is based on results obtained during co-combustion of wood pellets and straw in a 12 MW circulating fluidised bed (CFB) boiler. Elemental sulphur (S) and ammonium sulphate ((NH{sub 4}){sub 2}SO{sub 4}) were used as additives to convert the alkali chlorides (mainly KCl) to less corrosive alkali sulphates. Their performance was then evaluated using several measurement tools including, IACM (on-line measurements of gaseous alkali chlorides), a low-pressure impactor (particle size distribution and chemical composition of extracted fly ash particles), and deposit probes (chemical composition in deposits collected). The importance of the presence of either SO{sub 2} or SO{sub 3} for gas phase sulphation of KCl is also discussed. Ammonium sulphate performed significantly better than elemental sulphur. A more efficient sulphation of gaseous KCl was achieved with (NH{sub 4}){sub 2}SO{sub 4} even when the S/Cl molar ratio was less than half compared to sulphur. Thus the presence of gaseous SO{sub 3} is of greater importance than that of SO{sub 2} for the sulphation of gaseous KCl. (author)

  11. Thermodynamic analysis of small-scale dimethyl ether (DME) and methanol plants based on the efficient two-stage gasifier

    DEFF Research Database (Denmark)

    Clausen, Lasse Røngaard; Elmegaard, Brian; Ahrenfeldt, Jesper

    2011-01-01

    Models of dimethyl ether (DME) and methanol synthesis plants have been designed by combining the features of the simulation tools DNA and Aspen Plus. The plants produce DME or methanol by catalytic conversion of a syngas generated by gasification of woody biomass. Electricity is co......-produced in the plants by a gas engine utilizing the unconverted syngas. A two-stage gasifier with a cold gas efficiency of 93% is used, but because of the design of this type of gasifier, the plants have to be of small-scale (5 MWth biomass input). The plant models show energy efficiencies from biomass to DME....../methanol + electricity of 51–58% (LHV), which shows to be 6-8%-points lower than efficiencies achievable on large-scale plants based on torrefied biomass pellets. By using waste heat from the plants for district heating, the total energy efficiencies become 87–88%....

  12. Computer modeling of the Morgantown Energy Research Center's fixed bed gasifier. [Theory and development

    Energy Technology Data Exchange (ETDEWEB)

    DeSai, P.R.; Wen, C.Y.

    1978-03-01

    This report describes the modeling of a fixed bed stirred gasifier operated by the Morgantown Energy Research Center. One objective of this project was to increase the fundamental understanding of existing gasification processes with mathematical modeling, and thereby assist the Department of Energy in its overall project planning. Models are used for scale-up and optimization purposes and also for extrapolation beyond the normal operating conditions. However, very often, due to the complexity of the real system and the mathematical limitations, certain simplifying assumptions are made. Therefore, before using any model, its assumptions and hence its limitations should be examined and clearly understood. The theory and the development of the model are described. Background information about the MERC's and similar commercial gasifiers is provided.

  13. Innovative Instrumentation and Analysis of the Temperature Measurement for High Temperature Gasification

    Energy Technology Data Exchange (ETDEWEB)

    Seong W. Lee

    2006-09-30

    The project entitled, ''Innovative Instrumentation and Analysis of the Temperature Measurement for High Temperature Gasification'', was successfully completed by the Principal Investigator, Dr. S. Lee and his research team in the Center for Advanced Energy Systems and Environmental Control Technologies at Morgan State University. The major results and outcomes were presented in semi-annual progress reports and annual project review meetings/presentations. Specifically, the literature survey including the gasifier temperature measurement, the ultrasonic application in cleaning application, and spray coating process and the gasifier simulator (cold model) testing has been successfully conducted during the first year. The results show that four factors (blower voltage, ultrasonic application, injection time intervals, particle weight) were considered as significant factors that affect the temperature measurement. Then the gasifier simulator (hot model) design and the fabrication as well as the systematic tests on hot model were completed to test the significant factors on temperature measurement in the second year. The advanced Industrial analytic methods such as statistics-based experimental design, analysis of variance (ANOVA) and regression methods were applied in the hot model tests. The results show that operational parameters (i.e. air flow rate, water flow rate, fine dust particle amount, ammonia addition) presented significant impact on the temperature measurement inside the gasifier simulator. The experimental design and ANOVA are very efficient way to design and analyze the experiments. The results show that the air flow rate and fine dust particle amount are statistically significant to the temperature measurement. The regression model provided the functional relation between the temperature and these factors with substantial accuracy. In the last year of the project period, the ultrasonic and subsonic cleaning methods and coating

  14. TVA coal-gasification commercial demonstration plant project. Volume 5. Plant based on Koppers-Totzek gasifier. Final report

    Energy Technology Data Exchange (ETDEWEB)

    1980-11-01

    This volume presents a technical description of a coal gasification plant, based on Koppers-Totzek gasifiers, producing a medium Btu fuel gas product. Foster Wheeler carried out a conceptual design and cost estimate of a nominal 20,000 TPSD plant based on TVA design criteria and information supplied by Krupp-Koppers concerning the Koppers-Totzek coal gasification process. Technical description of the design is given in this volume.

  15. The effect of gastric dilatation in rats submitted to gasified water ingestion under the hepatic metabolic function

    OpenAIRE

    Santiago, José Roberto Ferreira; Kobayasi, Shoiti [UNESP

    2008-01-01

    INTRODUCTION: The amounts of people that are overweight have been increasing within the population in significant ways during the last decades. In this view, gasified beverages have become an important environmental concern in relation to the eating habits of people, especially who lives in the USA, Mexico, and Brazil. In this order, these three countries constitute the major beverages producers and consumers of the whole world. PURPOSE: To investigate the effects of gastric dilatation in rat...

  16. Design, scale-up, Six Sigma in processing different feedstocks in a fixed bed downdraft biomass gasifier

    Science.gov (United States)

    Boravelli, Sai Chandra Teja

    This thesis mainly focuses on design and process development of a downdraft biomass gasification processes. The objective is to develop a gasifier and process of gasification for a continuous steady state process. A lab scale downdraft gasifier was designed to develop the process and obtain optimum operating procedure. Sustainable and dependable sources such as biomass are potential sources of renewable energy and have a reasonable motivation to be used in developing a small scale energy production plant for countries such as Canada where wood stocks are more reliable sources than fossil fuels. This thesis addresses the process of thermal conversion of biomass gasification process in a downdraft reactor. Downdraft biomass gasifiers are relatively cheap and easy to operate because of their design. We constructed a simple biomass gasifier to study the steady state process for different sizes of the reactor. The experimental part of this investigation look at how operating conditions such as feed rate, air flow, the length of the bed, the vibration of the reactor, height and density of syngas flame in combustion flare changes for different sizes of the reactor. These experimental results also compare the trends of tar, char and syngas production for wood pellets in a steady state process. This study also includes biomass gasification process for different wood feedstocks. It compares how shape, size and moisture content of different feedstocks makes a difference in operating conditions for the gasification process. For this, Six Sigma DMAIC techniques were used to analyze and understand how each feedstock makes a significant impact on the process.

  17. Emission characteristics of toxic pollutants from an updraft fixed bed gasifier for disposing rural domestic solid waste.

    Science.gov (United States)

    Lei, Ming; Hai, Jing; Cheng, Jiang; Gui, Li; Lu, Jiawei; Ren, Ming-Zhong; Zhu, Feng; Yang, Zong-Hui

    2017-08-01

    Gasification has gained advantage as an effective way to dispose domestic solid waste in mountainous rural of China. However, its toxic emissions such as PCDD/Fs and heavy metals, as well as their potential environmental risks, were not well studied in engineering application. In this study, an updraft fixed bed gasifier was investigated by field sampling analysis. Results showed that low toxic emissions (dust, SO2, NOx, HCl, CO, H2S, NH3, PCDD/Fs and heavy metals) in the flue gas were achieved when the rural solid waste was used as feedstock. The mass distribution of heavy metals showed that 94.00% of Pb, 80.45% of Cu, 78.00% of Cd, 77.31% of Cr, and 76.25% of As were remained in residual, whereas 86.58% of Hg was found in flue gas. The content of PCDD/Fs in the flue gas was 0.103 ngI-TEQ·Nm-3, and the total emission factor of PCDD/Fs from the gasifier was 50.04 μgI-TEQ·t-waste-1, among which only 0.04 μgI-TEQ·t-waste-1 was found in the flue gas. The total output of PCDD/Fs was1.89 times as high as input, indicting the updraft fixed bed gasifier increased emission of PCDD/Fs during the treatment domestic solid waste. In addition, the distribution characteristics of PCDD/Fs congeners reflected that PCDD/Fs was mainly generated in the gasification process rather than the stage of flue gas cleaning, suggesting the importance to effectively control the generation of PCDD/Fs within the gasifier chamber in order to obtain a low PCDD/Fs emission level.

  18. Thermodynamic modelling of an onsite methanation reactor for upgrading producer gas from commercial small scale biomass gasifiers.

    Science.gov (United States)

    Vakalis, S; Malamis, D; Moustakas, K

    2017-06-26

    Small scale biomass gasifiers have the advantage of having higher electrical efficiency in comparison to other conventional small scale energy systems. Nonetheless, a major drawback of small scale biomass gasifiers is the relatively poor quality of the producer gas. In addition, several EU Member States are seeking ways to store the excess energy that is produced from renewables like wind power and hydropower. A recent development is the storage of energy by electrolysis of water and the production of hydrogen in a process that is commonly known as "power-to-gas". The present manuscript proposes an onsite secondary reactor for upgrading producer gas by mixing it with hydrogen in order to initiate methanation reactions. A thermodynamic model has been developed for assessing the potential of the proposed methanation process. The model utilized input parameters from a representative small scale biomass gasifier and molar ratios of hydrogen from 1:0 to 1:4.1. The Villar-Cruise-Smith algorithm was used for minimizing the Gibbs free energy. The model returned the molar fractions of the permanent gases, the heating values and the Wobbe Index. For mixtures of hydrogen and producer gas on a 1:0.9 ratio the increase of the heating value is maximized with an increase of 78%. For ratios higher than 1:3, the Wobbe index increases significantly and surpasses the value of 30 MJ/Nm3. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. CFD modelling of an open core downdraft moving bed biomass gasifier; Modelado de un gasificador estratificado de lecho movil de biomasa, utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Rogel-Ramirez, A [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)]. E-mail: ARogelR@iingen.unam.mx

    2008-10-15

    This paper contains the description of a bidimensional Computational Fluid Dynamics (CFD), model Developer to simulate the flow and reaction in a stratified downdraft biomass gasifier, whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model is based on the PHOENICS package and represents a tool which can be used in gasifier analysis and design. Contributions of chemical kinetics and the mixing rate using the EBU approach are considered in the gas phase global homogeneous reactions. The harmonic blending of chemical kinetics and mass transfer effects, determine the global heterogeneous reactions between char and O{sub 2}, CO{sub 2} and H{sub 2}O. The turbulence effect in the gas phase is accounted by the standard {kappa}-{epsilon} approach. The model provides information of the producer gas composition, velocities and temperature at the outlet, and allows different operating parameters and feed properties to be changed. Finally, a comparison with experimental data available in literature was done, which showed satisfactory agreement from a qualitative point of view, though further validation is required. [Spanish] Este estudio describe un modelo numerico bidimensional, basado en Dinamica de Fluidos Computacional (CFD), desarrollado para simular el flujo y las reacciones que ocurren en un gasificador estratificado de flujos paralelos, en el que se resuelven ecuaciones de conservacion Eulerianas para los componentes de la fase gaseosa, la fase solida, velocidades y entalpias especificas. El modelo esta basado en el codigo PHOENICS y representa una herramienta que puede ser utilizada en el analisis y diseno de gasificadores. En las reacciones globales homogeneas se consideran las contribuciones de la cinetica quimica y la rapidez de mezclado, usando el modelo Eddy Brake-UP (EBU). La medida harmonica de la cinetica quimica y la transferencia de masa, determinan las velocidades globales de

  20. Experimental numerical study utilizing CFD in a stratified gasifier operating with biomass; Estudio numerico experimental de un gasificador estratificado que opera con biomasa, utilizando CFD

    Energy Technology Data Exchange (ETDEWEB)

    Rogel Ramirez, Alejandro

    2007-07-01

    The central idea behind this work is the developing of a numeric-experimental model, useful to optimize the biomass stratified gasifier design. Firstly, model validation will be carried up by comparison with reference experimental data available. This study describes a 1-D + 2-D numerical model used to simulate the gasification of pine wood pellets in a stratified downdraft gasifier whereby Eulerian conservation equations are solved for particle and gas phase components, velocities and specific enthalpies. The model takes into account the biomass particle process such as heating up, drying, primary pyrolysis of biomass, secondary pyrolysis of tar, homogeneous reactions and heterogeneous combustion/gasification reactions, and particle size change. This CFD model can be used to predict temperature profiles, gas composition, producer gas lower heating value, and carbon conversion efficiency, and the reactor performance when operating parameters and feed properties are changed. The standard {kappa}-{epsilon} and RNG {kappa}-{epsilon} models were used to simulate the turbulent flow conditions. [Spanish] La idea central del presente trabajo es el desarrollo de un modelo numerico- experimental, para optimizar el diseno de gasificadores estratificados de biomasa. Primeramente, el modelo sera validado utilizando datos experimentales disponibles en la literatura. Este estudio describe un modelo numerico 1-D+2-D, utilizado para simular la gasificacion de 'pelets' de madera de pino en un gasificador estratificado de flujos paralelos, en el que se resuelven ecuaciones de conservacion Eulerianas para los componentes de la fase gaseosa, la fase solida, velocidades y entalpias especificas. El modelo considera procesos como: calentamiento, secado de la biomasa, pirolisis primaria de la madera, pirolisis secundaria de los alquitranes, reacciones homogeneas, reacciones heterogeneas de combustion/gasificacion y cambio en el tamano de la particula. Este modelo CFD puede ser

  1. Development of a micro-turbine plant to run on gasifier producer gas

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    This report presents the results of a work programme to test a Capstone micro gas turbine using producer gas (1) in a test facility using synthetic producer gas at Advantca's research laboratories and (2) at the premises of Biomass Engineering Ltd where the micro gas turbine was coupled to an existing 80 kWe downdraft gasifier operating on clean wood and wood wastes. The initial tests at Advantica achieved successful operation of the Capstone micro gas turbine on 100% producer gas at a net electrical output of 5.5 kWe and with very low NOx emissions (<2 ppm). The micro turbine was then moved and recommissioned at a site belonging to Biomass Engineering where 350 hours of operation were achieved using producer gas and over 800 hours using natural gas. Problems were experienced during start-up due to limited access to control software and late delivery of the gas compressor for the micro turbine. Gas emissions and performance were deemed satisfactory. The report describes the test work at Advantica and at Biomass Engineering and discusses the technical and economic aspects of biomass gasification and micro turbine systems.

  2. CFD-Modeling of the Multistage Gasifier Capacity of 30 KW

    Science.gov (United States)

    Levin, A. A.; Kozlov, A. N.; Svishchev, D. A.; Donskoy, I. G.

    2017-11-01

    Single-stage fuel gasification processes have been developed and widely studied in Russia and abroad throughout the 20th century. They are fundamental to the creation and design of modern gas generator equipment. Many studies have shown that single-stage gasification process, have already reached the limit of perfection, which was a significant improvement in their performance becomes impossible and unprofitable. The most fully meet modern technical requirements of multistage gasification technology. In the first step of the process, is organized allothermic biomass pyrolysis using heat of exhaust gas and generating power plant. At this stage, the yield of volatile products (gas and tar) of fuel. In the second step, the layer of fuel is, the tar is decomposed by the action of hot air and steam, steam-gas mixture is formed further reacts with the charcoal in the third process stage. The paper presents a model developed by the authors of the multi-stage gasifier for wood chips. The model is made with the use of CFD-modeling software package (COMSOL Multiphisics). To describe the kinetics of wood pyrolysis and gasification of charcoal studies were carried out using a set of simultaneous thermal analysis. For this complex developed original methods of interpretation of measurements, including methods of technical analysis of fuels and determine the parameters of the detailed kinetics and mechanism of pyrolysis.

  3. Phosphorus and zinc dissolution from thermally gasified piggery waste ash using sulphuric acid.

    Science.gov (United States)

    Kuligowski, Ksawery; Poulsen, Tjalfe G

    2010-07-01

    Ash from thermally gasified piggery waste (GA) was treated with sulphuric acid (H(2)SO(4)) using two extraction methods. First different loads (0.39-0.98 kg H(2)SO(4)/kg ash) and concentrations (0.2-2M) were used in 3h extraction. Second, titration of 1:25 (w/w) ash:water suspension was conducted with 4M H(2)SO(4) to determine ash buffer capacity at nine pH steps from 12 to 0.1. Total P and zinc (Zn) dissolution was monitored. Optimal acid load and concentration to dissolve 94% P and 55% Zn from GA was 0.98 kg H(2)SO(4)/kg ash and 0.6M, respectively, which corresponds to acid demand of 19.2 kg H(2)SO(4)/kg P recovered. High concentrations (2M) did not improve P dissolution, but Zn was easier released. Ash buffer capacity was the highest at pH 4 and 0.1, first one due to dissolution of Ca, the second one due to autoprotolysis of water. Acid load had stronger effect on dissolution than concentration in the first method, however in the second; both factors had comparable effect. Copyright (c) 2010 Elsevier Ltd. All rights reserved.

  4. Evaluation of catalytic effects in gasification of biomass at intermediate temperature and pressure

    NARCIS (Netherlands)

    Nanou, Pavlina; van Rossum, G.; van Swaaij, Willibrordus Petrus Maria; Kersten, Sascha R.A.; Lefferts, Leonardus; Seshan, Kulathuiyer

    2011-01-01

    This paper proposes and examines an alternative thermo-chemical process for biomethane production from lignocellulosic biomass, termed self-gasification. Self-gasification of biomass is envisaged to utilize a high-pressure steam gasifier (30−80 bar) at temperatures of 600−900 °C and to use the

  5. Hydrodynamics of a dual fluidized-bed gasifier. Part 2: Simulation of solid circulation rate, pressure loop and stability

    Energy Technology Data Exchange (ETDEWEB)

    Kaiser, S.; Loeffler, G.; Bosch, K.; Hofbauer, H. [Vienna Univ. of Technology, Inst. of Chemical Engineering, Fuel Technology and Environmental Technology, Vienna (Austria)

    2003-09-01

    This paper focuses on the determination of the solids circulation of a CFB gasification system with a dual fluidized bed concept, and the distribution of the solid hold up under different fluidization conditions. A mathematical model of the riser was designed and implemented in a model of a dual fluidized bed system. This model contains routines for calculation of each section of the dual fluidized bed system. The behaviour of the system was analysed regarding changes in solid inventory and variations of geometry. A diagram is presented which allows an illustration of the influence of changes in the dual fluidized bed system configuration on the resulting stable operation points. Analysis concerning the effect of counter pressure on the combustion and gasification side confirms the role of the seal loop in stabilizing the operation of the gasification system. (Author)

  6. High Temperature Air/Steam Gasification (HTAG). Technical report no. 2: High Temperature Air/Steam Gasification of biomass and wastes - Stage 2

    Energy Technology Data Exchange (ETDEWEB)

    Blasiak, W.; Kalisz, S.; Szewczyk, D.; Lucas, C.; Abeyweera, R. [Royal Inst. of Technology, Stockholm (Sweden). Dep of Materials Science and Engineering

    2005-02-01

    This report aims to provide information on activity of Division of Energy and Furnace Technology, Royal Inst. of Technology in the field of solid biomass conversion into fuel gas within year 2003. Contrary to the conventional gasification, in this work highly preheated air and steam is used as a gasifying agent and supplied to newly designed continuous gasifier. Preheating of air and steam is realised by means of the modern high-cycle regenerative Air/steam preheater. Maximum temperature of preheated air or steam is raised up to 1600 deg C. In this work the laboratory test facility called High Temperature Air/steam Gasification (HTAG) plant with flow rate of preheated air or steam up to 110 Nm{sup 3}/h is used. Use of highly preheated gasifying media provides additional energy into the gasification, which enhances the thermal decomposition of solids being gasified. Together with continuous operation mode of the new gasifier, a stable process producing relatively clean fuel gas is reported. High Temperature Air/steam Gasification has very clear economical and environmental benefits. It will increase consumption of biomass (like wood pellets) thus decreases CO{sub 2} emissions from energy intensive industries. Apart from CO{sub 2} reduction possibility, the new process, High Temperature Gasification of wastes, fulfils all new regulations proposed by European Commission on wastes incineration since: no landfilling of ash residues is required, no need to treat ashes from gasification since there is no ash produced but slag which is non leachable and can be used as building material, clean gas for combustion and production of heat or electricity. In this work only gasification of wood pellets is reported but all efforts are targeted on later continuous gasification of other kinds of biomass and wastes.

  7. Evaluation and modification of ASPEN fixed-bed gasifier models for inclusion in an integrated gasification combined-cycle power plant simulation

    Energy Technology Data Exchange (ETDEWEB)

    Stefano, J.M.

    1985-05-01

    Several Advanced System for Process Engineering (ASPEN) fixed-bed gasifier models have been evaluated to determine which is the most suitable model for use in an integrated gasification combined-cycle (IGCC) power plant simulation. Four existing ASPEN models were considered: RGAS, a dry ash gasifier model developed by Halcon/Scientific Design Company; USRWEN, the WEN II dry ash gasifier model originally developed by C.Y. Wen at West Virginia University; the slagging gasifier model developed by Massachusetts Institute of Technology (MIT) and based on Continental Oil Company's (CONOCO) design study for the proposed Pipeline Demonstration Plant; and the ORNL dry ash gasifier model developed by Oak Ridge National Laboratory for the simulation of the Tri-States Indirect Liquefaction Process. Because none of the models studied were suitable in their present form for inclusion in an IGCC power plant simulation, the SLAGGER model was developed by making significant modifications to the MIT model. The major problems with the existing ASPEN models were most often inaccurate material and energy balances, limitations of coal type, or long run times. The SLAGGER model includes simplifications and improvements over the MIT model, runs quickly (less than 30 seconds of computer time on a VAX-11/780), and gives more accurate mass and energy balances.

  8. Efficiency assessment of an integrated gasifier/boiler system for hydrogen production with different biomass types

    Energy Technology Data Exchange (ETDEWEB)

    Kalinci, Yildiz [Department of Technical Programs, Izmir Vocational High School, Dokuz Eylul University, Education Campus Buca, Izmir (Turkey); Hepbasli, Arif [Department of Mechanical Engineering, Faculty of Engineering, Ege University, 35100 Izmir (Turkey); Dincer, Ibrahim [Faculty of Engineering and Applied Science, University of Ontario Institute of Technology, 2000 Simcoe Street North, Oshawa, Ontario (Canada)

    2010-05-15

    In this study, we utilize some experimental data taken from the literature, especially on the air-blown gasification characteristics of six different biomass fuels, namely almond shell (ASF), walnut pruning (WPF), rice straw (RSF), whole tree wood chips (WWF), sludge (SLF) and non-recyclable waste paper (NPF) in order to study the thermodynamic performance of an integrated gasifier-boiler power system for its hydrogen production. In this regard, both energy and exergy efficiencies of the system are investigated. The exergy contents of different biomass fuels are calculated to be ranging from 15.89 to 22.07 MJ/kg, respectively. The hydrogen concentrations based on the stack gases at the cyclone exit are determined to be between 7 and 18 (%v/v) for NPF and ASF. Also, percentages of combustible vary from 30% to 46%. The stack gas has physical and chemical exergies. The total specific exergy rates are calculated and illustrated. These values change from 3.54 to 6.41 MJ/kg. Then, two types of exergy efficiencies are calculated, such as that exergy efficiency 1 is examined via all system powers, exergy and efficiency 2 is calculated according to specific exergy rates of biomass fuels and product gases. While the exergy efficiencies 1 change between 4.33% and 11.89%, exergy efficiencies 2 vary from 18.33% to 39.64%. Also, irreversibilities range from 9.76 to 18.02 MJ/kg. Finally, we investigate how nitrogen contents of biomass fuels affect on energy and exergy efficiencies. The SLF has the highest amount of nitrogen content as 5.64% db while the NPF has the lowest one as 0.14% db. The minimum and maximum exergetic efficiencies belong to the same fuels. Obviously, the higher the nitrogen content the lower the efficiency based on an inverse ratio between exergy efficiency and nitrogen content. (author)

  9. Testing of downstream catalysts for tar destruction with a guard bed in a fluidised bed biomass gasifier at pilot plant scale

    Energy Technology Data Exchange (ETDEWEB)

    Aznar, M.P.; Frances, E.; Campos, I.J.; Martin, J.A.; Gil, J. [Saragossa Univ. (Spain). Dept. of Chemistry and Environment Engineering; Corella, J. [Complutense Univ. of Madrid (Spain). Dept. of Chemical Engineering

    1996-12-31

    A new pilot plant for advanced gasification of biomass in a fast fluidised bed is now fully operative at University of Saragossa, Spain. It is a `3rd generation` pilot plant. It has been built up after having used two previous pilot plants for biomass gasification. The main characteristic of this pilot plant is that it has two catalytic reactors connected in series, downstream the biomass gasifier. Such reactors, of 4 cm i.d., are placed in a slip stream in a by-pass from the main gasifier exit gas. The gasification is made at atmospheric pressure, with flow rates of 3-50 kg/in, using steam + O{sub 2} mixtures as the gasifying agent. Several commercial Ni steam-reforming catalyst are being tested under a realistic raw gas composition. Tar eliminations or destructions higher than 99 % are easily achieved. (orig.) 2 refs.

  10. Climate effect of an integrated wheat production and bioenergy system with Low Temperature Circulating Fluidized Bed gasifier

    DEFF Research Database (Denmark)

    Sigurjonsson, Hafthor Ægir; Elmegaard, Brian; Clausen, Lasse Røngaard

    2015-01-01

    are assessed along with the effects of recycling the nutrients and carbon back to the agricultural system. The methods used to assess the integration was Life Cycle Assessment (LCA) with IPCC's 2013 100 year global warming potential (GWP) as impact assessment method. The boundary was set from cradle to gate...... based on carbon conversion to two references, no straw removal and straw combustion. The results show that the climate effect of removing the straws are mitigated by the carbon soil sequestration with biochar, and electricity and district heat substitution. Maximum biochar production outperforms maximum...... efficiency for biochar production can be beneficial in terms of climate change effect of an integrated wheat production and bioenergy system....

  11. INNOVATIVE INSTRUMENTATION AND ANALYSIS OF THE TEMPERATURE MEASUREMENT FOR HIGH TEMPERATURE GASIFICATION

    Energy Technology Data Exchange (ETDEWEB)

    Seong W. Lee

    2004-10-01

    The systematic tests of the gasifier simulator on the clean thermocouple were completed in this reporting period. Within the systematic tests on the clean thermocouple, five (5) factors were considered as the experimental parameters including air flow rate, water flow rate, fine dust particle amount, ammonia addition and high/low frequency device (electric motor). The fractional factorial design method was used in the experiment design with sixteen (16) data sets of readings. Analysis of Variances (ANOVA) was applied to the results from systematic tests. The ANOVA results show that the un-balanced motor vibration frequency did not have the significant impact on the temperature changes in the gasifier simulator. For the fine dust particles testing, the amount of fine dust particles has significant impact to the temperature measurements in the gasifier simulator. The effects of the air and water on the temperature measurements show the same results as reported in the previous report. The ammonia concentration was included as an experimental parameter for the reducing environment in this reporting period. The ammonia concentration does not seem to be a significant factor on the temperature changes. The linear regression analysis was applied to the temperature reading with five (5) factors. The accuracy of the linear regression is relatively low, which is less than 10% accuracy. Nonlinear regression was also conducted to the temperature reading with the same factors. Since the experiments were designed in two (2) levels, the nonlinear regression is not very effective with the dataset (16 readings). An extra central point test was conducted. With the data of the center point testing, the accuracy of the nonlinear regression is much better than the linear regression.

  12. BIOMASS-FUELED, SMALL-SCALE, INTEGRATED-GASIFIER, GAS-TURBINE POWER PLANT: PROGRESS REPORT ON THE PHASE 2 DEVELOPMENT

    Science.gov (United States)

    The paper reports the latest efforts to complete development of Phase 2 of a three-phase effort to develop a family of small-scale (1 to 20 MWe) biomass-fueled power plants. The concept envisioned is an air-blown pressurized fluidized-bed gasifier followed by a dry hot gas clean...

  13. Potential Increasing of Rubber Sheet Production with Fungus Displacement by Solar Tunnel Dryer by Integrating a Biomass Gasifier as an Assisting Heat Source

    Science.gov (United States)

    Dangphonthong, D.; Ruenruangrit, P.; Pinate, W.

    2017-10-01

    In this study, Potential increasing of rubber sheet production with fungus displacement by solar tunnel dryer. By integrating a biomass gasifier as an assisting heat source for drying Rubber Sheet produce and its performance analysis has been investigated. An experimental study has been carried out with the stand-alone solar tunnel dryer and the dryer with the assisted biomass gasifier. For thermal performance analysis, for wind speed 1.0 m/s, the dryer with assisted gasifier gave an average efficiency of 32.86% higher and the drying period was 31.45 % shorter than those of the unit without the gasifier. For wind speed 1.5 m/s, and for wind speed 2.0 m/s, the values are 21.49 %, 28.68 % and 33.17%, 24.54 %, respectively. From the economic analysis, drying of wind speed 1.5 m/s is the most appropriated. The payback and the IRR were 1.8 years and 55.48 %, respectively. While those for wind speed 1.0 m/s were 2.74 years and 36%, respectively.

  14. Adoption and use of a semi-gasifier cooking and water heating stove and fuel intervention in the Tibetan Plateau, China

    Science.gov (United States)

    Clark, S.; Carter, E.; Shan, M.; Ni, K.; Niu, H.; Tseng, J. T. W.; Pattanayak, S. K.; Jeuland, M.; Schauer, J. J.; Ezzati, M.; Wiedinmyer, C.; Yang, X.; Baumgartner, J.

    2017-07-01

    Improved cookstoves and fuels, such as advanced gasifier stoves, carry the promise of improving health outcomes, preserving local environments, and reducing climate-forcing air pollutants. However, low adoption and use of these stoves in many settings has limited their benefits. We aimed to improve the understanding of improved stove use by describing the patterns and predictors of adoption of a semi-gasifier stove and processed biomass fuel intervention in southwestern China. Of 113 intervention homes interviewed, 79% of homes tried the stove, and the majority of these (92%) continued using it 5-10 months later. One to five months after intervention, the average proportion of days that the semi-gasifier stove was in use was modest (40.4% [95% CI 34.3-46.6]), and further declined over 13 months. Homes that received the stove in the first batch used it more frequently (67.2% [95% CI 42.1-92.3] days in use) than homes that received it in the second batch (29.3% [95% CI 13.8-44.5] days in use), likely because of stove quality and user training. Household stove use was positively associated with reported cooking needs and negatively associated with age of the main cook, household socioeconomic status, and the availability of substitute cleaner-burning stoves. Our results show that even a carefully engineered, multi-purpose semi-gasifier stove and fuel intervention contributed modestly to overall household energy use in rural China.

  15. DESIGN, FABRICATION, ASSEMBLY AND BENCH TESTING OF A TEXACO INFRARED RATIO PYROMETER SYSTEM FOR THE MEASUREMENT OF REACTION CHAMBER TEMPERATURE

    Energy Technology Data Exchange (ETDEWEB)

    Tom Leininger

    2001-03-31

    Reliable measurement of gasifier reaction chamber temperature is important for the proper operation of slagging, entrained-flow gasification processes. Historically, thermocouples have been used as the main measurement technique, with the temperature inferred from syngas methane concentration being used as a backup measurement. While these have been sufficient for plant operation in many cases, both techniques suffer from limitations. The response time of methane measurements is too slow to detect rapid upset conditions, and thermocouples are subject to long-term drift, as well as slag attack, which eventually leads to failure of the thermocouple. Texaco's Montebello Technology Center (MTC) has developed an infrared ratio pyrometer system for measuring gasifier reaction chamber temperature. This system has a faster response time than both methane and thermocouples, and has been demonstrated to provide reliable temperature measurements for longer periods of time when compared to thermocouples installed in the same MTC gasifier. In addition, the system can be applied to commercial gasifiers without any significant scale-up issues. The major equipment items, the purge system, and the safety shutdown system in a commercial plant are essentially identical to the prototypes at MTC. The desired result of this DOE program is ''a bench-scale prototype, either assembled or with critical components (laboratory) tested in a convincing manner.'' The prototype of the pyrometer system (including gasifier optical access port) that was designed, assembled and tested for this program, has had previous prototypes that have been built and successfully tested under actual coal and coke gasification conditions in three pilot units at MTC. It was the intent of the work performed under the auspices of this program to review and update the existing design, and to fabricate and bench test an updated system that can be field tested in one or more commercial gasifiers

  16. Design of structure and simulation of the three-zone gasifier of dense layer of the inverted process

    Science.gov (United States)

    Zagrutdinov, R. Sh; Negutorov, V. N.; Maliykhin, D. G.; Nikishanin, M. S.; Senachin, P. K.

    2017-11-01

    Experts of LLC “New Energy Technologies” have developed gasifiers designs, with the implementation of the three-zone gasification method, which satisfy the following conditions: 1) the generated gas must be free from tar, soot and hydrocarbons, with a given ratio of CO/H2; 2) to use as the fuel source a wide range of low-grade low-value solid fuels, including biomass and various kinds of carbonaceous wastes; 3) have high reliability in operation, do not require qualified operating personnel, be relatively inexpensive to produce and use steam-air blowing instead of expensive steam-oxygen one; 4) the line of standard sizes should be sufficiently wide (with a single unit capacity of fuel from 1 to 50-70 MW). Two models of gas generators of the inverted gasification process with three combustion zones operating under pressure have been adopted for design: 1) gas generator with a remote combustion chamber type GOP-VKS (two-block version) and 2) a gas generator with a common combustion chamber of the GOP-OK type (single-block version), which is an almost ideal model for increasing the unit capacity. There have been worked out various schemes for the preparation of briquettes from practically the entire spectrum of low-grade fuel: high-ash and high-moisture coals, peat and biomass, including all types of waste - solid household waste, crop, livestock, poultry, etc. In the gas generators there are gasified the cylindrical briquettes with a diameter of 20-25 mm and a length of 25-35 mm. There have been developed a mathematical model and computer code for numerical simulation of synthesis gas generation processes in a gasifier of a dense layer of inverted process during a steam-air blast, including: continuity equations for the 8 gas phase components and for the solid phase; the equation of the heat balance for the entire heterogeneous system; the Darcy law equation (for porous media); equation of state for 8 components of the gas phase; equations for the rates of 3 gas

  17. Economic analysis of a 20 kW gasifier; Analise economica de um gaseificador de 20 kW

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Marcos Vinicius Miranda da; Rocha, Brigida Ramati Pereira da [Universidade Federal do Para (NEDS/UFPA), Belem, PA (Brazil). Nucleo de Energia para o Desenvolvimento Sustentavel], e-mail: neds@ufpa.br

    2006-07-01

    The gasification of biomass residues has been pointed as an alternative in electricity supplying for small communities of the Amazon region, because it promotes a significant substitution of the diesel oil in the electric power generation. This paper presents an economic analysis of an electricity generation system (gasifier and generator set) of 20 kw that is installed in the community of Jenipauba, in the State of Para. That analysis confirms the economic attractiveness of that energy alternative on the generator sets that operate exclusively with diesel oil. It also shows the impact of the labor law on electricity generation cost, as well as the need of subsidizing the electric power generation, because the community of Jenipauba is very poor. (author)

  18. Multi-gene genetic programming based predictive models for municipal solid waste gasification in a fluidized bed gasifier.

    Science.gov (United States)

    Pandey, Daya Shankar; Pan, Indranil; Das, Saptarshi; Leahy, James J; Kwapinski, Witold

    2015-03-01

    A multi-gene genetic programming technique is proposed as a new method to predict syngas yield production and the lower heating value for municipal solid waste gasification in a fluidized bed gasifier. The study shows that the predicted outputs of the municipal solid waste gasification process are in good agreement with the experimental dataset and also generalise well to validation (untrained) data. Published experimental datasets are used for model training and validation purposes. The results show the effectiveness of the genetic programming technique for solving complex nonlinear regression problems. The multi-gene genetic programming are also compared with a single-gene genetic programming model to show the relative merits and demerits of the technique. This study demonstrates that the genetic programming based data-driven modelling strategy can be a good candidate for developing models for other types of fuels as well. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Thermodynamics of the CO2–Absorption/Desorption Section in the Integrated Gasifying Combined Cycle — I. modeling

    Directory of Open Access Journals (Sweden)

    Jaroslav KOZACZKA

    2012-06-01

    Full Text Available The carbon dioxide absorption/desorption unit of the Integrated Gasifying Combined Cycle has been detailed described to formulate appropriate model equations for the processes, suitable for further thermodynamic analyzes. There are two principal technologies of the CO2–removing section, namely the absorption with the following expanding desorption process, and the absorption with the following classical plates (or packing desorption one. The physics of thermodynamic properties of the water/carbon dioxide solution have been presented thoroughly using hitherto literature data. The Henry's Law has been emphasized as the base for further thermodynamic analyzes. The numerical results of appropriate absorption/desorption units have been compiled presuming fundamental relations, which are also presented. They should be the base for their thermodynamic analyzes.

  20. Innovative Instrumentation and Analysis of the Temperature Measurement for High Temperature Gasification

    Energy Technology Data Exchange (ETDEWEB)

    Seong W. Lee

    2005-10-01

    The objectives of this project during this semi-annual reporting period are to test the effects of coating layer of the thermal couple on the temperature measurement and to screen out the significant factors affecting the temperature reading under different operational conditions. The systematic tests of the gasifier simulator on the high velocity oxygen fuel (HVOF) spray coated thermal couples were completed in this reporting period. The comparison tests of coated and uncoated thermal couples were conducted under various operational conditions. The temperature changes were recorded and the temperature differences were calculated to describe the thermal spray coating effect on the thermal couples. To record the temperature data accurately, the computerized data acquisition system (DAS) was adopted to the temperature reading. The DAS could record the data with the accuracy of 0.1 C and the recording parameters are configurable. In these experiments, DAS was set as reading one data for every one (1) minute. The operational conditions are the combination of three parameters: air flow rate, water/ammonia flow rate and the amount of fine dust particles. The results from the temperature readings show the temperature of uncoated thermal couple is uniformly higher than that of coated thermal couple for each operational condition. Analysis of Variances (ANOVA) was computed based on the results from systematic tests to screen out the significant factors and/or interactions. The temperature difference was used as dependent variable and three operational parameters (i.e. air flow rate, water/ammonia flow rate and amount of fine dust particle) were used as independent factors. The ANOVA results show that the operational parameters are not the statistically significant factors affecting the temperature readings which indicate that the coated thermal couple could be applied to temperature measurement in gasifier. The actual temperature reading with the coated thermal couple in

  1. Energetic evaluation of low potential biomass gasifier coupled with a burner of the produced gas for generation of heat; Avaliacao energetica de um gaseificador de biomassa de baixa potencia, associado a um combustor do gas produzido, para geracao de calor

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Samuel [Universidade de Brasilia (FAV/UNB), DF (Brazil). Fac. de Agronomia e Medicina Veterinaria], email: samuelmartin@unb.nr; Silva, Jadir Nogueira [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Engenharia Agricola; Machado, Cassio Silva; Zanatta, Fabio Luis; Galvarro, Svetlana F.S. [Universidade Federal de Vicosa (UFV), MG (Brazil)

    2011-07-01

    In the search of alternatives for sustainable socio-economic development, this study had the objective of evaluating the energetic performance of a concurrent flow biomass gasifier associated with a burner for the gas produced which was of low potential for air heating using a renewable energy source (substituting non-renewable). In this system 4 tests were performed using eucalyptus chips (tests 1 and 2) and logs (tests 3 and 4) as fuel, for the two fan motor frequencies of 60 and 50 hertz. Temperature in the combustion chamber was monitored, along with fuel consumption and other variables. In the tests, the average exhaust air temperature was maintained between 92.7 and 100.4 deg C, and the reduction in the motor frequency from 60 to 50 Hz caused an increase in the duration of the tests. The system presented the best energetic performance when utilizing a frequency of 60 Hz for both fuel types. However, the results of energy efficiency varied very little when comparing tests performed at the same fan frequency. Thus, the gasification process was little affected by variation in the physical characteristics of the tested fuels, and it was recommended that the equipment operate with a frequency of 60 Hz. (author)

  2. Ash deposition and high temperature corrosion at combustion of aggressive fuels

    Energy Technology Data Exchange (ETDEWEB)

    Hede Larsen, O. [I/S Fynsvaerket, Faelleskemikerne, Odense (Denmark); Henriksen, N. [Elsamprojekt A/S, Faelleskemikerne, Fredericia (Denmark)

    1996-12-01

    In order to reduce CO{sub 2} emission, ELSAM is investigating the possibilities of using biomass - mainly straw - for combustion in high efficiency power plants. As straw has very high contents of chlorine and potassium, a fuel with high corrosion and ash deposition propensities has been introduced. ELSAM has investigated 3 ultra supercritical boiler concepts for combustion of straw alone or together with coal: (1) PF boilers with a relatively low share of straw, (2) CFB boilers with low to high share of straw and (3) vibrating grate boilers with 100% straw. These investigations has mainly been full-scale tests with straw fed into existing boilers. Corrosion tests have been performed in these boilers using temperature regulated probes and in-plant test tubes in existing superheaters. The corrosion has been determined by detailed measurements of wall thickness reduction and light optical microscopic measurements of the material degradation due to high temperature corrosion. Corrosion mechanisms have been evaluated using SEM/EDX together with thermodynamical considerations based on measurements of the chemical environment in the flue gas. Ash deposition is problematic in CFB boilers and in straw fired boilers, especially in years with high potassium and chlorine content of the straw. This ash deposition also is related to condensation of KCl and can probably only be handled by improved cleaning devices. (EG)

  3. Advancement of High Temperature Black Liquor Gasification Technology

    Energy Technology Data Exchange (ETDEWEB)

    Craig Brown; Ingvar Landalv; Ragnar Stare; Jerry Yuan; Nikolai DeMartini; Nasser Ashgriz

    2008-03-31

    Weyerhaeuser operates the world's only commercial high-temperature black liquor gasifier at its pulp mill in New Bern, NC. The unit was started-up in December 1996 and currently processes about 15% of the mill's black liquor. Weyerhaeuser, Chemrec AB (the gasifier technology developer), and the U.S. Department of Energy recognized that the long-term, continuous operation of the New Bern gasifier offered a unique opportunity to advance the state of high temperature black liquor gasification toward the commercial-scale pressurized O2-blown gasification technology needed as a foundation for the Forest Products Bio-Refinery of the future. Weyerhaeuser along with its subcontracting partners submitted a proposal in response to the 2004 joint USDOE and USDA solicitation - 'Biomass Research and Development Initiative'. The Weyerhaeuser project 'Advancement of High Temperature Black Liquor Gasification' was awarded USDOE Cooperative Agreement DE-FC26-04NT42259 in November 2004. The overall goal of the DOE sponsored project was to utilize the Chemrec{trademark} black liquor gasification facility at New Bern as a test bed for advancing the development status of molten phase black liquor gasification. In particular, project tasks were directed at improvements to process performance and reliability. The effort featured the development and validation of advanced CFD modeling tools and the application of these tools to direct burner technology modifications. The project also focused on gaining a fundamental understanding and developing practical solutions to address condensate and green liquor scaling issues, and process integration issues related to gasifier dregs and product gas scrubbing. The Project was conducted in two phases with a review point between the phases. Weyerhaeuser pulled together a team of collaborators to undertake these tasks. Chemrec AB, the technology supplier, was intimately involved in most tasks, and focused primarily on the

  4. NUMERICAL PREDICTION OF BUBBLE SIZE AND INTERFACIAL AREA CONCENTRATION IN THE LIQUID BATH OF AN ENTRAINED-FLOW COAL GASIFIER

    Directory of Open Access Journals (Sweden)

    Xuan Wu

    Full Text Available Abstract A CFD-ABND coupling model was used to study the flow characteristic of gas-liquid two-phase flow in the process of gas passing through the liquid bath of a water-coal-slurry entrained-flow gasifier. In this model, an average bubble number density (ABND approach was employed and merged with the two-fluid model. A two-phase version of the RNG k-ε turbulence model was used for the liquid and gas, respectively. Comparisons of computational results with experimental data are done. The results show that the gas gathers along the outer wall of the cooling pipe and rises. The higher turbulent kinetic energy of gas and liquid, the larger bubble and the higher interfacial area concentration exist mainly near the exit and outer wall of the cooling pipe. The existence of a separator inserter is very helpful to strengthen the turbulence between gas and liquid; this can reduce the bubble diameter and increase the interfacial area effectively.

  5. Allothermal steam gasification of biomass in cyclic multi-compartment bubbling fluidized-bed gasifier/combustor - new reactor concept.

    Science.gov (United States)

    Iliuta, Ion; Leclerc, Arnaud; Larachi, Faïçal

    2010-05-01

    A new reactor concept of allothermal cyclic multi-compartment fluidized bed steam biomass gasification is proposed and analyzed numerically. The concept combines space and time delocalization to approach an ideal allothermal gasifier. Thermochemical conversion of biomass in periodic time and space sequences of steam biomass gasification and char/biomass combustion is simulated in which the exothermic combustion compartments provide heat into an array of interspersed endothermic steam gasification compartments. This should enhance unit heat integration and thermal efficiency and procure N(2)-free biosyngas with recourse neither to oxygen addition in steam gasification nor contact between flue and syngas. The dynamic, one-dimensional, multi-component, non-isothermal model developed for this concept accounts for detailed solid and gas flow dynamics whereupon gasification/combustion reaction kinetics, thermal effects and freeboard-zone reactions were tied. Simulations suggest that allothermal operation could be achieved with switch periods in the range of a minute supporting practical feasibility for portable small-scale gasification units. Copyright 2009 Elsevier Ltd. All rights reserved.

  6. Hydrodynamics of a dual fluidized-bed gasifier. Part 1: Simulation of a riser with gas injection and diffuser

    Energy Technology Data Exchange (ETDEWEB)

    Loeffler, G.; Kaiser, S.; Bosch, K.; Hofbauer, H. [Vienna Univ. of Technology, Inst. of Chemical Engineering, Fuel Technology and Environmental Technology, Vienna (Austria)

    2003-09-01

    Circulating fluidized beds often apply secondary gas injections and diffusers in the riser. These strongly affect the fluid dynamics of the gas-solid flow in the system. This work is performed to study these effects in a cold flow model of an 8 MW{sub th} biomass gasifier. It is shown that in the diffuser there is a bulb of the suspension flow, which enhances the internal solids recirculation by a factor of 3.5. Thus, the solids hold-up and the pressure drop in the diffuser are significantly increased. The study on the effect of gas injection confirms that the solids circulation rate is more enhanced by gas injections in the lower part of the riser than in the upper part. From the investigated operating parameters, the gas flow rates and the particle diameter have the strongest effects on solids circulation and mass distribution in the riser. The effect of riser geometry properties, besides the cross-section areas and the total height, was found to be small. (Author)

  7. Syngas production from olive tree cuttings and olive kernels in a downdraft fixed-bed gasifier

    Energy Technology Data Exchange (ETDEWEB)

    Skoulou, V.; Zabaniotou, A. [Laboratory of Plant Design, Department of Chemical Engineering, Aristotle University of Thessaloniki, University Box 455, University Campus, Thessaloniki 54124 (Greece); Stavropoulos, G.; Sakelaropoulos, G. [Chemical Process Engineering Laboratory (CPEL), Department of Chemical Engineering, Aristotle University of Thessaloniki, University Box 455, University Campus, Thessalonki 54124 (Greece)

    2008-02-15

    This study presents a laboratory fixed-bed gasification of olive kernels and olive tree cuttings. Gasification took place with air, in a temperature range of 750-950 C, for various air equivalence ratios (0.14-0.42) and under atmospheric pressure. In each run, the main components of the gas phase were CO, CO{sub 2}, H{sub 2} and CH{sub 4}. Experimental results showed that gasification with air at high temperatures (950 C) favoured gas yields. Syngas production increased with reactor temperature, while CO{sub 2}, CH{sub 4}, light hydrocarbons and tar followed the opposite trend. An increase of the air equivalence ratio decreased syngas production and lowered the product gas heating value, while favouring tar destruction. It was found that gas from olive tree cuttings at 950 C and with an air equivalence ratio of 0.42 had a higher LHV (9.41MJ/Nm{sup 3}) in comparison to olive kernels (8.60MJ/Nm{sup 3}). Olive kernels produced more char with a higher content of fixed carbon (16.39 w/w%) than olive tree cuttings; thus, they might be considered an attractive source for carbonaceous material production. (author)

  8. LIQUID BIO-FUEL PRODUCTION FROM NON-FOOD BIOMASS VIA HIGH TEMPERATURE STEAM ELECTROLYSIS

    Energy Technology Data Exchange (ETDEWEB)

    G. L. Hawkes; J. E. O' Brien; M. G. McKellar

    2011-11-01

    Bio-Syntrolysis is a hybrid energy process that enables production of synthetic liquid fuels that are compatible with the existing conventional liquid transportation fuels infrastructure. Using biomass as a renewable carbon source, and supplemental hydrogen from high-temperature steam electrolysis (HTSE), bio-syntrolysis has the potential to provide a significant alternative petroleum source that could reduce US dependence on imported oil. Combining hydrogen from HTSE with CO from an oxygen-blown biomass gasifier yields syngas to be used as a feedstock for synthesis of liquid transportation fuels via a Fischer-Tropsch process. Conversion of syngas to liquid hydrocarbon fuels, using a biomass-based carbon source, expands the application of renewable energy beyond the grid to include transportation fuels. It can also contribute to grid stability associated with non-dispatchable power generation. The use of supplemental hydrogen from HTSE enables greater than 90% utilization of the biomass carbon content which is about 2.5 times higher than carbon utilization associated with traditional cellulosic ethanol production. If the electrical power source needed for HTSE is based on nuclear or renewable energy, the process is carbon neutral. INL has demonstrated improved biomass processing prior to gasification. Recyclable biomass in the form of crop residue or energy crops would serve as the feedstock for this process. A process model of syngas production using high temperature electrolysis and biomass gasification is presented. Process heat from the biomass gasifier is used to heat steam for the hydrogen production via the high temperature steam electrolysis process. Oxygen produced form the electrolysis process is used to control the oxidation rate in the oxygen-blown biomass gasifier. Based on the gasifier temperature, 94% to 95% of the carbon in the biomass becomes carbon monoxide in the syngas (carbon monoxide and hydrogen). Assuming the thermal efficiency of the power

  9. Modeling of a Large-Scale High Temperature Regenerative Sulfur Removal Process

    DEFF Research Database (Denmark)

    Konttinen, Jukka T.; Johnsson, Jan Erik

    1999-01-01

    Regenerable mixed metal oxide sorbents are prime candidates for the removal of hydrogen sulfide from hot gasifier gas in the simplified integrated gasification combined cycle (IGCC) process. As part of the regenerative sulfur removal process development, reactor models are needed for scale......-up. Steady-state kinetic reactor models are needed for reactor sizing, and dynamic models can be used for process control design and operator training. The regenerative sulfur removal process to be studied in this paper consists of two side-by-side fluidized bed reactors operating at temperatures of 400...... model that does not account for bed hydrodynamics. The pilot-scale test run results, obtained in the test runs of the sulfur removal process with real coal gasifier gas, have been used for parameter estimation. The validity of the reactor model for commercial-scale design applications is discussed....

  10. Development of Mercury and Hydrogen Chloride Emission Monitors for Coal Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    G. Norton; D. Eckels; C. Chriswell

    2001-02-26

    The gas conditioning issues involved with coal gasification streams are very complex and do not have simple solutions. This is particularly true in view of the fact that the gas conditioning system must deal with tars, high moisture contents, and problems with NH{sub 3} without affecting low ppb levels of Hg, low levels (low ppm or less) of HCl, or the successful operation of conditioner components and analytical systems. Those issues are far from trivial. Trying to develop a non-chemical system for gas conditioning was very ambitious in view of the difficult sampling environment and unique problems associated with coal gasification streams. Although a great deal was learned regarding calibration, sample transport, instrumentation options, gas stream conditioning, and CEM design options, some challenging issues still remain. Sample transport is one area that is often not adequately considered. Because of the gas stream composition and elevated temperatures involved, special attention will need to be given to the choice of materials for the sample line and other plumbing components. When using gas stream oxidation, there will be sample transport regions under oxidizing as well as reducing conditions, and each of those regions will require different materials of construction for sample transport. The catalytic oxidation approach worked well for removal of tars and NH{sub 3} on a short term basis, but durability issues related to using the catalyst tube during extended testing periods still require study.

  11. Experimental study of biomass gasification with oxygen-enriched air in fluidized bed gasifier.

    Science.gov (United States)

    Liu, Lingqin; Huang, Yaji; Cao, Jianhua; Liu, Changqi; Dong, Lu; Xu, Ligang; Zha, Jianrui

    2018-01-17

    Considering the universality, renewability and cleanness of biomass, an experimental research is carried out using rice straw in a two-stage fluidized bed. The experimental analysis identified the relevant parameters in the operation of the two-stage fluidized bed to investigate the properties of biomass enriched air gasification. Results show that higher gasification temperature is conducive to enhance the gasification performance. An increasing ER is shown to go against adding gas heat value. When oxygen concentration increases from 21% to 45%, the gas heating value increases from 4.00MJ/kg to 5.24MJ/kg and the gasification efficiency increases from 29.60% to 33.59%, which shows higher oxygen concentration is conducive to higher quality gas and higher gasification efficiency. A secondary oxygen injection leads to reduction of tar concentration from 15.78g/Nm 3 to 10.24g/Nm 3 . The optimal secondary oxygen ratio is about 33.00%. When the secondary oxygen ratio increased to 46.86%, monocyclic aromatics reduced from 28.17% to 19.65% and PAHs increased from 34.97% to 44.05%, leading to the increase aromatization of tar. Copyright © 2018 Elsevier B.V. All rights reserved.

  12. Performance evaluation of a ceramic cross-flow filter on a bench-scale coal gasifier. Fourth quarterly report, July 1, 1985--September 30, 1985

    Energy Technology Data Exchange (ETDEWEB)

    Ciliberti, D.F.; Lippert, T.E.

    1985-12-31

    The Department of Energy is currently supporting a program that will aid in the development of cross flow filtration technology as applied to combined cycle power generation with coal gasification. The stated overall goal is to gain information on both the operational and economic feasibility of the implementation of cross flow filtration in various gasifier options. Westinghouse has prepared a comprehensive program that will lead directly to these program goals in an efficient manner. The proposed program is composed of three major technical tasks. Task 1 is directed at the design and actual test of a cross flow filter at a DOE bench scale gasifier. Task 2 is composed of several smaller theoretical and experimental efforts that are intended to firm up areas where engineering and design principles are lacking or considered inadequate. The third task is intended to integrate the results of the first two tasks in a conceptual design and cost analysis such that proper economic perspective for the filter concept can be gained. A brief summary of the approach taken in the technical tasks is presented in the following discussion.

  13. Performance of Ni/dolomite pellet catalyst on gas distribution from cassava rhizome gasification with a modular fixed-bed gasifier.

    Science.gov (United States)

    Sricharoenchaikul, V; Atong, D; Sornkade, P; Nisamaneenate, J

    2017-05-01

    Thermal conversion of cassava rhizome was performed using a modular downdraft gasifier with the addition of Ni-based catalysts as promising tar eliminating and produced gas upgrading techniques. The activities of a synthesized 5% Ni/dolomite pellet catalyst prepared by impregnation method were investigated in a secondary reactor downstream of the gasifier. High reforming activity of the Ni/dolomite pellet catalyst on tar reduction was achieved. The conversion to H 2 and CO was improved via steam reforming of methane and char reaction with CO 2 . Moreover, the formation of CH 4 and C x H y was diminished through the tar or condensable hydrocarbon reformed on the catalyst surface. The carbon and hydrogen conversions of cassava rhizome with prepared catalyst were 83.79% and 61.78%, respectively, at an air flow rate of 1.98 m 3 /hr. At this condition, tar formation was low, while the lower heating value was 4.39 MJ/m 3 and H 2 to CO molar ratio was 1.22. Generally, the addition of a catalyst not only enhanced gas production, but also reduced tar and particulate matter generation; thus, its implementation should help lessen the pollution control requirement and cost of operation, while allowing higher quality fuel gas production.

  14. Experiment Investigation of the Influencing Factors on Bed Agglomeration During Fluidized-Bed Gasification of Biomass Fuels

    Science.gov (United States)

    Chen, Y. Q.; Chen, H. P.; Yang, H. P.; Wang, X. H.; Zhang, S. H.

    With the depleting of fossil fuel and environmental polluting increasing, the utilization of biomass resources caught increasing concern. Biomass gasification in fluidized bed, as one promising technology, developed quickly. However, serious agglomeration was displayed as biomass ash reacted with bed material (silica sand) at higher temperature. It hindered the wide utilization of CFB gasifier. The objective ofthis work is to investigate the agglomeration behavior between biomass ash and silica sand, and catch the inherent mechanism. Firstly, the influence of ash compounds on the agglomeration behavior was analyzed with biomass ash and synthesis ash compounds addition in fixed bed as ash sample mixed with bed material evenly before every trial. The reaction temperature was set 850°C that is the operated temperature for many fluidized bed gasificated biomass fuels. Then the influence of reaction time was analyzed. The characteristics of the agglomerated silica sand particles were analyzed by the XRD. Finally, it was simulated with HSC computer mode based on thermodynamic equilibrium. It was observed that when the ratio of the biomass ash to the silica sand was above 0.2, the agglomeration was observed. With the increase of the reaction time, more silica sand particles agglomerated with the biomass ash. There are two kinds of silicate eutecticum investigated by the XRD. It is of great significance for the running ofCFB biomass gasifier and the development ofbiomass utilization technology.

  15. Gasification of algal biomass (Cladophora glomerata L.) with CO2/H2O/O2in a circulating fluidized bed.

    Science.gov (United States)

    Ebadi, Abdol Ghaffar; Hisoriev, Hikmat

    2017-11-28

    Gasification is one of the most important thermochemical routes to produce both synthesis gas (syngas) and chars. The quality of produced syngas wieldy depends on the operating conditions (temperature, residence time, heating rate, and gasifying agent), hydrodynamic properties of gasifier (particle size, minimum fluidization velocity, and gasifier size), and type of feedstock (coal, biomass, oil, and municipal solid wastes). In the present study, simulation of syngas production via circulating fluidized bed (CFB) gasification of algal biomass (Cladophora glomerata L.) at different gasifying agents and particle sizes was carried out, using Aspen Plus simulator. The model which has been validated by using experimental data of the technical literature was used to evaluate the influence of operating conditions on gas composition and performance parameters. The results show that biomass gasification using pure oxygen as the gasification agent has great potential to improve the caloric value of produced gas and performance indicators. It was also found that the produced gas caloric value, syngas yield, and performance parameters (CCE and CGE) increase with reaction temperature but are inversely proportional to the biomass particle size.

  16. Analysis of the fly ash from the processing of wood chips in a pilot-scale downdraft gasifier: Comparison of inorganic constituents determined by PIXE and ICP-AES

    Science.gov (United States)

    Thomas L Eberhardt; Hui Pan

    2013-01-01

    Gasification of biomass ultimately generates at least one solid byproduct in which the inorganic constituents of the biomass are concentrated. Given the potential for utilization, or issues with disposal, facile methods are needed for determining the compositions of the fly ashes from recently-available gasifier-based bioenergy systems. Proton induced x-ray emission...

  17. Gasification Reaction Characteristics of Ferro-Coke at Elevated Temperatures

    Science.gov (United States)

    Wang, Peng; Zhang, Jian-liang; Gao, Bing

    2017-01-01

    In this paper, the effects of temperature and atmosphere on the gasification reaction of ferro-coke were investigated in consideration of the actual blast furnace conditions. Besides, the microstructure of the cokes was observed by scanning electron microscope (SEM). It is found that the weight loss of ferro-coke during the gasification reaction is significantly enhanced in the case of increasing either the reaction temperature or the CO2 concentration. Furthermore, compared with the normal type of metallurgical coke, ferro-coke exhibits a higher weight loss when they are gasified at the same temperature or under the same atmosphere. As to the microstructure, inside the reacted ferro-coke are a large amount of pores. Contrary to the normal coke, the proportions of the large-size pores and the through holes are greatly increased after gasification, giving rise to thinner pore walls and hence a degradation in coke strength after reaction (CSR).

  18. Numerical Studies of the Gas-Solid Hydrodynamics at High Temperature in the Riser of a Bench-Scale Circulating Fluidized Bed

    Directory of Open Access Journals (Sweden)

    Maximilian J. Hodapp

    2012-01-01

    Full Text Available The hydrodynamics of circulating fluidized beds (CFBs is a complex phenomenon that can drastically vary depending on operational setup and geometrical configuration. A research of the literature shows that studies for the prediction of key variables in CFB systems operating at high temperature still need to be implemented aiming at applications in energy conversion, such as combustion, gasification, or fast pyrolysis of solid fuels. In this work the computational fluid dynamics (CFD technique was used for modeling and simulation of the hydrodynamics of a preheating gas-solid flow in a cylindrical bed section. For the CFD simulations, the two-fluid approach was used to represent the gas-solid flow with the k-epsilon turbulence model being applied for the gas phase and the kinetic theory of granular flow (KTGF for the properties of the dispersed phase. The information obtained from a semiempirical model was used to implement the initial condition of the simulation. The CFD results were in accordance with experimental data obtained from a bench-scale CFB system and from predictions of the semiempirical model. The initial condition applied in this work was shown to be a viable alternative to a more common constant solid mass flux boundary condition.

  19. INNOVATIVE INSTRUMENTATION AND ANALYSIS OF THE TEMPERATURE MEASUREMENT FOR HIGH TEMPERATURE GASIFICATION

    Energy Technology Data Exchange (ETDEWEB)

    Seong W. Lee

    2005-04-01

    The systematic tests of the gasifier simulator on the ultrasonic vibration application for cleaning method were completed in this reporting period. Within the systematic tests on the ultrasonic vibration application, the ambient temperature and high temperature status condition were tested separately. The sticky dirt on the thermocouple tip was simulated by the cement-covered layer on the thermocouple tip. At the ambient temperature status, four (4) factors were considered as the input factors affecting the response variable of peeling off rate. The input factors include the shape of the cement-covered layer (thickness and length), the ultrasonic vibration output power, and application time. At the high temperature tests, four (4) different environments were considered as the experimental parameters including air flow supply, water and air supply environment, water/air/fine dust particle supply, and air/water/ammonia/fine dust particle supply environment. The factorial design method was used in the experiment design with twelve (12) data sets of readings. Analysis of Variances (ANOVA) was applied to the results from systematic tests. The ANOVA results show that the thickness and length of the cement-covered layer have the significant impact on the peeling off rate of ultrasonic vibration application at the ambient temperature environment. For the high temperature tests, the different environments do not seem to have significant impact on the temperature changes. These results may indicate that the ultrasonic vibration is one of best cleaning methods for the thermocouple tip.

  20. The Effect of Temperature on the Gasification Process

    Directory of Open Access Journals (Sweden)

    Marek Baláš

    2012-01-01

    Full Text Available Gasification is a technology that uses fuel to produce power and heat. This technology is also suitable for biomass conversion. Biomass is a renewable energy source that is being developed to diversify the energy mix, so that the Czech Republic can reduce its dependence on fossil fuels and on raw materials for energy imported from abroad. During gasification, biomass is converted into a gas that can then be burned in a gas burner, with all the advantages of gas combustion. Alternatively, it can be used in internal combustion engines. The main task during gasification is to achieve maximum purity and maximum calorific value of the gas. The main factors are the type of gasifier, the gasification medium, biomass quality and, last but not least, the gasification mode itself. This paper describes experiments that investigate the effect of temperature and pressure on gas composition and low calorific value. The experiments were performed in an atmospheric gasifier in the laboratories of the Energy Institute atthe Faculty of Mechanical Engineering, Brno University of Technology.

  1. Multiplexed Sensor for Synthesis Gas Compsition and Temperature

    Energy Technology Data Exchange (ETDEWEB)

    Steven Buckley; Reza Gharavi; Marco Leon

    2007-10-01

    The overall goal of this project has been to develop a highly sensitive, multiplexed TDL-based sensor for CO{sub 2}, CO, H{sub 2}O (and temperature), CH{sub 4}, H{sub 2}S, and NH{sub 3}. Such a sensor was designed with so-called 'plug-and-play' characteristics to accommodate additional sensors, and provided in situ path-integrated measurements indicative of average concentrations at speeds suitable for direct gasifier control. The project developed the sensor and culminated in a real-world test of the underlying technology behind the sensor. During the project, new underlying measurements of spectroscopic constants for all of the gases of interest performed, in custom cells built for the project. The envisioned instrument was built from scratch from component lasers, fiber optics, amplifier blocks, detectors, etc. The sensor was tested for nearly a week in an operational power plant. The products of this research are expected to have a direct impact on gasifier technology and the production of high-quality syngas, with substantial broader application to coal and other energy systems. This report is the final technical report on project DE-FG26-04NT42172. During the project we completed all of the milestones planned in the project, with a modification of milestone (7) required due to lack of funding and personnel.

  2. Ultra-High Temperature Distributed Wireless Sensors

    Energy Technology Data Exchange (ETDEWEB)

    May, Russell; Rumpf, Raymond; Coggin, John; Davis, Williams; Yang, Taeyoung; O' Donnell, Alan; Bresnahan, Peter

    2013-03-31

    Research was conducted towards the development of a passive wireless sensor for measurement of temperature in coal gasifiers and coal-fired boiler plants. Approaches investigated included metamaterial sensors based on guided mode resonance filters, and temperature-sensitive antennas that modulate the frequency of incident radio waves as they are re-radiated by the antenna. In the guided mode resonant filter metamaterial approach, temperature is encoded as changes in the sharpness of the filter response, which changes with temperature because the dielectric loss of the guided mode resonance filter is temperature-dependent. In the mechanically modulated antenna approach, the resonant frequency of a vibrating cantilever beam attached to the antenna changes with temperature. The vibration of the beam perturbs the electrical impedance of the antenna, so that incident radio waves are phase modulated at a frequency equal to the resonant frequency of the vibrating beam. Since the beam resonant frequency depends on temperature, a Doppler radar can be used to remotely measure the temperature of the antenna. Laboratory testing of the guided mode resonance filter failed to produce the spectral response predicted by simulations. It was concluded that the spectral response was dominated by spectral reflections of radio waves incident on the filter. Laboratory testing of the mechanically modulated antenna demonstrated that the device frequency shifted incident radio waves, and that the frequency of the re-radiated waves varied linearly with temperature. Radio wave propagation tests in the convection pass of a small research boiler plant identified a spectral window between 10 and 13 GHz for low loss propagation of radio waves in the interior of the boiler.

  3. Constructive aspects and economical study of a 100 kg/h down draft biomass lignocellulose gasifier; Aspectos constructivos y estudio economico financiero de un gasificador de biomasa lignocelulosica downdraft

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Christian Coronado; Silveira, Jose Luz [Universidade Estadual Paulista (UNESP), Guaratingueta, SP (Brazil). Fac. de Engenharia], e-mail: christian@feg.unesp.br, e-mail: joseluz@feg.unesp.br; Perez, Jesus Arauzo [Universidad de Zaragoza (UNIZAR), Zaragoza (Spain). Dept. de Ingenieria Quimica y Tecnologias del Medio Ambiente. Centro Politecnico Superior], e-mail: qtarauzo@unizar.es

    2006-07-01

    This work consists in the development of a gasifier of 100 k W for an internal combustion engine, which includes the sizing process and the technical analysis. The availability of biomass resources and the application of system in the national energetic point of view are relevant. The gasifier will be feeding with 100 kg/h and the construction specific parameters are related with this particular quantity of biomass; for every case, air will be used as a gasifier agent. The study of economic feasibility depends the initial investment that involves engine cost as well as the gasification zone cost, and operating and maintenance costs; the lifetime of the plant will be considered to 15 years furthermore; the annual income would be considered as the saving that a particular isolated community would get in the case of a almost impossible to the national grid connection. Finally with these dates and assuming the real taxes such as interest, depreciation values and positives profit, was obtained a T IR of 11% and a VAN that achieve 33160,5 (US$) just as the respective payback of four years. (author)

  4. Electricity cogeneration evaluation from cane bagasse in gasifier systems/gas turbine; Avaliacao da cogeracao de eletricidade a partir de bagaco de cana em sistemas de gaseificador/turbina a gas

    Energy Technology Data Exchange (ETDEWEB)

    Coelho, Suani Teixeira

    1992-07-01

    Before the beginning of PROALCOOL in 1975, the first effective program in the world using biomass in large scale as an automotive fuel, sugar/alcohol industries already used sugar cane bagasse - a by-product of sugar/alcohol production - to generate energy for sugar production. Currently, besides the fact that they are self-sufficient in thermal/electrical energy, sugar/alcohol industries produce small electricity excess which is exported to local utilities. Gasifier/gas turbine systems are more advanced technologies which are being developed and shall be commercialized in eight to ten years approximately, presenting much higher efficiency, at low cost and inducing more exportable electricity. In this study, possibilities of gasifier/gas turbine systems are evaluated and projections of bagasse based electricity production are presented, until year 2010, for Sao Paulo state and Brazil. Generation costs of gasified bagasse based electricity are calculated: they shall be lower than electricity cost from fossil origin. Influence of electricity sale on the reduction of alcohol production cost are also evaluated for several opportunity costs of bagasse. Environmental and social impacts are analyzed, including evaluation of the cost of avoided carbon, related to the substitution of fossil fuel by sugar cane bagasse in thermoelectric power plants. (author)

  5. Bio-Fuel Production Assisted with High Temperature Steam Electrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Grant Hawkes; James O' Brien; Michael McKellar

    2012-06-01

    Two hybrid energy processes that enable production of synthetic liquid fuels that are compatible with the existing conventional liquid transportation fuels infrastructure are presented. Using biomass as a renewable carbon source, and supplemental hydrogen from high-temperature steam electrolysis (HTSE), these two hybrid energy processes have the potential to provide a significant alternative petroleum source that could reduce dependence on imported oil. The first process discusses a hydropyrolysis unit with hydrogen addition from HTSE. Non-food biomass is pyrolyzed and converted to pyrolysis oil. The pyrolysis oil is upgraded with hydrogen addition from HTSE. This addition of hydrogen deoxygenates the pyrolysis oil and increases the pH to a tolerable level for transportation. The final product is synthetic crude that could then be transported to a refinery and input into the already used transportation fuel infrastructure. The second process discusses a process named Bio-Syntrolysis. The Bio-Syntrolysis process combines hydrogen from HTSE with CO from an oxygen-blown biomass gasifier that yields syngas to be used as a feedstock for synthesis of liquid synthetic crude. Conversion of syngas to liquid synthetic crude, using a biomass-based carbon source, expands the application of renewable energy beyond the grid to include transportation fuels. It can also contribute to grid stability associated with non-dispatchable power generation. The use of supplemental hydrogen from HTSE enables greater than 90% utilization of the biomass carbon content which is about 2.5 times higher than carbon utilization associated with traditional cellulosic ethanol production. If the electrical power source needed for HTSE is based on nuclear or renewable energy, the process is carbon neutral. INL has demonstrated improved biomass processing prior to gasification. Recyclable biomass in the form of crop residue or energy crops would serve as the feedstock for this process. A process model

  6. On a clean power generation system with the co-gasification of biomass and coal in a quadruple fluidized bed gasifier.

    Science.gov (United States)

    Yan, Linbo; He, Boshu

    2017-07-01

    A clean power generation system was built based on the steam co-gasification of biomass and coal in a quadruple fluidized bed gasifier. The chemical looping with oxygen uncoupling technology was used to supply oxygen for the calciner. The solid oxide fuel cell and the steam turbine were combined to generate power. The calcium looping and mineral carbonation were used for CO 2 capture and sequestration. The aim of this work was to study the characteristics of this system. The effects of key operation parameters on the system total energy efficiency (ŋ ten ), total exergy efficiency (ŋ tex ) and carbon sequestration rate (R cs ) were detected. The energy and exergy balance calculations were implemented and the corresponding Sankey and Grassmann diagrams were drawn. It was found that the maximum energy and exergy losses occurred in the steam turbine. The system ŋ ten and ŋ tex could be ∼50% and ∼47%, and R cs could be over unit. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Biomass gasification cogeneration – A review of state of the art technology and near future perspectives

    DEFF Research Database (Denmark)

    Ahrenfeldt, Jesper; Thomsen, Tobias; Henriksen, Ulrik Birk

    2013-01-01

    in future energy systems. Thermal gasification of biomass is proved throughout this article to be both highly flexible and efficient if used optimally. Cogeneration processes with production of heat-and-power, heat-power-and-fuel or heat-power-and-fertilizer are described and compared. The following...... gasification platforms are included in the assessment: The Harboøre up draft gasifier with gas engine, the Güssing FICFB gasifier with gas engine or PDU, the LT-CFB gasifier with steam cycle and nutrient recycling and finally the TwoStage down draft gasifier with gas engine, micro gas turbine (MGT), SOFC, SOFC...

  8. Improved Materials for High-Temperature Black Liquor Gasification

    Energy Technology Data Exchange (ETDEWEB)

    Keiser, J.R.; Hemrick, J.G.; Gorog, J.P.; Leary, R.

    2006-06-29

    The laboratory immersion test system built and operated at ORNL was found to successfully screen samples from numerous refractory suppliers, including both commercially available and experimental materials. This system was found to provide an accurate prediction of how these materials would perform in the actual gasifier environment. Test materials included mullites, alumino-silicate bricks, fusion-cast aluminas, alumina-based and chrome-containing mortars, phosphate-bonded mortars, coated samples provided under an MPLUS-funded project, bonded spinels, different fusion-cast magnesia-alumina spinels with magnesia content ranging from 2.5% to about 60%, high-MgO castable and brick materials, spinel castables, and alkali-aluminate materials. This testing identified several candidate material systems that perform well in the New Bern gasifier. Fusion-cast aluminas were found to survive for nearly one year, and magnesia-alumina spinels have operated successfully for 18 months and are expected to survive for two years. Alkali-aluminates and high-MgO-content materials have also been identified for backup lining applications. No other material with a similar structure and chemical composition to that of the fusion-cast magnesium-aluminum spinel brick currently being used for the hot-face lining is commercially available. Other materials used for this application have been found to have inferior service lives, as previously discussed. Further, over 100 laboratory immersion tests have been performed on other materials (both commercial and experimental), but none to date has performed as well as the material currently being used for the hot-face lining. Operating experience accumulated with the high-temperature gasifier at New Bern, North Carolina, has confirmed that the molten alkali salts degrade many types of refractories. Fusion-cast alumina materials were shown to provide a great improvement in lifetime over materials used previously. Further improvement was realized

  9. Release of inorganic trace elements from high-temperature gasification of coal

    Energy Technology Data Exchange (ETDEWEB)

    Blaesing, Marc

    2012-05-30

    The development of cleaner, more efficient techniques in next-generation coal power plants is becoming increasingly important, especially regarding to the discussion of the influence of CO{sub 2} emissions on global warming. A promising coal utilisation process is the integrated gasification combined cycle process. The direct use of the raw gas requires gas clean-up to prevent downstream parts of the gasifier from several problems. An increased efficiency and a decreased amount of harmful species can be achieved through hot fuel gas cleaning. This clean-up technique requires a comprehensive knowledge of the release characteristics of inorganic coal constituents. The aim of this thesis was to provide enhanced knowledge of the effect of key process parameters and of the chemical constitution of coal on the release of Na, K, S, and Cl species from high-temperature coal gasification. The experimental setup consisted of atmospheric flow tube furnaces and a pressurised furnace. In-situ analysis of the product gas was carried out using molecular beam mass spectrometry. A broad spectrum of different coals with assumed qualitative and quantitative differences in the release characteristics was investigated. Additionally, experiments with model substances were performed. The results of the experimental investigation were compared with thermodynamic calculations. Finally, recommendations, for the operation of a high-temperature gasifier are formulated. (orig.)

  10. In situ CO{sub 2} capture in a dual fluidized bed biomass steam gasifier - bed material and fuel variation

    Energy Technology Data Exchange (ETDEWEB)

    Soukup, G.; Pfeifer, C.; Kreuzeder, A.; Hofbauer, H. [Institute of Chemical Engineering, Vienna University of Technology, Vienna (Austria)

    2009-03-15

    The AER (absorption enhanced reforming) process, based on the dual fluidized bed steam gasification process, uses a bed material which, apart from its function as heat carrier, acts as a CO{sub 2} transporting agent and selectively transfers CO{sub 2} from the gasification reactor to the combustion reactor. Thus, a hydrogen-rich gas is produced (H{sub 2} 55..70 vol.-%{sub db}, CH{sub 4} 8..13 vol.-%{sub db}, CO 5..11 vol.-%{sub db} as well as CO{sub 2} 7..20 vol.-%{sub db}). Seven different CaO containing bed materials were tested for their principal applicability to the AER process with special focus on their influence on tar production. The amount of tars was generally found to be five times lower than with conventional gasification (at 850 C) despite the low gasification temperatures (600-700 C). Due to these low gasification temperatures, biomass with high alkali contents (e.g., straw), indicating a low ash melting point (< 800 C), can be used under AER conditions. In summary, the AER process is very effective owing to the integration of the heat of the chemical reaction of CO{sub 2} with CaO and the water-gas shift reaction, which are both exothermic, into the gasification and the internal reforming of primary and secondary tars, which cuts off the formation of higher tars. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

  11. Gasification of high ash, high ash fusion temperature bituminous coals

    Science.gov (United States)

    Liu, Guohai; Vimalchand, Pannalal; Peng, WanWang

    2015-11-13

    This invention relates to gasification of high ash bituminous coals that have high ash fusion temperatures. The ash content can be in 15 to 45 weight percent range and ash fusion temperatures can be in 1150.degree. C. to 1500.degree. C. range as well as in excess of 1500.degree. C. In a preferred embodiment, such coals are dealt with a two stage gasification process--a relatively low temperature primary gasification step in a circulating fluidized bed transport gasifier followed by a high temperature partial oxidation step of residual char carbon and small quantities of tar. The system to process such coals further includes an internally circulating fluidized bed to effectively cool the high temperature syngas with the aid of an inert media and without the syngas contacting the heat transfer surfaces. A cyclone downstream of the syngas cooler, operating at relatively low temperatures, effectively reduces loading to a dust filtration unit. Nearly dust- and tar-free syngas for chemicals production or power generation and with over 90%, and preferably over about 98%, overall carbon conversion can be achieved with the preferred process, apparatus and methods outlined in this invention.

  12. Hot and Dry Cleaning of Biomass-Gasified Gas Using Activated Carbons with Simultaneous Removal of Tar, Particles, and Sulfur Compounds

    Directory of Open Access Journals (Sweden)

    Kinya Sakanishi

    2012-05-01

    Full Text Available This study proposes a gas-cleaning process for the simultaneous removal of sulfur compounds, tar, and particles from biomass-gasified gas using Fe-supported activated carbon and a water-gas shift reaction. On a laboratory scale, the simultaneous removal of H2S and COS was performed under a mixture of gases (H2/CO/CO2/CH4/C2H4/N2/H2S/COS/steam. The reactions such as COS + H2 → H2S + CO and COS + H2O → H2S + CO2 and the water-gas shift reaction were promoted on the Fe-supported activated carbon. The adsorption capacity with steam was higher than that without steam. On a bench scale, the removal of impurities from a gas derived from biomass gasification was investigated using two activated filters packed with Fe-supported activated carbon. H2S and COS, three- and four-ring polycyclic aromatic hydrocarbons (PAHs, and particles were removed and a water-gas shift reaction was promoted through the first filter at 320–350 °C. The concentrations of H2S and COS decreased to less than 0.1 ppmv. Particles and the one- and two-ring PAHs, except for benzene, were then removed through the second filter at 60–170 °C. The concentration of tar and particles decreased from 2428 to 102 mg Nm−3 and from 2244 to 181 mg Nm−3, respectively.

  13. Improved heat recovery and high-temperature clean-up for coal-gas fired combustion turbines

    Energy Technology Data Exchange (ETDEWEB)

    Barthelemy, N.M.; Lynn, S.

    1991-07-01

    This study investigates the performance of an Improved Heat Recovery Method (IHRM) applied to a coal-gas fired power-generating system using a high-temperature clean-up. This heat recovery process has been described by Higdon and Lynn (1990). The IHRM is an integrated heat-recovery network that significantly increases the thermal efficiency of a gas turbine in the generation of electric power. Its main feature is to recover both low- and high-temperature heat reclaimed from various gas streams by means of evaporating heated water into combustion air in an air saturation unit. This unit is a packed column where compressed air flows countercurrently to the heated water prior to being sent to the combustor, where it is mixed with coal-gas and burned. The high water content of the air stream thus obtained reduces the amount of excess air required to control the firing temperature of the combustor, which in turn lowers the total work of compression and results in a high thermal efficiency. Three designs of the IHRM were developed to accommodate three different gasifying process. The performances of those designs were evaluated and compared using computer simulations. The efficiencies obtained with the IHRM are substantially higher those yielded by other heat-recovery technologies using the same gasifying processes. The study also revealed that the IHRM compares advantageously to most advanced power-generation technologies currently available or tested commercially. 13 refs., 34 figs., 10 tabs.

  14. Steam gasification of various feedstocks at a dual fluidised bed gasifier: Impacts of operation conditions and bed materials

    Energy Technology Data Exchange (ETDEWEB)

    Pfeifer, Christoph; Koppatz, Stefan; Hofbauer, Hermann [Vienna University of Technology, Institute of Chemical Engineering, Vienna (Austria)

    2011-03-15

    Gasification of biomass is an attractive technology for combined heat and power production as well as for synthesis processes such as production of liquid and gaseous biofuels. Dual fluidised bed (DFB) technology offers the advantage of a nearly nitrogen-free product gas mainly consisting of H{sub 2}, CO, CO{sub 2} and CH{sub 4}. The DFB steam gasification process has been developed at Vienna University of Technology over the last 15 years using cold flow models, laboratory units, mathematical modelling and simulation. The main findings of the experimental work at a 100-kW pilot scale unit are presented. Different fuels (wood pellets, wood chips, lignite, coal, etc.) and different bed materials (natural minerals such as olivine, limestones, calcites, etc. as well as modified olivines) have been tested and the influence on tar content as well as gas composition was measured and compared among the different components. Moreover, the influence of operating parameters such as fuel moisture content, steam/fuel ratio and gasification temperature on the product gas has been investigated. DFB steam gasification of solid biomass coupled with CO{sub 2} capture, the so-called absorption enhanced reforming (AER) process, is highlighted. The experiments in pilot scale led to commercial realisation of this technology in demonstration scale. Summarising, the DFB system offers excellent fuel flexibility to be used in advanced power cycles as well as in polygeneration applications. (orig.)

  15. Catalytic Steam Reforming of Gasifier Tars: On-Line Monitoring of Tars with a Transportable Molecular-Beam Mass Spectrometer; Milestone Completion Report

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, D.; Ratcliff, M.; Dayton, D.

    2002-05-01

    of the tar conversion. The gas composition changes were monitored by two identical gas chromatographs (GCs), and modified method 5 sampling was performed to obtain gravimetric conversion data. The combination of these analytical techniques provided definitive catalyst performance data, as well as linkage to previous and on-going work elsewhere. Two catalysts were tested: nickel (Ni) on potassium promoted alumina (Sued-Chemie C11-NK), used commercially for naphtha steam reforming, and alumina (Battelle's DN34) claimed to be effective for gasifier tar decomposition. In addition, sand was tested as an inert reference material.

  16. Business venture-analysis case study relating to the manufacture of gas turbines for the generation of utility electric power. Volume II. Private sector and public sector venture studies. Final report. [Use of coal gasifier with combined gas and steam system

    Energy Technology Data Exchange (ETDEWEB)

    Davison, W.R.

    1978-05-05

    Increasing national attention is being directed toward the search for clean, efficient, and reliable energy-conversion systems, capable of using abundant indigenous fuels such as coal, for generation of utility electric power. A prime candidate in this area is the combined gas and steam (COGAS) system employing a high-temperature gas turbine with a steam-turbine bottoming cycle, fed by a coal gasifier. This program demonstrates the use of a logical and consistent venture-analysis methodology which could also be applied to investigate other high-technology, energy-conversion systems that have yet to reach a state of commercialization but which are of significant interest to the U.S. Government. The venture analysis was performed by using a computer to model the development, production, sales, and in-service development phases of programs necessary to introduce new gas turbines in COGAS systems. The simulations were produced in terms of estimated cash flows, rates of returns, and risks which a manufacturer would experience. Similar simulations were used to estimate public-sector benefits resulting from the lower cost of power and improved environment gained from the use of COGAS systems rather than conventional systems. The study shows that substantial social benefits could be realized and private investment would be made by the gas-turbine manufacturers if an infusion of external funds were made during key portions of the gas-turbine development program. It is shown that there is substantial precedent for such public assistance to make possible economic and environmental benefits that otherwise would not be possible. 42 references.

  17. Removal of dust from flue gas at elevated temperatures and pressures. Roeggasrensning for stoev ved hoej temperatur og hoejt tryk

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, D.V.; Rasmussen, J.

    1989-06-15

    Several new coal-based power generation systems are now ready for commercial application. Especially Integrated coal Gasification with combined Cycle (IGCC) and pressurized Fluidized Bed Combustion possess the potential for reducing emissions of SOx, NOx and particulates compared to conventional technology. In addition to this a decrease in heat-rate is possible. However, the decrease in heat-rate is dependant on the temperature of which the removal of particulated and gaseous pollutants takes place. Using state-of-the-art technology this temperature is 25-40 deg. C, but the efficiency improvement will only be substantial if the temperature can be raised to 400-500 deg. C or more. The coal gasification, which is the heart of an IGCC-system, can be caried out in a number of ways. Since the hot gas clean-up equipment (HGCU) to some extent is dependant on the gasification technology used, a description of the leading coal gasification systems is given. It is concluded that special interest should be given to gasifiers of the entrained flow type. The aim is to develope a HGCU-system for the removal of gaseous pollutants as well as particulate matter. The operating principles and stage of development of the competing technologies for dust removal at high temperature and pressure are described. Special attention is paid to the electrostatic precipitator, and possible solutions to problems related ot this technology are given. (AB) 165 refs.

  18. Temperature measurement

    Science.gov (United States)

    ... an oral temperature. Other factors to take into account are: In general, rectal temperatures are considered to ... urac.org). URAC's accreditation program is an independent audit to verify that A.D.A.M. follows ...

  19. Catalytic combustion over high temperature stable metal oxides

    Energy Technology Data Exchange (ETDEWEB)

    Berg, M. [TPS Termiska Processer AB, Nykoeping (Sweden)

    1996-12-31

    This thesis presents a study of the catalytic effects of two interesting high temperature stable metal oxides - magnesium oxide and manganese substituted barium hexa-aluminate (BMA) - both of which can be used in the development of new monolithic catalysts for such applications. In the first part of the thesis, the development of catalytic combustion for gas turbine applications is reviewed, with special attention to alternative fuels such as low-BTU gas, e.g. produced in an air blown gasifier. When catalytic combustion is applied for such a fuel, the primary advantage is the possibility of decreasing the conversion of fuel nitrogen to NO{sub x}, and achieving flame stability. In the experimental work, MgO was shown to have a significant activity for the catalytic combustion of methane, lowering the temperature needed to achieve 10 percent conversion by 270 deg C compared with homogeneous combustion.The reaction kinetics for methane combustion over MgO was also studied. It was shown that the heterogeneous catalytic reactions were dominant but that the catalytically initiated homogeneous gas phase reactions were also important, specially at high temperatures. MgO and BMA were compared. The latter showed a higher catalytic activity, even when the differences in activity decreased with increasing calcination temperature. For BMA, CO{sub 2} was the only product detected, but for MgO significant amounts of CO and C{sub 2}-hydrocarbons were formed. BMA needed a much lower temperature to achieve total conversion of other fuels, e.g. CO and hydrogen, compared to the temperature for total conversion of methane. This shows that BMA-like catalysts are interesting for combustion of fuel mixtures with high CO and H{sub 2} content, e.g. gas produced from gasification of biomass. 74 refs

  20. Methodology for sizing, energy analysis and selection of equipment for a biomass gasifier to drive an internal combustion engine; Metodologia de dimensionamento, analise energetica e selecao de equipamentos de um gaseificador de biomassa para o acionamento de um motor de combustao interna

    Energy Technology Data Exchange (ETDEWEB)

    Coronado, Christian Rodriguez; Silveira, Jose Luz [Universidade Estadual Paulista (FEG/UNESP), Guaratingueta, SP (Brazil). Fac. de Engenharia], e-mails: christian@feg.unesp.br, joseluz@feg.unesp.br; Arauzo, Jesus Perez [University of Zaragoza (UNIZAR), Zaragoza (Spain). Centro Politecnico Superior. Chemical and Environmental Engineering Dept.], e-mail: qtarauzo@unizar.es

    2006-07-01

    Alter both oil crisis, of 1973 and 1979, a bad effect of the elevated costs and continuously increment of the oil prices was noted, for this reason, the interest for renewable energies sources widely available in developing countries was increased. All over the world, governments have formulated main objectives for energies savings and search for friendly technologies, taking into account the effects related with the environment. The imminent scarcity of fossil fuels has made humanity the rational use of primary energies, as a result of these; new plants with improved technology have been conceived taking into account energy savings and efficiency improvement. In this context, biomass gasification technologies are important, since they consist in techniques of parallel production of electricity and heat from just one fuel. This work consists in the development of a gasifier down draft of 100 kW for an internal combustion engine, which includes its sizing process and its energy analysis. The sizing includes design facts and the parameters of the conditioning systems for the exhaust gas. This part is mainly based in the experience of a work group of the Zaragoza State University - Spain, UNIZAR, specialists in the construction of small down draft gasifiers, for every case, air will be used as a gasifier agent and as biomass forestall. The availability of biomass resources and the application of the national energetic view system are relevant. The gasifier will have a 100 kg/h of feeding, the energetic analysis includes the matter and energy balance and the respective efficient such cold as hot efficient of the exhaust gas. Moreover it will be tried the equipment recommended for the cleaning and conditioning of this gas fuel for this equipment in particular. (author)

  1. The effect of gastric dilatation in rats submitted to gasified water ingestion under the hepatic metabolic function Efeito da dilatação gástrica em ratos submetidos à ingestão de água gaseificada sobre a função metabólica hepática

    OpenAIRE

    José Roberto Ferreira Santiago; Shoiti Kobayasi

    2008-01-01

    INTRODUCTION: The amounts of people that are overweight have been increasing within the population in significant ways during the last decades. In this view, gasified beverages have become an important environmental concern in relation to the eating habits of people, especially who lives in the USA, Mexico, and Brazil. In this order, these three countries constitute the major beverages producers and consumers of the whole world. PURPOSE: To investigate the effects of gastric dilatation in rat...

  2. Advanced High-Temperature, High-Pressure Transport Reactor Gasification

    Energy Technology Data Exchange (ETDEWEB)

    Michael Swanson; Daniel Laudal

    2008-03-31

    The U.S. Department of Energy (DOE) National Energy Technology Laboratory Office of Coal and Environmental Systems has as its mission to develop advanced gasification-based technologies for affordable, efficient, zero-emission power generation. These advanced power systems, which are expected to produce near-zero pollutants, are an integral part of DOE's Vision 21 Program. DOE has also been developing advanced gasification systems that lower the capital and operating costs of producing syngas for chemical production. A transport reactor has shown potential to be a low-cost syngas producer compared to other gasification systems since its high-throughput-per-unit cross-sectional area reduces capital costs. This work directly supports the Power Systems Development Facility utilizing the KBR transport reactor located at the Southern Company Services Wilsonville, Alabama, site. Over 2800 hours of operation on 11 different coals ranging from bituminous to lignite along with a petroleum coke has been completed to date in the pilot-scale transport reactor development unit (TRDU) at the Energy & Environmental Research Center (EERC). The EERC has established an extensive database on the operation of these various fuels in both air-blown and oxygen-blown modes utilizing a pilot-scale transport reactor gasifier. This database has been useful in determining the effectiveness of design changes on an advanced transport reactor gasifier and for determining the performance of various feedstocks in a transport reactor. The effects of different fuel types on both gasifier performance and the operation of the hot-gas filter system have been determined. It has been demonstrated that corrected fuel gas heating values ranging from 90 to 130 Btu/scf have been achieved in air-blown mode, while heating values up to 230 Btu/scf on a dry basis have been achieved in oxygen-blown mode. Carbon conversions up to 95% have also been obtained and are highly dependent on the oxygen-coal ratio

  3. Sensing temperature.

    Science.gov (United States)

    Sengupta, Piali; Garrity, Paul

    2013-04-22

    Temperature is an omnipresent physical variable reflecting the rotational, vibrational and translational motion of matter, what Richard Feynman called the "jiggling" of atoms. Temperature varies across space and time, and this variation has dramatic effects on the physiology of living cells. It changes the rate and nature of chemical reactions, and it alters the configuration of the atoms that make up nucleic acids, proteins, lipids and other biomolecules, significantly affecting their activity. While life may have started in a "warm little pond", as Charles Darwin mused, the organisms that surround us today have only made it this far by devising sophisticated systems for sensing and responding to variations in temperature, and by using these systems in ways that allow them to persist and thrive in the face of thermal fluctuation. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Low temperature (

    NARCIS (Netherlands)

    Rath, J.K.; de Jong, M.; Schropp, R.E.I.

    2008-01-01

    Amorphous silicon films have been made by HWCVD at a very low substrate temperature of ≤ 100 °C (in a dynamic substrate heating mode) without artificial substrate cooling, through a substantial increase of the filament–substrate distance ( 80 mm) and using one straight tantalum filament. The

  5. Dicty_cDB: CFB874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tikysiylvvsynvlpsfyv*vnllisislmnhpliwilnnvlsslkss rdsfftlvnlvss*stislwpli*livssfmmvfqvslvxlilhnlsslv*tlslnls...g*tly--- ---lsecwlvichpilmlkfqs*msvtnhkksiqnsqvplen*linvfatlsfihnsnpm slnh*tlktss

  6. Dicty_cDB: CFB692 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VQVIEGTLSLNNEKGKKKIQSKTLLRQILGNLKDGDSPKETIIIYGLPFHFSGWRKYIQL EGLRKLVGNAMMAQWQNPLIQKQFGIEIPEGNRLREAKYQLKRSISQKKKAD*idqfvqk...VQVIEGTLSLNNEKGKKKIQSKTLLRQILGNLKDGDSPKETIIIYGLPFHFSGWRKYIQL EGLRKLVGNAMMAQWQNPLIQKQFGIEIPEGNRLREAKYQLKRSISQKKKAD*idqfvqk

  7. Dicty_cDB: CFB889 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2001. 6. 1 Translated Amino Acid sequence ---VKGISEALDKFEKETGLDIPIHVDAASGGFVAPFLQPEIVWDFRLPRVKSINGSGHK...Amino Acid sequence (All Frames) Frame A: ---VKGISEALDKFEKETGLDIPIHVDAASGGFVAPFLQPEIVWDFRLPRVKSINGSGHK

  8. Dicty_cDB: CFB729 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 44 7e-06 2 AU010407 |AU010407.1 Schizosaccharomyces pombe cDNA, clone spc05821. 44 7e-06 2 CF923027 |CF923027.1 gmrhRww2...4-02-SP6_G05_1_035 Soybean root hair subtracted cDNA library gmrhRww24 Glycine max cDNA, mRNA

  9. Dicty_cDB: CFB728 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cDNA clone VVB158G03 5, mRNA sequence. 64 4e-07 2 CA813481 |CA813481.1 CA48LN10IF-E8 Cabernet Sauvignon Lea...f - CA48LN Vitis vinifera cDNA clone CA48LN10IF-E8 5', mRNA sequence. 64 5e-07 2 CB341828 |CB341828.2 CA32EN0002_IIIbF_E01 Caberne

  10. Dicty_cDB: CFB753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available icago truncatula cDNA clone NF040A01EC 5', mRNA sequence. 38 1.3 2 AW694950 |AW694950.2 NF081H02ST1F1026 Developing... stem Medicago truncatula cDNA clone NF081H02ST 5', mRNA sequence. 38 1.4 2 AW692968 |AW692968.2 NF061D09ST1F1000 Developing

  11. Dicty_cDB: CFB725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of strain col-0 of Arabidopsis thaliana (thale cress). 64 7e-13 3 BX831354 |BX831354.1 Arabidopsis thaliana...of strain col-0 of Arabidopsis thaliana (thale cress). 64 7e-13 3 AY045584 |AY045584.1 Arabidopsis thaliana...of strain col-0 of Arabidopsis thaliana (thale cress). 64 8e-13 3 BG525546 |BG525546.1 51-5 Stevia field

  12. Recycle of baghouse product at Chatham CFB demonstration: Report

    Energy Technology Data Exchange (ETDEWEB)

    1989-01-01

    The performance of the Chatham circulating fluidized bed unit was satisfactory and the design predictions were met in all areas with the exception of sulphur capture. To obtain 90 percent sulphur dioxide removal, a calcium-sulphur ratio of 2.5 is required compared to the predicted value of 1.35. A program was developed to recycle ash, collected in the baghouse, to the combustor to attempt to improve the utilization of the limestone. This test program included a sequence of recycle rates with a progressive increase in solids loading. System equilibrium was attempted at each stage prior to sampling the ash streams for analysis. A period of no ash recycle was also included after each sequence to allow comparison of results.

  13. Summary of baghouse operation at the Nucla CFB Demonstration Plant

    Energy Technology Data Exchange (ETDEWEB)

    Heller, T.J. (Consolidated Edison Co. of New York, Nucla, CO (US)); Cushing, K.M. (Southern Research Inst., Birmingham, AL (United States)); Friedman, M.A. (Electric Power Research Inst., Palo Alto, CA (United States))

    1990-01-01

    This paper reports on baghouse performance. Air pollution control was upgraded at this plant by the addition of a twelve-compartment Research-Cottrell baghouse to supplement three existing, six-compartment, Wheelabrator- Frye baghouses that were installed in 1974. All four baghouses use shake/deflate cleaning. The baghouses have been in service since mid-1987 when the demonstration plant was placed in service.

  14. Techno-economic analysis of PC versus CFB combustion technology

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-10-01

    In the last ten years circulating fluidised bed combustion (CFBC) has emerged as a viable alternative to pulverised coal combustion (PCC) for utility-scale coal power generation, with widespread deployment of 300 MW boilers and the successful demonstration of supercritical units of up to 600 MW. Although CFBC offers a greater degree of fuel flexibility and does not usually require downstream flue gas cleaning, high capital costs and high auxiliary power use have hindered the adoption of CFBC for utility power generation. Recent advances in CFBC unit capacity and steam conditions have led to higher efficiencies and economies of scale, with the result that a CFBC plant may now be more economically favourable than a PCC plant depending on a range of factors such as available fuels and regional emissions limits. This report reviews the state-of-the-art for both technologies and provides a comparison of their relative performances and economic costs. Standard operational parameters such as efficiency, availability, and flexibility are assessed, in addition to relative suitability for biomass cofiring and oxyfuel combustion as strategies for carbon mitigation. A review of recent cost evaluations of the two technologies is accompanied by a breakdown of individual plant expenses including flue gas scrubbing equipment and ash recycle value.

  15. Increase of gastric area and weight gain in rats submitted to the ingestion of gasified water Aumento de área gástrica e ganho de peso em ratos submetidos à ingestão de água gaseificada

    Directory of Open Access Journals (Sweden)

    José Roberto Ferreira Santiago

    2004-06-01

    Full Text Available PURPOSE: Due to the progressive increasing in the use of gasified drinks and weight gain in the Brazilian population, in addition to the fact that carbonic gas is present in all soft drinks, an experimental study was conducted using rats as the subject to investigate the effects of gasified water in the hydric ingestion and food intake, weight gain, gastric area, blood sugar, hematocrit, and hemoglobin. METHODS: Four groups of 12 rats were studied for 36 days while receiving the following daily diet, four times per day: Group 1 - 35g/day of rat food "ad libitum" and 20ml of non-gasified water; Group 2 - 35g/day of rat food "ad libitum" and 20 ml of gasified water; Group 3 - 10g/day of rat food "ad libitum" and 20ml of non-gasified water; and Group 4 - 10g/day of rat food "ad libitum" and 20ml of gasified water. RESULTS: The results showed that the animals submitted to the treatment with gasified water (Groups 2 and 4, presented a larger volume of hydric ingestion and significant increase of the gastric area (pOBJETIVO: Em virtude do aumento progressivo da utilização de bebidas gaseificadas e do ganho de peso na população brasileira, e sabendo-se que os refrigerantes têm no gás carbônico um fator em comum, planejou-se um estudo experimental em ratos para investigar os efeitos da água gaseificada na ingestão hídrica e alimentar, ganho de peso, área gástrica, glicemia, hematócrito e hemoglobina. MÉTODOS: Foram constituídos 4 grupos de 12 ratos acompanhados por 36 dias. Ao Grupo-1 foi oferecido 35 g/dia de ração "ad libitum" e 20 ml de água não gaseificada em 4 períodos diários, ao Grupo-2 foi oferecido 35 g/dia de ração "ad libitum" e 20 ml de água gaseificada em 4 períodos diários, ao Grupo-3 foi oferecido 10 g/dia de ração "ad libitum" e 20 ml de água não gaseificada em 4 períodos diários e ao Grupo-4 foi oferecido 10 g/dia de ração "ad libitum" e 20 ml de água gaseificada em 4 períodos diários. RESULTADOS: Os

  16. Modeling of Combined Heat and Power Plant Based on a Multi-Stage Gasifier and Internal Combustion Engines of Various Power Outputs

    Science.gov (United States)

    Khudyakova, G. I.; Kozlov, A. N.; Svishchev, D. A.

    2017-11-01

    The paper is concerned with an integrated system of internal combustion engine and mini combined heat and power plant (ICE-CHP). The system is based on multi-stage wood biomass gasification. The use of producer gas in the system affects negatively the internal combustion engine performance and, therefore, reduces the efficiency of the ICE-CHP plant. A mathematical model of an internal combustion engine running on low-calorie producer gas was developed using an overview of Russian and foreign manufacturers of reciprocating units, that was made in the research. A thermal calculation was done for four-stroke gas engines of different rated power outputs (30, 100 and 250 kW), running on producer gas (CO2 – 10.2, CO – 45.8, N2 – 38.8%). Thermal calculation demonstrates that the engine exhaust gas temperature reaches 500 – 600°C at the rated power level and with the lower engine power, the temperature gets higher. For example, for an internal combustion engine power of 1000 kW the temperature of exhaust gases equals 400°C. A comparison of the efficiency of engine operation on natural gas and producer gas shows that with the use of producer gas the power output declines from 300 to 250 kWe. The reduction in the effective efficiency in this case makes up 2%. The measures are proposed to upgrade the internal combustion engine to enable it to run on low-calorie producer gas.

  17. Modeling and Prediction of Coal Ash Fusion Temperature based on BP Neural Network

    Directory of Open Access Journals (Sweden)

    Miao Suzhen

    2016-01-01

    Full Text Available Coal ash is the residual generated from combustion of coal. The ash fusion temperature (AFT of coal gives detail information on the suitability of a coal source for gasification procedures, and specifically to which extent ash agglomeration or clinkering is likely to occur within the gasifier. To investigate the contribution of oxides in coal ash to AFT, data of coal ash chemical compositions and Softening Temperature (ST in different regions of China were collected in this work and a BP neural network model was established by XD-APC PLATFORM. In the BP model, the inputs were the ash compositions and the output was the ST. In addition, the ash fusion temperature prediction model was obtained by industrial data and the model was generalized by different industrial data. Compared to empirical formulas, the BP neural network obtained better results. By different tests, the best result and the best configurations for the model were obtained: hidden layer nodes of the BP network was setted as three, the component contents (SiO2, Al2O3, Fe2O3, CaO, MgO were used as inputs and ST was used as output of the model.

  18. Techno-economic evaluation of high temperature pyrolysis processes for mixed plastic waste.

    NARCIS (Netherlands)

    Westerhout, R.W.J.; Westerhout, R.W.J.; van Koningsbruggen, M.P.; van der Ham, Aloysius G.J.; Kuipers, J.A.M.; van Swaaij, Willibrordus Petrus Maria

    1998-01-01

    Three pyrolysis processes for Mixed Plastic Waste (MPW) with different reactors (Bubbling Fluidized Bed, Circulating Fluidized Bed and Rotating Cone Reactor, respectively BFB, CFB and RCR) were designed and evaluated. The estimated fixed capital investment for a 50 kton/year MPW pyrolysis plant

  19. Effect of oxidation on base liquids of oil and synthetic-based drilling fluids at high pressure and high temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Shahbazi, K.; Mehta, S.A.; Moore, R.G.; Ursenbach, M.G. [Calgary Univ., AB (Canada)

    2005-07-01

    Diesels and distillates are used as a base liquid for most oil-based drilling fluids in conventional drilling and as the liquid phase in gasified liquids in some underbalanced drilling operations. They are also used as friction reducing agents to free stuck pipes. It is important to understand the true downhole rheological properties because they affect equivalent circulating density, hole cleaning, barite sag, surge/swab pressures during tripping, pump pressure and bit hydraulics. Also, gelation and high viscosity are major concerns, particularly at high temperatures. An experimental study was conducted to evaluate the effect of oxidation on some base liquids for oil-based and synthetic-based drilling fluids at high pressures and high temperatures. Gas and liquid phases were characterized and the solid phase was measured along with viscosity measurements at temperatures and pressures ranging from 20 to 152 degrees C at atmospheric pressures to 103.4 MPa. The viscosity of the liquid samples after aging was compared with that of corresponding fresh samples. The results indicate that the degree of oxidation plays an important role in increasing the sample viscosity. The increase in viscosity depends on temperature, and is more significant at low temperatures. Agitation of samples during aging with air resulted in increased amounts of solid precipitation while lowering the viscosity of the liquid phase. This study demonstrated that oxidation has an important influence on rheological properties of the oil, because it affects the mobility of the oil and therefore the recovery factor. 11 refs., 7 tabs., 22 figs.

  20. Amorphous Alloy Membranes for High Temperature Hydrogen Separation

    Energy Technology Data Exchange (ETDEWEB)

    Coulter, K. [Southwest Research Inst. (SwRI), San Antonio, TX (United States)

    2013-09-30

    At the beginning of this project, thin film amorphous alloy membranes were considered a nascent but promising new technology for industrial-scale hydrogen gas separations from coal- derived syngas. This project used a combination of theoretical modeling, advanced physical vapor deposition fabricating, and laboratory and gasifier testing to develop amorphous alloy membranes that had the potential to meet Department of Energy (DOE) targets in the testing strategies outlined in the NETL Membrane Test Protocol. The project is complete with Southwest Research Institute® (SwRI®), Georgia Institute of Technology (GT), and Western Research Institute (WRI) having all operated independently and concurrently. GT studied the hydrogen transport properties of several amorphous alloys and found that ZrCu and ZrCuTi were the most promising candidates. GT also evaluated the hydrogen transport properties of V, Nb and Ta membranes coated with different transition-metal carbides (TMCs) (TM = Ti, Hf, Zr) catalytic layers by employing first-principles calculations together with statistical mechanics methods and determined that TiC was the most promising material to provide catalytic hydrogen dissociation. SwRI developed magnetron coating techniques to deposit a range of amorphous alloys onto both porous discs and tubular substrates. Unfortunately none of the amorphous alloys could be deposited without pinhole defects that undermined the selectivity of the membranes. WRI tested the thermal properties of the ZrCu and ZrNi alloys and found that under reducing environments the upper temperature limit of operation without recrystallization is ~250 °C. There were four publications generated from this project with two additional manuscripts in progress and six presentations were made at national and international technical conferences. The combination of the pinhole defects and the lack of high temperature stability make the theoretically identified most promising candidate amorphous alloys

  1. Control of boiler temperature with explicit MPC; Panntemperaturreglering med explicit MPC

    Energy Technology Data Exchange (ETDEWEB)

    Slaetteke, Ola; Velut, Stefan; Raaberg, Martin

    2012-02-15

    MPC is the multivariable controller that has been most successful in the process industry and particularly the petrochemical industry. It has been described as one of the most significant developments in process control and the main reasons for this are: 1. It handles multivariable control problems in a natural manner. 2. It is relative easy to understand the structure of the controller, which is the same whether it is a simple loop or a multivariable system. 3. It handles limitations of both the process and other practical constraints in a systematic way. Examples of this is that a valve can only work between 0 and 100 %, but also that the CO-level in the flue gas must not exceed a certain level. 4. It allows for operating conditions near critical process boundaries, which in many cases is synonymous with increased production rates, reduced raw material consumption, better energy utilization, and faster process transitions. The aim of the project is to evaluate the potential of multivariable control in the form of explicit MPC in a boiler at Stora Enso Hylte Bruk. This research task can be divided into two sub-tasks: 1. General evaluation of explicit MPC. 2. Evaluation of multivariable control of boiler temperature The purpose of subtask one is to evaluate what is required of a facility owner to implement explicit MPC in a control system. This includes everything from available calculation tools, what is important to consider during the design phase of the controller, different pitfalls that exist, management of different operating modes, to how the controller should be implemented and commissioned. Subtask two is intended to evaluate the multivariable control of a boiler of CFB type (circulating fluidized bed). MPC controller will regulate the temperature in the boiler. In order to maintain the waste incineration directive, the temperature in the upper part of the boiler is controlled. This is done by means of changes in the flow of natural gas injection and

  2. Studies on thermoelectric power generation consuming municipal solid waste (MSW) and using bubbling fluidized bed gasifier : Estudos em geração termelétrica a partir de resíduos sólidos urbanos (RSU) utilizando gaseificadores de leito fluidizado borbulhante

    OpenAIRE

    Andres Felipe Rodriguez Torres

    2016-01-01

    Resumo: O presente trabalho introduz novos desenvolvimentos da estratégia no conceito Fuel-Slurry Integrated Gasifier/Gas Turbine para a geração de potência termoelétrica aplicada ao caso de Resíduos Sólidos Urbanos (RSU). O processo FSIG/GT permite a alimentação do combustível num gaseificador pressurizado utilizando bombas de lama disponíveis no mercado, evitando a necessidade de sistemas de silos em cascata. O gaseificador opera em regime de Leito Fluidizado Borbulhante (Bubbling Fluidized...

  3. Steam-air fluidized bed gasification of distillers grains: Effects of steam to biomass ratio, equivalence ratio and gasification temperature.

    Science.gov (United States)

    Kumar, Ajay; Eskridge, Kent; Jones, David D; Hanna, Milford A

    2009-03-01

    In this study, thermochemical biomass gasification was performed on a bench-scale fluidized-bed gasifier with steam and air as fluidizing and oxidizing agents. Distillers grains, a non-fermentable byproduct of ethanol production, were used as the biomass feedstock for the gasification. The goal was to investigate the effects of furnace temperature, steam to biomass ratio and equivalence ratio on gas composition, carbon conversion efficiency and energy conversion efficiency of the product gas. The experiments were conducted using a 3x3x3 full factorial design with temperatures of 650, 750 and 850 degrees C, steam to biomass ratios of 0, 7.30 and 14.29 and equivalence ratios of 0.07, 0.15 and 0.29. Gasification temperature was found to be the most influential factor. Increasing the temperature resulted in increases in hydrogen and methane contents, carbon conversion and energy efficiencies. Increasing equivalence ratio decreased the hydrogen content but increased carbon conversion and energy efficiencies. The steam to biomass ratio was optimal in the intermediate levels for maximal carbon conversion and energy efficiencies.

  4. Influence of the starting materials on performance of high temperature oxide fuel cells devices

    Directory of Open Access Journals (Sweden)

    Emília Satoshi Miyamaru Seo

    2004-03-01

    Full Text Available High temperature solid oxide fuel cells (SOFCs offer an environmentally friendly technology to convert gaseous fuels such as hydrogen, natural gas or gasified coal into electricity at high efficiencies. Besides the efficiency, higher than those obtained from the traditional energy conversion systems, a fuel cell provides many other advantages like reliability, modularity, fuel flexibility and very low levels of NOx and SOx emissions. The high operating temperature (950-1000 °C used by the current generation of the solid oxide fuel cells imposes severe constraints on materials selection in order to improve the lifetime of the cell. Besides the good electrical, electrochemical, mechanical and thermal properties, the individual cell components must be stable under the fuel cell operating atmospheres. Each material has to perform not only in its own right but also in conjunction with other system components. For this reason, each cell component must fulfill several different criteria. This paper reviews the materials and the methods used to fabricate the different cell components, such as the cathode, the electrolyte, the anode and the interconnect. Some remarkable results, obtained at IPEN (Nuclear Energy Research Institute in São Paulo, have been presented.

  5. High-temperature sapphire optical sensor fiber coatings

    Science.gov (United States)

    Desu, Seshu B.; Claus, Richard O.; Raheem, Ruby; Murphy, Kent A.

    1990-10-01

    Advanced coal-fired power generation systems, such as pressurized fluidized-bed combustors and integrated gasifier-combined cycles, may provide cost effective future alternatives for power generation, improve our utilization of coal resources, and decrease our dependence upon oil and gas. When coal is burned or converted to combustible gas to produce energy, mineral matter and chemical compounds are released as solid and gaseous contaminants. The control of contaminants is mandatory to prevent pollution as well as degradation of equipment in advanced power generation. To eliminate the need for expensive heat recovery equipment and to avoid efficiency losses it is desirable to develop a technology capable of cleaning the hot gas. For this technology the removal of particle contaminants is of major concern. Several prototype high temperature particle filters have been developed, including ceramic candle filters, ceramic bag filters, and ceramic cross-flow (CXF) filters. Ceramic candle filters are rigid, tubular filters typically made by bonding silicon carbide or alumina-silica grains with clay bonding materials and perhaps including alumina-silica fibers. Ceramic bag filters are flexible and are made from long ceramic fibers such as alumina-silica. CXF filters are rigid filters made of stacks of individual lamina through which the dirty and clean gases flow in cross-wise directions. CXF filters are advantageous for hot gas cleanup applications since they offer a large effective filter surface per unit volume. The relatively small size of the filters allows the pressurized vessel containing them to be small, thus reducing potential equipment costs. CXF filters have shown promise but have experienced degradation at normal operational high temperatures (close to 1173K) and high pressures (up to 24 bars). Observed degradation modes include delamination of the individual tile layers, cracking at either the tile-torid interface or at the mounting flange, or plugging of

  6. In-Situ Acoustic Measurements of Temperature Profile in Extreme Environments

    Energy Technology Data Exchange (ETDEWEB)

    Skliar, Mikhail [Univ. of Utah, Salt Lake City, UT (United States)

    2015-03-31

    A gasifier’s temperature is the primary characteristic that must be monitored to ensure its performance and the longevity of its refractory. One of the key technological challenges impacting the reliability and economics of coal and biomass gasification is the lack of temperature sensors that are capable of providing accurate, reliable, and long-life performance in an extreme gasification environment. This research has proposed, demonstrated, and validated a novel approach that uses a noninvasive ultrasound method that provides real-time temperature distribution monitoring across the refractory, especially the hot face temperature of the refractory. The essential idea of the ultrasound measurements of segmental temperature distribution is to use an ultrasound propagation waveguide across a refractory that has been engineered to contain multiple internal partial reflectors at known locations. When an ultrasound excitation pulse is introduced on the cold side of the refractory, it will be partially reflected from each scatterer in the US propagation path in the refractory wall and returned to the receiver as a train of partial echoes. The temperature in the corresponding segment can be determined based on recorded ultrasonic waveform and experimentally defined relationship between the speed of sound and temperature. The ultrasound measurement method offers a powerful solution to provide continuous real time temperature monitoring for the occasions that conventional thermal, optical and other sensors are infeasible, such as the impossibility of insertion of temperature sensor, harsh environment, unavailable optical path, and more. Our developed ultrasound system consists of an ultrasound engineered waveguide, ultrasound transducer/receiver, and data acquisition, logging, interpretation, and online display system, which is simple to install on the existing units with minimal modification on the gasifier or use with new units. This system has been successfully tested

  7. Pyrolysis and gasification of coal at high temperatures. Quarterly progress report No. 8, June 15, 1989--September 15, 1989

    Energy Technology Data Exchange (ETDEWEB)

    Zygourakis, K.

    1989-12-31

    Coals of different ranks will be pyrolyzed in a microscope hot-stage reactor using inert and reacting atmospheres. The macropore structure of the produced chars will be characterized using video microscopy and digital image processing techniques to obtain pore size distributions. Comparative studies will quantify the effect of pyrolysis conditions (heating rates, final heat treatment temperatures, particle size and inert or reacting atmosphere) on the pore structure of the devolatilized chars. The devolatilized chars will be gasified in the regime of strong intraparticle diffusional limitations using O{sub 2}/N{sub 2} and O{sub 2}/H{sub 2}O/N{sub 2} mixtures. Constant temperature and programmed-temperature experiments in a TGA will be used for these studies. Additional gasification experiments performed in the hot-stage reactor will be videotaped and selected images will be analyzed to obtain quantitative data on particle shrinkage and fragmentation. Discrete mathematical models will be developed and validated using the experimental gasification data.

  8. Body temperature norms

    Science.gov (United States)

    Normal body temperature; Temperature - normal ... Morrison SF. Regulation of body temperature. In: Boron WF, Boulpaep EL, eds. Medical Physiology . 3rd ed. Philadelphia, PA: Elsevier; 2017:chap 59. Sajadi MM, Mackowiak ...

  9. Low temperature solution processed high-κ ZrO2 gate dielectrics for nanoelectonics

    Science.gov (United States)

    Kumar, Arvind; Mondal, Sandip; Rao, K. S. R. Koteswara

    2016-05-01

    The high-κ gate dielectrics, specifically amorphous films offer salient features such as exceptional mechanical flexibility, smooth surfaces and better uniformity associated with low leakage current density. In this work, ∼35 nm thick amorphous ZrO2 films were deposited on silicon substrate at low temperature (300 °C, 1 h) from facile spin-coating method and characterized by various analytical techniques. The X-ray diffraction and X-ray photoelectron spectroscopy reveal the formation of amorphous phase ZrO2, while ellipsometry analysis together with the Atomic Force Microscope suggest the formation of dense film with surface roughness of 1.5 Å, respectively. The fabricated films were integrated in metal-oxide-semiconductor (MOS) structures to check the electrical capabilities. The oxide capacitance (Cox), flat band capacitance (CFB), flat band voltage (VFB), dielectric constant (κ) and oxide trapped charges (Qot) extracted from high frequency (1 MHz) C-V curve are 186 pF, 104 pF, 0.37 V, 15 and 2 × 10-11 C, respectively. The small flat band voltage 0.37 V, narrow hysteresis and very little frequency dispersion between 10 kHz-1 MHz suggest an excellent a-ZrO2/Si interface with very less trapped charges in the oxide. The films exhibit a low leakage current density 4.7 × 10-9 A/cm2 at 1 V. In addition, the charge transport mechanism across the MOSC is analyzed and found to have a strong bias dependence. The space charge limited conduction mechanism is dominant in the high electric field region (1.3-5 V) due to the presence of traps, while the trap-supported tunneling is prevailed in the intermediate region (0.35-1.3 V). Low temperature solution processed ZrO2 thin films obtained are of high quality and find their importance as a potential dielectric layer on Si and polymer based flexible electronics.

  10. Novel fragmentation model for pulverized coal particles gasification in low temperature air thermal plasma

    Directory of Open Access Journals (Sweden)

    Jovanović Rastko D.

    2016-01-01

    Full Text Available New system for start-up and flame support based on coal gasification by low temperature air thermal plasma is planned to supplement current heavy oil system in Serbian thermal power plants in order to decrease air pollutions emission and operational costs. Locally introduced plasma thermal energy heats up and ignites entrained coal particles, thus starting chain process which releases heat energy from gasified coal particles inside burner channel. Important stages during particle combustion, such as particle devolatilisation and char combustion, are described with satisfying accuracy in existing commercial CFD codes that are extensively used as powerful tool for pulverized coal combustion and gasification modeling. However, during plasma coal gasification, high plasma temperature induces strong thermal stresses inside interacting coal particles. These stresses lead to “thermal shock” and extensive particle fragmentation during which coal particles with initial size of 50-100 m disintegrate into fragments of at most 5-10 m. This intensifies volatile release by a factor 3-4 and substantially accelerates the oxidation of combustible matter. Particle fragmentation, due to its small size and thus limited influence on combustion process is commonly neglected in modelling. The main focus of this work is to suggest novel approach to pulverized coal gasification under high temperature conditions and to implement it into commercial comprehensive code ANSYS FLUENT 14.0. Proposed model was validated against experimental data obtained in newly built pilot scale D.C plasma burner test facility. Newly developed model showed very good agreement with experimental results with relative error less than 10%, while the standard built-in gasification model had error up to 25%.

  11. The effect of gastric dilatation in rats submitted to gasified water ingestion under the hepatic metabolic function Efeito da dilatação gástrica em ratos submetidos à ingestão de água gaseificada sobre a função metabólica hepática

    Directory of Open Access Journals (Sweden)

    José Roberto Ferreira Santiago

    2008-10-01

    Full Text Available INTRODUCTION: The amounts of people that are overweight have been increasing within the population in significant ways during the last decades. In this view, gasified beverages have become an important environmental concern in relation to the eating habits of people, especially who lives in the USA, Mexico, and Brazil. In this order, these three countries constitute the major beverages producers and consumers of the whole world. PURPOSE: To investigate the effects of gastric dilatation in rats submitted to gasified water ingestion, uniform vehicle for all soft drinks, under metabolic patterns of the hepatic function. METHODS: Two groups of 15 rats were formed and observed during two weeks. The rats of the group I, were fed with 200g/day of rat food ad libitum and 100ml of non-gasified water during three daily periods. The rats composing the group II, were fed with 200g/day of rat food ad libitum and 100ml of gasified water within 3 daily periods. The media (x and standard deviation (s were calculated through the paired t-test for each group in order to compare the effects of the different types of water and its effect in each one of them. RESULTS: The results indicated that the animals which were submitted to the treatment with gasified water (G-II, presented an increase of glutamic-pyruvic transaminase (GPT and alkaline phosphatase (ALP (pp>0,05 and increase of the gastric area with macroscopic morphologic alterations, such as the loss of the characteristic linear depressions on the surface of the mucous membrane. CONCLUSION: The gasified water favored the expansion of the gastric area and contributed to the extinction of the linear depressions of the mucous organ, which caused metabolic alterations of the hepatic function.INTRODUÇÃO: O excesso de peso na população aumentou de forma significante nas últimas décadas e as bebidas gasosas tornaram-se um fator ambiental importante no comportamento alimentar das pessoas, sendo os EUA, M

  12. Maine River Temperature Monitoring

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — We collect seasonal and annual temperature measurements on an hourly or quarter hourly basis to monitor habitat suitability for ATS and other species. Temperature...

  13. High temperature measuring device

    Science.gov (United States)

    Tokarz, Richard D.

    1983-01-01

    A temperature measuring device for very high design temperatures (to 2,000.degree. C.). The device comprises a homogenous base structure preferably in the form of a sphere or cylinder. The base structure contains a large number of individual walled cells. The base structure has a decreasing coefficient of elasticity within the temperature range being monitored. A predetermined quantity of inert gas is confined within each cell. The cells are dimensionally stable at the normal working temperature of the device. Increases in gaseous pressure within the cells will permanently deform the cell walls at temperatures within the high temperature range to be measured. Such deformation can be correlated to temperature by calibrating similarly constructed devices under known time and temperature conditions.

  14. GISS Surface Temperature Analysis

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The GISTEMP dataset is a global 2x2 gridded temperature anomaly dataset. Temperature data is updated around the middle of every month using current data files from...

  15. Experimental investigation on the changes in bed properties of a ...

    African Journals Online (AJOL)

    Biomass gasifiers of fixed bed, downdraft type are generally used for driving internal combustion engines. As part of research work, a versatile, throat type, biomass gasifier was developed. The gasifier had facilities for bed temperature measurements, pressure measurements, physical observation, sampling of bed particles, ...

  16. Experimental investigation on the changes in bed properties of a ...

    African Journals Online (AJOL)

    user

    Abstract. Biomass gasifiers of fixed bed, downdraft type are generally used for driving internal combustion engines. As part of research work, a versatile, throat type, biomass gasifier was developed. The gasifier had facilities for bed temperature measurements, pressure measurements, physical observation, sampling of bed ...

  17. Rescaling Temperature and Entropy

    Science.gov (United States)

    Olmsted, John, III

    2010-01-01

    Temperature and entropy traditionally are expressed in units of kelvin and joule/kelvin. These units obscure some important aspects of the natures of these thermodynamic quantities. Defining a rescaled temperature using the Boltzmann constant, T' = k[subscript B]T, expresses temperature in energy units, thereby emphasizing the close relationship…

  18. Studies and development of high-temperature catalytic materials for application in gas turbine combustion chamber

    Energy Technology Data Exchange (ETDEWEB)

    Papadias, Dennis; Thevenin, Philippe [Royal Inst. of Tech., Stockholm (Sweden). Dept. of Chemical Engineering and Technology

    2000-04-01

    -based garnets and aluminium titanate. The NZP materials (NaZr{sub 2}(PO{sub 4}){sub 3}) have an ultra-low thermal expansion which gives them the desired properties to stand thermal shocks. However their catalytic activity needs to be improved as they have a T{sub 50} above 520 deg C. The iron containing garnets (YIG) with the following formula Y{sub 3}Fe{sub 5}O{sub 12}, as well as the MgAl{sub 2}O{sub 4} spinel, show promising results with an activity close to the hexaaluminates. Different fuels could be considered for application in gas turbine combustion chambers. Ethanol appears to be a promising alternative fuel for mobile gas turbines, methane and gasified biomass for stationary utilisation. The experimental work in this project has been done using ethanol as fuel. The coming work will be oriented towards gasified biomass as well. Specific attention will be given to fuel-NO{sub x} formation from the ammonia present in the feed. The work was carried out in co-operation with Volvo Aero Corporation, which was involved in the European project AGATA where the objective was to develop a ceramic gas turbine for hybrid car applications. Furthermore, another project within catalytic combustion for gas turbine is conducted in co-operation with the Division of Heat and Power Technology at KTH (Nutek project P7057, Catalytic Combustion of Gasified Biomass). In this projects a fully catalytic system has been chosen. However a solution to overcome the problem given by the high temperature present in the last section of the combustor is a hybrid system described in the literature. A first catalyst segment with low temperature catalytic activity ignites part of the fuel at 300-400 deg C. The rest of the fuel is then burned homogeneously between 1000 - 1400 deg C. This design avoid the use of catalytic material at temperature above 1000 deg C. Different projects are running both in the US (Catalytica Combustion Systems Inc., Precision Combustion) and Japan (Osaka Gas Company) to develop a

  19. Video and thermal imaging system for monitoring interiors of high temperature reaction vessels

    Science.gov (United States)

    Saveliev, Alexei V [Chicago, IL; Zelepouga, Serguei A [Hoffman Estates, IL; Rue, David M [Chicago, IL

    2012-01-10

    A system and method for real-time monitoring of the interior of a combustor or gasifier wherein light emitted by the interior surface of a refractory wall of the combustor or gasifier is collected using an imaging fiber optic bundle having a light receiving end and a light output end. Color information in the light is captured with primary color (RGB) filters or complimentary color (GMCY) filters placed over individual pixels of color sensors disposed within a digital color camera in a BAYER mosaic layout, producing RGB signal outputs or GMCY signal outputs. The signal outputs are processed using intensity ratios of the primary color filters or the complimentary color filters, producing video images and/or thermal images of the interior of the combustor or gasifier.

  20. Chapter 6: Temperature

    Science.gov (United States)

    Jones, Leslie A.; Muhlfeld, Clint C.; Hauer, F. Richard; F. Richard Hauer,; Lamberti, G.A.

    2017-01-01

    Stream temperature has direct and indirect effects on stream ecology and is critical in determining both abiotic and biotic system responses across a hierarchy of spatial and temporal scales. Temperature variation is primarily driven by solar radiation, while landscape topography, geology, and stream reach scale ecosystem processes contribute to local variability. Spatiotemporal heterogeneity in freshwater ecosystems influences habitat distributions, physiological functions, and phenology of all aquatic organisms. In this chapter we provide an overview of methods for monitoring stream temperature, characterization of thermal profiles, and modeling approaches to stream temperature prediction. Recent advances in temperature monitoring allow for more comprehensive studies of the underlying processes influencing annual variation of temperatures and how thermal variability may impact aquatic organisms at individual, population, and community based scales. Likewise, the development of spatially explicit predictive models provide a framework for simulating natural and anthropogenic effects on thermal regimes which is integral for sustainable management of freshwater systems.

  1. Automatic temperature adjustment apparatus

    Science.gov (United States)

    Chaplin, James E.

    1985-01-01

    An apparatus for increasing the efficiency of a conventional central space heating system is disclosed. The temperature of a fluid heating medium is adjusted based on a measurement of the external temperature, and a system parameter. The system parameter is periodically modified based on a closed loop process that monitors the operation of the heating system. This closed loop process provides a heating medium temperature value that is very near the optimum for energy efficiency.

  2. Temperature measurement and control

    CERN Document Server

    Leigh, JR

    1988-01-01

    This book treats the theory and practice of temperature measurement and control and important related topics such as energy management and air pollution. There are no specific prerequisites for the book although a knowledge of elementary control theory could be useful. The first half of the book is an application oriented survey of temperature measurement techniques and devices. The second half is concerned mainly with temperature control in both simple and complex situations.

  3. Cardiac arrhythmogenesis and temperature.

    Science.gov (United States)

    Shah, Ujas; Bien, Harold; Entcheva, Emilia

    2006-01-01

    Fast processes in cardiac electrophysiology are often studied at temperatures lower than physiological. Extrapolation of values is based on widely accepted Q10 (Arrhenius) model of temperature dependence (ratio of kinetic properties for a 10 degrees C change in temperature). In this study, we set out to quantify the temperature dependence of essential parameters that define spatiotemporal behavior of cardiac excitation. Additionally, we examined temperature's effects on restitution dynamics. We employed fast fluorescence imaging with voltage-and calcium-sensitive dyes in neonatal rat cardiomyocyte sheets. Conduction velocity (CV), calcium transient duration (CTD), action potential duration (APD) and wavelength (W=CV*duration) change as functions of temperature were quantified. Using 24 degrees C as a reference point, we found a strong temperature-driven increase of CV (Q10=2.3) with smaller CTD and APD changes (Q10=1.33, 1.24, respectively). The spatial equivalents of voltage and calcium duration, wavelength, were slightly less sensitive to temperature with Q10=2.05 and 1.78, respectively, due to the opposing influences of decreasing duration with increased velocity. More importantly, we found that Q10 varies as a function of diastolic interval. Our results indicate the importance of examining temperature sensitivity across several frequencies. Armed with our results, experimentalists and modelers alike have a tool for reconciling different environmental conditions. In a broader sense, these data help better understand thermal influences on arrhythmia development or suppression such as during hibernation or cardiac surgery.

  4. Influence of Fuel Moisture Content and Reactor Temperature on the Calorific Value of Syngas Resulted from Gasification of Oil Palm Fronds

    Science.gov (United States)

    Atnaw, Samson Mekbib; Sulaiman, Shaharin Anwar; Yusup, Suzana

    2014-01-01

    Biomass wastes produced from oil palm mills and plantations include empty fruit bunches (EFBs), shells, fibers, trunks, and oil palm fronds (OPF). EFBs and shells are partially utilized as boiler fuel while the rest of the biomass materials like OPF have not been utilized for energy generation. No previous study has been reported on gasification of oil palm fronds (OPF) biomass for the production of fuel gas. In this paper, the effect of moisture content of fuel and reactor temperature on downdraft gasification of OPF was experimentally investigated using a lab scale gasifier of capacity 50 kW. In addition, results obtained from equilibrium model of gasification that was developed for facilitating the prediction of syngas composition are compared with experimental data. Comparison of simulation results for predicting calorific value of syngas with the experimental results showed a satisfactory agreement with a mean error of 0.1 MJ/Nm3. For a biomass moisture content of 29%, the resulting calorific value for the syngas was found to be only 2.63 MJ/Nm3, as compared to nearly double (4.95 MJ/Nm3) for biomass moisture content of 22%. A calorific value as high as 5.57 MJ/Nm3 was recorded for higher oxidation zone temperature values. PMID:24578617

  5. Influence of Fuel Moisture Content and Reactor Temperature on the Calorific Value of Syngas Resulted from Gasification of Oil Palm Fronds

    Directory of Open Access Journals (Sweden)

    Samson Mekbib Atnaw

    2014-01-01

    Full Text Available Biomass wastes produced from oil palm mills and plantations include empty fruit bunches (EFBs, shells, fibers, trunks, and oil palm fronds (OPF. EFBs and shells are partially utilized as boiler fuel while the rest of the biomass materials like OPF have not been utilized for energy generation. No previous study has been reported on gasification of oil palm fronds (OPF biomass for the production of fuel gas. In this paper, the effect of moisture content of fuel and reactor temperature on downdraft gasification of OPF was experimentally investigated using a lab scale gasifier of capacity 50 kW. In addition, results obtained from equilibrium model of gasification that was developed for facilitating the prediction of syngas composition are compared with experimental data. Comparison of simulation results for predicting calorific value of syngas with the experimental results showed a satisfactory agreement with a mean error of 0.1 MJ/Nm3. For a biomass moisture content of 29%, the resulting calorific value for the syngas was found to be only 2.63 MJ/Nm3, as compared to nearly double (4.95 MJ/Nm3 for biomass moisture content of 22%. A calorific value as high as 5.57 MJ/Nm3 was recorded for higher oxidation zone temperature values.

  6. High temperature materials; Materiaux a hautes temperatures

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2003-07-01

    The aim of this workshop is to share the needs of high temperature and nuclear fuel materials for future nuclear systems, to take stock of the status of researches in this domain and to propose some cooperation works between the different research organisations. The future nuclear systems are the very high temperature (850 to 1200 deg. C) gas cooled reactors (GCR) and the molten salt reactors (MSR). These systems include not only the reactor but also the fabrication and reprocessing of the spent fuel. This document brings together the transparencies of 13 communications among the 25 given at the workshop: 1) characteristics and needs of future systems: specifications, materials and fuel needs for fast spectrum GCR and very high temperature GCR; 2) high temperature materials out of neutron flux: thermal barriers: materials, resistance, lifetimes; nickel-base metal alloys: status of knowledge, mechanical behaviour, possible applications; corrosion linked with the gas coolant: knowledge and problems to be solved; super-alloys for turbines: alloys for blades and discs; corrosion linked with MSR: knowledge and problems to be solved; 3) materials for reactor core structure: nuclear graphite and carbon; fuel assembly structure materials of the GCR with fast neutron spectrum: status of knowledge and ceramics and cermets needs; silicon carbide as fuel confinement material, study of irradiation induced defects; migration of fission products, I and Cs in SiC; 4) materials for hydrogen production: status of the knowledge and needs for the thermochemical cycle; 5) technologies: GCR components and the associated material needs: compact exchangers, pumps, turbines; MSR components: valves, exchangers, pumps. (J.S.)

  7. Measuring body temperature.

    Science.gov (United States)

    McCallum, Louise; Higgins, Dan

    Body temperature is one of the four main vital signs that must be monitored to ensure safe and effective care. Temperature measurement is recommended by the National Institute of Clinical Excellence a part of the initial assessment in acute illness in adults (NICE, 2007) and by the Scottish Intercollegiate Guidelines Network guidelines for post-operative management in adults (SIGN, 2004). Despite applying in all healthcare environments, wide variations exist on the methods and techniques used to measure body temperature. It is essential to use the most appropriate technique to ensure that temperature is measured accurately. Inaccurate results may influence diagnosis and treatment, lead to a failure to identify patient deterioration and compromise patient safety. This article explains the importance of temperature regulation and compares methods of its measurement.

  8. High temperature structural silicides

    Energy Technology Data Exchange (ETDEWEB)

    Petrovic, J.J.

    1997-03-01

    Structural silicides have important high temperature applications in oxidizing and aggressive environments. Most prominent are MoSi{sub 2}-based materials, which are borderline ceramic-intermetallic compounds. MoSi{sub 2} single crystals exhibit macroscopic compressive ductility at temperatures below room temperature in some orientations. Polycrystalline MoSi{sub 2} possesses elevated temperature creep behavior which is highly sensitive to grain size. MoSi{sub 2}-Si{sub 3}N{sub 4} composites show an important combination of oxidation resistance, creep resistance, and low temperature fracture toughness. Current potential applications of MoSi{sub 2}-based materials include furnace heating elements, molten metal lances, industrial gas burners, aerospace turbine engine components, diesel engine glow plugs, and materials for glass processing.

  9. Novel Sorbent-Based Process for High Temperature Trace Metal Removal

    Energy Technology Data Exchange (ETDEWEB)

    Gokhan Alptekin

    2008-09-30

    The objective of this project was to demonstrate the efficacy of a novel sorbent can effectively remove trace metal contaminants (Hg, As, Se and Cd) from actual coal-derived synthesis gas streams at high temperature (above the dew point of the gas). The performance of TDA's sorbent has been evaluated in several field demonstrations using synthesis gas generated by laboratory and pilot-scale coal gasifiers in a state-of-the-art test skid that houses the absorbent and all auxiliary equipment for monitoring and data logging of critical operating parameters. The test skid was originally designed to treat 10,000 SCFH gas at 250 psig and 350 C, however, because of the limited gas handling capabilities of the test sites, the capacity was downsized to 500 SCFH gas flow. As part of the test program, we carried out four demonstrations at two different sites using the synthesis gas generated by the gasification of various lignites and a bituminous coal. Two of these tests were conducted at the Power Systems Demonstration Facility (PSDF) in Wilsonville, Alabama; a Falkirk (North Dakota) lignite and a high sodium lignite (the PSDF operator Southern Company did not disclose the source of this lignite) were used as the feedstock. We also carried out two other demonstrations in collaboration with the University of North Dakota Energy Environmental Research Center (UNDEERC) using synthesis gas slipstreams generated by the gasification of Sufco (Utah) bituminous coal and Oak Hills (Texas) lignite. In the PSDF tests, we showed successful operation of the test system at the conditions of interest and showed the efficacy of sorbent in removing the mercury from synthesis gas. In Test Campaign No.1, TDA sorbent reduced Hg concentration of the synthesis gas to less than 5 {micro}g/m{sup 3} and achieved over 99% Hg removal efficiency for the entire test duration. Unfortunately, due to the relatively low concentration of the trace metals in the lignite feed and as a result of the

  10. Hydrodynamics of a hybrid circulating fluidized bed reactor with a partitioned loop seal system

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Dal-Hee; Moon, Jong-Ho; Jin, Gyoung Tae; Shun, Dowon [Korea Institute of Energy Research, Daejeon (Korea, Republic of); Yun, Minyoung; Park, Chan Seung; Norbeck, Joseph M. [University of California, Riverside (United States)

    2015-07-15

    A circulating fluidized bed (CFB) with a hybrid design has been developed and optimized for steam hydrogasification. The hybrid CFB is composed of a bubbling fluidized bed (BFB) type combustor and a fast fluidized bed (FB) type gasifier. Char is burnt in the combustor and the generated heat is supplied to the gasifier along with the bed materials. Two different types of fluidized beds are connected to each other with a newly developed partitioned loop seal to avoid direct contact between two separate gas streams flowing in each fluidized bed. Gas mixing tests were carried out with Air and Argon in a cold model hybrid CFB to test the loop seal efficiency. Increase in solid inventory in the loop seal can improve the gas separation efficiency. It can be realized at higher gas velocity in fast bed and with higher solid inventory in the loop seal system. In addition, bed hydrodynamics was investigated with varying gas flow conditions and particle sizes in order to obtain a full understanding of changes of solid holdup in the FB. The solid holdup in the FB increased with increasing gas velocity in the BFB. Conversely, increase in gas velocity in the FB contributed to reducing the solid holdup in the FB. It was observed that changing the particle size of bed material does not have a big impact on hydrodynamic parameters.

  11. Model-free adaptive control of supercritical circulating fluidized-bed boilers

    Science.gov (United States)

    Cheng, George Shu-Xing; Mulkey, Steven L

    2014-12-16

    A novel 3-Input-3-Output (3.times.3) Fuel-Air Ratio Model-Free Adaptive (MFA) controller is introduced, which can effectively control key process variables including Bed Temperature, Excess O2, and Furnace Negative Pressure of combustion processes of advanced boilers. A novel 7-input-7-output (7.times.7) MFA control system is also described for controlling a combined 3-Input-3-Output (3.times.3) process of Boiler-Turbine-Generator (BTG) units and a 5.times.5 CFB combustion process of advanced boilers. Those boilers include Circulating Fluidized-Bed (CFB) Boilers and Once-Through Supercritical Circulating Fluidized-Bed (OTSC CFB) Boilers.

  12. About thermometers and temperature

    Science.gov (United States)

    Baldovin, M.; Puglisi, A.; Sarracino, A.; Vulpiani, A.

    2017-11-01

    We discuss a class of mechanical models of thermometers and their minimal requirements to determine the temperature for systems out of the common scope of thermometry. In particular we consider: (1) anharmonic chains with long time of thermalization, such as the Fermi-Pasta-Ulam (FPU) model; (2) systems with long-range interactions where the equivalence of ensembles does not always hold; (3) systems featuring absolute negative temperatures. We show that for all the three classes of systems a mechanical thermometer model can be designed: a temporal average of a suitable mechanical observable of the thermometer is sufficient to get an estimate of the system’s temperature. Several interesting lessons are learnt from our numerical study: (1) the long thermalization times in FPU-like systems do not affect the thermometer, which is not coupled to normal modes but to a group of microscopic degrees of freedom; (2) a thermometer coupled to a long-range system measures its microcanonical temperature, even at values of the total energy where its canonical temperature would be very different; (3) a thermometer to read absolute negative temperatures must have a bounded total energy (as the system), otherwise it heavily perturbs the system changing the sign of its temperature. Our study shows that in order to also work in a correct way in ‘non standard’ cases, the proper model of thermometer must have a special functional form, e.g. the kinetic part cannot be quadratic.

  13. Control of supply temperature

    Energy Technology Data Exchange (ETDEWEB)

    Madsen, H.; Nielsen, T.S.; Soegaard, H.T.

    1996-09-01

    For many district heating systems, e.g. the system in Hoeje Taastrup, it is desirable to minimize the supply temperature from the heat production unit(s). Lower supply temperature implies lower costs in connection with the production and distribution of heat. Factors having impact on the heat demand are for instance solar radiation, wind speed, wind direction and a climate independent part, which is a function of the time of the day/week/year. By applying an optimization strategy, which minimizes the supply temperature, it is assumed that optimal economical operation can be obtained by minimizing the supply temperature and thereby the heat losses in the system. The models and methods described in this report take such aspects into account, and can therefore be used as elements in a more efficient minimization of the supply temperature. The theoretical part of this report describes models and methods for optimal on-line control of the supply temperature in district heating systems. Some of the models and methods have been implemented - or are going to be implemented - in the computer program PRESS which is a tool for optimal control of supply temperature and forecasting of heat demand in district heating systems. The principles for using transfer function models are briefly described. The ordinary generalized predictive control (OGPC) method is reviewed, and several extensions of this method are suggested. New controller, which is called the extended generalized predictive controller (XGPC), is described. (EG) 57 refs.

  14. Temperature estimation with ultrasound

    Science.gov (United States)

    Daniels, Matthew

    Hepatocelluar carcinoma is the fastest growing type of cancer in the United States. In addition, the survival rate after one year is approximately zero without treatment. In many instances, patients with hepatocelluar carcinoma may not be suitable candidates for the primary treatment options, i.e. surgical resection or liver transplantation. This has led to the development of minimally invasive therapies focused on destroying hepatocelluar by thermal or chemical methods. The focus of this dissertation is on the development of ultrasound-based image-guided monitoring options for minimally invasive therapies such as radiofrequency ablation. Ultrasound-based temperature imaging relies on relating the gradient of locally estimated tissue displacements to a temperature change. First, a realistic Finite Element Analysis/ultrasound simulation of ablation was developed. This allowed evaluation of the ability of ultrasound-based temperature estimation algorithms to track temperatures for three different ablation scenarios in the liver. It was found that 2-Dimensional block matching and a 6 second time step was able to accurately track the temperature over a 12 minute ablation procedure. Next, a tissue-mimicking phantom was constructed to determine the accuracy of the temperature estimation method by comparing estimated temperatures to that measured using invasive fiber-optic temperature probes. The 2-Dimensional block matching was able to track the temperature accurately over the entire 8 minute heating procedure in the tissue-mimicking phantom. Finally, two separate in-vivo experiments were performed. The first experiment examined the ability of our algorithm to track frame-to-frame displacements when external motion due to respiration and the cardiac cycle were considered. It was determined that a frame rate between 13 frames per second and 33 frames per second was sufficient to track frame-to-frame displacements between respiratory cycles. The second experiment examined

  15. High Temperature Electrolysis

    DEFF Research Database (Denmark)

    Elder, Rachael; Cumming, Denis; Mogensen, Mogens Bjerg

    2015-01-01

    High temperature electrolysis of carbon dioxide, or co-electrolysis of carbon dioxide and steam, has a great potential for carbon dioxide utilisation. A solid oxide electrolysis cell (SOEC), operating between 500 and 900. °C, is used to reduce carbon dioxide to carbon monoxide. If steam is also...... input to the cell then hydrogen is produced giving syngas. This syngas can then be further reacted to form hydrocarbon fuels and chemicals. Operating at high temperature gives much higher efficiencies than can be achieved with low temperature electrolysis. Current state of the art SOECs utilise a dense...

  16. Coal plasticity at high heating rates and temperatures. Final technical progress report

    Energy Technology Data Exchange (ETDEWEB)

    Gerjarusak, S.; Peters, W.A.; Howard, J.B.

    1995-05-01

    Plastic coals are important feedstocks in coke manufacture, coal liquefaction, gasification, and combustion. During these processes, the thermoplastic behavior of these coals is also important since it may contribute to desirable or undesirable characteristics. For example, during liquefaction, the plastic behavior is desired since it leads to liquid-liquid reactions which are faster than solid-liquid reactions. During gasification, the elastic behavior is undesired since it leads to caking and agglomeration of coal particles which result in bed bogging in fixed or fluidized bed gasifiers. The plastic behavior of different coals was studied using a fast-response plastometer. A modified plastometer was used to measure the torque required to turn at constant angular speed a cone-shaped disk embedded in a thin layer of coal. The coal particles were packed between two metal plates which are heated electrically. Heating rates, final temperatures, pressures, and durations of experiment ranged from 200--800 K/s, 700--1300 K, vacuum-50 atm helium, and 0--40 s, respectively. The apparent viscosity of the molten coal was calculated from the measured torque using the governing equation of the cone-and-plate viscometer. Using a concentrated suspension model, the molten coal`s apparent viscosity was related to the quantity of the liquid metaplast present during pyrolysis. Seven coals from Argonne National Laboratory Premium Coal Sample Bank were studied. Five bituminous coals, from high-volatile to low-volatile bituminous, were found to have very good plastic behavior. Coal type strongly affects the magnitude and duration of plasticity. Hvb coals were most plastic. Mvb and lvb coals, though the maximum plasticity and plastic period were less. Low rank coals such as subbituminous and lignite did not exhibit any plasticity in the present studies. Coal plasticity is moderately well correlated with simple indices of coal type such as the elemental C,O, and H contents.

  17. High Temperature QCD

    CERN Document Server

    Lombardo, M P

    2012-01-01

    I review recent results on QCD at high temperature on a lattice. Steady progress with staggered fermions and Wilson type fermions allow a quantitative description of hot QCD whose accuracy in many cases parallels that of zero temperature studies. Simulations with chiral quarks are coming of age, and togheter with theoretical developments trigger interesting developments in the analysis of the critical region. Issues related with the universality class of the chiral transition and the fate of the axial symmetry are discussed in the light of new numerical and analytical results. Transport coefficients and analysis of bottomonium spectra compare well with results of heavy ion collisions at RHIC and LHC. Model field theories, lattice simulations and high temperature systematic expansions help building a coherent picture of the high temperature phase of QCD. The (strongly coupled) Quark Gluon Plasma is heavily investigated, and asserts its role as an inspiring theoretical laboratory.

  18. QUARKONIUM AT FINITE TEMPERATURE.

    Energy Technology Data Exchange (ETDEWEB)

    PETRECZKY,P.

    2003-07-21

    The author discusses quarkonium spectral functions at finite temperature reconstructed using the Maximum Entropy Method. The author shows in particular that the J/{psi} survives in the deconfined phase up to 1.5T{sub c}.

  19. Surface Temperature Data Analysis

    Science.gov (United States)

    Hansen, James; Ruedy, Reto

    2012-01-01

    Small global mean temperature changes may have significant to disastrous consequences for the Earth's climate if they persist for an extended period. Obtaining global means from local weather reports is hampered by the uneven spatial distribution of the reliably reporting weather stations. Methods had to be developed that minimize as far as possible the impact of that situation. This software is a method of combining temperature data of individual stations to obtain a global mean trend, overcoming/estimating the uncertainty introduced by the spatial and temporal gaps in the available data. Useful estimates were obtained by the introduction of a special grid, subdividing the Earth's surface into 8,000 equal-area boxes, using the existing data to create virtual stations at the center of each of these boxes, and combining temperature anomalies (after assessing the radius of high correlation) rather than temperatures.

  20. Anisotropic Unruh temperatures

    Science.gov (United States)

    Arias, Raúl E.; Casini, Horacio; Huerta, Marina; Pontello, Diego

    2017-11-01

    The relative entropy between very high-energy localized excitations and the vacuum, where both states are reduced to a spatial region, gives place to a precise definition of a local temperature produced by vacuum entanglement across the boundary. This generalizes the Unruh temperature of the Rindler wedge to arbitrary regions. The local temperatures can be read off from the short distance leading have a universal geometric expression that follows by solving a particular eikonal type equation in Euclidean space. This equation generalizes to any dimension the holomorphic property that holds in two dimensions. For regions of arbitrary shapes the local temperatures at a point are direction dependent. We compute their explicit expression for the geometry of a wall or strip.

  1. Sediment Temperature, 2015

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — This data table contains summary data for temperature time series in near-surface sediments in high and low tidal marsh at 7 sites during 2015. These data support...

  2. Temperatures of exploding nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Serfling, V.; Schwarz, C.; Begemann-Blaich, M.; Fritz, S.; Gross, C.; Kleinevoss, U.; Kunze, W.D; Lynen, U.; Mahi, M.; Mueller, W.F.J.; Odeh, T.; Schnittker, M.; Trautmann, W.; Woerner, A.; Xi, H. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Bassini, R.; Iori, I.; Moroni, A.; Petruzzelli, F. [Milan Univ. (Italy). Ist. di Scienze Fisiche]|[Istituto Nazionale di Fisica Nucleare, Milan (Italy); Gaff, S.J.; Kunde, G.J. [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy]|[Michigan State Univ., East Lansing, MI (United States). National Superconducting Cyclotron Lab.; Imme, G.; Maddalena, V.; Nociforo, C.; Raciti, G.; Riccobene, G.; Romano, F.P.; Saija, A.; Sfienti, C.; Verde, G. [Catania Univ. (Italy). Dipt. di Fisica]|[Istituto Nazionale di Fisica Nucleare, Catania (Italy); Moehlenkamp, T.; Seidel, W. [Forschungszentrum Rossendorf e.V. (FZR), Dresden (Germany); Ocker, B.; Schuettauf, A. [Frankfurt Univ. (Germany). Inst. fuer Kernphysik; Pochodzalla, J. [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany); Trzcinski, A.; Zwieglinski, B. [Soltan Inst. for Nuclear Studies, Warsaw (Poland)

    1998-01-01

    Breakup temperatures in central collisions of {sup 197}Au+{sup 197}Au at bombarding energies E/A=50 to 200 MeV were determined with two methods. Isotope temperatures, deduced from double ratios of hydrogen, helium, and lithium isotopic yields, increase monotonically with bombarding energy from 5 MeV to 12 MeV, in qualitative agreement with a scenario of chemical freeze-out after adiabatic expansion. Excited-state temperatures, derived from yield ratios of states in {sup 4}He, {sup 5,6}Li, and {sup 8}Be, are about 5 MeV, independent of the projectile energy, and seem to reflect the internal temperature of fragments at their final separation from the system. (orig.)

  3. High temperature battery. Hochtemperaturbatterie

    Energy Technology Data Exchange (ETDEWEB)

    Bulling, M.

    1992-06-04

    To prevent heat losses of a high temperature battery, it is proposed to make the incoming current leads in the area of their penetration through the double-walled insulating housing as thermal throttle, particularly spiral ones.

  4. Confinement at Finite Temperature

    Science.gov (United States)

    Cardoso, Nuno; Bicudo, Pedro; Cardoso, Marco

    2017-05-01

    We show the flux tubes produced by static quark-antiquark, quark-quark and quark-gluon charges at finite temperature. The sources are placed on the lattice with fundamental and adjoint Polyakov loops. We compute the squared strengths of the chromomagnetic and chromoelectric fields above and below the critical temperature. Our results are for pure gauge SU(3) gauge theory, they are invariant and all computations are done with GPUs using CUDA.

  5. Portable Body Temperature Conditioner

    Science.gov (United States)

    2014-12-01

    patients become hypothermic after severe injury due to environmental exposure during transport. These patients also have decreased thermoregulation due to...based on the load demand to conserve power consumption 4 Requires glycol solution to prevent H20 freezing at cold ambient temperatures 3. Product...three days. To encompass the range of the temperature to be used during the Patient Simulation testing (15oC – 40oC); cold (15oC), neutral (25oC

  6. Temperature in the throat

    Directory of Open Access Journals (Sweden)

    Dariush Kaviani

    2016-09-01

    Full Text Available We study the temperature of extended objects in string theory. Rotating probe D-branes admit horizons and temperatures a la Unruh effect. We find that the induced metrics on slow rotating probe D1-branes in holographic string solutions including warped Calabi–Yau throats have distinct thermal horizons with characteristic Hawking temperatures even if there is no black hole in the bulk Calabi–Yau. Taking the UV/IR limits of the solution, we show that the world volume black hole nucleation depends on the deformation and the warping of the throat. We find that world volume horizons and temperatures of expected features form not in the regular confining IR region but in the singular nonconfining UV solution. In the conformal limit of the UV, we find horizons and temperatures similar to those on rotating probes in the AdS throat found in the literature. In this case, we also find that activating a background gauge field form the U(1 R-symmetry modifies the induced metric with its temperature describing two different classes of black hole solutions.

  7. Temperature in the throat

    Science.gov (United States)

    Kaviani, Dariush; Mosaffa, Amir Esmaeil

    2016-09-01

    We study the temperature of extended objects in string theory. Rotating probe D-branes admit horizons and temperatures a la Unruh effect. We find that the induced metrics on slow rotating probe D1-branes in holographic string solutions including warped Calabi-Yau throats have distinct thermal horizons with characteristic Hawking temperatures even if there is no black hole in the bulk Calabi-Yau. Taking the UV/IR limits of the solution, we show that the world volume black hole nucleation depends on the deformation and the warping of the throat. We find that world volume horizons and temperatures of expected features form not in the regular confining IR region but in the singular nonconfining UV solution. In the conformal limit of the UV, we find horizons and temperatures similar to those on rotating probes in the AdS throat found in the literature. In this case, we also find that activating a background gauge field form the U (1) R-symmetry modifies the induced metric with its temperature describing two different classes of black hole solutions.

  8. Temperature measurement: Thermocouples

    Science.gov (United States)

    1982-11-01

    This Data Item is available as part of the ESDU Sub-series on Heat Transfer. Background information and practical guidance on designing temperature measuring systems using thermocouples is provided. The nominal temperature range covered is -200 degrees C to 2000 degrees C but the comments apply, in general terms, to all thermocouple systems. The information is aimed at the user who wishes to design and install a practical thermocouple system using improved techniques that will allow temperatures to be measured within known tolerances. The selection, preparation, and installation of thermocouples, the use of compensating or extension cables, methods of referencing to a known temperature and measurement system are considered. The requirements for reliable systems operating to commercial tolerances are also described. Various factors that might impair the accuracy and stability of thermocouples are identified together with methods of reducing their effect. A check list for the design of a thermocouple system is given and a flow chart procedure for selecting appropriate thermocouple materials is provided as well. The employment of the techniques described will ensure that the temperature of the measuring junction is within known tolerances.

  9. Temperature Data Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, David

    2003-03-01

    Groundwater temperature is sensitive to the competing processes of heat flow from below the advective transport of heat by groundwater flow. Because groundwater temperature is sensitive to conductive and advective processes, groundwater temperature may be utilized as a tracer to further constrain the uncertainty of predictions of advective radionuclide transport models constructed for the Nevada Test Site (NTS). Since heat transport, geochemical, and hydrologic models for a given area must all be consistent, uncertainty can be reduced by devaluing the weight of those models that do not match estimated heat flow. The objective of this study was to identify the quantity and quality of available heat flow data at the NTS. One-hundred-forty-five temperature logs from 63 boreholes were examined. Thirteen were found to have temperature profiles suitable for the determination of heat flow values from one or more intervals within the boreholes. If sufficient spatially distributed heat flow values are obtained, a heat transport model coupled to a hydrologic model may be used to reduce the uncertainty of a nonisothermal hydrologic model of the NTS.

  10. Low Temperature Particle Filtration of Producer Gas with Low Tar Content

    DEFF Research Database (Denmark)

    Hindsgaul, Claus

    the five days of gasifier operation, cartridge filters, bag filters were tested. Attempts to test an electrostatic precipitator failed. Cold gas cleaning systems using fiber filters (bag filters and filter cartridges at approx. 90°C) were successfully demonstrated with collection efficiencies between 96...

  11. Low Temperature Particle Filtration of Wood Gas with Low Tar Content

    DEFF Research Database (Denmark)

    Hindsgaul, Claus; Henriksen, Ulrik Birk; Bentzen, Jens Dall

    2002-01-01

    Baghouse filters and cartridge filters were tested online with wood gas from a two stage down draft gasifier. The gas contained soot and very low levels (10-30 mg/Nm³) of tar. Particle collection efficiencies were above 95%. Continuous operation with cheap self cleaning baghouse filters were tested...

  12. DETERMINING SURFACE TEMPERATURE AND CLOUD TEMPERATURE FROM METEOROLOGICAL EARTH SATELLITES,

    Science.gov (United States)

    ATMOSPHERIC TEMPERATURE, *METEOROLOGICAL SATELLITES), SURFACE TEMPERATURE , CLOUDS, BLACKBODY RADIATION, PERIODIC VARIATIONS, INTEGRALS, BOUNDARY LAYER, INTENSITY, ERRORS, CORRECTIONS, FUNCTIONS(MATHEMATICS), USSR

  13. Elevated temperature deformation analysis

    Science.gov (United States)

    Nelson, J. M.

    The paper demonstrates a novel nondestructive test and data analysis technique for quantitative measurement of circumferentially varying flexural moduli of 2D involute carbon-carbon tag rings containing localized wrinkles and dry plies at room and rocket nozzle operating temperatures. Room temperature computed tomography (CT) deformation tests were performed on 11 carbon-carbon rings selected from the cylinders and cones fabricated under the NDE data application program and two plexiglass rings fabricated under this program. This testing and analysis technique is found to have primary application in validation of analytical models for carbon-carbon performance modeling. Both effects of defects assumptions, the effects of high temperature environments, and failure-related models can be validated effectively. The testing and analysis process can be interwoven in a manner that increases the engineering understanding of the material behavior and permits rapid resolution of analysis questions. Specific recommendations for the development and implementation of this technique are provided.

  14. Do `negative' temperatures exist?

    Science.gov (United States)

    Lavenda, B. H.

    1999-06-01

    A modification of the second law is required for a system with a bounded density of states and not the introduction of a `negative' temperature scale. The ascending and descending branches of the entropy versus energy curve describe particle and hole states, having thermal equations of state that are given by the Fermi and logistic distributions, respectively. Conservation of energy requires isentropic states to be isothermal. The effect of adiabatically reversing the field is entirely mechanical because the only difference between the two states is their energies. The laws of large and small numbers, leading to the normal and Poisson approximations, characterize statistically the states of infinite and zero temperatures, respectively. Since the heat capacity also vanishes in the state of maximum disorder, the third law can be generalized in systems with a bounded density of states: the entropy tends to a constant as the temperature tends to either zero or infinity.

  15. Temperature-reflection I

    DEFF Research Database (Denmark)

    McGady, David A.

    2017-01-01

    -temperature path integrals for quantum field theories (QFTs) should be T-reflection invariant. Because multi-particle partition functions are equal to Euclidean path integrals for QFTs, we expect them to be T-reflection invariant. Single-particle partition functions though are often not invariant under T......In this paper, we revisit the claim that many partition functions are invariant under reflecting temperatures to negative values (T-reflection). The goal of this paper is to demarcate which partition functions should be invariant under T-reflection, and why. Our main claim is that finite...... that T-reflection is unrelated to time-reversal. Finally, we study the interplay between T-reflection and perturbation theory in the anharmonic harmonic oscillator in quantum mechanics and in Yang-Mills in four-dimensions. This is the first in a series of papers on temperature-reflections....

  16. Fiber optic temperature sensor

    Science.gov (United States)

    Sawatari, Takeo (Inventor); Gaubis, Philip A. (Inventor)

    2000-01-01

    A fiber optic temperature sensor uses a light source which transmits light through an optical fiber to a sensor head at the opposite end of the optical fiber from the light source. The sensor head has a housing coupled to the end of the optical fiber. A metallic reflective surface is coupled to the housing adjacent the end of the optical fiber to form a gap having a predetermined length between the reflective surface and the optical fiber. A detection system is also coupled to the optical fiber which determines the temperature at the sensor head from an interference pattern of light which is reflected from the reflective surface.

  17. Fluorescent temperature sensor

    Science.gov (United States)

    Baker, Gary A [Los Alamos, NM; Baker, Sheila N [Los Alamos, NM; McCleskey, T Mark [Los Alamos, NM

    2009-03-03

    The present invention is a fluorescent temperature sensor or optical thermometer. The sensor includes a solution of 1,3-bis(1-pyrenyl)propane within a 1-butyl-1-1-methylpyrrolidinium bis(trifluoromethylsulfonyl)imide ionic liquid solvent. The 1,3-bis(1-pyrenyl)propane remains unassociated when in the ground state while in solution. When subjected to UV light, an excited state is produced that exists in equilibrium with an excimer. The position of the equilibrium between the two excited states is temperature dependent.

  18. Nimbus-7 SMMR Antenna Temperatures

    Data.gov (United States)

    National Aeronautics and Space Administration — The SMMR Antenna Temperatures (Nimbus-7) data set consists of antenna temperatures from passive microwave radiometers aboard NOAA's Nimbus-7 satellite. The...

  19. TEMPERATURE INDEPENDENT PHOTOLUMINESCENCE ...

    Indian Academy of Sciences (India)

    8

    [1] C.A.K. Gouvˆea, F. Wypych, S.G. Moraes, N. Dur´an, P. Peralta-Zamora, Semiconductor- assisted photocatalytic degradation of reactive dyes in aqueous solution, Chemosphere. 427(2000) 40. [2] D.C Look, Equation of state for the study of temperature dependence of volume thermal expansion of nanomaterials, Mater.

  20. Life at High Temperatures

    Indian Academy of Sciences (India)

    2005-09-15

    Sep 15, 2005 ... or more in the vicinity of geothermal vents in the deep sea and the plant Tidestromia oblongifolia (Amaranthaceae) found in Death. Valley in California, where the hottest temperature on earth ever recorded during 43 consecutive days in 1917 was >48 °C. (Guinness Book of W orId Records, 1999).

  1. High temperature superconducting materials

    Energy Technology Data Exchange (ETDEWEB)

    Alario-Franco, M.A. [Universidad Complutense de Madrid (Spain). Facultad de Ciencias Quimicas

    1995-02-01

    The perovskite structure is the basis of all known high-temperature superconducting materials. Many of the most successful (highest T{sub c}) materials are based on mercury and thallium phases but, due to the high toxicity of the component compounds effort has been invested in the substitution of these elements with silver. Progress is reviewed. (orig.)

  2. Measuring Temperature: The Thermometer

    Science.gov (United States)

    Chamoun, Mirvette

    2005-01-01

    The author discusses the historical development of the thermometer with the view of helping children understand the role that mathematics plays in society. A model thermometer that is divided into three sections, each displaying one of the three temperature scales used today (Fahrenheit, Celsius and Kelvin) is highlighted as a project to allow…

  3. High-temperature superconductors

    CERN Document Server

    Saxena, Ajay Kumar

    2010-01-01

    The present book aims at describing the phenomenon of superconductivity and high-temperature superconductors discovered by Bednorz and Muller in 1986. The book covers the superconductivity phenomenon, structure of high-Tc superconductors, critical currents, synthesis routes for high Tc materials, superconductivity in cuprates, the proximity effect and SQUIDs, theories of superconductivity and applications of superconductors.

  4. High temperature superconductivity: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Bedell, K.S.; Coffey, D. (Los Alamos National Lab., NM (USA)); Meltzer, D.E. (Florida Univ., Gainesville, FL (USA)); Pines, D. (Illinois Univ., Urbana, IL (USA)); Schrieffer, J.R. (California Univ., Santa Barbara, CA (USA)) (eds.)

    1990-01-01

    This book is the result of a symposium at Los Alamos in 1989 on High Temperature Superconductivity. The topics covered include: phenomenology, quantum spin liquids, spin space fluctuations in the insulating and metallic phases, normal state properties, and numerical studies and simulations. (JF)

  5. Low Temperature Plasma Medicine

    Science.gov (United States)

    Graves, David

    2013-10-01

    Ionized gas plasmas near room temperature are used in a remarkable number of technological applications mainly because they are extraordinarily efficient at exploiting electrical power for useful chemical and material transformations near room temperature. In this tutorial address, I will focus on the newest area of low temperature ionized gas plasmas (LTP), in this case operating under atmospheric pressure conditions, in which the temperature-sensitive material is living tissue. LTP research directed towards biomedical applications such as sterilization, surgery, wound healing and anti-cancer therapy has seen remarkable growth in the last 3-5 years, but the mechanisms responsible for the biomedical effects have remained mysterious. It is known that LTP readily create reactive oxygen species (ROS) and reactive nitrogen species (RNS). ROS and RNS (or RONS), in addition to a suite of other radical and non-radical reactive species, are essential actors in an important sub-field of aerobic biology termed ``redox'' (or oxidation-reduction) biology. I will review the evidence suggesting that RONS generated by plasmas are responsible for their observed therapeutic effects. Other possible bio-active mechanisms include electric fields, charges and photons. It is common in LTP applications that synergies between different mechanisms can play a role and I will review the evidence for synergies in plasma biomedicine. Finally, I will address the challenges and opportunities for plasma physicists to enter this novel, multidisciplinary field.

  6. Temperature responsive cooling apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Weker, M.L.; Stearns, R.M.

    1987-08-11

    A temperature responsive cooling apparatus is described for an air conditioner or refrigeration system in operative association with a reservoir of fluid, the air conditioner or refrigeration system having an air cooled coil and means for producing a current of air for cooling the coil, the temperature responsive cooling apparatus comprising: (a) means for transferring the fluid from the reservoir to the air conditioner temperature responsive cooling apparatus, (b) a fluid control device activated by the current of air for cooling the coil; (c) a temperature activated, nonelectrical device for terminating and initiating the flow of fluid therethrough in an intermittent fashion for enhancing the operability of the compressor associated with the refrigeration system and for reducing the quantity of fluid required to cool the coil of the refrigeration system, (d) a fluid treatment device for preventing, reducing or mitigating the deposition of nonevaporative components on the air cooled coil, and (e) means for dispersing the fluid to the air cooled coil from the fluid control device for cooling the coil and increasing the efficiency of the air conditioner thereby reducing the cost of operating and maintaining the air conditioner without damaging the air conditioner and without the deposition of nonevaporative components thereupon.

  7. Fast Air Temperature Sensors

    DEFF Research Database (Denmark)

    Hendricks, Elbert

    1998-01-01

    The note documents briefly work done on a newly developed sensor for making fast temperature measurements on the air flow in the intake ports of an SI engine and in the EGR input line. The work reviewed has been carried out in close cooperation with Civ. Ing. Michael Føns, the author (IAU...

  8. Life at High Temperatures

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 9. Life at High Temperatures. Ramesh Maheshwari. General Article Volume 10 Issue 9 September 2005 pp 23-36. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/010/09/0023-0036. Keywords.

  9. High temperature storage loop :

    Energy Technology Data Exchange (ETDEWEB)

    Gill, David Dennis; Kolb, William J.

    2013-07-01

    A three year plan for thermal energy storage (TES) research was created at Sandia National Laboratories in the spring of 2012. This plan included a strategic goal of providing test capability for Sandia and for the nation in which to evaluate high temperature storage (>650ÀC) technology. The plan was to scope, design, and build a flow loop that would be compatible with a multitude of high temperature heat transfer/storage fluids. The High Temperature Storage Loop (HTSL) would be reconfigurable so that it was useful for not only storage testing, but also for high temperature receiver testing and high efficiency power cycle testing as well. In that way, HTSL was part of a much larger strategy for Sandia to provide a research and testing platform that would be integral for the evaluation of individual technologies funded under the SunShot program. DOEs SunShot program seeks to reduce the price of solar technologies to 6/kWhr to be cost competitive with carbon-based fuels. The HTSL project sought to provide evaluation capability for these SunShot supported technologies. This report includes the scoping, design, and budgetary costing aspects of this effort

  10. Temperature differential detection device

    Science.gov (United States)

    Girling, P.M.

    1986-04-22

    A temperature differential detection device for detecting the temperature differential between predetermined portions of a container wall is disclosed as comprising a Wheatstone bridge circuit for detecting resistance imbalance with a first circuit branch having a first elongated wire element mounted in thermal contact with a predetermined portion of the container wall, a second circuit branch having a second elongated wire element mounted in thermal contact with a second predetermined portion of a container wall with the wire elements having a predetermined temperature-resistant coefficient, an indicator interconnected between the first and second branches remote from the container wall for detecting and indicating resistance imbalance between the first and second wire elements, and connector leads for electrically connecting the wire elements to the remote indicator in order to maintain the respective resistance value relationship between the first and second wire elements. The indicator is calibrated to indicate the detected resistance imbalance in terms of a temperature differential between the first and second wall portions. 2 figs.

  11. Temperature crossovers in cuprates

    Energy Technology Data Exchange (ETDEWEB)

    Chubukov, Andrey V. [Department of Physics, University of Wisconsin, Madison, WI (United States); Pines, David; Stojkovic, Branko P. [Department of Physics, University of Illinois, Urbana, IL (United States)

    1996-11-25

    We study the temperature crossovers seen in the magnetic and transport properties of cuprates using a nearly antiferromagnetic Fermi-liquid model (NAFLM). We distinguish between underdoped and overdoped systems on the basis of their low-frequency magnetic behaviour and so classify the optimally doped cuprates as a special case of the underdoped cuprates. For the overdoped cuprates, we find, in agreement with earlier work, mean-field z=2 behaviour of the magnetic variables associated with the fact that the damping rate of their spin fluctuations is essentially independent of temperature, while the resistivity exhibits a crossover from Fermi-liquid behaviour at low temperature to linear-in-T behaviour above a certain temperature T{sub o}. We demonstrate that above T{sub o} the proximity of the quasiparticle Fermi surface to the magnetic Brillouin zone boundary brings about the measured linear-in-T resistivity. For the underdoped cuprates we argue that the sequence of crossovers identified by Barzykin and Pines in the low-frequency magnetic behaviour (from mean-field z=2 behaviour at high temperatures, T>T{sub cr}, to non-universal z=1 scaling behaviour at intermediate temperatures, T{sub *}temperature-dependent spin damping and ends at T{sub *} where the Fermi surface has lost pieces near corners of the magnetic Brillouin zone. For T{sub *}

  12. Couleurs, etoiles, temperatures.

    Science.gov (United States)

    Spite, F.

    The eye is able to distinguish very tiny color differences of contiguous objects (at high light level, cones vision), but it is not a reliable colorimeter. Hot objects (a heated iron rod) emits some red light, a hotter object would provide a yellow-orange light (the filament of a bulb) and a still hotter one a white or even bluish light : this may be at reverse of common life codes, where "red" means hot water and/or danger, and "blue" cool water or cool air. Stars are a good illustration of the link between temperatures and colors. A heated iron rod has a temperature of about 800 K. Let us recall that K is a temperature unit (Kelvin) such that the Kelvin temperature is the Celsius temperature +273).The so called red stars (or cool stars) have temperature around 3000 K, higher than "white-hot iron". The Sun has a still higher temperature (5800 K) and its color is white : the solar light is by definition the "white light", and includes violet, blue, green, yellow, orange and red colors in balanced proportions (the maximum in the yellow-green). It is often said that the Sun is a yellow star. Admittedly, a brief glimpse at the Sun (take care ! never more than a VERY brief glimpse !) provides a perception of yellow light, but such a vision, with the eye overwhelmed by a fierce light, is not able to provide a good evaluation of the solar color : prefer a white sheet of paper illuminated by the Sun at noon and conclude that "the Sun is a white star". It is sometimes asked why red, white and bluish stars are seen in the sky, but no green stars : the solar light has its maximum intensity in the green, but such a dominant green light, equilibrated by some blue and some red light, is what we call "white", so that stars similar to the Sun, with a maximum in the green, are seen as white stars. Faint stars (rods vision of the eye) are also seen as white stars. Spots on the Sun (never look at the Sun ! let us say spots on "projected images of the Sun") appear as black spots

  13. Estimation of bare soil surface temperature from air temperature and ...

    African Journals Online (AJOL)

    Soil surface temperature has critical influence on climate, agricultural and hydrological activities since it serves as a good indicator of the energy budget of the earth's surface. Two empirical models for estimating soil surface temperature from air temperature and soil depth temperature were developed. The coefficient of ...

  14. High temperature materials and mechanisms

    CERN Document Server

    2014-01-01

    The use of high-temperature materials in current and future applications, including silicone materials for handling hot foods and metal alloys for developing high-speed aircraft and spacecraft systems, has generated a growing interest in high-temperature technologies. High Temperature Materials and Mechanisms explores a broad range of issues related to high-temperature materials and mechanisms that operate in harsh conditions. While some applications involve the use of materials at high temperatures, others require materials processed at high temperatures for use at room temperature. High-temperature materials must also be resistant to related causes of damage, such as oxidation and corrosion, which are accelerated with increased temperatures. This book examines high-temperature materials and mechanisms from many angles. It covers the topics of processes, materials characterization methods, and the nondestructive evaluation and health monitoring of high-temperature materials and structures. It describes the ...

  15. JV Task 46 - Development and Testing of a Thermally Integrated SOFC-Gasification System for Biomass Power Generation

    Energy Technology Data Exchange (ETDEWEB)

    Phillip Hutton; Nikhil Patel; Kyle Martin; Devinder Singh

    2008-02-01

    The Energy & Environmental Research Center has designed a biomass power system using a solid oxide fuel cell (SOFC) thermally integrated with a downdraft gasifier. In this system, the high-temperature effluent from the SOFC enables the operation of a substoichiometric air downdraft gasifier at an elevated temperature (1000 C). At this temperature, moisture in the biomass acts as an essential carbon-gasifying medium, reducing the equivalence ratio at which the gasifier can operate with complete carbon conversion. Calculations show gross conversion efficiencies up to 45% (higher heating value) for biomass moisture levels up to 40% (wt basis). Experimental work on a bench-scale gasifier demonstrated increased tar cracking within the gasifier and increased energy density of the resultant syngas. A series of experiments on wood chips demonstrated tar output in the range of 9.9 and 234 mg/m{sup 3}. Both button cells and a 100-watt stack was tested on syngas from the gasifier. Both achieved steady-state operation with a 22% and 15% drop in performance, respectively, relative to pure hydrogen. In addition, tar tolerance testing on button cells demonstrated an upper limit of tar tolerance of approximately 1%, well above the tar output of the gasifier. The predicted system efficiency was revised down to 33% gross and 27% net system efficiency because of the results of the gasifier and fuel cell experiments. These results demonstrate the feasibility and benefits of thermally integrating a gasifier and a high-temperature fuel cell in small distributed power systems.

  16. Temperature Measurement and Monitoring Devices

    Science.gov (United States)

    1988-08-01

    feasibility based on potential usefulness in clinical medicine ’ias explored. All information herein wasn obtained from literature rrv’iew only. No...measurements, applications for temperature measuring devices, and description of several modern body temperature monitoring devices (techniques). Finally...gynecology, drug therapy, and ophthalmology. TEMPERATURE SENSING DEVICES Hippocrates is believed to be the first person Lo associate body temperature as

  17. High Temperature Piezoelectric Drill

    Science.gov (United States)

    Bao, Xiaoqi; Bar-Cohen, Yoseph; Sherrit, Stewart; Badescu, Mircea; Shrout, Tom

    2012-01-01

    Venus is one of the planets in the solar systems that are considered for potential future exploration missions. It has extreme environment where the average temperature is 460 deg C and its ambient pressure is about 90 atm. Since the existing actuation technology cannot maintain functionality under the harsh conditions of Venus, it is a challenge to perform sampling and other tasks that require the use of moving parts. Specifically, the currently available electromagnetic actuators are limited in their ability to produce sufficiently high stroke, torque, or force. In contrast, advances in developing electro-mechanical materials (such as piezoelectric and electrostrictive) have enabled potential actuation capabilities that can be used to support such missions. Taking advantage of these materials, we developed a piezoelectric actuated drill that operates at the temperature range up to 500 deg C and the mechanism is based on the Ultrasonic/Sonic Drill/Corer (USDC) configuration. The detailed results of our study are presented in this paper

  18. Core Outlet Temperature Study

    Energy Technology Data Exchange (ETDEWEB)

    Moisseytsev, A. [Argonne National Laboratory (ANL), Argonne, IL (United States); Hoffman, E. [Argonne National Laboratory (ANL), Argonne, IL (United States); Majumdar, S. [Argonne National Laboratory (ANL), Argonne, IL (United States)

    2008-07-28

    It is a known fact that the power conversion plant efficiency increases with elevation of the heat addition temperature. The higher efficiency means better utilization of the available resources such that higher output in terms of electricity production can be achieved for the same size and power of the reactor core or, alternatively, a lower power core could be used to produce the same electrical output. Since any nuclear power plant, such as the Advanced Burner Reactor, is ultimately built to produce electricity, a higher electrical output is always desirable. However, the benefits of the higher efficiency and electricity production usually come at a price. Both the benefits and the disadvantages of higher reactor outlet temperatures are analyzed in this work.

  19. High temperature future

    Energy Technology Data Exchange (ETDEWEB)

    Sheinkopf, K. [Solar Energy Research and Education Foundation, Washington, DC (United States)

    1994-09-01

    During the past few years, there have been dramatic accomplishments and success of high temperature solar thermal systems and significant development of these systems. High temperature technologies, about 500 F and higher, such as dish engines, troughs, central receiver power towers and solar process heat systems, have been tested, demonstrated and used in an array of applications, including many cost-effective utility bulk power production and demand side supply projects in the United States. Large systems provide power and hot water to prisons, schools, nursing homes and other institutions. Joint ventures with industry, utility projects, laboratory design assistance and other activities are building a solid industry of US solar thermal systems ready for use today.

  20. The temperature hydration kinetics

    Directory of Open Access Journals (Sweden)

    Mircea Oroian

    2017-07-01

    Full Text Available The aim of this study is to evaluate the hydration kinetics of lentil seeds (Lens culinaris in water at different temperatures (25, 32.5, 40, 55, 70 and 80 °C for assessing the adequacy of models for describing the absorption phenomena during soaking. The diffusion coefficient values were calculated using Fick’s model for spherical and hemispherical geometries and the values were in the range of 10−6 m2/s. The experimental data were fitted to Peleg, Sigmoidal, Weibull and Exponential models. The models adequacy was determined using regression coefficients (R2, root mean square error (RMSE and reduced chi-square (χ2. The Peleg model is the suitable one for predicting the experimental data. Temperature had a positive and significant effect on the water absorption capacities and absorption was an endothermic process.

  1. Ultrahigh temperature intermetallic alloys

    Energy Technology Data Exchange (ETDEWEB)

    Brady, M.P.; Zhu, J.H.; Liu, C.T.; Tortorelli, P.F.; Wright, J.L.; Carmichael, C.A.; Walker, L.R. [Oak Ridge National Lab., TN (United States). Metals and Ceramics Div.

    1997-12-01

    A new family of Cr-Cr{sub 2}X based alloys with fabricability, mechanical properties, and oxidation resistance superior to previously developed Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys has been identified. The new alloys can be arc-melted/cast without cracking, and exhibit excellent room temperature and high-temperature tensile strengths. Preliminary evaluation of oxidation behavior at 1100 C in air indicates that the new Cr-Cr{sub 2}X based alloys form an adherent chromia-based scale. Under similar conditions, Cr-Cr{sub 2}Nb and Cr-Cr{sub 2}Zr based alloys suffer from extensive scale spallation.

  2. Fast Air Temperature Sensors

    DEFF Research Database (Denmark)

    Hendricks, Elbert

    1998-01-01

    The note documents briefly work done on a newly developed sensor for making fast temperature measurements on the air flow in the intake ports of an SI engine and in the EGR input line. The work reviewed has been carried out in close cooperation with Civ. Ing. Michael Føns, the author (IAU......) and Spencer C. Sorenson (ET). The theory which decribes in detail the overall dynamic chracteristics of the sensor was developed at IAU, DTU....

  3. Fuel Temperature Fluctuations During Storage

    Science.gov (United States)

    Levitin, R. E.; Zemenkov, Yu D.

    2016-10-01

    When oil and petroleum products are stored, their temperature significantly impacts how their properties change. The paper covers the problem of determining temperature fluctuations of hydrocarbons during storage. It provides results of the authors’ investigations of the stored product temperature variations relative to the ambient temperature. Closeness and correlation coefficients between these values are given. Temperature variations equations for oil and petroleum products stored in tanks are deduced.

  4. Crowdsourcing urban air temperatures from smartphone battery temperatures

    Science.gov (United States)

    Overeem, Aart; Robinson, James C. R.; Leijnse, Hidde; Steeneveld, Gert-Jan; Horn, Berthold K. P.; Uijlenhoet, Remko

    2014-05-01

    Accurate air temperature observations in urban areas are important for meteorology and energy demand planning. They are indispensable to study the urban heat island effect and the adverse effects of high temperatures on human health. However, the availability of temperature observations in cities is often limited. Here we show that relatively accurate air temperature information for the urban canopy layer can be obtained from an alternative, nowadays omnipresent source: smartphones. In this study, battery temperatures were collected by an Android application for smartphones. It has been shown that a straightforward heat transfer model can be employed to estimate daily mean air temperatures from smartphone battery temperatures for eight major cities around the world. The results demonstrate the enormous potential of this crowdsourcing application for real-time temperature monitoring in densely populated areas. Battery temperature data were collected by users of an Android application for cell phones (opensignal.com). The application automatically sends battery temperature data to a server for storage. In this study, battery temperatures are averaged in space and time to obtain daily averaged battery temperatures for each city separately. A regression model, which can be related to a physical model, is employed to retrieve daily air temperatures from battery temperatures. The model is calibrated with observed air temperatures from a meteorological station of an airport located in or near the city. Time series of air temperatures are obtained for each city for a period of several months, where 50% of the data is for independent verification. The methodology has been applied to Buenos Aires, London, Los Angeles, Paris, Mexico City, Moscow, Rome, and Sao Paulo. The evolution of the retrieved air temperatures often correspond well with the observed ones. The mean absolute error of daily air temperatures is less than 2 degrees Celsius, and the bias is within 1 degree

  5. SUPPORTED LIQUID CATALYSTS FOR REMOVAL OF HIGH TEMPERATURE FUEL CELL CONTAMINANTS

    Energy Technology Data Exchange (ETDEWEB)

    Alan W. Weimer (PI); Peter Czerpak; Patrick Hilbert

    2000-01-01

    A novel catalytic synthesis gas oxidation process using molten carbonate salts supported on compatible fluidized iron oxide particles (supported-liquid-phase-catalyst (SLPC) fluidized bed process) was investigated. This process combines the advantages of large scale fluidized bed processing with molten salt bath oxidation. Molten salt catalysts can be supported within porous fluidized particles in order to improve mass transfer rates between the liquid catalysts and the reactant gases. Synthesis gas can be oxidized at reduced temperatures resulting in low NO{sub x} formation while trace sulfides and halides are captured in-situ. Hence, catalytic oxidation of synthesis gas can be carried out simultaneously with hot gas cleanup. Such SLPC fluidized bed processes are affected by inter-particle liquid capillary forces that may lead to agglomeration and de-fluidization of the bed. An understanding of the origin and strength of these forces is needed so that they can be overcome in practice. Process design is based on thermodynamic free energy minimization calculations that indicate the suitability of eutectic Na{sub 2}CO{sub 3}/K{sub 2}CO{sub 3} mixtures for capturing trace impurities in-situ (< 1 ppm SO{sub x} released) while minimizing the formation of NO{sub x}(< 10 ppm). Iron oxide has been identified as a preferred support material since it is non-reactive with sodium, is inexpensive, has high density (i.e. inertia), and can be obtained in various particle sizes and porosities. Force balance modeling has been used to design a surrogate ambient temperature system that is hydrodynamically similar to the real system, thus allowing complementary investigation of the governing fluidization hydrodynamics. The primary objective of this research was to understand the origin of and to quantify the liquid capillary interparticle forces affecting the molten carbonate SLPC fluidized bed process. Substantial theoretical and experimental exploratory results indicate process

  6. Energetic Materials and Metals Contamination at CFB/ASU Wainwirght, Alberta Phase 1

    Science.gov (United States)

    2008-11-01

    en Alberta a permis d’évaluer la contamination en métaux et en matériaux énergétiques dans les sols et la biomasse. Cette base a été sélectionnée...du site d’entraînement. Les échantillons de sols et de biomasses ont été prélevés suivant une approche composite pour être statistiquement...à RDDC Valcartier. Ce travail a été réalisé aux mois de mai et de juin 2004 et a été supporté par DLE à Ottawa et SERDP, à Washington D.C., aux

  7. Rheological behavior in Xinglongzhuang coal washery sludge pump system of CFB boiler

    Energy Technology Data Exchange (ETDEWEB)

    Tang, X.; Yang, J.; Jiang, X.; Chi, Y.; Yan, J. [Zhejiang University, Hangzhou (China)

    2007-06-15

    The rheological behaviour of slime was researched and the application reliability of a pump was tested by carrying out a feasibility test and simulating a project test with a KK139 pump made in Germany. The moisture of the slime changed from 27.5% to 30.2% and the frequency of the pump changed from 32.42 Hz to 64.49 Hz. The rheological behaviour of the slime was calculated by a series of hydromechanical formulae. Experimental results show that, in this moisture range, yield shearing stress, shearing stress, apparent viscosity and floating resistance were reduced following increase of moisture. Slime of 27.5% is the lowest moisture level which can be pumped. Slime of 28% is the most economically suitable to pump. Its rheological behaviour has complete transformation from yielding-pseudoplastic to Bingham fluid. 3 refs., 3 figs., 1 tab.

  8. Hydrodynamics of a commercial scale CFB boiler-study with radioactive tracer particles

    DEFF Research Database (Denmark)

    Lin, Weigang; Hansen, Peter F.B.; Dam-Johansen, Kim

    1999-01-01

    This paper presents the experimental results with radioactive tracer particles in an 80 MWth circulating fluidized-bed boiler. Batches of gamma-ray emitting tracer particles were injected into the standpipe. The response curves of the impulse injection were measured by a set of successive scintil...... the model to the experimental data. In the same way, the average particle velocities in the furnace are estimated. The impact of loading on the particle recirculating rate and on the hydrodynamics of the boiler is discussed. (C) 1999 Elsevier Science Ltd. All rights reserved....

  9. A CFD study of gas-solid jet in a CFB riser flow

    Energy Technology Data Exchange (ETDEWEB)

    Li, Tingwen; Guenther, Chris

    2012-03-01

    Three-dimensional high-resolution numerical simulations of a gas–solid jet in a high-density riser flow were conducted. The impact of gas–solid injection on the riser flow hydrodynamics was investigated with respect to voidage, tracer mass fractions, and solids velocity distribution. The behaviors of a gas–solid jet in the riser crossflow were studied through the unsteady numerical simulations. Substantial separation of the jetting gas and solids in the riser crossflow was observed. Mixing of the injected gas and solids with the riser flow was investigated and backmixing of gas and solids was evaluated. In the current numerical study, both the overall hydrodynamics of riser flow and the characteristics of gas–solid jet were reasonably predicted compared with the experimental measurements made at NETL.

  10. Residential Indoor Temperature Study

    Energy Technology Data Exchange (ETDEWEB)

    Booten, Chuck [National Renewable Energy Lab. (NREL), Golden, CO (United States); Robertson, Joseph [National Renewable Energy Lab. (NREL), Golden, CO (United States); Christensen, Dane [National Renewable Energy Lab. (NREL), Golden, CO (United States); Heaney, Mike [Arrow Electronics, Centennial, CO (United States); Brown, David [Univ. of Virginia, Charlottesville, VA (United States); Norton, Paul [Norton Energy Research and Development, Boulder, CO (United States); Smith, Chris [Ingersoll-Rand Corp., Dublin (Ireland)

    2017-04-07

    In this study, we are adding to the body of knowledge around answering the question: What are good assumptions for HVAC set points in U.S. homes? We collected and analyzed indoor temperature data from US homes using funding from the U.S. Department of Energy's Building America (BA) program, due to the program's reliance on accurate energy simulation of homes. Simulations are used to set Building America goals, predict the impact of new building techniques and technologies, inform research objectives, evaluate home performance, optimize efficiency packages to meet savings goals, customize savings approaches to specific climate zones, and myriad other uses.

  11. Room Temperature Curing Polymers

    Science.gov (United States)

    1977-05-01

    UJ LU LU LU UJ LU W -Q U "O 26 -- - -■- — ■ ■- ■ MBti ^L. IIIIIIII.IHI.I|.UHI,IW’I»;I.!I"IT,U» mpwi«ŕ "^Wl be 190,000 psi which is consistent...was added to the mixture. After 1 hour benzene and water were added and the mixture was stirred until the salt was dissolved. The organic ...for 15 minutes and then cooled to room temperature. The mixture was extracted with two 100 ml portions of water. The organic layer was dried (MgS04

  12. High temperature superconductors

    CERN Document Server

    Paranthaman, Parans

    2010-01-01

    This essential reference provides the most comprehensive presentation of the state of the art in the field of high temperature superconductors. This growing field of research and applications is currently being supported by numerous governmental and industrial initiatives in the United States, Asia and Europe to overcome grid energy distribution issues. The technology is particularly intended for densely populated areas. It is now being commercialized for power-delivery devices, such as power transmission lines and cables, motors and generators. Applications in electric utilities include current limiters, long transmission lines and energy-storage devices that will help industries avoid dips in electric power.

  13. The relationship between body and ambient temperature and corneal temperature

    DEFF Research Database (Denmark)

    Kessel, Line; Johnson, Leif; Arvidsson, Henrik Sven

    2010-01-01

    Exposure to elevated ambient temperatures has been mentioned as a risk factor for common eye diseases, primarily presbyopia and cataract. The aim of the present study was to examine the relationship among ambient, cornea, and body core temperature....

  14. Ultra high temperature gasification of municipal wastewater primary biosolids in a rotary kiln reactor for the production of synthesis gas.

    Science.gov (United States)

    Gikas, Petros

    2017-12-01

    Primary Fine-Sieved Solids (PFSS) are produced from wastewater by the use of micro-sieves, in place of primary clarification. Biosolids is considered as a nuisance product, however, it contains significant amounts of energy, which can be utilized by biological (anaerobic digestion) or thermal (combustion or gasification) processes. In the present study, an semi-industrial scale UHT rotary kiln gasifier, operating with electric energy, was employed for the gasification of PFSS (at 17% moisture content), collected from a municipal wastewater treatment plant. Two gasification temperatures (950 and 1050 °C) had been tested, with minimal differences, with respect to syngas yield. The system appears to reach steady state after about 30-40 min from start up. The composition of the syngas at near steady state was measured approximately as 62.4% H 2 , 30.0% CO, 2.4% CH 4 and 3.4% CO 2 , plus 1.8% unidentified gases. The potential for electric energy production from the syngas produced is theoretically greater than the electric energy required for gasification. Theoretically, approximately 3.8 MJ/kg PFSS of net electric energy may be produced. However, based on the measured electric energy consumption, and assuming that all the syngas produced is used for electric energy production, addition of excess electric energy (about 0.43 MJ/kg PFSS) is required to break even. The latter is probably due to heat losses to the environment, during the heating process. With the improvement of energy efficiency, the process can be self sustained, form the energy point of view. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. The relationship between body and ambient temperature and corneal temperature

    DEFF Research Database (Denmark)

    Kessel, Line; Johnson, Leif; Arvidsson, Henrik Sven

    2010-01-01

    Exposure to elevated ambient temperatures has been mentioned as a risk factor for common eye diseases, primarily presbyopia and cataract. The aim of the present study was to examine the relationship among ambient, cornea, and body core temperature.......Exposure to elevated ambient temperatures has been mentioned as a risk factor for common eye diseases, primarily presbyopia and cataract. The aim of the present study was to examine the relationship among ambient, cornea, and body core temperature....

  16. Core temperature affects scalp skin temperature during scalp cooling.

    Science.gov (United States)

    Daanen, Hein A M; Peerbooms, Mijke; van den Hurk, Corina J G; van Os, Bernadet; Levels, Koen; Teunissen, Lennart P J; Breed, Wim P M

    2015-08-01

    The efficacy of hair loss prevention by scalp cooling to prevent chemotherapy induced hair loss has been shown to be related to scalp skin temperature. Scalp skin temperature, however, is dependent not only on local cooling but also on the thermal status of the body. This study was conducted to investigate the effect of body temperature on scalp skin temperature. We conducted experiments in which 13 healthy subjects consumed ice slurry to lower body temperature for 15 minutes after the start of scalp cooling and then performed two 12-minute cycle exercise sessions to increase body core temperature. Esophageal temperature (Tes ), rectal temperature (Tre ), mean skin temperature (eight locations, Tskin ), and mean scalp temperature (five locations, Tscalp ) were recorded. During the initial 10 minutes of scalp cooling, Tscalp decreased by >15 °C, whereas Tes decreased by 0.2 °C. After ice slurry ingestion, Tes , Tre , and Tskin were 35.8, 36.5, and 31.3 °C, respectively, and increased after exercise to 36.3, 37.3, and 33.0 °C, respectively. Tscalp was significantly correlated to Tes (r = 0.39, P scalp cooling contributes to the decrease in scalp temperature and may improve the prevention of hair loss. This may be useful if the desired decrease of scalp temperature cannot be obtained by scalp cooling systems. © 2015 The International Society of Dermatology.

  17. Crowdsourcing urban air temperatures from smartphone battery temperatures

    NARCIS (Netherlands)

    Overeem, A.; Robinson, J.C.R.; Leijnse, H.; Steeneveld, G.J.; Horn, B.K.P.; Uijlenhoet, R.

    2013-01-01

    [1] Accurate air temperature observations in urban areas are important for meteorology and energy demand planning. They are indispensable to study the urban heat island effect and the adverse effects of high temperatures on human health. However, the availability of temperature observations in

  18. Effect of irrigation fluid temperature on body temperature during ...

    African Journals Online (AJOL)

    ... of dogs were hypothermic (<37oC). The addition of warmed irrigation fluids to a temperature management protocol in dogs undergoing elbow arthroscopy during general anaesthesia did not lead to decreased temperature losses. Keywords: Arthroscopy, Hypothermia, Irrigation fluid temperature, Thermoregulation.

  19. High Temperature Aquifer Storage

    Science.gov (United States)

    Ueckert, Martina; Niessner, Reinhard; Baumann, Thomas

    2016-04-01

    Combined heat and power generation (CHP) is highly efficient because excess heat is used for heating and/or process energy. However, the demand of heat energy varies considerably throughout the year while the demand for electrical energy is rather constant. It seems economically and ecologically highly beneficial for municipalities and large power consumers such as manufacturing plants to store excess heat in groundwater aquifers and to recuperate this energy at times of higher demand. Within the project High Temperature Aquifer Storage, scientists investigate storage and recuperation of excess heat energy into the bavarian Malm aquifer. Apart from high transmissivity and favorable pressure gradients, the hydrochemical conditions are crucial for long-term operation. An enormous technical challenge is the disruption of the carbonate equilibrium - modeling results indicated a carbonate precipitation of 10 - 50 kg/d in the heat exchangers. The test included five injection pulses of hot water (60 °C up to 110 °C) and four tracer pulses, each consisting of a reactive and a conservative fluorescent dye, into a depth of about 300 m b.s.l. resp. 470 m b.s.l. Injection and production rates were 15 L/s. To achieve the desired water temperatures, about 4 TJ of heat energy were necessary. Electrical conductivity, pH and temperature were recorded at a bypass where also samples were taken. A laboratory container at the drilling site was equipped for analysing the concentration of the dyes and the major cations at sampling intervals of down to 15 minutes. Additional water samples were taken and analysed in the laboratory. The disassembled heat exchanger prooved that precipitation was successfully prevented by adding CO2 to the water before heating. Nevertheless, hydrochemical data proved both, dissolution and precipitation processes in the aquifer. This was also suggested by the hydrochemical modelling with PhreeqC and is traced back to mixture dissolution and changing

  20. Studies involving high temperature desulfurization/regeneration reactions of metal oxides for fuel cell development. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Jalan, V.

    1983-10-01

    Research conducted at Giner, Inc. during 1981 to 1983 under the present contract has been a continuation of the investigation of a high temperature regenerable desulfurization process capable of reducing the sulfur content in coal gases from 200 ppM to 1 ppM. The overall objective has been the integration of a coal gasifier with a molten carbonate fuel cell, which requires that the sulfur content be below 1 ppM. Commercially available low temperature processes incur an excessive energy penalty. Results obtained with packed-bed and fluidized bed reactors have demonstrated that a CuO/ZnO mixed oxide sorbent is regenerable and capable of lowering the sulfur content (as H/sub 2/S and COS) from 200 ppM in simulated hot coal-derived gases to below 1 ppM level at 600 to 650/sup 0/C. Four potential sorbents (copper, tungsten oxide, vanadium oxide and zinc oxide) were initially selected for experimental use in hot regenerable desulfurization in the temperature range 500 to 650/sup 0/C. Based on engineering considerations, such as desulfurization capacity in per weight or volume of sorbents, a coprecipitated CuO/ZnO was selected for further study. A structural reorganization mechanism, unique to mixed oxides, was identified: the creation of relatively fine crystallites of the sulfided components (Cu/sub 2/S and ZnS) to counteract the loss of surface area due to sintering during regeneration. Studies with 9 to 26% water vapor in simulated coal gases show that sulfur levels below 1 ppM can be achieved in the temperature range of 500/sup 0/ to 650/sup 0/C. The ability of CuO/ZnO to remove COS, CS/sub 2/ and CH/sub 3/SH at these conditions has been demonstrated in this study. Also a previously proposed pore-plugging model was further developed with good success for data treatment of both packed bed and fluidized-bed reactors. 96 references, 42 figures, 21 tables.

  1. High temperature superconductor accelerator magnets

    NARCIS (Netherlands)

    van Nugteren, J.

    2016-01-01

    For future particle accelerators bending dipoles are considered with magnetic fields exceeding 20T. This can only be achieved using high temperature superconductors (HTS). These exhibit different properties from classical low temperature superconductors and still require significant research and

  2. Temperature measurement in the sea

    Digital Repository Service at National Institute of Oceanography (India)

    Krishnamacharyulu, R.J.; Rao, L.V.G.

    meters with temperature sensors, moored data buoys and drifting buoys) are described in brief. Specialised equipment used for studying oceanic features like internal waves, thermal fronts and temperature microstructure (thermistor chain, isotherm follower...

  3. Temperature Measurement for the LSST

    OpenAIRE

    Czekala, Ian; Paul O'Connor

    2014-01-01

    We explore the various means of temperature measurement to search for a low-cost accurate temperature measuring device.  This poster was completed as part of the Brookhaven National Laboratory High School intern program in 2005.

  4. Safe Minimum Internal Temperature Chart

    Science.gov (United States)

    ... JSR 286) Actions ${title} Loading... Safe Minimum Internal Temperature Chart Safe steps in food handling, cooking, and ... from other foods. Cook —Cook to the right temperature. Chill —Refrigerate food promptly. Cook all food to ...

  5. Melting temperature of archaeometallurgical slag

    Directory of Open Access Journals (Sweden)

    Jozef Petrík

    2013-12-01

    Full Text Available The aim of submitted work is to search the softening and melting temperature of archeometallurgy bloomery and blast furnace slag using high – temperature microscope. The high values of melting temperature of bloomery slag is a result of secondary oxidation of wüstite in the chamber of a microscope. The melting temperature increases with an increase in SiO2 and decreases with increasing basicity of the slag.

  6. Fiber Sagnac interferometer temperature sensor

    Energy Technology Data Exchange (ETDEWEB)

    Starodumov, A.N.; Zenteno, L.A.; Monzon, D.; De La Rosa, E. [Centro de Investigaciones en Optica, 37150 Leon, Gto (Mexico)

    1997-01-01

    A modified Sagnac interferometer-based fiber temperature sensor is proposed. Polarization independent operation and high temperature sensitivity of this class of sensors make them cost effective instruments for temperature measurements. A comparison of the proposed sensor with Bragg grating and long-period grating fiber sensors is derived. A temperature-induced spectral displacement of 0.99 nm/K is demonstrated for an internal stress birefringent fiber-based Sagnac interferometer. {copyright} {ital 1997 American Institute of Physics.}

  7. Modeling Temperature and Pricing Weather Derivatives Based on Temperature

    Directory of Open Access Journals (Sweden)

    Birhan Taştan

    2017-01-01

    Full Text Available This study first proposes a temperature model to calculate the temperature indices upon which temperature-based derivatives are written. The model is designed as a mean-reverting process driven by a Levy process to represent jumps and other features of temperature. Temperature indices are mainly measured as deviations from a base temperature, and, hence, the proposed model includes jumps because they may constitute an important part of this deviation for some locations. The estimated value of a temperature index and its distribution in this model apply an inversion formula to the temperature model. Second, this study develops a pricing process over calculated index values, which returns a customized price for temperature-based derivatives considering that temperature has unique effects on every economic entity. This personalized price is also used to reveal the trading behavior of a hypothesized entity in a temperature-based derivative trade with profit maximization as the objective. Thus, this study presents a new method that does not need to evaluate the risk-aversion behavior of any economic entity.

  8. High temperature autoclave vacuum seals

    Science.gov (United States)

    Hoffman, J. R.; Simpson, W. G.; Walker, H. M.

    1971-01-01

    Aluminum sheet forms effective sealing film at temperatures up to 728 K. Soft aluminum wire rings provide positive seal between foil and platen. For applications at temperatures above aluminum's service temperature, stainless steel is used as film material and copper wire as sealant.

  9. Temperature dependence of surface nanobubbles

    NARCIS (Netherlands)

    Berkelaar, R.P.; Seddon, James Richard Thorley; Zandvliet, Henricus J.W.; Lohse, Detlef

    2012-01-01

    The temperature dependence of nanobubbles was investigated experimentally using atomic force microscopy. By scanning the same area of the surface at temperatures from 51 °C to 25 °C it was possible to track geometrical changes of individual nanobubbles as the temperature was decreased.

  10. High Temperature Superconductor Machine Prototype

    DEFF Research Database (Denmark)

    Mijatovic, Nenad; Jensen, Bogi Bech; Træholt, Chresten

    2011-01-01

    A versatile testing platform for a High Temperature Superconductor (HTS) machine has been constructed. The stationary HTS field winding can carry up to 10 coils and it is operated at a temperature of 77K. The rotating armature is at room temperature. Test results and performance for the HTS field...

  11. Battery system with temperature sensors

    Science.gov (United States)

    Wood, Steven J.; Trester, Dale B.

    2012-11-13

    A battery system to monitor temperature includes at least one cell with a temperature sensing device proximate the at least one cell. The battery system also includes a flexible member that holds the temperature sensor proximate to the at least one cell.

  12. High Temperature Hybrid Elastomers

    Science.gov (United States)

    Drake, Kerry Anthony

    Conventional high temperature elastomers are produced by chain polymerization of olefinic or fluorinated olefinic monomers. Ultimate thermal stabilities are limited by backbone bond strengths, lower thermal stability of cross-link sites relative to backbone bonds, and depolymerization or "unzipping" at high temperatures. In order to develop elastomers with enhanced thermal stability, hybrid thermally cross-linkable polymers that consisted only of organic-inorganic and aromatic bonds were synthesized and evaluated. The addition of phenylethynyl or phenylacetylinic functional groups to these polymers resulted in conversion of the polymers into high temperature elastomers when cross-linked by thermal curing. Polyphenyoxydiphenylsilanes were synthesized via several different condensation reactions. Results of these synthetic reactions, which utilized both hydroquinone and biphenol as monomers, were systematically evaluated to determine the optimal synthetic conditions for subsequent endcapping reactions. It was determined that dichlorodiphenylsilane condensations with biphenol in toluene or THF were best suited for this work. Use of excess dichlorodiphenylsilane yielded polymers of appropriate molecular weights with terminal reactive chlorosilane groups that could be utilized for coupling with phenylethynyl reagents in a subsequent reaction. Two new synthetic routes were developed to endcap biphenoxysilanes with ethynyl containing substituents, to yield polymers with cross-linkable end groups. Endcapping by lithiumphenylacetylide and 4[(4-fluorophenylethynyl))phenol yielded two new polymers that could be thermally cross-linked on heating above 300 °C. Successful endcapping was verified chemically by 13C NMR, FTIR and Raman analysis. Exothermic peaks consistent with ethynyl curing reactions were observed in endcapped polymers by DSC. A new diacetylinic polymer was prepared through reaction of 4,4'-buta-1,3-diyne-1,4-diyldiphenol and dichlorodiphenylsilane. This

  13. Hadrons at finite temperature

    CERN Document Server

    Mallik, Samirnath

    2016-01-01

    High energy laboratories are performing experiments in heavy ion collisions to explore the structure of matter at high temperature and density. This elementary book explains the basic ideas involved in the theoretical analysis of these experimental data. It first develops two topics needed for this purpose, namely hadron interactions and thermal field theory. Chiral perturbation theory is developed to describe hadron interactions and thermal field theory is formulated in the real-time method. In particular, spectral form of thermal propagators is derived for fields of arbitrary spin and used to calculate loop integrals. These developments are then applied to find quark condensate and hadron parameters in medium, including dilepton production. Finally, the non-equilibrium method of statistical field theory to calculate transport coefficients is reviewed. With technical details explained in the text and appendices, this book should be accessible to researchers as well as graduate students interested in thermal ...

  14. Temperature integration and DIF in cut chrysanthemum

    NARCIS (Netherlands)

    Korner, O.; Challa, H.

    2003-01-01

    To reduce energy consumption in greenhouses, temperature integration can be used. However, the temperature integration principle considers only average temperatures and does not comply with the DIF concept (difference between mean day temperature and mean night temperature). With DIF, stem

  15. Advances in high temperature chemistry

    CERN Document Server

    Eyring, Leroy

    1969-01-01

    Advances in High Temperature Chemistry, Volume 2 covers the advances in the knowledge of the high temperature behavior of materials and the complex and unfamiliar characteristics of matter at high temperature. The book discusses the dissociation energies and free energy functions of gaseous monoxides; the matrix-isolation technique applied to high temperature molecules; and the main features, the techniques for the production, detection, and diagnosis, and the applications of molecular beams in high temperatures. The text also describes the chemical research in streaming thermal plasmas, as w

  16. Mild temperature gasification: Partitioning sulfur to gas as H{sub 2}S. [Quarterly] technical report, March 1--May 31, 1993

    Energy Technology Data Exchange (ETDEWEB)

    Stencel, J.M.; Neathery, J.K.; Schaefer, J.L.; Yang, Jidong [Kentucky Univ., Lexington, KY (United States). Center for Applied Energy Research

    1993-09-01

    Bench-scale, mild temperature fluidized bed gasification (MTFBG) will be performed on three high sulfur Illinois basin coals after mixing with phosphoric acid. The research initiates development of an advanced processing technology which partitions coal sulfur to the gas phase as H{sub 2}S. Influences of coal type, coal agglomeration, and steam injection on the properties of the solid, condensible and gaseous products produced during MTFBG will be examined. Analytical measurements of the products will be obtained and are designed to provide product quality and quantity data. Combustion reactivity testing of the char, and pressurized, hot water extraction of H{sub 3}PO{sub 4} from the char, will be performed to provide information for design of a continuous and integrated process for the removal and recovery of coal sulfur. MTFBG experiments were performed on Illinois coals IBC-101, -106 and -110. The yields of char, tar and gaseous products varied between 60--85% char, 0.4--1.3% tar, and 15--43% gas for IBC-101 and -106. Gas yields were sensitive to the coal/phosphoric acid mixing ratio and also dependent on the residence time within the gasifier. The mean residence time was low ({approximately}6 seconds), and was influenced by the mean particle size of the coals. The total sulfur removal was as high as 83% for IBC-106 at a temperature of 500{degrees}C. In comparison with previous fixed bed testing, it is believed that the sulfur is removed as H{sub 2}S. Experiments planned for the next quarter should define the concentration and type of sulfur in the gas.

  17. Bradycardia During Targeted Temperature Management

    DEFF Research Database (Denmark)

    Thomsen, Jakob Hartvig; Nielsen, Niklas; Hassager, Christian

    2016-01-01

    OBJECTIVES: Bradycardia is common during targeted temperature management, likely being a physiologic response to lower body temperature, and has recently been associated with favorable outcome following out-of-hospital cardiac arrest in smaller observational studies. The present study sought...... to confirm this finding in a large multicenter cohort of patients treated with targeted temperature management at 33°C and explore the response to targeted temperature management targeting 36°C. DESIGN: Post hoc analysis of a prospective randomized study. SETTING: Thirty-six ICUs in 10 countries. PATIENTS......: We studied 447 (targeted temperature management = 33°C) and 430 (targeted temperature management = 36°C) comatose out-of-hospital cardiac arrest patients with available heart rate data, randomly assigned in the targeted temperature management trial from 2010 to 2013. INTERVENTIONS: Targeted...

  18. Micro-Mechanical Temperature Sensors

    DEFF Research Database (Denmark)

    Larsen, Tom

    Temperature is the most frequently measured physical quantity in the world. The field of thermometry is therefore constantly evolving towards better temperature sensors and better temperature measurements. The aim of this Ph.D. project was to improve an existing type of micro-mechanical temperature...... sensor or to develop a new one. Two types of micro-mechanical temperature sensors have been studied: Bilayer cantilevers and string-like beam resonators. Both sensor types utilize thermally generated stress. Bilayer cantilevers are frequently used as temperature sensors at the micro-scale, and the goal....... The reduced sensitivity was due to initial bending of the cantilevers and poor adhesion between the two cantilever materials. No further attempts were made to improve the sensitivity of bilayer cantilevers. The concept of using string-like resonators as temperature sensors has, for the first time, been...

  19. High-Temperature Piezoelectric Sensing

    Directory of Open Access Journals (Sweden)

    Xiaoning Jiang

    2013-12-01

    Full Text Available Piezoelectric sensing is of increasing interest for high-temperature applications in aerospace, automotive, power plants and material processing due to its low cost, compact sensor size and simple signal conditioning, in comparison with other high-temperature sensing techniques. This paper presented an overview of high-temperature piezoelectric sensing techniques. Firstly, different types of high-temperature piezoelectric single crystals, electrode materials, and their pros and cons are discussed. Secondly, recent work on high-temperature piezoelectric sensors including accelerometer, surface acoustic wave sensor, ultrasound transducer, acoustic emission sensor, gas sensor, and pressure sensor for temperatures up to 1,250 °C were reviewed. Finally, discussions of existing challenges and future work for high-temperature piezoelectric sensing are presented.

  20. HIGH TEMPERATURE VACUUM MIXER

    Directory of Open Access Journals (Sweden)

    E. D. Chertov

    2015-01-01

    Full Text Available The work is devoted to the creation of a new type of mixer to produce homogeneous mixtures of dissimilar materials applied to recycling of housing and communal services waste. The article describes the design of a dual-chamber device of the original high-temperature vacuum mixer, there investigated the processes occurring in the chambers of such devices. The results of theoretical and experimental research of the process of mixing recycled polyethylene with a mixture of "grinded food waste – Eco wool” are presented. The problem of the optimum choice of bending the curvilinear blades in the working volume of the seal, which is achieved by setting their profile in the form of involute arc of several circles of different radii, is examined . The dependences, allowing to define the limits of the changes of the main mode parameters the angular velocity of rotation of the working body of the mixer using two ways of setting the profile of the curvilinear blade mixer are obtained. Represented design of the mixer is proposed to use for a wide range of tasks associated with the mixing of the components with a strongly pronounced difference of physic al chemical properties and, in particular, in the production of composites out of housing and communal services waste.

  1. Measurement of thermodynamic temperature of high temperature fixed points

    Energy Technology Data Exchange (ETDEWEB)

    Gavrilov, V. R.; Khlevnoy, B. B.; Otryaskin, D. A.; Grigorieva, I. A.; Samoylov, M. L.; Sapritsky, V. I. [All-Russian Research Institute for Optical and Physical Measurements (VNIIOFI), 46 Ozernaya St., Moscow 119361 (Russian Federation)

    2013-09-11

    The paper is devoted to VNIIOFI's measurements of thermodynamic temperature of the high temperature fixed points Co-C, Pt-C and Re-C within the scope of the international project coordinated by the Consultative Committee for Thermometry working group 5 'Radiation Thermometry'. The melting temperatures of the fixed points were measured by a radiance mode radiation thermometer calibrated against a filter radiometer with known irradiance spectral responsivity via a high temperature black body. This paper describes the facility used for the measurements, the results and estimated uncertainties.

  2. Measurement of thermodynamic temperature of high temperature fixed points

    Science.gov (United States)

    Gavrilov, V. R.; Khlevnoy, B. B.; Otryaskin, D. A.; Grigorieva, I. A.; Samoylov, M. L.; Sapritsky, V. I.

    2013-09-01

    The paper is devoted to VNIIOFI's measurements of thermodynamic temperature of the high temperature fixed points Co-C, Pt-C and Re-C within the scope of the international project coordinated by the Consultative Committee for Thermometry working group 5 "Radiation Thermometry". The melting temperatures of the fixed points were measured by a radiance mode radiation thermometer calibrated against a filter radiometer with known irradiance spectral responsivity via a high temperature black body. This paper describes the facility used for the measurements, the results and estimated uncertainties.

  3. Soil application of ash produced by low-temperature fluidized bed gasification: effects on soil nutrient dynamics and crop response

    DEFF Research Database (Denmark)

    Müller-Stöver, Dorette Sophie; Ahrenfeldt, Jesper; Holm, Jens Kai

    2012-01-01

    on soil nutrient levels or on crop biomass. We conclude from the results of this study, that—depending on the feedstock used—ashes from LT-CFB gasification of plant biomass can be used to replace mineral fertilizers if they are applied according to their nutrient content, the crop demand, and soil...... to investigate the effects of the ashes on soil microbiological and chemical properties and on the response of the three crops. The ash treatments were compared with a control treatment that received only nitrogen, magnesium, and sulphur (CO) and a fully fertilized control (COPK). Soil microbial parameters were...

  4. Hall Sensors for Extreme Temperatures

    Directory of Open Access Journals (Sweden)

    Maciej Oszwaldowski

    2011-01-01

    Full Text Available We report on the preparation of the first complete extreme temperature Hall sensor. This means that the extreme-temperature magnetic sensitive semiconductor structure is built-in an extreme-temperature package especially designed for that purpose. The working temperature range of the sensor extends from −270 °C to +300 °C. The extreme-temperature Hall-sensor active element is a heavily n-doped InSb layer epitaxially grown on GaAs. The magnetic sensitivity of the sensor is ca. 100 mV/T and its temperature coefficient is less than 0.04 %/K. This sensor may find applications in the car, aircraft, spacecraft, military and oil and gas industries.

  5. Temperature Monitoring and Perioperative Thermoregulation

    Science.gov (United States)

    Sessler, Daniel I.

    2008-01-01

    Most clinically available thermometers accurately report the temperature of whatever tissue is being measured. The difficulty is that no reliably core-temperature measuring sites are completely non-invasive and easy to use — especially in patients not having general anesthesia. Nonetheless, temperature can be reliably measured in most patients. Body temperature should be measured in patients having general anesthesia exceeding 30 minutes in duration, and in patients having major operations under neuraxial anesthesia. Core body temperature is normally tightly regulated. All general anesthetics produce a profound dose-dependent reduction in the core temperature triggering cold defenses including arterio-venous shunt vasoconstriction and shivering. Anesthetic-induced impairment of normal thermoregulatory control, and the resulting core-to-peripheral redistribution of body heat, is the primary cause of hypothermia in most patients. Neuraxial anesthesia also impairs thermoregulatory control, although to a lesser extant than general anesthesia. Prolonged epidural analgesia is associated with hyperthermia whose cause remains unknown. PMID:18648241

  6. Temperature based Restricted Boltzmann Machines

    Science.gov (United States)

    Li, Guoqi; Deng, Lei; Xu, Yi; Wen, Changyun; Wang, Wei; Pei, Jing; Shi, Luping

    2016-01-01

    Restricted Boltzmann machines (RBMs), which apply graphical models to learning probability distribution over a set of inputs, have attracted much attention recently since being proposed as building blocks of multi-layer learning systems called deep belief networks (DBNs). Note that temperature is a key factor of the Boltzmann distribution that RBMs originate from. However, none of existing schemes have considered the impact of temperature in the graphical model of DBNs. In this work, we propose temperature based restricted Boltzmann machines (TRBMs) which reveals that temperature is an essential parameter controlling the selectivity of the firing neurons in the hidden layers. We theoretically prove that the effect of temperature can be adjusted by setting the parameter of the sharpness of the logistic function in the proposed TRBMs. The performance of RBMs can be improved by adjusting the temperature parameter of TRBMs. This work provides a comprehensive insights into the deep belief networks and deep learning architectures from a physical point of view.

  7. TEMPERATURE TOLERANCES AND OSMOREGULATION IN ...

    African Journals Online (AJOL)

    MQCOmQ IItora/I' and P,ammotelllllll capelUis) have upper lethal temperatures of 4l-46°C when heated at a rate of 1 CO/lO minutes. TWo species have upper lethal temperatures of 37°C and 39°C when heated at a rate of 1 CO/day. It has been concluded that they can tolerate much hisher temperatures thaD they normally ...

  8. Rare Earth Optical Temperature Sensor

    Science.gov (United States)

    Chubb, Donald L. (Inventor); Jenkins, Phillip (Inventor)

    2004-01-01

    A rare earth optical temperature sensor is disclosed for measuring high temperatures. Optical temperature sensors exist that channel emissions from a sensor to a detector using a light pipe. The invention uses a rare earth emitter to transform the sensed thermal energy into a narrow band width optical signal that travels to a detector using a light pipe. An optical bandpass filter at the detector removes any noise signal outside of the band width of the signal from the emitter.

  9. Sensors for low temperature application

    Science.gov (United States)

    Henderson, Timothy M.; Wuttke, Gilbert H.

    1977-01-01

    A method and apparatus for low temperature sensing which uses gas filled micro-size hollow glass spheres that are exposed in a confined observation area to a low temperature range (Kelvin) and observed microscopically to determine change of state, i.e., change from gaseous state of the contained gas to condensed state. By suitable indicia and classification of the spheres in the observation area, the temperature can be determined very accurately.

  10. Low-temperature tracking detectors

    CERN Document Server

    Niinikoski, T O; Anbinderis, P; Anbinderis, T; D'Ambrosio, N; de Boer, Wim; Borchi, E; Borer, K; Bruzzi, M; Buontempo, S; Chen, W; Cindro, V; Dezillie, B; Dierlamm, A; Eremin, V; Gaubas, E; Gorbatenko, V; Granata, V; Grigoriev, E; Grohmann, S; Hauler, F; Heijne, Erik H M; Heising, S; Hempel, O; Herzog, R; Härkönen, J; Ilyashenko, Yu S; Janos, S; Jungermann, L; Kalesinskas, V; Kapturauskas, J; Laiho, R; Li, Z; Luukka, Panja; Mandic, I; De Masi, R; Menichelli, D; Mikuz, M; Militaru, O; Nüssle, G; O'Shea, V; Pagano, S; Paul, S; Perea-Solano, B; Piotrzkowski, K; Pirollo, S; Pretzl, K; Rahman, M; Rato-Mendes, P; Rouby, X; Ruggiero, G; Smith, K; Sousa, P; Tuominen, E; Tuovinen, E; Vaitkus, J; Verbitskaya, E; Da Vià, C; Vlasenko, L; Vlasenko, M; Wobst, E; Zavrtanik, M

    2004-01-01

    RD39 collaboration develops new detector techniques for particle trackers, which have to withstand fluences up to 10/sup 16/ cm/sup -2 / of high-energy particles. The work focuses on the optimization of silicon detectors and their readout electronics while keeping the temperature as a free parameter. Our results so far suggest that the best operating temperature is around 130 K. We shall also describe in this paper how the current-injected mode of operation reduces the polarization of the bulk silicon at low temperatures, and how the engineering and materials problems related with vacuum and low temperature can be solved. (9 refs).

  11. Core temperature affects scalp skin temperature during scalp cooling

    NARCIS (Netherlands)

    Daanen, H.A.M.; Peerbooms, M.; van den Hurk, C.J.G.; van Os, B.; Levels, K.; Teunissen, L.P.J.; Breed, W.P.M.

    2015-01-01

    Background: The efficacy of hair loss prevention by scalp cooling to prevent chemotherapy induced hair loss has been shown to be related to scalp skin temperature. Scalp skin temperature, however, is dependent not only on local cooling but also on the thermal status of the body. Objectives: This

  12. High Temperature Solid Lubricant Coating for High Temperature Wear Applications

    Science.gov (United States)

    DellaCorte, Christopher (Inventor); Edmonds, Brian J (Inventor)

    2014-01-01

    A self-lubricating, friction and wear reducing composite useful over a wide temperature range is described herein. The composite includes metal bonded chromium oxide dispersed in a metal binder having a substantial amount of nickel. The composite contains a fluoride of at least one Group I, Group II, or rare earth metal, and optionally a low temperature lubricant metal.

  13. Selection and performance of Materials for Biomass Gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Keiser, James R [ORNL; Hemrick, James Gordon [ORNL; Meisner, Roberta A [University of Tennessee, Knoxville (UTK) & Oak Ridge National Laboratory (ORNL); Blau, Peter J [Oak Ridge National Laboratory (ORNL); Pint, Bruce A [ORNL

    2010-01-01

    Production of syngas through gasification or pyrolysis offers one of the more efficient routes for utilization of biomass resources; however, the containment structures used for many of these thermochemical processes are exposed to severe environments that limit their longevity and reliability. Studies have been conducted for three of these systems, and superior alternative materials have been identified. Improved materials will be of even greater importance in proposed gasification systems, many of which will generate even more extreme operating conditions.

  14. Portable Biomass Gasifier Power Generation Using Non Edible Seed Cake

    OpenAIRE

    M. Vivek; Srividhya, PK; K Sujatha

    2015-01-01

    Non edible seeds are used most of the applications but the dehydration of seed cakes is too difficult. And the same time the seeds could not feed food as animal. Hence, to adopt various techniques it can be used for other applications. 1 ton crude oil yield from 3 tons of seeds and the remaining becomes seed cake. After oil extraction using screw press machine, seed cake still has 10 % to 15 % of oil. Hence this is a good combustible material with calorific value of approximately 600 Kcal/m3...

  15. Detailed model for practical pulverized coal furnaces and gasifiers

    Energy Technology Data Exchange (ETDEWEB)

    Philips, S.D.; Smoot, L.D.

    1989-08-01

    The need to improve efficiency and reduce pollutant emissions commercial furnaces has prompted energy companies to search for optimized operating conditions and improved designs in their fossil-fuel burning facilities. Historically, companies have relied on the use of empirical correlations and pilot-plant data to make decisions about operating conditions and design changes. The high cost of collecting data makes obtaining large amounts of data infeasible. The main objective of the data book is to provide a single source of detailed three-dimensional combustion and combustion-related data suitable for comprehensive combustion model evaluation. Five tasks were identified as requirements to achieve the main objective. First, identify the types of data needed to evaluate comprehensive combustion models, and establish criteria for selecting the data. Second, identify and document available three-dimensional combustion data related to pulverized coal combustion. Third, collect and evaluate three-dimensional data cases, and select suitable cases based on selection criteria. Fourth, organize the data sets into an easy-to-use format. Fifth, evaluate and interpret the nature and quality of the data base. 39 refs., 15 figs., 14 tabs.

  16. Design of gasifiers to optimize fuel cell systems

    Energy Technology Data Exchange (ETDEWEB)

    1992-02-01

    The objective of this project is to configure coal gasification/carbonate fuel cell systems that can significantly improve the economics, performance, and efficiency of electric power generation systems. (VC)

  17. Status of METC investigations of coal gas desulfurization at high temperature. [Zinc ferrite

    Energy Technology Data Exchange (ETDEWEB)

    Steinfeld, G.

    1984-03-01

    This report documents the continuing effort at the US Department of Energy/Morgantown Energy Technology Center (METC) to develop a hot-gas desulfurization process for coal-derived gas, primarily for application to molten carbonate fuel cells. Metal oxide sorbents were tested on lab-scale test equipment, and it was determined that scale-up of the process was warranted. A larger, skid-mounted test unit was therefore designed, constructed, and installed on a sidestream of the DOE/METC fixed-bed gasifier. A first series of tests was conducted during Gasifier Run 101. These tests served to shake down the test unit, and provide data on the performance of the test unit operating on coal-derived gas. Overall, the process operated well on fixed-bed, air-blown gasifier gas. Sulfur levels in exit dry gas were reduced to less than 10 ppM. Regeneration appears to restore the sulfur-removing capacity of the sorbent. Sorbent integrity was maintained during the test period, which incorporated three sulfidations. It is recommended that treatment of the regeneration offgas be investigated, and that testing and development of a system to reduce the sulfur in this gas to elemental sulfur be initiated. In addition, it is suggested that a multiple reactor system be planned for continuous operation, to allow for long-term tests of downstream users of desulfurized gas. 7 references, 18 figures, 9 tables.

  18. (Krauss) at constant high temperatures

    African Journals Online (AJOL)

    Snail Research Unit of the SAMRC and Department of Zoology, Potchefstroom University for CHE,. Potchefstroom. The survival of the freshwater snail species Bulinus africanus, Bulinus g/obosus and Biompha/aria pfeifferi at extreme high temperatures was experimentally investigated. Snails were exposed to temperatures ...

  19. Spectroscopy of Low Temperature Plasma

    CERN Document Server

    Ochkin, Vladimir N

    2009-01-01

    Providing an up-to-date overview on spectroscopical diagnostics of low temperature plasma Spectroscopy of Low Temperature Plasma covers the latest developments and techniques. Written by a distinguished scientist and experienced book author this text is applicable to many fields in materials and surface science as well as nanotechnology and contains numerous appendices with indispensable reference data.

  20. Embedded Temperature-Change Sensors

    Science.gov (United States)

    Thakoor, Sarita; Thakoor, Anil; Karmon, Dan

    1995-01-01

    Transducers sensitive to rates of change of temperature embedded in integrated circuits and discrete electronic components damaged by overheating, according to proposal. Used to detect onset of rapid heating and to trigger shutoffs of power or other corrective actions before temperatures rise beyond safe limits. Sensors respond fast and reliably to incipient overheating because they are in direct thermal contact with vulnerable circuit elements.