WorldWideScience

Sample records for tellurium 138

  1. Tellurium

    Science.gov (United States)

    Goldfarb, Richard J.; Berger, Byron R.; George, Micheal W.; Seal, Robert R.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.

    2017-12-19

    Tellurium (Te) is a very rare element that averages only 3 parts per billion in Earth’s upper crust. It shows a close association with gold and may be present in orebodies of most gold deposit types at levels of tens to hundreds of parts per million. In large-tonnage mineral deposits, such as porphyry copper and seafloor volcanogenic massive sulfide deposits, sulfide minerals may contain hundreds of parts per million tellurium, although the orebodies likely have overall concentrations of 0.1 to 1.0 parts per million tellurium. Tellurium is presently recovered as a primary ore from only two districts in the world; these are the gold-tellurium epithermal vein deposits located adjacent to one another at Dashuigou and Majiagou (Sichuan Province) in southwestern China, and the epithermal-like mineralization at the Kankberg deposit in the Skellefteå VMS district of Västerbotten County, Sweden. Combined, these two groups of deposits account for about 15 percent (about 70 metric tons) of the annual global production of between 450 and 470 metric tons of tellurium. Most of the world’s tellurium, however, is produced as a byproduct of the mining of porphyry copper deposits. These deposits typically yield concentrations of 1 to 4 percent tellurium in the anode slimes recovered during copper refining. Present production of tellurium from the United States is solely from the anode slimes at ASARCO LLC’s copper refinery in Amarillo, Texas, and may total about 50 metric tons per year. The main uses of tellurium are in photovoltaic solar cells and as an additive to copper, lead, and steel alloys in various types of machinery. The environmental data available regarding the mining of tellurium are limited; most concerns to date have focused on the more-abundant metals present in the large-tonnage deposits from which tellurium is recovered as a byproduct. Global reserves of tellurium are estimated to be 24,000 metric tons, based on the amount of tellurium likely contained in

  2. Extractive separation of tellurium(4)

    International Nuclear Information System (INIS)

    Gawali, S.B.; Shinde, V.M.

    1977-01-01

    A method is described for the extraction of tellurium (4) from hydrobromic acid media using 4-methyl-2-pentanol as an extractant. The method affords the determination of tellurium after its separation from Se, Au, Cu, Pb, Fe, Os, V and Al. (author)

  3. Thermodynamic behaviour of tellurium at high temperatures

    International Nuclear Information System (INIS)

    Garisto, F.

    1992-09-01

    Thermodynamic calculations are used to determine the chemical speciation of tellurium in the primary heat transport system under postulated reactor accident conditions. The speciation of tellurium is determined for various values of the temperature, oxygen partial pressure, tellurium concentration and Cs/Te ratio. The effects of the Zircaloy cladding and/or cesium on tellurium speciation and volatility are of particular interest in this report. (Author) (37 refs., 14 figs., 4 tabs.)

  4. Selenium and tellurium nanomaterials

    Science.gov (United States)

    Piacenza, Elena; Presentato, Alessandro; Zonaro, Emanuele; Lampis, Silvia; Vallini, Giovanni; Turner, Raymond J.

    2018-04-01

    Over the last 40 years, the rapid and exponential growth of nanotechnology led to the development of various synthesis methodologies to generate nanomaterials different in size, shape and composition to be applied in various fields. In particular, nanostructures composed of Selenium (Se) or Tellurium (Te) have attracted increasing interest, due to their intermediate nature between metallic and non-metallic elements, being defined as metalloids. Indeed, this key shared feature of Se and Te allows us the use of their compounds in a variety of applications fields, such as for manufacturing photocells, photographic exposure meters, piezoelectric devices, and thermoelectric materials, to name a few. Considering also that the chemical-physical properties of elements result to be much more emphasized when they are assembled at the nanoscale range, huge efforts have been made to develop highly effective synthesis methods to generate Se- or Te-nanomaterials. In this context, the present book chapter will explore the most used chemical and/or physical methods exploited to generate different morphologies of metalloid-nanostructures, focusing also the attention on the major advantages, drawbacks as well as the safety related to these synthetic procedures.

  5. Reaction of tellurium with Zircaloy-4

    International Nuclear Information System (INIS)

    Boer, R. de; Cordfunke, E.H.P.

    1994-09-01

    Interaction of tellurium vapour with Zircaloy during the initial stage of an accident will lead to retention of tellurium in the core. For reliable estimation of the release behaviour of tellurium, it is necessary to know which zirconium tellurides are formed during this interaction. In this work the reaction of tellurium with Zircaloy-4 has been studied, using various reaction temperatures and tellurium vapour pressures. The compound ZrTe 2-x is formed on the surface of the Zircaloy in a broad range of reaction temperatures and vapour pressures. It is found that the formation of the more zirconium-rich compound Zr 5 Te 4 is favoured at high reaction temperatures is combination with low tellurium vapour pressures. (orig.)

  6. On the resistivity of metal-tellurium alloys for low concentrations of tellurium

    International Nuclear Information System (INIS)

    Gorecki, J.

    1982-04-01

    The resistivity and thermoelectric power of metal-tellurium liquid alloys have been discussed for the case of small tellurium concentration. Nearly free electron model of conduction band has been used. The rapid increase of resistivity in transition metal-tellurium alloys has been predicted. (author)

  7. Sulfur, selenium, tellurium and polonium

    International Nuclear Information System (INIS)

    Berry, F.J.

    1987-01-01

    This chapter on the coordination compounds of sulfur, selenium, tellurium and polonium starts with an introduction to the bonding, valence and geometry of the elements. Complexes of the group VIB elements are discussed with particular reference to the halo and pseudohalide complexes, oxo acid complexes, oxygen and nitrogen donor complexes and sulfur and selenium donor complexes. There is a section on the biological properties of the complexes discussed. (UK)

  8. Electrowinning Of Tellurium From Acidic Solutions

    Directory of Open Access Journals (Sweden)

    Kowalik R.

    2015-06-01

    Full Text Available The process of electrochemical deposition of tellurium was studied. Preliminary researches embrace the voltammetry and microgravimetric measurements. According to the results the electrolysis of tellurium was conducted under potentiostatic conditions. There was no deposition of tellurium above potential −0.1 vs. Ag/AgCl electrode in 25°C. The process of deposition is observed in the range of potentials −0.1 to −0.3 V vs. Ag/AgCl. The presence of tellurium was confirmed by XRF and XRD. The obtained deposits were homogenous and compact. Below potential −0.3 V vs. Ag/AgCl the Faradaic efficiency of the tellurium deposition decreased due to reduction of Te to H2Te and hydrogen evolution.

  9. New radiohalogenated alkenyl tellurium fatty acids

    International Nuclear Information System (INIS)

    Srivastava, P.C.; Knapp, F.F. Jr.; Kabalka, G.W.

    1987-01-01

    Radiolabeled long-chain fatty acids have diagnostic value as radiopharmaceutical tools in myocardial imaging. Some applications of these fatty acids are limited due to their natural metabolic degradation in vivo with subsequent washout of the radioactivity from the myocardium. The identification of structural features that will increase the myocardial residence time without decreasing the heart uptake of long-chain fatty acids is of interest. Fatty acids containing the tellurium heteroatom were the first modified fatty acids developed that show unique prolonged myocardial retention and low blood levels. Our detailed studies with radioiodinated vinyliodide substituted tellurium fatty acids demonstrate that heart uptake is a function of the tellurium position. New techniques of tellurium and organoborane chemistry have been developed for the synthesis of a variety of radioiodinated iodoalkenyl tellurium fatty acids. 9 refs., 3 figs., 2 tabs

  10. Tellurium self-diffusion and point defects in lead telluride

    International Nuclear Information System (INIS)

    Simirskij, Yu.N.; Firsova, L.P.

    1982-01-01

    Method of radioactive indicators was used to determine factors of tellurium self-diffusion in lead telluride with different deviation of the composition from stoichiometric in the range of enrichment by tellurium. It was found that at 973 K factors of tellurium self-diffusion in lead telluride depend slightly on the vapor pressure of tellurium equilibrium with solid phase

  11. Tellurium: providing a bright future for solar energy

    Science.gov (United States)

    Goldfarb, Richard J.

    2015-01-01

    Tellurium is one of the least common elements on Earth. Most rocks contain an average of about 3 parts per billion tellurium, making it rarer than the rare earth elements and eight times less abundant than gold. Grains of native tellurium appear in rocks as a brittle, silvery-white material, but tellurium more commonly occurs in telluride minerals that include varied quantities of gold, silver, or platinum. Tellurium is a metalloid, meaning it possesses the properties of both metals and nonmetals.

  12. Tellurium in active volcanic environments: Preliminary results

    Science.gov (United States)

    Milazzo, Silvia; Calabrese, Sergio; D'Alessandro, Walter; Brusca, Lorenzo; Bellomo, Sergio; Parello, Francesco

    2014-05-01

    Tellurium is a toxic metalloid and, according to the Goldschmidt classification, a chalcophile element. In the last years its commercial importance has considerably increased because of its wide use in solar cells, thermoelectric and electronic devices of the last generation. Despite such large use, scientific knowledge about volcanogenic tellurium is very poor. Few previous authors report result of tellurium concentrations in volcanic plume, among with other trace metals. They recognize this element as volatile, concluding that volcanic gases and sulfur deposits are usually enriched with tellurium. Here, we present some results on tellurium concentrations in volcanic emissions (plume, fumaroles, ash leachates) and in environmental matrices (soils and plants) affected by volcanic emissions and/or deposition. Samples were collected at Etna and Vulcano (Italy), Turrialba (Costa Rica), Miyakejima, Aso, Asama (Japan), Mutnovsky (Kamchatka) at the crater rims by using common filtration techniques for aerosols (polytetrafluoroethylene filters). Filters were both eluted with Millipore water and acid microwave digested, and analyzed by inductively coupled plasma mass spectrometry (ICP-MS). Volcanic ashes emitted during explosive events on Etna and Copahue (Argentina) were analyzed for tellurium bulk composition and after leaching experiments to evaluate the soluble fraction of tellurium. Soils and leaves of vegetation were also sampled close to active volcanic vents (Etna, Vulcano, Nisyros, Nyiragongo, Turrialba, Gorely and Masaya) and investigated for tellurium contents. Preliminary results showed very high enrichments of tellurium in volcanic emissions comparing with other volatile elements like mercury, arsenic, thallium and bismuth. This suggests a primary transport in the volatile phase, probably in gaseous form (as also suggested by recent studies) and/or as soluble salts (halides and/or sulfates) adsorbed on the surface of particulate particles and ashes. First

  13. Selenium and tellurium reagents in organic synthesis

    International Nuclear Information System (INIS)

    Comasseto, J.V.

    1984-01-01

    A review of the contribution of the University of Sao Paulo (SP, Brazil) to the organic synthesis of selenium and tellurium reagents is made. Major reactions amoung selenium compounds and insaturated substrates, phosphorus, ester enolates as well as the use of phase transference catalysed reactions to produce arylselenolate are described. For tellurium, interactions of its compounds with organic substrates and reactive intermediates (e.g. benzino diazomethane) are reported. (C.L.B.) [pt

  14. Tellurium chemistry, tellurium release and deposition during the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Sallach, R.A.; Osetek, D.J.; Hobbins, R.R.; Akers, D.W.

    1985-08-01

    This report presents the chemistry and estimated behavior of tellurium during and after the accident at Three Mile Island Unit-2. The discussion of tellurium behavior is based on all available measurement data for /sup 129 m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te, and 130 Te), and best estimate calculations of tellurium release and transport. Results from Oak Ridge National Laboratory (ORNL) tests, Power Burst Facility (PBF) Severe Fuel Damage Tests at Idaho National Engineering Laboratory (INEL) and SASCHA tests from Karlsruhe, W. Germany are compared with calculated release fractions and samples taken from TMI Unit-2. It is concluded that very little tellurium was released and transported from the TMI-2 core, probably as a result of holdup by zircaloy cladding and other structural materials. 39 refs., 24 figs., 17 tabs

  15. Tellurium chemistry, tellurium release and deposition during the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Sallach, R.A.; Osetek, D.J.; Hobbins, R.R.; Akers, D.W.

    1985-01-01

    This paper presents the chemistry and estimated behavior of tellurium during and after the accident at Three Mile Island Unit-2. The discussion of tellurium behavior is based on all available measurement data for /sup 129m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te, and 130 Te), and best estimate calculations of tellurium release and transport. Results from Oak Ridge National Laboratory (ORNL) tests, Power Burst Facility (PBF) Severe Fuel Damage Tests at Idaho National Engineering Laboratory (INEL) and SASCHA tests from Karlsruhe, W. Germany are compared with calculated release fractions and samples taken from TMI Unit-2. It is concluded that very little tellurium was released and transported from the TMI-2 core, probably as a result of holdup by zircaloy cladding and other structural materials. 37 refs., 12 figs., 4 tabs

  16. Selenium Se and tellurium Te

    International Nuclear Information System (INIS)

    Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.

    1978-01-01

    The basic methods for determining selenium and tellurium in various objects are presented. The bichromatometric determination of Te in cadmium, zinc and mercury tellurides is based on oxidation of Te(4) to (6) in H 2 SO 4 with potassium bichromate. In steels, Te is determined photometrically with the aid of KI. The determination is hindered by Fe(3), Cu(2), Bi(3) and Se(4) ions, which must be separated. The extraction-photometric determination of Te in native sulfur is carried out with the aid of 5-mercapto-3-(naphthyl-2)-1,3,4-thiadiazolthione-2 (pH=4.8-5.0). The dyed complex is readily extracted with chloroform and benzene. The spectrophotometric determination of Te in selenium is performed with the aid of 3,5-diphenylpyrazoline-1-dithiocarbamate of sodium. Te is determined in commercial indium, arsenic and their semiconductor compounds photometrically with the aid of copper diethyldithiocarbamate. The method permits determining 5x10 -5 % Te in a weighed amount of 0.5 g. The chloride complex of Te(4) with diantipyriodolpropylmethane is quantitatively extracted with dichloroethane from hydrochloric acid solutions. Thus, any amounts of Te can be separated from Se and determined photometrically. The extraction-photometric determination of Te in commercial lead and bismuth is carried out with the aid of pyrazolone derivatives, in commercial copper with the aid of diantipyridolpropylmethane, and in ores (more than 0.01% Te) with the aid of bismuthol 2. Also described is the extraction-polarographic determination of Te in sulfide ores

  17. Facile electrochemical synthesis of tellurium nanorods and their photoconductive properties

    Energy Technology Data Exchange (ETDEWEB)

    Li, H.H. [Center for Photon Manufacturing Science and Technology, School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); Zhang, P. [Dongguan University of Technology, Dongguan-523808 (China); School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou - 510275 (China); Liang, C.L. [Instrumental Analysis and Research Center, SunYat-sen University, Guangzhou - 510275 (China); Yang, J. [School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); Zhou, M. [Center for Photon Manufacturing Science and Technology, School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); The State Key Laboratory of Tribology, Tsinghua University, Beijing - 10084 (China); Lu, X.H. [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou - 510275 (China); Hope, G.A. [School of Biomolecular and Physical Sciences, Griffith University, Nathan - Qld 4111 (Australia)

    2012-10-15

    Tellurium nanorods have been successfully fabricated by template and surfactant-free electrochemical technique from an aqueous solution at room temperature. The as-prepared tellurium nanorods were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Raman spectrometry, UV-vis spectroscopy and photoluminescence spectroscopy. Films based on tellurium nanorods were constructed to study the photoresponse and I-V curves. These photoresponse measurements demonstrate that tellurium nanorods exhibited enhanced conductivity under illumination compared to in the dark measurement. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. The mineralogical characterization of tellurium in copper anodes

    Science.gov (United States)

    Chen, T. T.; Dutrizac, J. E.

    1993-12-01

    A mineralogical study of a «normal» commercial copper anode and six tellurium-rich copper anodes from the CCR Refinery of the Noranda Copper Smelting and Refining Company was carried out to identify the tellurium carriers and their relative abundances. In all the anodes, the major tellurium carrier is the Cu2Se-Cu2Te phase which occurs as a constituent of complex inclusions at the copper grain boundaries. In tellurium-rich anodes, the molar tellurium content of the Cu2Se-Cu2Te phase can exceed that of selenium. Although >85 pct of the tellurium occurs as the Cu2Se-Cu2Te phase, minor amounts are present in Cu-Pb-As-Bi-Sb oxide, Cu-Bi-As oxide, and Cu-Te-As oxide phases which form part of the grain-boundary inclusions. About 1 pct of the tellurium content of silver-rich anodes occurs in various silver alloys, but gold tellurides were never detected. Surprising is the fact that 2 to 8 pct of the total tellurium content of the anodes occurs in solid solution in the copper-metal matrix, and presumably, this form of tellurium dissolves at the anode interface during electrorefining.

  19. Comparison between selenium and tellurium clusters

    International Nuclear Information System (INIS)

    Benamar, A.; Rayane, D.; Tribollet, B.; Broyer, M.; Melinon, P.

    1991-01-01

    Selenium and tellurium clusters are produced by the inert gas condensation technique. The mass spectra of both species are completely different and reveal different properties. In selenium, a periodicity of 6-7 is observed and may be interpreted by the binding energy between small cyclic molecules. Moreover, it was very difficult to obtained large clusters probably because the binding energy between these molecules is very small. In tellurium, these periodic structures do not exist and large clusters are easily obtained in nucleation conditions where only small selenium clusters are present. These results are discussed and a simple nucleation model is used to illustrate this different behavior. Finally these clusters properties are correlated to the bulk structure of both materials. (orig.)

  20. Neutron activation analysis of high purity tellurium

    International Nuclear Information System (INIS)

    Gil'bert, Eh.N.; Verevkin, G.V.; Obrazovskij, E.G.; Shatskaya, S.S.

    1980-01-01

    A scheme of neutron activation analysis of high purity tellurium is developed. Weighed amount of Te (0.5 g) is irradiated for 20-40 hr in the flux of 2x10 13 neutron/(cm 2 xs). After decomposition of the sample impurities of gold and palladium are determined by the extraction with organic sulphides. Tellurium separation from the remaining impurities is carried out by the extraction with monothiobenzoic acid from weakly acidic HCl solutions in the presence of iodide-ions, suppressing silver extraction. Remaining impurity elements in the refined product are determined γ-spectrometrically. The method allows to determine 34 impurities with determination limits 10 -6 -10 -11 g

  1. Interaction of tellurium and tellurium-containing semiconductor compounds with solutions of HI-HNO3-H2O system

    International Nuclear Information System (INIS)

    Tomashik, V.N.; Sava, A.A.; Tomashik, Z.F.

    1994-01-01

    As a result of experimental investigations and physical-chemical simulation are established regularities of solution of semiconducting tellurium-containing compounds in HI-HNO 3 -H 2 O systems. In HNO 3 -HI system solutions enriched by HNO 3 are not used for CdTe treatment but HI enriched solution are similar in composition with I 2 -HI solutions. Solution of the given tellurium-containing materials proceeds by a chemical mechanism and is determined by tellurium oxidation with iodine

  2. Copper Tellurium Oxides - A Playground for Magnetism.

    Energy Technology Data Exchange (ETDEWEB)

    Norman, M. R.

    2018-04-15

    A variety of copper tellurium oxide minerals are known, and many of them exhibit either unusual forms of magnetism, or potentially novel spin liquid behavior. Here, I review a number of the more interesting materials with a focus on their crystalline symmetry and, if known, the nature of their magnetism. Many of these exist (so far) in mineral form only, and most have yet to have their magnetic properties studied. This means a largely unexplored space of materials awaits our exploration.

  3. Tellurium release and deposition during the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Osetek, D.J.; Hobbins, R.R.; Jessup, J.S.

    1984-09-01

    The estimated behavior of tellurium during and after the accident at the Three Mile Island Unit-2 is presented. The behavior is based on all available measurement data for /sup 129m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te and 130 Te), and best estimate calculations of tellurium release and transport. The predicted release was calculated using current techniques that relate release rate to fuel temperature and holdup of tellurium in zircaloy until significant oxidation occurs. The calculated release fraction was low, approx. 7%, but the total measured release for samples analyzed to date is about 5.8%. Of the measured tellurium about 2.4, 1.8, 0.88, 0.42, 0.17 and 0.086% of core inventory were in the containment sump water, upper plenum assembly surfaces, containment solids in the sump water, makeup and purification demineralizer, containment inside surface, and the reactor primary coolant, respectively. A significant fraction (54%) of the tellurium calculated to be retained on the upper plenum surfaces (4.61% of the core inventory) was deposited during the high pressure injection of coolant at about 200 min after the reactor scram. Comparison of tellurium behavior with in-pile and out-of-pile tests strongly suggests that zircaloy holds tellurium until significant cladding oxidation occurs

  4. Tellurium behavior during and after the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Osetek, D.J.; Hobbins, R.R.

    1984-01-01

    The estimated behavior of tellurium during and after the accident at the Three Mile Island Unit-2 is presented. The behavior is based on all available measurement data for /sup 129m/Te, 132 Te and stable tellurium ( 126 Te, 128 Te and 130 Te), and best estimate calculations of tellurium release and transport. The predicted release was calculated using current techniques that relate release rate to fuel temperature and holdup of tellurium in zircaloy until significant oxidation occurs. The calculated release fraction was low, approximately 7%, but the total measured release for samples analyzed to date is about 4.0%. Of the measured tellurium about 2.4, 0.88, 0.42, 0.17 and 0.086% of core inventory were in the containment sump water, containment solids in water, makeup and purification demineralizer, containment inside surface, and the reactor primary coolant, respectively. A significant fraction (54%) of the calculated tellurium retained on the upper plenum surfaces (4.61% of the core inventory) was deposited during the high pressure injection of coolant at about 200 minutes after the reactor scram. Comparison of tellurium behavior with inpile and out-of-pile tests strongly suggests that zircaloy holds tellurium until significant cladding oxidation occurs

  5. Rapid radiochemical ion-exchange separation of iodine from tellurium: a novel radioiodine-132 generator

    Energy Technology Data Exchange (ETDEWEB)

    Abrao, A

    1975-01-01

    Tellurium ions form a soluble cationic complex with thiourea in acid medium. The cationic tellurium-thiourea species is strongly absorbed on a cationic ion exchanger. The retention of tellurium on the resin enables many interesting separation schemes for tellurium from various ions. With special interest, the separation of iodine from tellurium was studied. An efficient and convenient iodine-132 generator is described, in which the radio-iodine is eluted with water or 9 g/1 NaCl, when desired.

  6. A rapid radiochemical ion-exchange separation of iodine from tellurium: a novel radioiodine-132 generator

    International Nuclear Information System (INIS)

    Abrao, A.

    1975-01-01

    Tellurium ions form a soluble cationic complex with thiourea in acid medium. The cationic tellurium-thiourea species is strongly absorbed on a cationic ion exchanger. The retention of tellurium on the resin enables many interesting separation schemes for tellurium from various ions. With special interest, the separation of iodine from tellurium was studied. An efficient and convenient iodine-132 generator is described, in which the radio-iodine is eluted with water or 9 g/1 NaCL, when desired

  7. Analysis of tellurium thin films electrodeposition from acidic citric bath

    Energy Technology Data Exchange (ETDEWEB)

    Kowalik, Remigiusz; Kutyła, Dawid [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, al. A. Mickiewicza 30, 30-059 Krakow (Poland); Mech, Krzysztof [AGH University of Science and Technology, Academic Centre for Materials and Nanotechnology, al. A. Mickiewicza 30, Krakow (Poland); Żabiński, Piotr, E-mail: rkowalik@agh.edu.pl [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, al. A. Mickiewicza 30, 30-059 Krakow (Poland)

    2016-12-01

    This work presents the description of the electrochemical process of formation thin tellurium layers from citrate acidic solution. The suggested methodology consists in the preparation of stable acidic baths with high content of tellurium, and with the addition of citrate acid. In order to analyse the mechanism of the process of tellurium deposition, the electroanalytical tests were conducted. The tests of cyclic voltammetry and hydrodynamic ones were performed with the use of polycrystalline gold disk electrode. The range of potentials in which deposition of tellurium in direct four-electron process is possible was determined as well as the reduction of deposited Te° to Te{sup 2−} and its re-deposition as a result of the comproportionation reaction. On the basis of the obtained results, the deposition of tellurium was conducted by the potentiostatic method. The influence of a deposition potential and a concentration of TeO{sub 2} in the solution on the rate of tellurium coatings deposition was examined. The presence of tellurium was confirmed by X-ray spectrofluorometry and electron probe microanalysis. In order to determine the phase composition and the morphology, the obtained coatings were analysed with the use of x-ray diffraction and scanning electron microscopy.

  8. Selenium and tellurium as carbon substitutes

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    1980-01-01

    This review has summarized structure-activity studies with 75 Se- and /sup 123m/Te-labeled radiopharmaceuticals in which the selenium or tellurium heteroatom has been inserted between carbon-carbon bonds. The agents that have been investigated in most detail include steroids for adrenal imaging and long-chain fatty acids, and a variety of other unique agents have also been studied. Because of the great versatility of the organic chemistry of selenium and tellurium, there is continuing interest in the preparation of radiopharmaceuticals labeled with 75 Se, 73 Se, and /sup 123m/Te. There are two important factors which will determine the extent of future interest in such agents. These include the necessity of a decrease in the cost of highly enriched 122 Te to make the reactor production of /sup 123m/Te cost effective. In addition, the potential preparation of large amounts of 73 Se should stimulate the development of 73 Se-labeled radiopharmaceuticals

  9. Double beta decay of tellurium-130

    International Nuclear Information System (INIS)

    Richardson, J.F.; Manuel, O.K.; Sinha, B.; Thorpe, R.I.

    1986-01-01

    The isotopic composition of xenon is reported in four, neutron-irradiated tellurium minerals - tellurobismuthite from Boliden, Sweden, native tellurium from the Good Hope Mine of Gunnison County, Colorado, altaite from the Kirkland Lake area, Ontario, and altaite from the Mattagami Lake area, Quebec. From the amount of radiogenic 130 Xe and pile-produced 131 Xe in these samples, it is concluded that the half-life of 130 Te for ββ-decay is 21 y based on measured values of (1.0+-0.3) . 10 21 y and higher. Our results demonstrate that there has been no significant partial leakage of radiogenic 130 Xe from these minerals over geologic time. Larger values of Tsub(1/2), as indicated from some of the analysis reported here and in other studies, are attributed to recrystallization of the soft telluride minerals and complete resetting of the Te-Xe system after mineralization. The value obtained here for the half-life of 130 Te is substantiated by recent measurements on xenon in tellurides from Kalgoorlie, Western Australia. (orig.)

  10. Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method

    Science.gov (United States)

    Bolotnikov, Aleskey E [South Setauket, NY; James, Ralph B [Ridge, NY

    2010-07-20

    The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

  11. Peroxide coordination of tellurium in aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Mikhaylov, Alexey A.; Medvedev, Alexander G. [Kurnakov Institute of General and Inorganic Chemistry, Russian Academy of Sciences, Moscow (Russian Federation); The Casali Center of Applied Chemistry, The Institute of Chemistry, The Hebrew University of Jerusalem (Israel); Churakov, Andrei V.; Grishanov, Dmitry A.; Prikhodchenko, Petr V. [Kurnakov Institute of General and Inorganic Chemistry, Russian Academy of Sciences, Moscow (Russian Federation); Lev, Ovadia [The Casali Center of Applied Chemistry, The Institute of Chemistry, The Hebrew University of Jerusalem (Israel)

    2016-02-15

    Tellurium-peroxo complexes in aqueous solutions have never been reported. In this work, ammonium peroxotellurates (NH{sub 4}){sub 4}Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 4}(OH){sub 2} (1) and (NH{sub 4}){sub 5}Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 5}(OH).1.28 H{sub 2}O.0.72 H{sub 2}O{sub 2} (2) were isolated from 5 % hydrogen peroxide aqueous solutions of ammonium tellurate and characterized by single-crystal and powder X-ray diffraction analysis, by Raman spectroscopy and thermal analysis. The crystal structure of 1 comprises ammonium cations and a symmetric binuclear peroxotellurate anion [Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 4}(OH){sub 2}]{sup 4-}. The structure of 2 consists of an unsymmetrical [Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 5}(OH)]{sup 5-} anion, ammonium cations, hydrogen peroxide, and water. Peroxotellurate anions in both 1 and 2 contain a binuclear Te{sub 2}(μ-OO){sub 2}(μ-O) fragment with one μ-oxo- and two μ-peroxo bridging groups. {sup 125}Te NMR spectroscopic analysis shows that the peroxo bridged bitellurate anions are the dominant species in solution, with 3-40 %wt H{sub 2}O{sub 2} and for pH values above 9. DFT calculations of the peroxotellurate anion confirm its higher thermodynamic stability compared with those of the oxotellurate analogues. This is the first direct evidence for tellurium-peroxide coordination in any aqueous system and the first report of inorganic tellurium-peroxo complexes. General features common to all reported p-block element peroxides could be discerned by the characterization of aqueous and crystalline peroxotellurates. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  12. 33 CFR 138.40 - Forms.

    Science.gov (United States)

    2010-07-01

    ...) § 138.40 Forms. All forms referred to in this subpart may be obtained from NPFC by requesting them in writing at the address given in § 138.45(a) or by clicking on the Forms link at the NPFC E-COFR Web site... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Forms. 138.40 Section 138.40...

  13. Structure and activity of tellurium-cerium oxide acrylonitrile catalysts

    International Nuclear Information System (INIS)

    Bart, J.C.J.; Giordano, N.

    1982-01-01

    Ammoxidation of propylene to acrylonitrile (ACN) was investigated over various silica-supported (Te,Ce)O catalysts at 360 and 440 0 C. The binary oxide system used consists of a single nonstoichiometric fluorite-type phase α-(Ce,Te)O 2 up to about 80 mole% TeO 2 and a tellurium-saturated solid solution β-(Ce,Te)O 2 at higher tellurium concentrations. The ACN yield varies almost linearly with the tellurium content of (Ce,Te)O 2 . The β-(Ce,Te)O 2 phase is the most active component of the system (propylene conversion and ACN selectivity at 440 C of 76.7 and 74%, respectively) and is slightly more selective to ACN than α-Te0 2 . Tellurium reduces the overoxidation properties of cerium and selective oxidation occurs through Te(IV)-bonded oxygen

  14. Selenium- or tellurium- containing bile acids and derivatives thereof

    International Nuclear Information System (INIS)

    Monks, R.; Riley, A.L.M.

    1981-01-01

    This invention relates to the preparation of selenium and tellurium derivatives, particularly γ-emitting radioactive derivatives of bile acids and bile salts. Such compounds are valuable in the examination of body function, especially small bowel function. (author)

  15. Study of distribution coefficients of admixtures in tellurium

    International Nuclear Information System (INIS)

    Kuchar, L.; Drapala, J.; Kuchar, L. jr.

    1986-01-01

    Limit areas of tellurium-admixture binary systems were studied and the values determined of steady-state distribution coefficients of admixtures. A second order polynomial was used to express equations of solidus and liquidus curves for Te-Se, Te-S, Te-Hg systems; the curves are graphically represented. The most effective method for preparing high-purity tellurium is zonal melting with material removal. (M.D.). 4 figs., 4 tabs., 16 refs

  16. Thermal neutron capture cross sections of tellurium isotopes

    International Nuclear Information System (INIS)

    Tomandl, I.; Honzatko, J.; Egidy, T. von; Wirth, H.-F.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Zs.; Molnar, G.L.; Firestone, R.B.; Bondarenko, V.

    2003-01-01

    New values for thermal neutron capture cross sections of the tellurium isotopes 122 Te, 124 Te, 125 Te, 126 Te, 128 Te, and 130 Te are reported. These values are based on a combination of newly determined partial γ-ray cross sections obtained from experiments on targets contained natural Te and γ intensities per capture of individual Te isotopes. Isomeric ratios for the thermal neutron capture on the even tellurium isotopes are also given

  17. Thermal neutron capture cross sections of tellurium isotopes

    International Nuclear Information System (INIS)

    Tomandl, I.; Honzatko, J.; Egidy, T. von; Wirth, H.-F.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Zs.; Molnar, G.L.; Firestone, R.B.; Bondarenko, V.

    2004-01-01

    New values for thermal neutron capture cross sections of the tellurium isotopes 122Te, 124Te, 125Te, 126Te, 128Te, and 130Te are reported. These values are based on a combination of newly determined partial g-ray cross sections obtained from experiments on targets contained natural Te and gamma intensities per capture of individual Te isotopes. Isomeric ratios for the thermal neutron capture on the even tellurium isotopes are also given

  18. Thermal neutron capture cross sections of tellurium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Tomandl, I.; Honzatko, J.; von Egidy, T.; Wirth, H.-F.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Zs.; Molnar, G.L.; Firestone, R.B.; Bondarenko, V.

    2004-03-01

    New values for thermal neutron capture cross sections of the tellurium isotopes 122Te, 124Te, 125Te, 126Te, 128Te, and 130Te are reported. These values are based on a combination of newly determined partial g-ray cross sections obtained from experiments on targets contained natural Te and gamma intensities per capture of individual Te isotopes. Isomeric ratios for the thermal neutron capture on the even tellurium isotopes are also given.

  19. Tellurium quantum dots: Preparation and optical properties

    Science.gov (United States)

    Lu, Chaoyu; Li, Xueming; Tang, Libin; Lai, Sin Ki; Rogée, Lukas; Teng, Kar Seng; Qian, Fuli; Zhou, Liangliang; Lau, Shu Ping

    2017-08-01

    Herein, we report an effective and simple method for producing Tellurium Quantum dots (TeQDs), zero-dimensional nanomaterials with great prospects for biomedical applications. Their preparation is based on the ultrasonic exfoliation of Te powder dispersed in 1-methyl-2-pyrrolidone. Sonication causes the van der Waals forces between the structural hexagons of Te to break so that the relatively coarse powder breaks down into nanoscale particles. The TeQDs have an average size of about 4 nm. UV-Vis absorption spectra of the TeQDs showed an absorption peak at 288 nm. Photoluminescence excitation (PLE) and photoluminescence (PL) are used to study the optical properties of TeQDs. Both the PLE and PL peaks revealed a linear relationship against the emission and excitation energies, respectively. TeQDs have important potential applications in biological imaging and catalysis as well as optoelectronics.

  20. Quantitative analysis of tellurium in simple substance sulfur

    International Nuclear Information System (INIS)

    Arikawa, Yoshiko

    1976-01-01

    The MIBK extraction-bismuthiol-2 absorptiometric method for the quantitative analysis of tellurium was studied. The method and its limitation were compared with the atomic absorption method. The period of time required to boil the solution in order to decompose excess hydrogen peroxide and to reduce tellurium from 6 valance to 4 valance was examined. As a result of experiment, the decomposition was fast in the alkaline solution. It takes 30 minutes with alkaline solution and 40 minutes with acid solution to indicate constant absorption. A method of analyzing the sample containing tellurium less than 5 ppm was studied. The experiment revealed that the sample containing a very small amount of tellurium can be analyzed when concentration by extraction is carried out for the sample solutions which are divided into one gram each because it is difficult to treat several grams of the sample at one time. This method also is suitable for the quantitative analysis of selenium. This method showed good addition effect and reproducibility within the relative error of 5%. The comparison between the calibration curve of the standard solution of tellurium 4 subjected to the reaction with bismuthiol-2 and the calibration curve obtained from the extraction of tellurium 4 with MIBK indicated that the extraction is perfect. The result by bismuthiol-2 method and that by atom absorption method coincided quite well on the same sample. (Iwakiri, K.)

  1. METHODS OF SYNTHESIS EIGHT-TELLURIUM-CONTAINING HETEROCYCLES WITH MORE HETEROATOMS

    Directory of Open Access Journals (Sweden)

    G. M. Abakarov

    2013-01-01

    Full Text Available In this article systematized and summarized data on the synthesis of neweight-embered tellurium-containing heterocycles and new preparative methods described above produce heterocyclic tellurium.

  2. Investigation of γ-irradiation influence on the DLTS spectra in silicon diluted by tellurium

    International Nuclear Information System (INIS)

    Sultanov, N.A.; Tadzhibaev, M.; Mirzabadalov, Zh

    1997-01-01

    The influence of gamma-radiation on deep level transient spectroscopy(DLTS) spectra for silicon crystals doped with tellurium was studied. The DLTS spectra have shown that tellurium in silicon formed two deep levels with fixed ionization energy. It was shown that the presence of tellurium prevents the formation of radiation defects

  3. Fission product tellurium chemistry from fuel to containment

    International Nuclear Information System (INIS)

    McFarlane, J.

    1996-01-01

    Chemical equilibrium calculations were performed on the speciation of tellurium in-core and inside the primary heat transport system (PHTS) under loss-of-coolant accident conditions. Data from recent Knudsen-cell experiments on the volatilization of Cs 2 Te were incorporated into the calculation. These data were used to recalculate thermodynamic quantities for Cs 2 Te(g), including Δ f G o (298 K)= -118±9 kJ.mol -1 . The description of the condensed high-temperature cesium-tellurium phase was expanded to include Cs 2 Te 3 (c) in addition to Cs 2 Te(c). These modifications were incorporated into the database used in the equilibrium calculations; the net effect was to stabilize the condensed cesium-tellurium phase and reduce the vapour pressure of Cs 2 Te(g) between 1200 and 1600 K. The impact of tellurium speciation in containment, after release from the PHTS, is discussed along with the possible effect of tellurium on iodine chemistry. (author) 10 figs., 5 tabs., 21 refs

  4. Fission product tellurium chemistry from fuel to containment

    Energy Technology Data Exchange (ETDEWEB)

    McFarlane, J [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Labs.

    1996-12-01

    Chemical equilibrium calculations were performed on the speciation of tellurium in-core and inside the primary heat transport system (PHTS) under loss-of-coolant accident conditions. Data from recent Knudsen-cell experiments on the volatilization of Cs{sub 2}Te were incorporated into the calculation. These data were used to recalculate thermodynamic quantities for Cs{sub 2}Te(g), including {Delta}{sub f}G{sup o}(298 K)= -118{+-}9 kJ.mol{sup -1}. The description of the condensed high-temperature cesium-tellurium phase was expanded to include Cs{sub 2}Te{sub 3}(c) in addition to Cs{sub 2}Te(c). These modifications were incorporated into the database used in the equilibrium calculations; the net effect was to stabilize the condensed cesium-tellurium phase and reduce the vapour pressure of Cs{sub 2}Te(g) between 1200 and 1600 K. The impact of tellurium speciation in containment, after release from the PHTS, is discussed along with the possible effect of tellurium on iodine chemistry. (author) 10 figs., 5 tabs., 21 refs.

  5. A recycling model of the biokinetics of systemic tellurium.

    Science.gov (United States)

    Giussani, Augusto

    2014-11-01

    To develop a compartmental model of the systemic biokinetics of tellurium required for calculating the internal dose and interpreting bioassay measurements after incorporation of radioactive tellurium. The compartmental model for tellurium was developed with the software SAAM II v. 2.0 (©The Epsilon Group, Charlottesville, Virginia, USA). Model parameters were determined on the basis of published retention and excretion data in humans and animals. The model consists of two blood compartments, one compartment each for liver, kidneys, thyroid, four compartments for bone tissues and a generic compartment for the soft tissues. The model predicts a rapid urinary excretion of systemic tellurium: 45% in the first 24 h and 84% after 50 d. Faecal excretion amounts to 0.4% after 3 d and 9% after 50 d. Whole body retention is 55% after one day, and 2.8% after 100 d. These values as well as the retained fractions in the single organs are reasonably consistent with the available human and animal data (studies with swine and guinea pigs). The proposed model gives a realistic description of the available biokinetic data for tellurium and will be adopted by the International Commission on Radiological Protection for applications in internal dosimetry.

  6. Tracing Tellurium and Its Nanostructures in Biology.

    Science.gov (United States)

    Zare, Bijan; Nami, Mohammad; Shahverdi, Ahmad-Reza

    2017-12-01

    Tellurium (Te) is a semimetal rare element in nature. Together with oxygen, sulfur (S), and selenium (Se), Te is considered a member of chalcogen group. Over recent decades, Te applications continued to emerge in different fields including metallurgy, glass industry, electronics, and applied chemical industries. Along these lines, Te has recently attracted research attention in various fields. Though Te exists in biologic organisms such as microbes, yeast, and human body, its importance and role and some of its potential implications have long been ignored. Some promising applications of Te using its inorganic and organic derivatives including novel Te nanostructures are being introduced. Before discovery and straightforward availability of antibiotics, Te had considered and had been used as an antibacterial element. Antilishmaniasis, antiinflammatory, antiatherosclerotic, and immuno-modulating properties of Te have been described for many years, while the innovative applications of Te have started to emerge along with nanotechnological advances over the recent years. Te quantum dots (QDs) and related nanostructures have proposed novel applications in the biological detection systems such as biosensors. In addition, Te nanostructures are used in labeling, imaging, and targeted drug delivery systems and are tested for antibacterial or antifungal properties. In addition, Te nanoparticles show novel lipid-lowering, antioxidant, and free radical scavenging properties. This review presents an overview on the novel forms of Te, their potential applications, as well as related toxicity profiles.

  7. Tellurium Enrichment in Jurassic Coal, Brora, Scotland

    Directory of Open Access Journals (Sweden)

    Liam Bullock

    2017-11-01

    Full Text Available Mid-Jurassic pyritic coals exposed at the village of Brora, northern Scotland, UK, contain a marked enrichment of tellurium (Te relative to crustal mean, average world coal compositions and British Isles Carboniferous coals. The Te content of Brora coal pyrite is more than one order of magnitude higher than in sampled pyrite of Carboniferous coals. The Te enrichment coincides with selenium (Se and mercury (Hg enrichment in the rims of pyrite, and Se/Te is much lower than in pyrites of Carboniferous coals. Initial pyrite formation is attributed to early burial (syn-diagenesis, with incorporation of Te, Se, Hg and lead (Pb during later pyrite formation. The source of Te may have been a local hydrothermal system which was responsible for alluvial gold (Au in the region, with some Au in Brora headwaters occurring as tellurides. Anomalous Te is not ubiquitous in coal, but may occur locally, and is detectable by laser ablation inductively coupled plasma-mass spectrometry (LA-ICP-MS.

  8. Electrophilic addition of selenium and tellurium halides to methyldiethynylsilane

    International Nuclear Information System (INIS)

    Amosova, S.V.; Penzik, M.V.; Martynov, A.V.; Zhilitskaya, L.V.; Voronkov, M.G.

    2009-01-01

    Reaction of TeCl 4 with methyldiethynylsilane (MDES) proceeds with the predominant formation of E-isomer 1,1,3,6-tetrachlorine-1-methyl-1-(methyldiethynylsiloxy)-1,4-tellurium(IV) silafulvic due to the interaction of intermediate E-isomer 4-methyl-1,1,3,6-tetrachlorine-1,4-tellurium(IV)silafulvic with MDES. TeCl 4 Reacts with MDES without reduction of Te(IV) in Te(II). Tetracoordination of tellurium atom in heterocycle was established by NMR 125 Te. Mass spectrum of heterocycle shows the presence of fragmentary ions [M-Cl 2 ] + . According elemental analysis Te:Cl=1:4 ratio proves composition of heterocycle

  9. Analysis of tellurium-silicon alloys. Part 1. Determination of tellurium by the reduction from perchloric acid solution

    International Nuclear Information System (INIS)

    Teperek, J.

    1977-01-01

    When 100-150 mg of tellurium is dissolved in the solution containing 20 cm 3 72 wt.% of perchloric acid, the reduction of tellurium to elementary form is possible only after adding 60-100 milimoles of HCl. The reduction is performed by adding 1 cm 3 of saturated sodium pyrosulphite solution (Na 2 S 2 O 5 ) and 10 cm 3 of 10 wt.% hydrazine hydrochloride solution (N 2 H 4 .2HCl) to 80-90 cm 3 of cold solution of Te in HClO 4 -HCl mixture. The reduction is completed after 3-5 min. of boiling. When 150-200 mg sample of Te-Si alloy is dissolved in 20 cm 3 of hot 72% per chloric acid, the separation of components is reached. Tellurium can be determinated in filtrate by proposed procedure with high accuracy and precision. (author)

  10. METALCOMPLEXES OF TELLURIUM-CONTAINING AMINES AND AZOMETINES

    Directory of Open Access Journals (Sweden)

    G. M. Abakarov

    2014-01-01

    Full Text Available In this article methods of synthesis and reactionary ability of metalcomplexes of tellurium-containing amines, azometines, of a problem of competitive coordination with use of the principle of "soft" and "rigid" acids and the bases (R. Pearson.

  11. Properties of low-alloy steel with tellurium

    International Nuclear Information System (INIS)

    Popova, L.V.; Lebedev, D.V.; Litvinenko, D.A.; Nasibov, A.G.

    1983-01-01

    The results of investigations into 09G2 and 09G2F steels alloyed with tellurium after controlled rolling are presented. 0.002-0.011% tellurium additions did not change strength and plastic properties of the steels after controlled rolling. Tellurium additions results in 40-50% increase of the steel impact strength on samples With circular and sharp cuts in brittle-viscous region. 0.002-0.003% of tellurium is considered to be the optimum content from the view point of increa=. sing steel strength. Increase of impact strength takes place at the expense of growth of both work function of crack formation and work function of crack propagation but in different temperature ranges: at the expense of firstone at 80-40 deg C, at the expense of second one at 20-40 deg C. 0.002-0.011% teilurium additions mainly at the expense of sulphide globularization bring about decrease of anisotropy of steet properties by impact strength reducing anisotropy factor from 2 to 1.5

  12. Tellurium Stable Isotopes as a Paleoredox Proxy

    Science.gov (United States)

    Wasserman, N.; Johnson, T. M.

    2017-12-01

    Despite arguments for variably-oxygenated shallow waters and anoxic deep marine waters, which delayed animal development until the Neoproterozoic Oxidation Event, the magnitude of atmospheric oxygen during the Proterozoic is still uncertain [1]. The evidence for low pO2 (<0.1-1% PAL) is based on geochemical and isotopic proxies, which track the mobilization of Fe and Mn on the continents. For example, large chromium isotope shifts occur at the Neoproterozoic Oxidation Event due to the initiation of Cr redox cycling, but this proxy is insensitive to fluctuations in the lower-pO2 conditions at other times during the Proterozoic. Tellurium, a metalloid with a lower threshold to oxidation, may be sensitive to pO2 shifts in a lower range. In the reduced forms, Te(-II) and Te(0), the element is insoluble and immobile. However, in the more oxidized phases, Te(IV) and Te(VI), Te can form soluble oxyanions (though it tends to adsorb to Fe-oxyhydroxides and clays) [2]. Te stable isotopes have been shown to fractionate during abiotic or biologic reduction of Te(VI) or Te(IV) to elemental Te(0) [3, 4]. Utilizing hydride generation MC-ICP-MS, we are able to obtain high precision (2σ 0.04‰) measurements of δ128Te/125Te for natural samples containing < 10 ng of Te. A suite of Phanerozoic and Proterozoic ironstones show significant variation in δ128Te/125Te (<0.5‰), suggesting that the Te redox cycle was active during the Proterozoic. Future directions will include Te isotope measurements of Precambrian paleosols to determine natural isotope variation before the Great Oxidation Event and experiments to determine fractionation during adsorption to Fe-oxyhydroxides. [1] Planavsky et al. (2014) Science 346 (6209), pp. 635-638 [2] Qin et al. (2017) Environmental Science and Technology 51 (11), pp 6027-6035 [3] Baesman et al. (2007) Applied Environmental Microbiology 73 (7), pp 2135-2143 [4] Smithers and Krause (1968) Canadian Journal of Chemistry 46(4): pp 583-591

  13. Enrichment mechanisms of tellurium in ferromanganese crusts

    Science.gov (United States)

    Sakaguchi, A.; Sugiyama, T.; Usui, A.; Takahashi, Y.

    2012-04-01

    Marine ferromanganese crusts (FMCs) consist of iron (Fe) hydroxides and manganese (Mn) oxides with various minor and trace elements. Especially for tellurium (Te), which is recognized as one of the rare metals, it has been reported that this element is concentrated about 105 times in FMCs compared with earth's crust, and the host phase might be Fe (oxy)hydroxide (Hein et al., 2003). Actually, in our previous study, the high concentration of Te in very surface layers of FMCs was found from the top to halfway down of a seamount in the Pacific Ocean. However, the concentration of Te in surface layers through the seamount showed good correlation with that of Mn instead of Fe. In this study, we attempted to clarify the enrichment mechanism of Te in FMCs with some methods including X-ray absorption fine structure (XAFS) technique for synthesised /natural samples. Seventeen FMC samples were collected from the Takuyo-Daigo seamount, from 950 m (summit) to 3000 m in water depth, with hyper-dolphin (remotely operated vehicle) equipped with live video camera and manipulators. The growth rates of all FMC samples were estimated to be about 3 mm/Ma. Very surface layer (less than 1 mm) of all FMC was analyzed with XRD and XAFS to confirm the mineral composition and speciation of Te. Furthermore, to serve as an aid to clarify the adsorption mechanism of Te on FMCs, distribution coefficients (Kd) and oxidation states were determined through the adsorption experiments of Te(IV) and Te(VI) on ferrihydrite and δ-MnO2. In all the experiments, pH and ionic strength were adjusted to pH 7.5 and 0.7 M, respectively. The oxidation state of Te in water phase was determined with HPLC-ICP-MS. As for the analysis of oxidation and adsorption states on the solid phase, XAFS was employed. The major mineral composition of Fe and Mn had no significant variation through the water depth of Takuyo-Daigo seamount. The oxidation state of Te in all samples showed hexavalent, and there was no significant

  14. Particle-hole states in 138Ba

    International Nuclear Information System (INIS)

    Bondarenko, V.A.; Khitrov, V.A.; Popov, Yu.P.; Brant, S.; Paar, V.; Simicic, L.

    1995-01-01

    The thermal-neutron-capture gamma rays and γγ-coincidences were measured by means of Ge detectors. Using primary and secondary (n, γ) data, the level scheme of 138 Ba was established with 63 levels up to an excitation energy of 5 MeV. The level energies and (d, p) transfer data were compared with model predictions of the interacting boson-fermion-fermion model. As shown, this model provides a basic understanding of the neutron particle-hole states of 138 Ba in the energy range of 3.5-5.0 MeV. ((orig.))

  15. Atomic absorption determination of ultratrace tellurium in rocks utilizing high sensitivity sampling systems

    International Nuclear Information System (INIS)

    Beaty, R.D.

    1973-01-01

    The sampling boat and the graphite furnace were shown to possess the required sensitivity to detect tellurium at ultratrace levels, in a variety of sample types, by atomic absorption. In the sampling boat approach, tellurium in sample solutions is chemically separated and concentrated by extraction into methyl isobutyl ketone before measurement. For samples exhibiting extraction interferences or excessively high background absorption, a preliminary separation of tellurium by coprecipitation with selenium is described. Using this technique, tellurium can be quantitatively detected down to 5 nanograms and linear response is observed to 100 nanograms. Relative standard deviations of better than 7 percent are achieved for 50 nanograms of tellurium. For samples that have a tellurium content below the detection limits of the sampling boat, the graphite furnace is used for atomization. By this method, as little as 0.07 nanograms of tellurium can be detected, and a precision of 1 percent relative standard deviation is achievable at the 5 nanogram level. A routinely applicable procedure was developed for determining tellurium in rocks, using the graphite furnace, after a hydrofluoric acid decomposition of the sample. Using this procedure, tellurium data were obtained on 20 different rocks, and the significance of this new information is discussed. (Diss. Abstr. Int., B)

  16. Effects of tellurium concentration on the structure of melt-grown ZnSe crystals

    International Nuclear Information System (INIS)

    Atroshchenko, Lyubov V.; Galkin, Sergey N.; Rybalka, Irina A.; Voronkin, Evgeniy F.; Lalayants, Alexandr I.; Ryzhikov, Vladimir D.; Fedorov, Alexandr G.

    2005-01-01

    It has been shown that isovalent doping by tellurium positively affects the structural perfection of ZnSe crystals related to the completeness of the wurtzite-sphalerite phase transition. The optimum concentration range of tellurium in ZnSe crystals is 0.3-0.6 mass %. X-ray diffraction studies have shown that in ZnSe 1-x Te x crystals at tellurium concentrations below 0.3 mass % twinning and packing defects occur, while tellurium concentrations above 0.6 mass % lead to formation of tetragonal crystal lattice

  17. Determining arsenic in elemental antimony containing selenium and tellurium

    International Nuclear Information System (INIS)

    Mogileva, M.G.; Kozlova, E.L.

    1986-01-01

    The authors have developed a method of determining arsenic in metallic antimony containing selenium, tellurium, and mercury, in which they isolated it in elementary form for separation from the antimony and the associated elements (silicon and phosphorus), followed by colorimetric determination of the arsenic from arsenic-molbdenum blue. The reducing agents to reduce the arsenic were sodium hypophosphite and tin(II) chloride, which do not reduce antimony and which do not interfere with the determination. This method of determining arsenic in metallic antimony without preliminary separation of the selenium and tellurium is in no way inferior in accuracy to the method given in All-Union State Standard (GOST) 1367.4-83

  18. RILIS-ionized mercury and tellurium beams at ISOLDE CERN

    Energy Technology Data Exchange (ETDEWEB)

    Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN (Switzerland); Billowes, J. [The University of Manchester, School of Physics and Astronomy (United Kingdom); Chrysalidis, K. [CERN (Switzerland); Fedorov, D. V. [Petersburg Nuclear Physics Institute (Russian Federation); Fedosseev, V. N.; Marsh, B. A. [CERN (Switzerland); Molkanov, P. L. [Petersburg Nuclear Physics Institute (Russian Federation); Rossel, R. E.; Rothe, S.; Seiffert, C. [CERN (Switzerland); Wendt, K. D. A. [Johannes Gutenberg Universität, Institut für Physik (Germany)

    2017-11-15

    This paper presents the results of ionization scheme development for application at the ISOLDE Resonance Ionization Laser Ion Source (RILIS). Two new ionization schemes for mercury are presented: a three-step three-resonance ionization scheme, ionizing via an excitation to a Rydberg level and a three-step two-resonance ionization scheme, with a non-resonant final step to the ionization continuum that corresponded to a factor of four higher ionization efficiency. The efficiency of the optimal mercury ionization scheme was measured, together with the efficiency of a new three-step three resonance ionization scheme for tellurium. The efficiencies of the mercury and tellurium ionization schemes were determined to be 6 % and >18 % respectively.

  19. ELECTROCHEMICAL STUDY OF RHENIUM-TELLURIUM-COPPER SYSTEM

    OpenAIRE

    E.A.Salakhova*1, D.B.Tagiyev2, P.E.Kalantarova3 and A.M.Askerova4

    2017-01-01

    The formation of the triple alloys Re-Te-Cu on the platinum electrode at volt amperemetric cycling has been studied. The investigation was carried out from chloride acidic solution containing tellurium acid, potassium perrhenate, chloride copper. The kinetics of the processes was controlled using the measurements by the method of cyclic volt-amperometry on the device İVİUMSTAT. For the analysis of composition and structure the methods of XRD (X-ray diffraction analysis) were used, and the inv...

  20. Starting material radiation source for Moessbauer investigations of tellurium compounds

    International Nuclear Information System (INIS)

    Alexandrov, A.J.; Grushko, J.S.; Makarov, E.F.; Mishin, K.Y.; Baltrunas, D.A.J.

    1977-01-01

    A method is described of preparing a radiation source for Mossbauer investigations of tellurium compounds manufactured on the basis of 5 MgO . Te 124 O 3 . 5 MgO . Te 124 O 3 is irradiated in a reactor by means of thermal neutrons, followed by annealing at a temperature ranging from 600 0 to 1,100 0 C for a period of from 5 to 10 hours

  1. Flotation concentration for tellurium determination in industrial sewage

    International Nuclear Information System (INIS)

    Skripchuk, V.G.; Bormotova, L.V.; Lukoyanova, L.P.; Tret'yakova, M.I.

    1983-01-01

    Combination of the flotation of tellurium (4) precipitate with papaverine toluene and extraction-photometric determination of Te with butylrhodamine C allows one to determine 0.002-0.1 mg Te/l without its preliminary precipitation. Accompanying elements found in non-ferrous metallurgy sewage have no effect upon it. The duration of analysis of 10 samples is 1 to 1.5 h. Relative error is 12%. The method is introduced at the ''Uralelektromed'' plant

  2. 33 CFR 138.20 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... financial responsibility referred to in § 138.10(a): claim, claimant, damages, discharge, exclusive economic... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water...

  3. 7 CFR 1956.138 - Processing.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) DEBT SETTLEMENT Debt Settlement-Community and Business Programs § 1956.138 Processing... this subpart. (d) Appeal rights. In accordance with Subpart B of Part 1900 of this chapter, the debtor...

  4. RNF138 joins the HR team

    DEFF Research Database (Denmark)

    Bekker-Jensen, Simon; Mailand, Niels

    2015-01-01

    Two studies show that the E3 ubiquitin ligase RNF138 is recruited to DNA double-strand break sites, where it ubiquitylates key repair factors to promote DNA-end resection and homologous recombination. These findings add insights into the multilayered regulatory mechanisms underlying DNA double-st...

  5. Investigation of biomethylation of arsenic and tellurium during composting

    International Nuclear Information System (INIS)

    Diaz-Bone, Roland A.; Raabe, Maren; Awissus, Simone; Keuter, Bianca; Menzel, Bernd; Kueppers, Klaus; Widmann, Renatus; Hirner, Alfred V.

    2011-01-01

    Though the process of composting features a high microbiological activity, its potential to methylate metals and metalloids has been little investigated so far in spite of the high impact of this process on metal(loid) toxicity and mobility. Here, we studied the biotransformation of arsenic, tellurium, antimony, tin and germanium during composting. Time resolved investigation revealed a highly dynamic process during self-heated composting with markedly differing time patterns for arsenic and tellurium species. Extraordinary high concentrations of up to 150 mg kg -1 methylated arsenic species as well as conversion rates up to 50% for arsenic and 5% for tellurium were observed. In contrast, little to no conversion was observed for antimony, tin and germanium. In addition to experiments with metal(loid) salts, composting of arsenic hyperaccumulating ferns Pteris vittata and P. cretica grown on As-amended soils was studied. Arsenic accumulated in the fronds was efficiently methylated resulting in up to 8 mg kg -1 methylated arsenic species. Overall, these studies indicate that metal(loid)s can undergo intensive biomethylation during composting. Due to the high mobility of methylated species this process needs to be considered in organic waste treatment of metal(loid) contaminated waste materials.

  6. Rutherford backscatter measurements on tellurium and cadmium implanted gallium arsenide

    International Nuclear Information System (INIS)

    Bell, E.C.

    1979-10-01

    The primary aim of the work described in this thesis was to examine implanted layers of the dopant impurities cadmium and tellurium in gallium arsenide and to experimentally assess their potential for producing electrically active layers. 1.5 MeV Rutherford backscattering measurements of lattice disorder and atom site location have been used to assess post implantation thermal annealing and elevated temperature implantations to site the dopant impurities on either gallium or arsenic lattice positions in an otherwise undisordered lattice. Pyrolitically deposited silicon dioxide was used as an encapsulant to prevent thermal dissociation of the gallium arsenide during annealing. It has been shown that high doses of cadmium and tellurium can be implanted without forming amorphous lattice disorder by heating the gallium arsenide during implantation to relatively low temperatures. Atom site location measurements have shown that a large fraction of a tellurium dose implanted at 180 0 C is located on or near lattice sites. Channeled backscatter measurements have shown that there is residual disorder or lattice strain in gallium arsenide implanted at elevated temperatures. The extent of this disorder has been shown to depend on the implanted dose and implantation temperature. The channeling effect has been used to measure annealing of the disorder. (author)

  7. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Yang F

    2014-10-01

    Full Text Available Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellurium-containing phycocyanin (Te-PC and allophycocyanin (Te-APC, two organic tellurium (Te species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 µg g-1 protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropanedihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress. Keywords: tellurium, phycocyanin, allophycocyanin, purification, antioxidant activity

  8. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis.

    Science.gov (United States)

    Yang, Fang; Wong, Ka-Hing; Yang, Yufeng; Li, Xiaoling; Jiang, Jie; Zheng, Wenjie; Wu, Hualian; Chen, Tianfeng

    2014-01-01

    Tellurium-containing phycocyanin (Te-PC) and allophycocyanin (Te-APC), two organic tellurium (Te) species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 μg g(-1) protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropane)dihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress.

  9. Electrodeposition of antimony, tellurium and their alloys from molten acetamide mixtures

    NARCIS (Netherlands)

    Nguyen, H.P.; Peng, X.; Murugan, G.; Vullers, R.J.M.; Vereecken, P.M.; Fransaer, J.

    2013-01-01

    We examine the electrodeposition of antimony (Sb), tellurium (Te) and their alloys from molten mixtures of acetamide - antimony chloride and tellurium chloride. The binary mixtures of acetamide with SbCl3 and TeCl 4 exhibit eutectic formation with large depressions of freezing points to below room

  10. Biosynthesis and recovery of rod-shaped tellurium nanoparticles and their bactericidal activities

    Energy Technology Data Exchange (ETDEWEB)

    Zare, Bijan; Faramarzi, Mohammad Ali; Sepehrizadeh, Zargham [Department of Pharmaceutical Biotechnology and Biotechnology Research Center, Faculty of Pharmacy, Tehran University of Medical Sciences, P.O. Box 14155-6451 Tehran (Iran, Islamic Republic of); Shakibaie, Mojtaba [Department of Pharmacognosy and Biotechnology, School of Pharmacy, Pharmaceutics Research Center, Kerman University of Medical Sciences, P.O. Box 76175-493 Kerman (Iran, Islamic Republic of); Rezaie, Sassan [Department of Medical Biotechnology, School of Advanced Medical Technologies, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Shahverdi, Ahmad Reza, E-mail: shahverd@sina.tums.ac.ir [Department of Pharmaceutical Biotechnology and Biotechnology Research Center, Faculty of Pharmacy, Tehran University of Medical Sciences, P.O. Box 14155-6451 Tehran (Iran, Islamic Republic of)

    2012-11-15

    Highlights: ► Biosynthesis of rod shape tellurium nanoparticles with a hexagonal crystal structure. ► Extraction procedure for isolation of tellurium nanoparticles from Bacillus sp. BZ. ► Extracted tellurium nanoparticles have good bactericidal activity against some bacteria. -- Abstract: In this study, a tellurium-transforming Bacillus sp. BZ was isolated from the Caspian Sea in northern Iran. The isolate was identified by various tests and 16S rDNA analysis, and then used to prepare elemental tellurium nanoparticles. The isolate was subsequently used for the intracellular biosynthesis of elemental tellurium nanoparticles. The biogenic nanoparticles were released by liquid nitrogen and purified by an n-octyl alcohol water extraction system. The shape, size, and composition of the extracted nanoparticles were characterized. The transmission electron micrograph showed rod-shaped nanoparticles with dimensions of about 20 nm × 180 nm. The energy dispersive X-ray and X-ray diffraction spectra respectively demonstrated that the extracted nanoparticles consisted of only tellurium and have a hexagonal crystal structure. This is the first study to demonstrate a biological method for synthesizing rod-shaped elemental tellurium by a Bacillus sp., its extraction and its antibacterial activity against different clinical isolates.

  11. Biosynthesis and recovery of rod-shaped tellurium nanoparticles and their bactericidal activities

    International Nuclear Information System (INIS)

    Zare, Bijan; Faramarzi, Mohammad Ali; Sepehrizadeh, Zargham; Shakibaie, Mojtaba; Rezaie, Sassan; Shahverdi, Ahmad Reza

    2012-01-01

    Highlights: ► Biosynthesis of rod shape tellurium nanoparticles with a hexagonal crystal structure. ► Extraction procedure for isolation of tellurium nanoparticles from Bacillus sp. BZ. ► Extracted tellurium nanoparticles have good bactericidal activity against some bacteria. -- Abstract: In this study, a tellurium-transforming Bacillus sp. BZ was isolated from the Caspian Sea in northern Iran. The isolate was identified by various tests and 16S rDNA analysis, and then used to prepare elemental tellurium nanoparticles. The isolate was subsequently used for the intracellular biosynthesis of elemental tellurium nanoparticles. The biogenic nanoparticles were released by liquid nitrogen and purified by an n-octyl alcohol water extraction system. The shape, size, and composition of the extracted nanoparticles were characterized. The transmission electron micrograph showed rod-shaped nanoparticles with dimensions of about 20 nm × 180 nm. The energy dispersive X-ray and X-ray diffraction spectra respectively demonstrated that the extracted nanoparticles consisted of only tellurium and have a hexagonal crystal structure. This is the first study to demonstrate a biological method for synthesizing rod-shaped elemental tellurium by a Bacillus sp., its extraction and its antibacterial activity against different clinical isolates.

  12. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  13. Polarographic determination of selenium and tellurium in silver-gold alloys

    International Nuclear Information System (INIS)

    Gornostaeva, T.D.; Shmargun, S.V.

    1986-01-01

    The determination of selenium and tellurium is of importance in monitoring the composition of silver-gold alloys (SGA) since these elements are harmful impurities in the pure metals. Tellurium is determined in silver alloys by atomic absorption and atomic emmission methods; selenium determination is made by atomic absorption methods. This paper examines the polarographic determination of silver and tellurium in SGA containing platinum metals and copper. Copper and the bulk of the platinum and palladium were removed by precipitating selenium and tellurium with potassium hypophosphite in the elementary state from 6 M HC1. The results of an analysis of samples of SGA according to the proposed method were compared with the results obtained by the atomic absorption method. the relative deviation in the determination of 0.02-1.0% by weight selenium and tellurium does not exceed 0.12 (n = 5)

  14. Synthesis and structure of aromatic and heterocyclic compounds of tellurium

    International Nuclear Information System (INIS)

    Sadekov, I.D.; Maksimenko, A.A.; Rivkin, B.B.

    1983-01-01

    A new universal method of preparing assymmetric and symmetric diaryl-tellurium chlorides and-dibromides, based on the interaction of diarylditellurides with cations of aryl-diazonium in the presence of copper (2) halogenides is developed. High yields of diaryltellium dihalogenices (60-90 de %), the possibility of the a wide variation of the nature of substituents in both components make this reaction one of the most general methods of preparing assymmetric diaryltellurium dihalogenides. It is advisable to use aryldiazonium boron fluorides instead of halogenides in this reaction

  15. Characterization of tellurium-based films for NO2 detection

    International Nuclear Information System (INIS)

    Tsiulyanu, D.; Tsiulyanu, A.; Liess, H.-D.; Eisele, I.

    2005-01-01

    Sensing characteristics of tellurium-based thin films for NO 2 monitoring was studied systematically. The influence of contact materials, thermal treatment, temperature and thickness of the samples on the electrical conductivity and sensitivity to NO 2 with respect to scanning electron microscopy analyses is given. The possibility is shown to optimize the properties of the films for the development of a simple and stable NO 2 sensor device with rapid response/recovery time and low operating temperature. The sensing mechanism is discussed for the direct interaction of gaseous species with lone-pair electrons of chalcogen atoms

  16. Van der Waals epitaxy and photoresponse of hexagonal tellurium nanoplates on flexible mica sheets.

    Science.gov (United States)

    Wang, Qisheng; Safdar, Muhammad; Xu, Kai; Mirza, Misbah; Wang, Zhenxing; He, Jun

    2014-07-22

    Van der Waals epitaxy (vdWE) is of great interest due to its extensive applications in the synthesis of ultrathin two-dimensional (2D) layered materials. However, vdWE of nonlayered functional materials is still not very well documented. Here, although tellurium has a strong tendency to grow into one-dimensional nanoarchitecture due to its chain-like structure, we successfully realize 2D hexagonal tellurium nanoplates on flexible mica sheets via vdWE. Chemically inert mica surface is found to be crucial for the lateral growth of hexagonal tellurium nanoplates since it (1) facilitates the migration of tellurium adatoms along mica surface and (2) allows a large lattice mismatch. Furthermore, 2D tellurium hexagonal nanoplates-based photodetectors are in situ fabricated on flexible mica sheets. Efficient photoresponse is obtained even after bending the device for 100 times, indicating 2D tellurium hexagonal nanoplates-based photodetectors on mica sheets have a great application potential in flexible and wearable optoelectronic devices. We believe the fundamental understanding of vdWE effect on the growth of 2D tellurium hexagonal nanoplate can pave the way toward leveraging vdWE as a useful channel to realize the 2D geometry of other nonlayered materials.

  17. Release of tellurium and cesium from UO2 in LWR fuel rods during irradiation

    International Nuclear Information System (INIS)

    Malen, K.A.

    1983-01-01

    In this paper the release of tellurium (Te-132) and cesium (Cs-134 and Cs-137) from UO 2 -fuel is analyzed. The basis for the analysis is the experimental results from the S176 series of experiments performed at Studsvik. It seems that the model developed earlier for release of iodine applies also to tellurium and cesium. This model assumes sweeping up of the species in question by moving grain boundaries and subsequent release through grain boundary porosity. An interesting extra feature is deposition of tellurium at temperatures in the range 1500-2000 K believed to be due to condensation. (author)

  18. Review of tellurium release rates from LWR fuel elements under accident conditions

    International Nuclear Information System (INIS)

    Lorenz, R.A.; Beahm, E.C.; Wichner, R.P.

    1983-01-01

    Although fission product tellurium presents a potentially significant radiohazard, its release and transport in source-term experiments is frequently overlooked because it does not possess a readily measurable, gamma emission; moreover, a recent study emphasized noble gas, iodine and cesium release from LWR fuel elements because of the large data base that exists for these materials. Some new tests show that in some cases tellurium may be held up in core material to a greater degree than previously assumed - an observation that prompts a careful reappraisal of the existing tellurium-release data and its chemical foundation

  19. 7 CFR 800.138 - Conflict of interest.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Conflict of interest. 800.138 Section 800.138 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Inspection Services § 800.138 Conflict of interest. Official personnel cannot perform or participate in...

  20. 29 CFR 102.138 - Definition of meeting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...

  1. 6 CFR 13.8 - Service of Complaint.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Service of Complaint. 13.8 Section 13.8 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.8 Service of Complaint. (a) Service of a Complaint must be Made by certified or registered mail or by...

  2. 32 CFR 935.138 - Motor bus operation.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor bus operation. 935.138 Section 935.138 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE TERRITORIAL AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.138 Motor bus operation. Each person operating a motor...

  3. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    Bajo, S.; Wyttenbach, A.

    1978-03-01

    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  4. A Magnetic Resonance Force Microscopy Quantum Computer with Tellurium Donors in Silicon

    OpenAIRE

    Berman, G. P.; Doolen, G. D.; Tsifrinovich, V. I.

    2000-01-01

    We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines the well-developed silicon technology with expected advances in MRFM.

  5. Flame and flameless atomic-absorption determination of tellurium in geological materials

    Science.gov (United States)

    Chao, T.T.; Sanzolone, R.F.; Hubert, A.E.

    1978-01-01

    The sample is digested with a solution of hydrobromic acid and bromine and the excess of bromine is expelled. After dilution of the solution to approximately 3 M in hydrobromic acid, ascorbic acid is added to reduce iron(III) before extraction of tellurium into methyl isobutyl ketone (MIBK). An oxidizing air-acetylene flame is used to determine tellurium in the 0.1-20 ppm range. For samples containing 4-200 ppb of tellurium, a carbon-rod atomizer is used after the MIBK extract has been washed with 0.5 M hydrobromic acid to remove the residual iron. The flame procedure is useful for rapid preliminary monitoring, and the flameless procedure can determine tellurium at very low concentrations. ?? 1978.

  6. DETECTION OF THE SECOND r-PROCESS PEAK ELEMENT TELLURIUM IN METAL-POOR STARS ,

    International Nuclear Information System (INIS)

    Roederer, Ian U.; Lawler, James E.; Cowan, John J.; Beers, Timothy C.; Frebel, Anna; Ivans, Inese I.; Schatz, Hendrik; Sobeck, Jennifer S.; Sneden, Christopher

    2012-01-01

    Using near-ultraviolet spectra obtained with the Space Telescope Imaging Spectrograph on board the Hubble Space Telescope, we detect neutral tellurium in three metal-poor stars enriched by products of r-process nucleosynthesis, BD +17 3248, HD 108317, and HD 128279. Tellurium (Te, Z = 52) is found at the second r-process peak (A ≈ 130) associated with the N = 82 neutron shell closure, and it has not been detected previously in Galactic halo stars. The derived tellurium abundances match the scaled solar system r-process distribution within the uncertainties, confirming the predicted second peak r-process residuals. These results suggest that tellurium is predominantly produced in the main component of the r-process, along with the rare earth elements.

  7. Simple and effective method for nuclear tellurium isomers separation from antimony cyclotron targets

    International Nuclear Information System (INIS)

    Bondarevskij, S.I.; Eremin, V.V.

    1999-01-01

    Simple and effective method of generation of tellurium nuclear isomers from irradiated on cyclotron metallic antimony is suggested. Basically this method consists in consideration of the big difference in volatilities of metallic forms of antimony, tin and tellurium. Heating of the tin-antimony alloy at 1200 K permits to separate about 90 % of produced quantity of 121m Te and 123m Te (in this case impurity of antimony radionuclides is not more than 1 % on activity) [ru

  8. Nano-Structured Crystalline Te Films by Laser Gas-Phase Pyrolysis of Dimethyl Tellurium

    Czech Academy of Sciences Publication Activity Database

    Pola, Josef; Pokorná, Veronika; Boháček, Jaroslav; Bastl, Zdeněk; Ouchi, A.

    2004-01-01

    Roč. 71, č. 2 (2004), s. 739-746 ISSN 0165-2370 R&D Projects: GA AV ČR IAA4072107; GA MŠk OC 523.60 Institutional research plan: CEZ:AV0Z4072921; CEZ:AV0Z4032918; CEZ:AV0Z4040901 Keywords : dimethyl tellurium * tellurium films * laser Subject RIV: CA - Inorganic Chemistry Impact factor: 1.352, year: 2004

  9. Kinetics and mechanism of oxidation of tellurium (IV) by periodate in alkaline medium

    International Nuclear Information System (INIS)

    Srinivas, K.; Vani, P.; Dikshitulu, L.S.A.

    1995-01-01

    Detailed kinetic study of the oxidation of tellurium (IV) by periodate in alkaline medium has been carried out to compare the mechanisms of oxidation in the acid and alkaline media. It is interesting to note that the rate step involves a two-electron transfer from tellurium (IV) to periodate in alkaline medium although the kinetic pattern is somewhat different from that in the acid medium. 7 refs., 1 tab

  10. Methods of selenium and tellurium determination in geological and enviromental materials

    International Nuclear Information System (INIS)

    Nazarenko, I.I.; Kislova, I.V.

    1988-01-01

    Atomic-absorption and atomic-emission methods of tellurium determination in ores and products of their processing are described. Flame variant with extractional concentration permits to determine tellurium with the concentration up to 6x10 -6 %, the use of graphite cuvette after preliminary concentration-up to 1x10 -6 %. Atomic-emissional method permits to determine 3x10 -4 % Te from sample of 0.5 g

  11. Formation of defects in tellurium at various levels of gravitation

    International Nuclear Information System (INIS)

    Parfen'ev, R.V.; Farbshtejn, I.I.; Shul'pina, I.L.; Yakimov, S.V.; Shalimov, V.P.; Turchaninov, A.M.

    2002-01-01

    One investigated into effect of gravitation conditions during tellurium crystallization (ranging from microgravitation up to increased gravitation - 5g 0 ) on concentration of neutral (N D ) and electrically active (N AD ) acceptor structure defects in specimens grown both under complete remelting of parent ingot and under directed recrystallization of ingot with inoculation. N AD and N D concentrations and their distribution along the specimen depth were determined on the basis of analysis of electrical characteristics (conductivity and the Hall effect) measured along ingots within 1.6-300 K temperature range. The results were compared with characteristics of specimens grown following the similar program under normal conditions. At complete remelting under microgravitation one detected attributes of strong supercooling and spontaneous crystallization, as well as, of specimen resistance oscillation by its depth caused by N D modulation [ru

  12. Facile Hydrothermal Synthesis of Tellurium Nanostructures for Solar Cells

    Directory of Open Access Journals (Sweden)

    M. Panahi-Kalamuei

    2014-10-01

    Full Text Available Tellurium (Te nanostructures have been successfully synthesized via a simple hydrothermal methodfrom the reaction of a TeCl4 aqueous solution with thioglycolic acid (TGA as a reductant. TGA can be easily oxidized to the corresponding disulfide [SCH2CO2H]2, which in turn can reduce TeCl4 to Te. The obtained Te was characterized by XRD, SEM, EDS, and DRS. The effect of reducing agent on morphology and size of the products were also studied. Additionally, Te thin film was deposited on the FTO-TiO2 by Dr- blading then employed to solar cell application and measured open circuit voltage (Voc, short circuit current (Isc, and fill factor (FF were determined as well. The studies showed that particle morphology and sizes play crucial role on solar cell efficiencies.

  13. Tellurium adsorption on tungsten and molybdenum field emitters

    International Nuclear Information System (INIS)

    Collins, R.A.; Kiwanga, C.A.

    1977-01-01

    Studies of the adsorption of tellurium onto tungsten and molybdenum field emitters are described and the results obtained are compared with those obtained in previous work on the adsorption of silicon and selenium. The adsorption of Te onto W was found to be much more uniform than in the case of Se. Although Te is metallic in many of its properties its adsorptive behavior on field emitters is found to be similar to that of selenium and these adsorptive properties are basically common to all semiconductors. The most evident property of these adsorbates is that the work function and emission current decrease simultaneously at coverages of less than half a monolayer and the work function subsequently increases. (B.D.)

  14. Strong nonlinear photonic responses from microbiologically synthesized tellurium nanocomposites

    Science.gov (United States)

    Liao, K.-S.; Wang, Jingyuan; Dias, S.; Dewald, J.; Alley, N.J.; Baesman, S.M.; Oremland, R.S.; Blau, W.J.; Curran, S.A.

    2010-01-01

    A new class of nanomaterials, namely microbiologically-formed nanorods composed of elemental tellurium [Te(0)] that forms unusual nanocomposites when combined with poly(m-phenylenevinylene-co-2,5-dioctoxy-phenylenevinylene) (PmPV) is described. These bio-nanocomposites exhibit excellent broadband optical limiting at 532 and 1064 nm. Nonlinear scattering, originating from the laser induced solvent bubbles and microplasmas, is responsible for this nonlinear behavior. The use of bacterially-formed Te(0) when combined with an organic chemical host (e.g., PmPV) is a new green method of nanoparticle syntheses. This opens the possibilities of using unique, biologically synthesized materials to advance future nanoelectronic and nanophotonic applications. ?? 2009 Elsevier B.V. All rights reserved.

  15. Band structures in near spherical 138Ce

    Science.gov (United States)

    Bhattacharjee, T.; Chanda, S.; Bhattacharyya, S.; Basu, S. K.; Bhowmik, R. K.; Das, J. J.; Pramanik, U. Datta; Ghugre, S. S.; Madhavan, N.; Mukherjee, A.; Mukherjee, G.; Muralithar, S.; Singh, R. P.

    2009-06-01

    The high spin states of N=80138Ce have been populated in the fusion evaporation reaction 130Te( 12C, 4n) 138Ce at E=65 MeV. The γ transitions belonging to various band structures were detected and characterized using an array of five Clover Germanium detectors. The level scheme has been established up to a maximum spin and excitation energy of 23 ℏ and 9511.3 keV, respectively, by including 53 new transitions. The negative parity ΔI=1 band, developed on the 6536.3 keV 15 level, has been conjectured to be a magnetic rotation band following a semiclassical analysis and comparing the systematics of similar bands in the neighboring nuclei. The said band is proposed to have a four quasiparticle configuration of [πgh]⊗[. Other band structures are interpreted in terms of multi-quasiparticle configurations, based on Total Routhian Surface (TRS) calculations. For the low and medium spin states, a shell model calculation using a realistic two body interaction has been performed using the code OXBASH.

  16. Study On Analytical Methods Of Tellurium Content In Natriiodide (Na131I) Radiopharmaceutical Solution Produced In The Dalat Nuclear Reactor

    International Nuclear Information System (INIS)

    Vo Thi Cam Hoa; Duong Van Dong; Nguyen Thi Thu; Chu Van Khoa

    2007-01-01

    This report describes the practical methods for analyzing of Tellurium content in Na 131 I solution produced at the Dalat Nuclear Research Institute. We studied analytical methods to control Tellurium content in final Na 131 I solution product used in medical purposes by three methods such as: spot test, gamma spectrometric and spectrophotometric methods. These investigation results are shown that the spot test method is suitable for controlling Tellurium trace in the final product. This spot test can be determinate Tellurium trace less than 10 ppm and are used to quality control of Na 131 I solution using in medical application. (author)

  17. [Management of spontaneous pneumothorax: about 138 cases].

    Science.gov (United States)

    Habibi, Bouchra; Achachi, Leila; Hayoun, Sohaib; Raoufi, Mohammed; Herrak, Laila; Ftouh, Mustapha El

    2017-01-01

    Pneumothorax is a collection of air in the pleural cavity. We conducted a retrospective study of patients with spontaneous pneumothorax in the Department of Pneumology at the Ibn Sina Hospital in Rabat (2009-2011) with the aim to determine the epidemiological, clinical, radiological, therapeutic and evolutionary manifestation of spontaneous pneumothorax. The study involved 138 patients: 128 men and 10 women (17-83 years), with an average age of 44.5 +/- 17.4 years and sex ratio of 12/8. 81.2% of patients were smokers. Clinical symptomatology was chest pain (92%), dyspnea (60%). Chest radiograph showed total unilateral (110 cases); partial (10 cases); localized (6 cases); bilateral (4 cases); right (51.4%) or left (45.7%) PNO (pneumothorax). During our study period we found that 70% of patients had spontaneous primitive pneumothorax and 30% had PNO secondary to Chronic obstructive pulmonary disease (COPD) (44%) and pulmonary tuberculosis (TB) (39%). Initial management included patients hospitalization, chest drainage (95%), needle exsufflation (1%), rest and O 2 (4%). It enables the lung to stick to the chest wall within 10 days in 63% of patients. Evolution was favorable in 89% of patients. Immediate complications included: subcutaneous emphysema (5 cases); infection (6 cases) and 3 deaths (cardiorespiratory arrest). Late complications included: recurrences in 11.6%; the first recurrence occurred in 13 cases (chest drainage in 11 cases and oxygen therapy in 2 cases) while the second recurrence occurred in 3 cases (surgery). This study shows the role of chest drainage and monitoring in the management of pneumothorax to avoid complications and especially to prevent recurrences, with a possible need to resort to surgery.

  18. Statistical nuclear properties and synthesis of 138La

    Directory of Open Access Journals (Sweden)

    Kheswa B. V.

    2015-01-01

    Full Text Available The synthesis of the neutron deficient 138La nucleus has been a puzzle for a long time. It has not been clear whether it is produced through photodisintegration processes or neutrino induced reactions due to unavailability of experimental data for nuclear level densities and γ strength functions of 138,139La nuclei. In the present work these nuclear properties have been measured and are used to investigate the synthesis of 138La. The results support the neutrino interactions as a dominant production process for 138La.

  19. Near threshold electron impact ionization cross section for tellurium atoms

    International Nuclear Information System (INIS)

    Chipev, F.F.; Chernyshova, I.V.; Kontros, J.E.; Shpenik, O.B.

    2004-01-01

    Full text: Up today electron-impact ionization is one of the most intensively investigated processes in atomic and molecular physics [1]. These experiments however, are associated with difficulties: high temperatures and densities are required to produce atomic beams and monochromatic intensive electron beams. A crossed electron and atomic beams scattering geometry was employed to measure the ionization efficiency curve for tellurium atoms. Our electron spectrometer comprises two serially mounted hypocycloidal electron energy analyzers [2], the first being the monochromator and the second - the scattered electron analyzer. The whole spectrometer is immersed into the homogenous magnetic field. Great care was taken in selecting the value of the extracting potential at the electrode, mounted normally to the atomic beam direction. By careful choosing this potential as low as possible (∼1.4 V), its influence on the motion of the monochromatized electrons in the collision region was minimized and the full collection of the formed ions was reached. The atom beam was produced using a compact effusion source made of the stainless steel with a microchannel exit to minimise the angular divergency of the beam. The temperature of the microchannel plate was taken about 50 K higher than that of the metal vapour in the heated reservoir. This atomic beam source enabled to produce an atomic beam with the concentration of two orders of magnitude higher than that in the case of a standard effusion source. A typical value of the electron energy spread was 0.15 eV (FWHM) in the 0.1-15 eV energy range. The primary electron beam current was equal to 10 -7 A. Such values of electron energy spread and beam current for the primary electron beam passing through the collision chamber were chosen to provide identical conditions for carrying out all the measurements. The energy scale was calibrated with the accuracy of ± 0.05 eV. The measured ionization cross-section normalized to the results

  20. 22 CFR 138.205 - Professional and technical services.

    Science.gov (United States)

    2010-04-01

    ..., drafting of a legal document accompanying a bid or proposal by a lawyer is allowable. Similarly, technical... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.205... Activities by Own Employees § 138.205 Professional and technical services. (a) The prohibition on the use of...

  1. 22 CFR 138.300 - Professional and technical services.

    Science.gov (United States)

    2010-04-01

    ... and analysis directly applying any professional or technical discipline. For example, drafting or a... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 138.300... Activities by Other Than Own Employees § 138.300 Professional and technical services. (a) The prohibition on...

  2. 33 CFR 138.150 - Service of process.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Service of process. 138.150... Pollution (Vessels) § 138.150 Service of process. (a) When executing the forms required by this subpart... as its agent for service of process for purposes of this subpart and for receipt of notices of...

  3. 29 CFR 780.138 - Application of the general principles.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Application of the general principles. 780.138 Section 780.138 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR... principles. Some examples will serve to illustrate the above principles. Employees of a fruit grower who dry...

  4. Optimization of scintillator loading with the tellurium-130 isotope for long-term stability

    Science.gov (United States)

    Duhamel, Lauren; Song, Xiaoya; Goutnik, Michael; Kaptanoglu, Tanner; Klein, Joshua; SNO+ Collaboration

    2017-09-01

    Tellurium-130 was selected as the isotope for the SNO + neutrinoless double beta decay search, as 130Te decays to 130Xe via double beta decay. Linear alkyl benzene(LAB) is the liquid scintillator for the SNO + experiment. To load tellurium into scintillator, it is combined with 1,2-butanediol to form an organometallic complex, commonly called tellurium butanediol (TeBD). This study focuses on maximizing the percentage of tellurium loaded into scintillator and evaluates the complex's long-term stability. Studies on the effect of nucleation due to imperfections in the detector's surface and external particulates were employed by filtration and induced nucleation. The impact of water on the stability of TeBD complex was evaluated by liquid-nitrogen sparging, variability in pH and induced humidity. Alternative loading methods were evaluated, including the addition of stability-inducing organic compounds. Samples of tellurium-loaded scintillator were synthesized, treated, and consistently monitored in a controlled environment. It was found that the hydronium ions cause precipitation in the loaded scintillator, demonstrating that water has a detrimental effect on long-term stability. Optimization of loaded scintillator stability can contribute to the SNO + double beta decay search.

  5. Chemical Process for Treatment of Tellurium and Chromium Liquid Waste from I-131 Radioisotope Production

    International Nuclear Information System (INIS)

    Zainus-Salimin; Gunandjar; Dedy-Harsono; Hendro; Sugeng-Purnomo; Mohammad-Faruq; Zulfakhri

    2000-01-01

    The I-131 radioisotope is used in nuclear medicine for diagnosis and therapy. The I-131 radioisotope is produced by wet distillation at Bandung Nuclear Research Center and generated about 4,875 Itr of liquid waste containing 2,532.8 ppm of tellurium and 1,451.8 ppm chromium at pH 1. Considering its negative impact to the environment caused by toxic behaviour of tellurium and chromium, it is necessary to treat chemically that's liquid waste. The research of chemical treatment of tellurium and chromium liquid waste from I-131 radioisotope production has been done. The steps of process are involved of neutralisation with NaOH, coagulation-flocculation process for step I using Ca(OH) 2 coagulant for precipitation of sulphate, sulphite, oxalic, chrome Cr 3+ , and coagulation-flocculation process for step II using BaCI 2 coagulant for precipitation of chrome Cr 6+ and tellurium from the supernatant of coagulation in step I. The best result of experiment was achieved at 0.0161 ppm of chromium concentration on the supernatant from coagulation-flocculation of step I using 3.5 g Ca(OH) 2 for 100 ml of liquid waste, and 0.95 ppm of tellurium concentration on the final supernatant from coagulation-flocculation by of step II using 0.7 g BaCI 2 for supernatant from coagulation of step I. (author)

  6. Gamma Radiation Dosimetry Using Tellurium Dioxide Thin Film Structures

    Directory of Open Access Journals (Sweden)

    Olga Korostynska

    2002-08-01

    Full Text Available Thin films of Tellurium dioxide (TeO2 were investigated for γ-radiation dosimetry purposes. Samples were fabricated using thin film vapour deposition technique. Thin films of TeO2 were exposed to a 60Co γ-radiation source at a dose rate of 6 Gy/min at room temperature. Absorption spectra for TeO2 films were recorded and the values of the optical band gap and energies of the localized states for as-deposited and γ-irradiated samples were calculated. It was found that the optical band gap values were decreased as the radiation dose was increased. Samples with electrical contacts having a planar structure showed a linear increase in current values with the increase in radiation dose up to a certain dose level. The observed changes in both the optical and the electrical properties suggest that TeO2 thin film may be considered as an effective material for room temperature real time γ-radiation dosimetry.

  7. Enhancement of Au-Ag-Te contents in tellurium-bearing ore minerals via bioleaching

    Science.gov (United States)

    Choi, Nag-Choul; Cho, Kang Hee; Kim, Bong Ju; Lee, Soonjae; Park, Cheon Young

    2018-03-01

    The purpose of this study was to enhance the content of valuable metals, such as Au, Ag, and Te, in tellurium-bearing minerals via bioleaching. The ore samples composed of invisible Au and Au paragenesis minerals (such as pyrite, chalcopyrite, sphalerite and galena) in combination with tellurium-bearing minerals (hessite, sylvanite and Tellurobismuthite) were studied. Indigenous microbes from mine drainage were isolated and identified as Acidithiobacillus ferrooxidans, which were used in bioleaching after adaption to copper. The effect of the microbial adaption on the bioleaching performance was then compared with the results produced by the non-adaptive process. The microbial adaption enhanced the Au-Ag-Te contents in biological leaching of tellurium-bearing ore minerals. This suggests that bioleaching with adapted microbes can be used both as a pretreatment and in the main recovery processes of valuable metals.

  8. Status of tellurium--hastelloy N studies in molten fluoride salts

    International Nuclear Information System (INIS)

    Keiser, J.R.

    1977-10-01

    Tellurium, which is a fission product in nuclear reactor fuels, can embrittle the surface grain boundaries of nickel-base structural materials. This report summarizes results of an experimental investigation conducted to understand the mechanism and to develop a means of controlling this embrittlement in the alloy Hastelloy N. The addition of a chromium telluride to salt can be used to provide small partial pressures of tellurium simulating a reactor environment where tellurium appears as a fission product. The intergranular embrittlement produced in Hastelloy N when exposed to this chromium telluride-salt mixture can be reduced by adding niobium to the Hastelloy N or by controlling the oxidation potential of the salt in the reducing range

  9. Selective floatation-spectrophotometric determination of tellurium (4) with papaverine and butyl rhodamine B

    International Nuclear Information System (INIS)

    Skripchuk, V.G.

    1981-01-01

    It is shown, that papaverine reacts with a bromide complex of tellurium (4) to form a compound readily floated by toluene. The floatation is carried out from an aqueous solution, 5.2 M in H 2 SO 4 , 0.2 M in KBr and 5.4x10 -3 M in papaverine. The absorbance is a function of tellurium (4) concentration over a range of 5-100 μg Te/5 ml. Such a highly sensitive reagent as butylrhodamine B can be effectively substituted for papaverine. The floatation results in better selectivity. The method makes it possible to determine tellurium in blister, anodic and cathodic copper without matrix preseparation [ru

  10. The defects produced by electron irradiation in tellurium-doped germanium

    International Nuclear Information System (INIS)

    Fukuoka, Noboru; Saito, Haruo

    1989-01-01

    The nature of the irradiation induced defects in a germanium single crystal doped with tellurium was studied by DLTS and electrical measurements. The E c -0.21 eV level produced by irradiation with 1.5 MeV electrons was studied using the DLTS technique. It was found that the defect associated with this level is a divacancy. The E-center like defect (group V impurity-vacancy pair) introduces the E c -0.20 eV level in samples doped with a group V impurity. The level introduced by a tellurium (group VI impurity)-vacancy pair is deeper. The E c -0.16 eV level was generated by annealing at 430 K. A tellurium-vacancies complex is proposed as the defect associated with this level. (author)

  11. Determination of half life of tellurium isotopes: a proposal for the teaching of nuclear physics

    International Nuclear Information System (INIS)

    Ruivo, Julio C.; Zamboni, Cibele B.; Batista, Wagner F.

    2013-01-01

    This work aimed at the development of courseware for teaching nuclear physics, using experimental data of half-life measurement (T1/2) of Tellurium isotopes (A=127 and 131). The choice of Tellurium was established for providing nuclear data, which are fundamental in related investigations of nuclear structure and its use in various areas such as geochemistry, chemical and pharmaceutical industries, astrophysics etc. For evaluation of the proposal performance, the material was made available, bringing a lot of information about nuclear safety, production and storage of radioactive material and concepts of radioactive decay, subatomic particles, emission of gamma radiation, half-life, etc.

  12. Determination of half life of tellurium isotopes: a proposal for the teaching of nuclear physics

    Energy Technology Data Exchange (ETDEWEB)

    Ruivo, Julio C.; Zamboni, Cibele B.; Batista, Wagner F., E-mail: julio.ruivo.costa@usp.br, E-mail: czamboni@ipen.br, E-mail: fisicawagner@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    This work aimed at the development of courseware for teaching nuclear physics, using experimental data of half-life measurement (T1/2) of Tellurium isotopes (A=127 and 131). The choice of Tellurium was established for providing nuclear data, which are fundamental in related investigations of nuclear structure and its use in various areas such as geochemistry, chemical and pharmaceutical industries, astrophysics etc. For evaluation of the proposal performance, the material was made available, bringing a lot of information about nuclear safety, production and storage of radioactive material and concepts of radioactive decay, subatomic particles, emission of gamma radiation, half-life, etc.

  13. Electrochemical and antimicrobial activity of tellurium oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Pramod K. [Department of Applied Sciences and Humanities, Jamia Millia Islamia, New Delhi 110067 (India); Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India); Sharma, Prem Prakash; Sharma, Anshu [Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India); Khan, Zishan H., E-mail: zishan_hk@yahoo.co.in [Department of Applied Sciences and Humanities, Jamia Millia Islamia, New Delhi 110067 (India); Solanki, Pratima R., E-mail: pratimarsolanki@gmail.com [Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India)

    2016-09-15

    Highlights: • TeO{sub 2} NPs synthesized without using any catalyst by chemical vapour deposition method. • The growth temperature was 410 °C with continuous flow of O{sub 2.} • TeO{sub 2} NPs have anti-bacterial activity against E. coli, K. pneumoniae and S. aureus while enhances the growth of S. pyogenes. • TeO{sub 2} shows maximum redox current at pH 7 for phosphate buffer solution. - Abstract: Thin film of tellurium oxide (TeO{sub 2}) has been synthesized by chemical vapour deposition method onto indium tin oxide (ITO) coated glass substrate without using any catalyst. XRD pattern of TeO{sub 2} thin film suggests that the structure of TeO{sub 2} changes from amorphous to crystalline (paratellurite) on dispersing into deionized water. Zeta potential measurement reveals a positive surface potential of 28.8 mV. TEM images shows spherical shaped TeO{sub 2} nanoparticles having average particle size of 65 nm. Electrochemical studies of TeO{sub 2}/ITO electrode exhibit improved electron transfer owing to its inherent electron transfer property at pH 7.0 of phosphate buffer. Antimicrobial activity of TeO{sub 2} has been studied for gram-positive (Staphylococcus aureus and Streptococcus pyogenes) and gram negative (Escherichia coli and Klebsiella pneumoniae) bacterial and fungal strains (Aspergillus nizer and Candida albicans). These studies suggest that the TeO{sub 2} NPs inhibit the growth of E. coli, K. pneumoniae and S. aureus bacteria, whereas the same particles enhance the growth of S. pyogenes bacteria.

  14. Absolute densities in exoplanetary systems. Photodynamical modelling of Kepler-138.

    Science.gov (United States)

    Almenara, J. M.; Díaz, R. F.; Dorn, C.; Bonfils, X.; Udry, S.

    2018-04-01

    In favourable conditions, the density of transiting planets in multiple systems can be determined from photometry data alone. Dynamical information can be extracted from light curves, providing modelling is done self-consistently, i.e. using a photodynamical model, which simulates the individual photometric observations instead of the more generally used transit times. We apply this methodology to the Kepler-138 planetary system. The derived planetary bulk densities are a factor of two more precise than previous determinations, and we find a discrepancy in the stellar bulk density with respect to a previous study. This leads, in turn, to a discrepancy in the determination of masses and radii of the star and the planets. In particular, we find that interior planet, Kepler-138 b, has a size in between Mars and the Earth. Given our mass and density estimates, we characterize the planetary interiors using a generalized Bayesian inference model. This model allows us to quantify for interior degeneracy and calculate confidence regions of interior parameters such as thicknesses of the core, the mantle, and ocean and gas layers. We find that Kepler-138 b and Kepler-138 d have significantly thick volatile layers, and that the gas layer of Kepler-138 b is likely enriched. On the other hand, Kepler-138 c can be purely rocky.

  15. Magnetic resonance force microscopy quantum computer with tellurium donors in silicon.

    Science.gov (United States)

    Berman, G P; Doolen, G D; Hammel, P C; Tsifrinovich, V I

    2001-03-26

    We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines well-developed silicon technology and expected advances in MRFM. Our proposal does not use electrostatic gates to realize quantum logic operations.

  16. Magnetic Resonance Force Microscopy Quantum Computer with Tellurium Donors in Silicon

    International Nuclear Information System (INIS)

    Berman, G. P.; Doolen, G. D.; Hammel, P. C.; Tsifrinovich, V. I.

    2001-01-01

    We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines well-developed silicon technology and expected advances in MRFM. Our proposal does not use electrostatic gates to realize quantum logic operations

  17. Electric field fluctuations in liquid tellurium alloys a hint to bond character

    NARCIS (Netherlands)

    Paulick, C.A.; Brinkmann, R.; Elwenspoek, Michael Curt; von Hartrott, M.; Kiehl, M.; Maxim, P.; Quitmann, D.

    1985-01-01

    Atomic scale electric field fluctuations in liquid tellurium alloys are detected as they induce nuclear spin relaxation rate RQ in noble gas impurity atoms, via quadrupolar interaction. Results for Xe in liquid Ag, Ga, In, Tl, Ge, Sn---Te alloys are discussed, assuming that bonding in these alloys

  18. Subnanosecond pulse measurements of 10.6 μm radiation with tellurium

    NARCIS (Netherlands)

    Haselhoff, E.H.; Bonnie, R.J.M.; Ernst, G.J.; Witteman, W.J.

    1988-01-01

    Subnanosecond infrared pulses have been measured by noncollinear secondharmonic generation in tellurium. The method is very practical because due to the high refractive index the fine tuning of the phase matching is easily obtained by rotating the crystal around the optic axis.

  19. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery.

    Science.gov (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric

    2017-04-01

    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

  20. Thermoelectric properties of electrodeposited tellurium films and the sodium lignosulfonate effect

    International Nuclear Information System (INIS)

    Abad, Begoña; Rull-Bravo, Marta; Hodson, Stephen L.; Xu, Xianfan; Martin-Gonzalez, Marisol

    2015-01-01

    The effect of the addition of a surfactant, sodium lignosulfonate (SLS), on the thermoelectric properties of tellurium films prepared by electrochemical deposition is studied. The growth mechanism is found to have an important role in the thermoelectric properties since the grain size of the films is sharply reduced when the surfactant is added to the solution. For this reason, the electrical resistivity of the tellurium films when the surfactant is not added is 229 μΩ·m, which is lower than 798 μΩ·m with SLS. The Seebeck coefficient values are not influenced, with values in the vicinity of 285 μV/K for both solutions. The power factor resulted higher values than previous works, reaching values of 280 μW/m·K 2 (without SLS) and 82 μW/m·K 2 (with SLS) at room temperature. Finally, the thermal conductivity was measured by means of the Photoacoustic technique, which showed values of the order of 1 W/m·K for both solutions, which is a factor of 3 less than the bulk value of tellurium. A notable observation is that the power factor and the thermal conductivity of electrodeposited tellurium films have the same order of magnitude of bismuth telluride films grown by electrodeposition. The figure of merit is estimated to be approximately one order of magnitude higher than the bulk value, 0.09 without SLS and 0.03 with SLS, both at room temperature

  1. Determination of spins and radioactive widths of tellurium nuclear levels with capturre gamma rays

    International Nuclear Information System (INIS)

    Bianchini, F.G.

    1973-01-01

    Spins and levels widths of the tellurium, mainly 128 Te and 130 Te, were determinated by gamma spectroscopy. Measurements of inelastic and elastic scattering, angular distribution and scattering temperature dependence, were still made. Energy levels of this isotopes, were also determinated [pt

  2. Simultaneous determination of selenium and tellurium in native sulfur by atomic absorption spectrophotometry

    International Nuclear Information System (INIS)

    Arikawa, Yoshiko; Hirai, Shoji; Ozawa, Takejiro.

    1979-01-01

    A method for the determination of selenium and tellurium in native sulfur has been investigated by means of atomic absorption spectrophotometry. Native sulfur collected from around fumarole or volcanic crater is ground down into powder, a portion of which weighing 1 g is subjected to analysis. A 2.6% (w/v) sodium hydroxide solution is added by 10 ml to the sample in a teflon beaker, and the mixture is then heated on a hot plate. Sulfur is decomposed and dissolved in the form of disulfide and thiosulfate. A 30% hydrogenperoxide solution is added by 10 ml to oxidize them to sulfate. At the same time selenium and tellurium contained in the sulfur sample are also thought to be oxidized to Se(VI) and Te(VI) states. The solution is neutralized with hydrochloric acid and diluted with distilled water to 100 ml. The sample solution thus prepared is sprayed into the air-acetylene flame of the atomic absorption spectrophotometer. The absorbance is measured at 195.9 nm for selenium and 214.2 nm for tellurium. Calibration curve is prepared by measuring the absorbances of the solutions prepared as follows. One gram portions of pure sulfur (99.9999%) are decomposed as for the samples. After neutralization, standard solutions containing each same amount of selenium and tellurium (0 -- 1000 μg) are added to the sulfur solution and then diluted with water to 100 ml. The standard deviations were estimated to be 50.4 ppm for selenium at 756 ppm and 16.6 ppm for tellurium at 587 ppm. For the check of the reliability of the method, results were compared with those obtained by neutron activation analysis. Results obtained by both methods showed good agreement. (author)

  3. 40 CFR 86.138-96 - Hot soak test.

    Science.gov (United States)

    2010-07-01

    ....138-96 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... preparation for the hot soak test. (2) Gaseous-fueled vehicles. Since gaseous-fueled vehicles are not required.... (iii) Fresh impingers shall be installed in the methanol sample collection system immediately prior to...

  4. 42 CFR 480.138 - Disclosure for other specified purposes.

    Science.gov (United States)

    2010-10-01

    ...) General requirements for disclosure. Except as specified in paragraph (b) of this section, the following... information is necessary to protect against a substantial risk to the public health. (3) Disclosure to the... 42 Public Health 4 2010-10-01 2010-10-01 false Disclosure for other specified purposes. 480.138...

  5. 7 CFR 457.138 - Grape crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... types, in the county for which a premium rate is provided by the actuarial documents: (a) In which you... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.138 Grape crop insurance... avoirdupois. Type. A category of grapes (one or more varieties) identified as a type in the Special Provisions...

  6. Large-scale synthesis of Tellurium nanostructures via galvanic displacement of metals

    Science.gov (United States)

    Kok, Kuan-Ying; Choo, Thye-Foo; Ubaidah Saidin, Nur; Rahman, Che Zuraini Che Ab

    2018-01-01

    Tellurium (Te) is an attractive semiconductor material for a wide range of applications in various functional devices including, radiation dosimeters, optical storage materials, thermoelectric or piezoelectric generators. In this work, large scale synthesis of tellurium (Te) nanostructures have been successfully carried out in different concentrations of aqueous solutions containing TeO2 and NaOH, by galvanic displacements of Zn and Al which served as the sacrificial materials. Galvanic displacement process is cost-effective and it requires no template or surfactant for the synthesis of nanostructures. By varying the concentrations of TeO2 and NaOH, etching temperatures and etching times, Te nanostructures of various forms of nanostructures were successfully obtained, ranging from one-dimensional needles and rod-like structures to more complex hierarchical structures. Microscopy examinations on the nanostructures obtained have shown that both the diameters and lengths of the Te nanostructures increased with increasing etching temperature and etching time.

  7. Equilibrium state of delta-phase with tellurium in the Sb-Bi-Te system

    International Nuclear Information System (INIS)

    Gajgukova, V.S.; Dudkin, L.D.; Erofeev, R.S.; Musaelyan, V.V.; Nadzhip, A.Eh.; Sokolov, O.B.

    1978-01-01

    A research has been carried out with a view to establish the equilibrium state of delta-phase of the composition (Sbsub(1-x)Bisub(x)) 2 Te 3 with tellurium, depending on x and temperature. The Hall effect, the thermoelectromotive force, and the electric conductivity of the samples of Sb-Bi-Te alloys have been measured, the samples being annealed at various temperatures (550 to 250 deg C). The measurement results have shown that as the Bi 2 Te 3 content in the solid solutions increases and temperature decreases, the delta-phase-Te boundary monotonously approaches the stoichiometric composition. Using the research carrid out as the basis, the general character of the equilibrium delta-phase with tellurium boundary has been rendered more precise in Sb-Bi-Te system, depending on the temperature and Bi content (up to 25 at.%)

  8. GALVANIC MAGNETIC PROPERTIES OF BISMUTH THIN FILMS DOPED WITH TELLURIUM MADE BY THERMAL VACUUM EVAPORATION

    Directory of Open Access Journals (Sweden)

    V. A. Komarov

    2013-01-01

    Full Text Available The influence of n-type impurity of tellurium (concentration range from 0.005 atomic % Te to 0.15 atomic % Te on galvanic magnetic properties (resistivity, magnetic resistance and Hall constant of Bi thin films with various thicknesses was studied. The properties were measured in temperature range from 77 to 300 K. It was established that the classical size effect in the films is significant and decreases with higher concentration of Te impurity. The analysis of experimental results was carried out in approximation of the law of Jones-Schoenberg dispersion for Bi films doped with tellurium. Calculation of concentration and mobility of charge carriers in the studied films was made.

  9. The dependence of the texture of tellurium thin films on vacuum deposition angle

    International Nuclear Information System (INIS)

    Cocks, F.H.; Peterson, M.J.; Jones, P.L.

    1980-01-01

    Vacuum-deposited tellurium thin films can show substantially different surface morphologies depending on the angle with which the vapor stream impinges on the substrate surface. These tellurium thin films have a tendency to grow as acicular crystallites but as the deposition angle is increased so that the vapor stream becomes tangential to the substrate surface the spacing between crystallites increases and approaches, at stream angles of approximately 80 0 from the normal, dimensions roughly once or twice the average wavelength of visible light. Such films may have application in solar energy collector systems because of the high absorptivity of sunlight shown by such films. Mechanisms which describe the tendency for crystallite spacing to increase with increasing angle are discussed. (Auth.)

  10. Acousto-optic measurements of ultrasound attenuation in tellurium dioxide crystal

    International Nuclear Information System (INIS)

    Voloshinov, V. B.; Lemyaskina, E. A.

    1996-01-01

    The paper is devoted to experimental investigation of ultrasound propagation in tellurium dioxide monocrystal. In particular, attenuation of slow shear acoustic modes in the crystal was measured. The measurements were performed by acousto-optic methods using probing of acoustic column by a laser beam. The paper describes measurements of acoustic attenuation coefficient for slow shear ultrasonic waves propagating at an angle =4.5 O with respect to the (110) direction in the (110) plane. The investigation was made at acoustic frequency f = 100 MHz with pulsed acoustic waves and with an optical beam of a He-Ne laser. It is found that the attenuation coefficient is α = 0.57 cm -1 ± 15 %. The attenuation at acoustic frequencies f ≥ 100 MHz influences performance characteristics of acousto-optical devices based on tellurium dioxide. As proved, spectral resolution of a quasicollinear acoustooptic filter decreases by a factor of 2 compared to a case of the attenuation absence. (authors)

  11. Evaluated phase diagrams of binary metal-tellurium systems of the D-block transition elements

    International Nuclear Information System (INIS)

    Chattopadhyay, G.; Bharadwaj, S.R.

    1989-01-01

    The binary phase diagrams of metal-tellurium systems for twenty seven d-block transition elements have been critically evaluated. Complete phase diagrams are presented for the elements, chromium, manganese, iron, cobalt, nickel, copper, molybdenum, palladium, silver, lanthanum, platinum and gold, whereas, for scandium, titanium, vanadium, yttrium, zirconium, niobium, technitium, ruthenium, rhodium, hafnium, tantalum, tungsten , rhenium, osmium and iridium, the phase diagrams are incomplete and tentative. (author). 20 refs., 27 tabs., 27 figs

  12. Exploring molecular and spin interactions of Tellurium adatom in reduced graphene oxide

    Energy Technology Data Exchange (ETDEWEB)

    Alegaonkar, Ashwini [Department of Chemistry, Savitribai Phule Pune University (Formerly University of Pune), Ganeshkhind, Pune, 411 007, MS (India); Alegaonkar, Prashant [Department of Applied Physics, Defence Institute of Advance Technology, Girinagar, Pune, 411 025, MS (India); Pardeshi, Satish, E-mail: skpar@chem.unipune.ac.in [Department of Chemistry, Savitribai Phule Pune University (Formerly University of Pune), Ganeshkhind, Pune, 411 007, MS (India)

    2017-07-01

    The transport of spin information fundamentally requires favourable molecular architecture and tunable spin moments to make the medium pertinent for spintronic. We report on achieving coherent molecular-spin parameters for rGO due to Tellurium (Te) adatom. Initially, GO prepared using graphite, was modified into rGO by in situ incorporation of 1 (w/w)% of Te. Both the systems were subjected to ESCA, FTIR, Raman dispersion, ESR spectroscopy, and electron microscopy. Analysis revealed that, Te substantially reacted with epoxides, carbonyl, and carboxylate groups that improved C-to-O ratio by twice. However, the spin splitting character, between Te and C, seems to be quenched. Moreover, Te altered the dynamical force constant between C-C and C=C that generated the mechanical stress within rGO network. The layer conjugation, nature of folding, symmetry, and electronic states of the edges were also affected by precipitation and entrapment of Te. The calculated dynamic molecular Raman and ESR spin parameters indicated that, Te acted as a bridging element for long range spin transport. This is particularly due to, the p-orbital moments of Te contributing, vectorially, to spin relaxation process operative at broken inversion symmetry sites. Our study suggests that, facile addition of Te in rGO is useful to achieve favourable spintronic properties. - Highlights: • Spin interactions and molecular dynamics modification due to Tellurium adatom in rGO. • Molecular level manipulation of Tellurium adatom for favourable spintronic properties. • Bychocov-Rashaba coupling are the operative channels in rGO. • Extrinsic coupling component get added vectorially by Tellurium. • Te-rGO is a viable medium for molecular spintronics.

  13. The effect of hydrostatic pressure on the anomalous sign reversal of the Hall coefficient in tellurium

    International Nuclear Information System (INIS)

    Balynas, V.; Dobrovolskis, Z.; Krotkus, A.; Hoerstel, W.

    1981-01-01

    In order to obtain information about the pressure behaviour of the higher lying second conduction band the dependences of the Hall coefficient of single crystalline tellurium on temperature (300 to 500 K) have been measured at atmospheric pressure and hydrostatic pressures of 500 and 800 MPa. The separation between the two conduction bands in Te decreases with increasing pressure. The anomalous sign reversal of the Hall coefficient can be well explained by a double-conduction band model

  14. Electrochemical characterization of the underpotential deposition of tellurium on Au electrode

    International Nuclear Information System (INIS)

    Zhu, W.; Yang, J.Y.; Zhou, D.X.; Bao, S.Q.; Fan, X.A.; Duan, X.K.

    2007-01-01

    Electrochemical characterization of the underpotential deposition (UPD) of tellurium on Au substrate has been performed in this paper. The mechanism of Te deposition and its voltammetry dependence on the Te ion concentration were studied, and it suggests that variations in the metal ion concentration may affect the UPD process kinetics. The effect of tellurium adsorbates on UPD behavior of Te has also been investigated. The results show that the tellurium adsorbates could be irreversibly adsorbed upon the Au substrate surface under the open-circuit conditions. Subsequent removal of the Te adsorbates was also proved to be very difficult within the Au double-layer region, and a standard electrochemical cleaning procedure is necessary to remove the Te adsorbates completely. When the potential was cycled into the Au oxidation region, a substantial loss of Te adsobates was observed, which occurs simultaneously with the Au oxidation features. Scan rate dependent cyclic voltammetry experiments reveal that the peak current in the Te UPD peak is not a linear function of the scan rate, ν, but of a 2/3 power of the scan rate, ν 2/3 . It is in good consistent with a two-dimension nucleation and growth mechanism

  15. Iodine-129 in thyroids and tellurium isotopes in meteorites by neutron activation analysis

    International Nuclear Information System (INIS)

    Ballad, R.V.

    1978-06-01

    A combination of neutron activation and mass spectrometry has been used to determine the concentration of fissiogenic 129 I and the value of the 129 I/ 127 I ratio in thyroids of man, cow, and deer from Missouri. Deer thyroids show an average value of 129 I/ 127 I = 1.8 x 10 -8 and an average concentration of 3 x 10 -3 pCi 129 I per gram of thyroid (wet weight). Thyroids of cows and humans show successively lower values for the 129 I/ 127 I ratio and the 129 I content because their diets dilute fission-produced 129 I in the natural iodine cycle with mineral iodine. The results of analyses on a few thyroids from other geographic areas are also reported. The isotopic compositions of tellurium, krypton, and xenon were determined in acid-resistant residues of the Allende meteorite. Neutron activation and γ-counting were used to determine the relative abundances of six tellurium isotopes, and mass spectrometry was used to determine the isotopic compositions of krypton and xenon in aliquots of the same residues. Nucleogenetic anomalies were observed in the isotopic compositions of these three elements. The presence of isotopically distinct components of tellurium, krypton, and xenon in these residues provides strong support for the suggestion that our solar system formed directly from the debris of a supernova

  16. Hydrogen-assisted post-growth substitution of tellurium into molybdenum disulfide monolayers with tunable compositions

    Science.gov (United States)

    Yin, Guoli; Zhu, Dancheng; Lv, Danhui; Hashemi, Arsalan; Fei, Zhen; Lin, Fang; Krasheninnikov, Arkady V.; Zhang, Ze; Komsa, Hannu-Pekka; Jin, Chuanhong

    2018-04-01

    Herein we report the successful doping of tellurium (Te) into molybdenum disulfide (MoS2) monolayers to form MoS2x Te2(1-x) alloy with variable compositions via a hydrogen-assisted post-growth chemical vapor deposition process. It is confirmed that H2 plays an indispensable role in the Te substitution into as-grown MoS2 monolayers. Atomic-resolution transmission electron microscopy allows us to determine the lattice sites and the concentration of introduced Te atoms. At a relatively low concentration, tellurium is only substituted in the sulfur sublattice to form monolayer MoS2(1-x)Te2x alloy, while with increasing Te concentration (up to ˜27.6% achieved in this study), local regions with enriched tellurium, large structural distortions, and obvious sulfur deficiency are observed. Statistical analysis of the Te distribution indicates the random substitution. Density functional theory calculations are used to investigate the stability of the alloy structures and their electronic properties. Comparison with experimental results indicate that the samples are unstrained and the Te atoms are predominantly substituted in the top S sublattice. Importantly, such ultimately thin Janus structure of MoS2(1-x)Te2x exhibits properties that are distinct from their constituents. We believe our results will inspire further exploration of the versatile properties of asymmetric 2D TMD alloys.

  17. The characterisation of vapour-phase alkali metal-tellurium-oxygen species

    International Nuclear Information System (INIS)

    Gomme, R.A.; Ogden, J.S.; Bowsher, B.R.

    1986-10-01

    Detailed assessments of hypothetical severe accidents in light water reactors require the identification of the chemical forms of the radionuclides in order to determine their transport characteristics. Caesium and tellurium are important volatile fission products in accident scenarios. This report describes detailed studies to characterise the chemical species that vaporise from heated mixtures of various alkali metal-tellurium-oxygen systems. The molecular species were characterised by a combination of quadrupole mass spectrometry and matrix isolation-infrared spectroscopy undertaken in conjunction with experiments involving oxygen-18 substitution. The resulting spectra were interpreted in terms of a vapour-phase molecule with the stoichiometry M 2 TeO 3 (M = K,Rb,Cs) for M/Te molecular ratios of ∼ 2, and polymeric species for ratios < 2. This work has demonstrated the stability of caesium tellurite. The formation of this relatively low-volatility, water-soluble species could significantly modify the transport and release of caesium and tellurium. The data presented in this report should allow more comprehensive thermodynamic calculations to be undertaken that assist in the quantification of fission product behaviour during severe reactor accidents. (author)

  18. Influence of ion beam irradiation induced defects on the structural, optical and electrical properties of tellurium nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Narinder [Department of Physics, Chaudhary Devi Lal University, Sirsa, 125055 (India); Department of Physics, Haryana College of Technology & Management, Kaithal, 136027 (India); Kumar, Rajesh [Department of Physics, RN College of Engineering & Technology, Madlauda, 132104 (India); Kumar, Sushil, E-mail: sushil_phys@rediffmail.com [Department of Physics, Chaudhary Devi Lal University, Sirsa, 125055 (India); Chakarvarti, S.K. [Research and Development, Manav Rachana International University, Faridabad, 121001 (India)

    2016-11-01

    In this study, tellurium nanowires were electrodeposited into the polymer membranes from aqueous acidic bath containing HTeO{sub 2}{sup +} ions. The field emission scanning electron microscopy (FESEM) images confirmed the formation of uniform and straight nanowires. The influence of 110 MeV Ni{sup 8+} ion irradiation induced defects on the structural, optical and electrical properties of as–deposited tellurium nanowires were examined using X-ray diffraction (XRD), UV–visible absorption spectroscopy and current–voltage (I–V) measurements. The XRD data depicted the hexagonal phase of tellurium nanowires and further revealed a variation in the intensity of diffraction peaks of ion irradiated nanowires. Williamson–Hall (WH) analysis is used for convoluting the size and microstrain contributions to the width of diffraction peaks. Tellurium nanowires exhibited a distinct absorbance band in the visible region at 686 nm, while this was absent in bulk tellurium. Electrical properties of nanowires are explored on the basis of I–V curves, which revealed a significant increase in the electrical conductivity of irradiated nanowires. A possible mechanism for the enhanced electrical conductivity is the increase in carrier concentration due to thermally excited defects. The defects produced by ion irradiation play a vital role in modifying the properties of semiconducting nanowires. - Highlights: • 110 MeV Ni{sup 8+} ion beam induced changes in tellurium nanowires have been examined. • Nanowires were prepared using template electrodeposition method. • Irradiation improved the electrical conductivity of tellurium nanowires. • Mechanism for enhanced electrical conductivity of irradiated nanowires was discussed.

  19. Structural and decay properties of Z = 132, 138 superheavy nuclei

    Energy Technology Data Exchange (ETDEWEB)

    Rather, Asloob A.; Ikram, M.; Usmani, A.A. [Aligarh Muslim University, Department of Physics, Aligarh (India); Kumar, Bharat; Patra, S.K. [Institute of Physics, Bhubaneswar (India); Homi Bhabha National Institute, Mumbai, Anushakti Nagar (India)

    2016-12-15

    In this paper, we analyze the structural properties of Z = 132 and Z = 138 superheavy nuclei within the ambit of axially deformed relativistic mean-field framework with NL3* parametrization and calculate the total binding energies, radii, quadrupole deformation parameter, separation energies, density distributions. We also investigate the phenomenon of shape coexistence by performing the calculations for prolate, oblate and spherical configurations. For clear presentation of nucleon distributions, the two-dimensional contour representation of individual nucleon density and total matter density has been made. Further, a competition between possible decay modes such as α-decay, β-decay and spontaneous fission of the isotopic chain of superheavy nuclei with Z = 132 within the range 312 ≤ A ≤ 392 and 318 ≤ A ≤ 398 for Z = 138 is systematically analyzed within self-consistent relativistic mean-field model. From our analysis, we inferred that the α-decay and spontaneous fission are the principal modes of decay in majority of the isotopes of superheavy nuclei under investigation apart from β-decay as dominant mode of decay in {sup 318-322}138 isotopes. (orig.)

  20. First example of a high-level correlated calculation of the indirect spin-spin coupling constants involving tellurium

    DEFF Research Database (Denmark)

    Rusakov, Yury Yu; Krivdin, Leonid B.; Østerstrøm, Freja From

    2013-01-01

    This paper documents a very first example of a high-level correlated calculation of spin-spin coupling constants involving tellurium taking into account relativistic effects, vibrational corrections and solvent effects for the medium sized organotellurium molecules. The 125Te-1H spin-spin coupling...... constants of tellurophene and divinyl telluride were calculated at the SOPPA and DFT levels in a good agreement with experiment. A new full-electron basis set av3z-J for tellurium derived from the "relativistic" Dyall's basis set, dyall.av3z, and specifically optimized for the correlated calculations...... of spin-spin coupling constants involving tellurium, was developed. The SOPPA methods show much better performance as compared to 15 those of DFT, if relativistic effects calculated within the ZORA scheme are taken into account. Vibrational and solvent corrections are next to negligible, while...

  1. Site-specific nucleation and controlled growth of a vertical tellurium nanowire array for high performance field emitters

    International Nuclear Information System (INIS)

    Safdar, Muhammad; Zhan Xueying; Mirza, Misbah; Wang Zhenxing; Sun Lianfeng; He Jun; Niu Mutong; Zhang Jinping; Zhao Qing

    2013-01-01

    We report the controlled growth of highly ordered and well aligned one-dimensional tellurium nanostructure arrays via a one-step catalyst-free physical vapor deposition method. The density, size and fine structures of tellurium nanowires are systematically studied and optimized. Field emission measurement was performed to display notable dependence on nanostructure morphologies. The ordered nanowire array based field emitter has a turn-on field as low as 3.27 V μm −1 and a higher field enhancement factor of 3270. Our finding offers the possibility of controlling the growth of tellurium nanowire arrays and opens up new means for their potential applications in electronic devices and displays. (paper)

  2. Design of portable electrocardiogram device using DSO138

    Science.gov (United States)

    Abuzairi, Tomy; Matondang, Josef Stevanus; Purnamaningsih, Retno Wigajatri; Basari, Ratnasari, Anita

    2018-02-01

    Cardiovascular disease has been one of the leading causes of sudden cardiac deaths in many countries, covering Indonesia. Electrocardiogram (ECG) is a medical test to detect cardiac abnormalities by measuring the electrical activity generated by the heart, as the heart contracts. By using ECG, we can observe anomaly at the time of heart abnormalities. In this paper, design of portable ECG device is presented. The portable ECG device was designed to easily use in the village clinic or houses, due to the small size device and other benefits. The device was designed by using four units: (1) ECG electrode; (2) ECG analog front-end; (3) DSO138; and (4) battery. To create a simple electrode system in the portable ECG, 1-lead ECG with two electrodes were applied. The analog front-end circuitry consists of three integrated circuits, an instrumentation amplifier AD820AN, a low noise operational amplifier OPA134, and a low offset operational amplifier TL082. Digital ECG data were transformed to graphical data on DSO138. The results show that the portable ECG is successfully read the signal from 1-lead ECG system.

  3. Intergranular tellurium cracking of nickel-based alloys in molten Li, Be, Th, U/F salt mixture

    Science.gov (United States)

    Ignatiev, Victor; Surenkov, Alexander; Gnidoy, Ivan; Kulakov, Alexander; Uglov, Vadim; Vasiliev, Alexander; Presniakov, Mikhail

    2013-09-01

    In Russia, R&D on Molten Salt Reactor (MSR) are concentrated now on fast/intermediate spectrum concepts which were recognized as long term alternative to solid fueled fast reactors due to their attractive features: strong negative feedback coefficients, easy in-service inspection, and simplified fuel cycle. For high-temperature MSR corrosion of the metallic container alloy in primary circuit is the primary concern. Key problem receiving current attention include surface fissures in Ni-based alloys probably arising from fission product tellurium attack. This paper summarizes results of corrosion tests conducted recently to study effect of oxidation state in selected fuel salt on tellurium attack and to develop means of controlling tellurium cracking in the special Ni-based alloys recently developed for molten salt actinide recycler and tranforming (MOSART) system. Tellurium corrosion of Ni-based alloys was tested at temperatures up to 750 °C in stressed and unloaded conditions in molten LiF-BeF2 salt mixture fueled by about 20 mol% of ThF4 and 2 mol% of UF4 at different [U(IV)]/[U(III)] ratios: 0.7, 4, 20, 100 and 500. Following Ni-based alloys (in mass%): HN80М-VI (Mo—12, Cr—7.6, Nb—1.5), HN80МТY (Mo—13, Cr—6.8, Al—1.1, Ti—0.9), HN80МТW (Mo—9.4, Cr—7.0, Ti—1.7, W—5.5) and ЕМ-721 (W—25.2, Cr—5.7, Ti—0.17) were used for the study in the corrosion facility. If the redox state the fuel salt is characterized by uranium ratio [U(IV)]/[U(III)] uranium intermetallic compounds and alloys with nickel and molybdenum. This leads to spontaneous behavior of alloy formation processes on the specimens' surface and further diffusion of uranium deep into the metallic phase. As consequence of this films of intermetallic compounds and alloys of nickel, molybdenum, tungsten with uranium are formed on the alloys specimens' surface, and intergranular corrosion does not take place. In the fuel salt with [U(IV)]/[U(III)] = 4-20 the potentials of uranium

  4. Continuous removal and recovery of tellurium in an upflow anaerobic granular sludge bed reactor

    Energy Technology Data Exchange (ETDEWEB)

    Mal, Joyabrata, E-mail: joyabrata2006@gmail.com [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Nancharaiah, Yarlagadda V. [Biofouling and Biofilm Processes Section, Water and Steam Chemistry Division, Bhabha Atomic Research Centre, Kalpakkam, 603102, Tamil Nadu (India); Homi Bhabha National Institute, Anushakti Nagar Complex, Mumbai 400094 (India); Maheshwari, Neeraj [CNRS UMR 7338, BMBI University de Technologie Compiegne, 60200 Compiegne (France); Hullebusch, Eric D. van [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Université Paris-Est, Laboratoire Géomatériaux et Environnement (LGE), EA 4508, UPEM, 77454, Marne-la-Vallée (France); Lens, Piet N.L. [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Department of Chemistry and Bioengineering, Tampere University of Technology, P.O-Box 541, Tampere (Finland)

    2017-04-05

    Highlights: • Tellurite bioreduction coupled to recovery of biogenic Te(0) nanocrystals. • First report on continuous tellurite removal in a UASB reactor. • Biogenic Te(0) was mainly associated with loosely-bound EPS of granular sludge. • Repeated exposure to tellurite caused compositional changes in the EPS matrix. - Abstract: Continuous removal of tellurite (TeO{sub 3}{sup 2−}) from synthetic wastewater and subsequent recovery in the form of elemental tellurium was studied in an upflow anaerobic granular sludge bed (UASB) reactor operated at 30 °C. The UASB reactor was inoculated with anaerobic granular sludge and fed with lactate as carbon source and electron donor at an organic loading rate of 0.6 g COD L{sup −1} d{sup −1}. After establishing efficient and stable COD removal, the reactor was fed with 10 mg TeO{sub 3}{sup 2−} L{sup −1} for 42 d before increasing the influent concentration to 20 mg TeO{sub 3}{sup 2−} L{sup −1}. Tellurite removal (98 and 92%, respectively, from 10 and 20 mg Te L{sup −1}) was primarily mediated through bioreduction and most of the removed Te was retained in the bioreactor. Characterization using XRD, Raman spectroscopy, SEM-EDX and TEM confirmed association of tellurium with the granular sludge, typically in the form of elemental Te(0) deposits. Furthermore, application of an extracellular polymeric substances (EPS) extraction method to the tellurite reducing sludge recovered up to 78% of the tellurium retained in the granular sludge. This study demonstrates for the first time the application of a UASB reactor for continuous tellurite removal from tellurite-containing wastewater coupled to elemental Te(0) recovery.

  5. Continuous reduction of tellurite to recoverable tellurium nanoparticles using an upflow anaerobic sludge bed (UASB) reactor.

    Science.gov (United States)

    Ramos-Ruiz, Adriana; Sesma-Martin, Juan; Sierra-Alvarez, Reyes; Field, Jim A

    2017-01-01

    According to the U.S. Department of Energy and the European Union, tellurium is a critical element needed for energy and defense technology. Thus methods are needed to recover tellurium from waste streams. The objectives of this study was to determine the feasibility of utilizing upflow anaerobic sludge bed (UASB) reactors to convert toxic tellurite (Te IV ) oxyanions to non-toxic insoluble elemental tellurium (Te 0 ) nanoparticles (NP) that are amendable to separation from aqueous effluents. The reactors were supplied with ethanol as the electron donating substrate to promote the biological reduction of Te IV . One reactor was additionally amended with the redox mediating flavonoid compound, riboflavin (RF), with the goal of enhancing the bioreduction of Te IV . Its performance was compared to a control reactor lacking RF. The continuous formation of Te 0 NPs using the UASB reactors was found to be feasible and remarkably improved by the addition of RF. The presence of this flavonoid was previously shown to enhance the conversion rate of Te IV by approximately 11-fold. In this study, we demonstrated that this was associated with the added benefit of reducing the toxic impact of Te IV towards the methanogenic consortium in the UASB and thus enabled a 4.7-fold higher conversion rate of the chemical oxygen demand. Taken as a whole, this work demonstrates the potential of a methanogenic granular sludge to be applied as a bioreactor technology producing recoverable Te 0 NPs in a continuous fashion. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Continuous removal and recovery of tellurium in an upflow anaerobic granular sludge bed reactor

    International Nuclear Information System (INIS)

    Mal, Joyabrata; Nancharaiah, Yarlagadda V.; Maheshwari, Neeraj; Hullebusch, Eric D. van; Lens, Piet N.L.

    2017-01-01

    Highlights: • Tellurite bioreduction coupled to recovery of biogenic Te(0) nanocrystals. • First report on continuous tellurite removal in a UASB reactor. • Biogenic Te(0) was mainly associated with loosely-bound EPS of granular sludge. • Repeated exposure to tellurite caused compositional changes in the EPS matrix. - Abstract: Continuous removal of tellurite (TeO 3 2− ) from synthetic wastewater and subsequent recovery in the form of elemental tellurium was studied in an upflow anaerobic granular sludge bed (UASB) reactor operated at 30 °C. The UASB reactor was inoculated with anaerobic granular sludge and fed with lactate as carbon source and electron donor at an organic loading rate of 0.6 g COD L −1 d −1 . After establishing efficient and stable COD removal, the reactor was fed with 10 mg TeO 3 2− L −1 for 42 d before increasing the influent concentration to 20 mg TeO 3 2− L −1 . Tellurite removal (98 and 92%, respectively, from 10 and 20 mg Te L −1 ) was primarily mediated through bioreduction and most of the removed Te was retained in the bioreactor. Characterization using XRD, Raman spectroscopy, SEM-EDX and TEM confirmed association of tellurium with the granular sludge, typically in the form of elemental Te(0) deposits. Furthermore, application of an extracellular polymeric substances (EPS) extraction method to the tellurite reducing sludge recovered up to 78% of the tellurium retained in the granular sludge. This study demonstrates for the first time the application of a UASB reactor for continuous tellurite removal from tellurite-containing wastewater coupled to elemental Te(0) recovery.

  7. A new tellurium-containing amphiphilic molecule induces apoptosis in HCT116 colon cancer cells.

    Science.gov (United States)

    Du, Peng; Saidu, Nathaniel Edward Bennett; Intemann, Johanna; Jacob, Claus; Montenarh, Mathias

    2014-06-01

    Chalcogen-based redox modulators over the years have attracted considerable attention as anti-cancer agents. New selenium- and tellurium-containing compounds with a polar head group and aryl-groups of various lengths have recently been reported as biologically active in several organisms. In the present study, we used the most active of the tellurium compound DP41, and its selenium counterpart DP31 to investigate their effects on the human cancer cell line HCT116. Cells were treated with DP41 or DP31 and the formation of superoxide radicals was determined using dihydroethidium. Cell cycle analysis and apoptosis was determined by cytofluorimetry. Proteins involved in ER signaling and apoptosis were determined by Western blot analysis and fluorescence microscopy. With 50μM of DP41, we observed an increase in O2(-) formation. There was, however, no such increase in O2(-) after treatment with the corresponding selenium compound under the same conditions. In the case of DP41, the production of O2(-) radicals was followed by an up-regulation of Nrf2, HO-1, phospho-eIF2α and ATF4. CHOP was also induced and cells entered apoptosis. Unlike the cancer cells, normal retinal epithelial ARPE-19 cells did not produce elevated levels of O2(-) radicals nor did they induce the ER signaling pathway or apoptosis. The tellurium-containing compound DP41, in contrast to the corresponding selenium compound, induces O2(-) radical formation and oxidative and ER stress responses, including CHOP activation and finally apoptosis. These results indicate that DP41 is a redox modulating agent with promising anti-cancer potentials. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Simultaneous analysis of arsenic, antimony, selenium and tellurium in environmental samples using hydride generation ICPMS

    International Nuclear Information System (INIS)

    Jankowski, L.M.; Breidenbach, R.; Bakker, I.J.I.; Epema, O.J.

    2009-01-01

    Full text: A quantitative method for simultaneous analysis of arsenic, antimony, selenium and tellurium in environmental samples is being developed using hydride generation ICPMS. These elements must be first transformed into hydride-forming oxidation states. This is particularly challenging for selenium and antimony because selenium is susceptible to reduction to the non-hydride-forming elemental state and antimony requires strong reducing conditions. The effectiveness of three reducing agents (KI, thiourea, cysteine) is studied. A comparison is made between addition of reducing agent to the sample and addition of KI to the NaBH 4 solution. Best results were obtained with the latter approach. (author)

  9. Effect of tellurium on viscosity and liquid structure of GaSb melts

    Energy Technology Data Exchange (ETDEWEB)

    Ji Leilei [School of Material Science and Engineering, Jinan University, Jinan 250022 (China); Geng Haoran [School of Material Science and Engineering, Jinan University, Jinan 250022 (China)], E-mail: mse_genghr@ujn.edu.cn; Sun Chunjing [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Teng Xinying; Liu Yamei [School of Material Science and Engineering, Jinan University, Jinan 250022 (China)

    2008-04-03

    The behavior of GaSb melt with tellurium addition was investigated using viscometer and differential scanning calorimetry (DSC). Normally, the viscosity of all melts measured decreased with the increasing temperature. However, anomalous transition points were observed in the temperature dependence of viscosity for Ga-Sb-Te system. Corresponded with the abnormal points on the viscosity-temperature curves, there were thermal effect peaks on the DSC curves. Furthermore, viscous activation energy and flow units of these melts and their structural features were discussed in this paper.

  10. Light-Induced Tellurium Enrichment on CdZnTe Crystal Surfaces Detected by Raman Spectroscopy

    International Nuclear Information System (INIS)

    Hawkins, Samantha A.; Villa-Aleman, Eliel; Duff, Martine C.; Hunter, Doug B.; Burger, Arnold; Groza, Michael; Buliga, Vladimir; Black, David R.

    2008-01-01

    CdZnTe (CZT) crystals can be grown under controlled conditions to produce high-quality crystals to be used as room-temperature radiation detectors. Even the best crystal growth methods result in defects, such as tellurium secondary phases, that affect the crystal's performance. In this study, CZT crystals were analyzed by micro-Raman spectroscopy. The growth of Te rich areas on the surface was induced by low-power lasers. The growth was observed versus time with low-power Raman scattering and was observed immediately under higher-power conditions. The detector response was also measured after induced Te enrichment.

  11. LIGHT INDUCED TELLURIUM ENRICHMENT ON CDZNTE CRYSTAL SURFACES DETECTED BY RAMAN SPECTROSCOPY

    International Nuclear Information System (INIS)

    Hawkins, S; Eliel Villa-Aleman, E; Martine Duff, M; Douglas Hunter, D

    2007-01-01

    Synthetic CdZnTe or 'CZT' crystals can be grown under controlled conditions to produce high quality crystals to be used as room temperature radiation detectors. Even the best crystal growth methods result in defects, such as tellurium secondary phases, that affect the crystal's performance. In this study, CZT crystals were analyzed by micro Raman spectroscopy. The growth of Te rich areas on the surface was induced by low powered lasers. The growth was observed versus time with low power Raman scattering and was observed immediately under higher power conditions. The detector response was also measured after induced Te enrichment

  12. Vaporization studies on elemental tellurium and selenium by Knudsen effusion mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Viswanathan, R., E-mail: rvis1953@gmail.com; Balasubramanian, R., E-mail: rbs@igcar.gov.in; Darwin Albert Raj, D., E-mail: darwinalbertraj1953@gmail.com; Sai Baba, M., E-mail: msb@igcar.gov.in; Lakshmi Narasimhan, T.S., E-mail: tslak@igcar.gov.in

    2014-08-01

    Highlights: • A detailed KEMS study of vaporization of elemental tellurium and selenium systems. • Clusters Te{sub i}(g) (i = 2 to 7) and Se{sub i}(g) (i = 2 to 9) identified over Te(s) and Se(s). • p–T relations for Te{sub i}(g) (590 to 690 K) and Se{sub i}(g) (380 to 480 K). • Vapor phase of Te dominated by Te{sub 2}(g) (∼95%) while that of Se by Se{sub 6}(g) (∼50%) and Se{sub 5}(g) (∼25%). • Sublimation and atomization enthalpies deduced for Te{sub i}(g) and Se{sub i}(g). - Abstract: Vaporization studies on elemental tellurium and selenium were conducted by Knudsen effusion mass spectrometry in the temperature range of 590–690 K and 380–480 K, respectively. The ionic species Te{sub i}{sup +} (i = 1–7) and Se{sub i}{sup +}(g) (i = 1–9) were detected in the mass spectra over these two condensed phases. Measurement of ion intensities were performed as a function of electron impact energy and as a function of temperature (at different electron impact energies) for identifying the gaseous precursor species as well as for determining the partial pressure–temperature relations and sublimation enthalpies for these species. While the major species over elemental tellurium was confirmed to be Te{sub 2}(g) (with all other gaseous species Te{sub 3}–Te{sub 7} put together constituting less than 5%), the major species over elemental selenium was found to be Se{sub 6}(g), closely followed by Se{sub 5}(g) (with other gaseous species Se{sub 2}–Se{sub 4} and Se{sub 7}–Se{sub 9} put together also moderately constituting ∼25%). From the partial pressures, the thermodynamic data for the sublimation reactions i Te(s) = Te{sub i}(g) and i Se(s) = Se{sub i}(g) were deduced by second- and third-law methods. The atomization enthalpies of tellurium and selenium clusters were also deduced by using the recommended enthalpies of formation of monomeric species. Comparison of the findings obtained in the present study with those in previous studies revealed

  13. Characterization of tellurium-based films for NO{sub 2} detection

    Energy Technology Data Exchange (ETDEWEB)

    Tsiulyanu, D. [Technical University, Department of Physics, bul. Dacia 41, MD-2060 Kishinau (Moldova, Republic of)]. E-mail: tsiu@cni.md; Tsiulyanu, A. [Technical University, Department of Physics, bul. Dacia 41, MD-2060 Kishinau (Moldova, Republic of); Liess, H.-D. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany); Eisele, I. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany)

    2005-08-01

    Sensing characteristics of tellurium-based thin films for NO{sub 2} monitoring was studied systematically. The influence of contact materials, thermal treatment, temperature and thickness of the samples on the electrical conductivity and sensitivity to NO{sub 2} with respect to scanning electron microscopy analyses is given. The possibility is shown to optimize the properties of the films for the development of a simple and stable NO{sub 2} sensor device with rapid response/recovery time and low operating temperature. The sensing mechanism is discussed for the direct interaction of gaseous species with lone-pair electrons of chalcogen atoms.

  14. Influence of the hydrolysis conditions on the properties of tellurium coatings obtained from hydrochloric acid baths

    International Nuclear Information System (INIS)

    Bigelis, V.M.; Kim, G.N.; Navalikhin, L.V.; Kalanov, M.; Abrarov, O.A.

    1982-01-01

    The structure of tellurium coatings has been studied using the methods of activational analysis on fast neutrons, roentgenography using DRON-2. The study is carried out in electrolyte 1N TeO 2 +6NHCl+2NH 2 SO 4 at the temperatures 25 and 95 deg C in the range of current densities 10-150 mA/cm 2 with and without mixing. Atomic content of chlorine and oxygen in deposite depending on the electrolyte work is determined. Nicrohardness, density, specific resistance of the coatings investigated are determined

  15. Test of irradiation of tellurium oxide for obtaining iodine-131 by dry distillation

    International Nuclear Information System (INIS)

    Alanis M, J.

    2003-07-01

    With the purpose of optimizing to the maximum independently the work of the reactor of those mathematical calculations of irradiation that are already optimized, now it corresponds to carry out irradiation tests in the different positions with their respective neutron fluxes that it counts the reactor for samples irradiation. Then, it is necessary to carry out the irradiation of the tellurium dioxide through cycles, with the purpose of observing the activity that it goes accumulating in each cycle and this way to obtain an activity of the Iodine-131 obtained when finishing the last cycle. (Author)

  16. 33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...

  17. 7 CFR 400.138 - Procedures for salary offset; methods of collection.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Procedures for salary offset; methods of collection. 400.138 Section 400.138 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL... Management-Regulations for the 1986 and Succeeding Crop Years § 400.138 Procedures for salary offset; methods...

  18. Complete genome sequence of an attenuated Sparfloxacin resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    Through selection of resistance to sparfloxacin, an attenuated Streptococcus agalactiae strain 138spar was obtained from its virulent parent strain S. agalactiae 138P. The full genome of S. agalactiae 138spar is 1,838,126 bp. The availability of this genome will allow comparative genomics to identi...

  19. Speciation analysis of tellurium by solid-phase extraction in the presence of ammonium pyrrolidine dithiocarbamate and inductively coupled plasma mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Chunhai; Cai, Qiantao; Guo, Zhong-Xian; Yang, Zhaoguang [Centre for Advanced Water Technology, Innovation Centre (NTU), Singapore (Singapore); Khoo, Soo Beng [Department of Chemistry, National University of Singapore (Singapore)

    2003-05-01

    Under acidic conditions tellurium(IV) formed a complex with ammonium pyrrolidine dithiocarbamate (APDC). The tellurium(IV) complex was completely retained on a non-polar Isolute silica-based octadecyl (C{sub 18}) sorbent-containing solid-phase extraction (SPE) cartridge, while the uncomplexed Te(VI) passed through the cartridge and remained as a free species in the solution. Only partial Te(IV) was retained on the SPE cartridge for samples without addition of APDC. On the basis of different retention behaviours of the complexed Te(IV) and uncomplexed Te(VI), a simple and highly sensitive method is proposed for the determination of total tellurium and Te(VI) by SPE separation and inductively coupled plasma mass spectrometry (ICP-MS) detection. The Te(IV) concentration was calculated as the difference between total tellurium and Te(VI) concentrations. The detection limit (3{sigma}) is 3 ng L{sup -1} tellurium. Factors affecting the separation and detection of tellurium species were investigated. Coexisting ions did not show significant interferences with the Te(IV)-APDC complex retention and the subsequent ICP-MS detection of Te. The method has been successfully applied to the tellurium speciation analysis in waters with spiked recoveries for Te(IV) and Te(VI) of 86.0-108% and 87.1-97.4%, respectively. (orig.)

  20. Resource recovery from urban stock, the example of cadmium and tellurium from thin film module recycling

    Energy Technology Data Exchange (ETDEWEB)

    Simon, F.-G., E-mail: franz-georg.simon@bam.de [BAM Federal Institute for Materials Research and Testing, Division 4.3 Contaminant Transfer and Environmental Technologies, Unter den Eichen 87, 12205 Berlin (Germany); Holm, O.; Berger, W. [BAM Federal Institute for Materials Research and Testing, Division 4.3 Contaminant Transfer and Environmental Technologies, Unter den Eichen 87, 12205 Berlin (Germany)

    2013-04-15

    Highlights: ► The semiconductor layer on thin-film photovoltaic modules can be removed from the glass-plate by vacuum blast cleaning. ► The separation of blasting agent and semiconductor can be performed using flotation with a valuable yield of 55%. ► PV modules are a promising source for the recovery of tellurium in the future. - Abstract: Raw material supply is essential for all industrial activities. The use of secondary raw material gains more importance since ore grade in primary production is decreasing. Meanwhile urban stock contains considerable amounts of various elements. Photovoltaic (PV) generating systems are part of the urban stock and recycling technologies for PV thin film modules with CdTe as semiconductor are needed because cadmium could cause hazardous environmental impact and tellurium is a scarce element where future supply might be constrained. The paper describes a sequence of mechanical processing techniques for end-of-life PV thin film modules consisting of sandblasting and flotation. Separation of the semiconductor material from the glass surface was possible, however, enrichment and yield of valuables in the flotation step were non-satisfying. Nevertheless, recovery of valuable metals from urban stock is a viable method for the extension of the availability of limited natural resources.

  1. Ecological aspects of selenium and tellurium in human and animal health

    Energy Technology Data Exchange (ETDEWEB)

    Frost, D V; Ingvoldstad, D

    1975-01-01

    Animal and human studies indicate that selenium inadequacy, in part, underlies various chronic diseases. Epidemiologic evidence suggests that cancer and heart disease are most common where ambient Se availability is low. Plant Se uptake and Se blood levels are inverse to human cancer mortality. As the active group in glutathione peroxidase, Se/sup -2/ inhibits aberrant oxidations which lead to chronic diseases. It binds heavy metals, and with tocopherol maintains tissue integrity. Sulfur dioxide fallout from the atmosphere, resulting from fossil fuel burning, may diminish the nutritional availability of selenium by diminishing plant uptake. Intensive ruminant grazing returns unavailable Se/sup 0/ to soils. Trimethyl selenium ion, as excreted by animals, also appears to be unavailable to plants. Modern fertilization practices and the effect of buildup of sulfates in the soil, due to acid rains, both appear to lessen the availability of Se to plants. SeO/sub 2/ added to the atmosphere from combustion and volcanic activity react with SO/sub 2/ to yield Se/sup 0/. This is presumed to fall out as particles from the air. How traces of Se are otherwise carried in air, explaining its enrichment in some areas, is unknown. The New Zealand experience with Se inadequacy in animals and man may be repeated in other parts of the world. Se inadequacy is far more of a human health problem than Se toxicity. There are no known adverse health effects from tellurium, other than tellurium breath. 164 references, 5 figures, 3 tables.

  2. Catalytic activity of oxide cerium-molybdenum-tellurium catalysts in oxidation ammonolysis

    International Nuclear Information System (INIS)

    Dzhordano, N.; Bart, D.; Madzhori, R.

    1984-01-01

    A commercial catalyst containing a mixture of Ce-, Mo-, Te oxides deposited on SiO 2 is shown to manifest a high efficiency in oxidative ammonolysis of propylene (C 3 - ) to acrylonitrile (AN). The dependence of the catalytic properties on the catalyst composition and reaction conditions is studied. It is established that three-component mixtures are more active and selective than the systems with a lesser number of components. Using the catalyst with the optimum ratio of constituent oxides in a microreactor at 440 deg enabled one to achieve initial selectivity in terms of AN equal to 82.5% at 97% conversion of C 3 - . Acrolein, acetonitrile, HCN and nitrogen oxides are the reaction by-products. A supposition is made that the reaction proceeds via the formation of π-compleXes on the centres of Te(4). Setective oxidation occurs on oxygen atoms bonded with the Mo(6) ions. Tellurium enhances the molybdenum reducibleness due to delocalization of electrons, whereas the cerium addition to the mixture of tellurium- and molybdenum oxides increases the rate of molybdenum reoxidation and thus enhances the catalytic system stability

  3. Determination of tellurium by hydride generation with in situ trapping flame atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Matusiewicz, H.; Krawczyk, M. [Politechn Poznanska, Poznan (Poland)

    2007-03-15

    The analytical performance of coupled hydride generation - integrated atom trap (HG-IAT) atomizer flame atomic absorption spectrometry (FAAS) system was evaluated for determination of Te in reference material (GBW 07302 Stream Sediment), coal fly ash and garlic. Tellurium, using formation of H{sub 2}Te vapors, is atomized in air-acetylene flame-heated IAT. A new design HG-IAT-FAAS hyphenated technique that would exceed the operational capabilities of existing arrangernents (a water-cooled single silica tube, double-slotted quartz tube or an 'integrated trap') was investigated. An improvement in detection limit was achieved compared with using either of the above atom trapping techniques separately. The concentration detection limit, defined as 3 times the blank standard deviation (3{sigma}), was 0.9 ng mL{sup -1} for Te. For a 2 min in situ preconcentration time (sample volume of 2 mL), sensitivity enhancement compared to flame AAS, was 222 fold, using the hydride generation atom trapping technique. The sensitivity can be further improved by increasing the collection time. The precision, expressed as RSD, was 7.0% (n = 6) for Te. The accuracy of the method was verified using a certified reference material (GBW 07302 Stream Sediment) by aqueous standard calibration curves. The measured Te contents of the reference material was in agreement with the information value. The method was successfully applied to the determination of tellurium in coal fly ash and garlic.

  4. High performance supercapacitor and non-enzymatic hydrogen peroxide sensor based on tellurium nanoparticles

    Directory of Open Access Journals (Sweden)

    M. Manikandan

    2017-04-01

    Full Text Available Tellurium nanoparticles (Te Nps were synthesized by wet chemical method and characterized by XRD, Raman, FESEM, TEM, XPS, UV–Vis and FL. The Nps were coated on graphite foil and Glassy carbon electrode to prepare the electrodes for supercapacitor and biosensor applications. The supercapacitor performance is evaluated in 2 M KOH electrolyte by both Cyclic Voltammetry (CV and galvanostatic charge-discharge method. From charge-discharge method, Te Nps show a specific capacitance of 586 F/g at 2 mA/cm2 and 100 F/g at 30 mA/cm2 as well as an excellent cycle life (100% after 1000 cycles. In addition, the H2O2 sensor performance of Te Nps modified glassy carbon electrode is checked by CV and Chronoamperometry (CA in phosphate buffer solution (PBS. In the linear range of 0.67 to 8.04 μM of hydrogen peroxide (H2O2, Te NPs show a high sensitivity of 0.83 mA mM−1 cm−2 with a correlation coefficient of 0.995. The detection limit is 0.3 μM with a response time less than 5 s. Keywords: Tellurium nanoparticles, Supercapacitor, Biosensor, Hydrogen peroxide

  5. Equilibrium evaporation test of lead-bismuth eutectic and of tellurium in lead-bismuth

    International Nuclear Information System (INIS)

    Ohno, Shuji; Nishimura, Masahiro; Hamada, Hirotsugu; Miyahara, Shinya; Sasa, Toshinobu; Kurata, Yuji

    2005-01-01

    A series of equilibrium evaporation experiment was performed to acquire the essential and the fundamental knowledge about the transfer behavior of lead-bismuth eutectic (LBE) and impurity tellurium in LBE from liquid to gas phase. The experiments were conducted using the transpiration method in which saturated vapor in an isothermal evaporation pot was transported by inert carrier gas and collected outside of the pot. The size of the used evaporation pot is 8 cm inner diameter and 15 cm length. The weight of the LBE pool in the pot is about 500 g. The investigated temperature range was 450degC to 750degC. From this experiment and discussion using the data in literature, we have obtained several instructive and useful data on the LBE evaporation behavior such as saturated vapor pressure of LBE, vapor concentration of Pb, Bi and Bi 2 in LBE saturated gas phase, and activity coefficient of Pb in the LBE. The LBE vapor pressure equation is represented as the sum of Pb, Bi and Bi 2 vapor in the temperature range between 550degC and 750degC as logP[Pa]=10.2-10100/T[k]. The gas-liquid equilibrium partition coefficient of tellurium in LBE is in the range of 10 to 100, with no remarkable temperature dependency between 450degC and 750degC. This research was founded by the Ministry of Education, Culture, Sports, Science and Technology (MEXT). (author)

  6. Improvement of physical properties of ZnO thin films by tellurium doping

    Energy Technology Data Exchange (ETDEWEB)

    Sönmezoğlu, Savaş, E-mail: svssonmezoglu@kmu.edu.tr; Akman, Erdi

    2014-11-01

    Highlights: • We report the synthesis of tellurium-doped zinc oxide (Te–ZnO) thin films using sol–gel method. • Highly c-axis oriented Te-doped ZnO thin films were grown on FTO glasses as substrate. • 1.5% Te-doping ratio could improve the physical properties of ZnO thin films. - Abstract: This investigation addressed the structural, optical and morphological properties of tellurium incorporated zinc oxide (Te–ZnO) thin films. The obtained results indicated that Te-doped ZnO thin films exhibit an enhancement of band gap energy and crystallinity compared with non-doped films. The optical transmission spectra revealed a shift in the absorption edge toward lower wavelengths. X-ray diffraction measurement demonstrated that the film was crystallized in the hexagonal (wurtzite) phase and presented a preferential orientation along the c-axis. The XRD obtained patterns indicate that the crystallite size of the thin films, ranging from 23.9 to 49.1 nm, changed with the Te doping level. The scanning electron microscopy and atomic force microscopy results demonstrated that the grain size and surface roughness of the thin films increased as the Te concentration increased. Most significantly, we demonstrate that it is possible to control the structural, optical and morphological properties of ZnO thin films with the isoelectronic Te-incorporation level.

  7. Tellurium labeled analogues of the fatty acid hexadecenoic acid for imaging of myocardial tissue

    International Nuclear Information System (INIS)

    Mills, S.L.

    1980-01-01

    Non-invasive nuclear diagnostic procedures for the evaluation of acute myocardial infarction and ischemia are currently limited by problems associated with the availablity of radiopharmaceuticals, development of imaging equipment, and inherent characteristics of radionuclides. Myocardial tissue requires high levels of substrates which provide energy for the continuous functioning of this vital organ. Of the major sources of energy, the most utilized source is fatty acids. Tellurium-123m, with excellent gamma imaging characteristics was chosen as the radionuclide. A 16 carbon fatty acid, hexadecenoic acid, was chosen as the carrier molecule. The tellurium-123m fatty acid radiopharmaceuticals were formulated either in a solution of 20 percent ethanol, two percent polysorbate 80, and brought to volume with normal saline or in 12.5 percent human serum ablumin and brought to volume with normal saline. Biodistribution was performed in three animal species: Sprague-Dawley rats (three rats per time frame), Australian white rabbits (three rabbits per time frame), and mongrel dogs (one dog per time frame). Dosimetry calculations were performed to assess the radiation dose

  8. Microbial-assisted synthesis and evaluation the cytotoxic effect of tellurium nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Forootanfar, Hamid [Herbal and Traditional Medicines Research Center, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Amirpour-Rostami, Sahar; Jafari, Mandana [Pharmaceutics Research Center, Institute of Neuropharmacology, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Forootanfar, Amir [Department of Pharmacology and Toxicology, Faculty of Pharmacy, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Yousefizadeh, Zahra [The Student Research Committee, Faculty of Pharmacy, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Shakibaie, Mojtaba, E-mail: shakiba@kmu.ac.ir [Pharmaceutics Research Center, Institute of Neuropharmacology, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of)

    2015-04-01

    The present study was designed to isolate bacterial strain capable of tellurium nanorods' (Te NRs) production followed by purification and evaluation of the cytotoxic effect of Te NRs. Among 25 environmental samples collected for screening of Te NR-producer bacterial strains one bacterial colony (isolated from hot spring and identified as Pseudomonas pseudoalcaligenes strain Te) was selected and applied for biosynthesis of Te NRs. Thereafter, an organic–aqueous partitioning system was applied for the purification of the biogenic Te NRs and the purified Te NRs were characterized using transmission electron microscopy (TEM), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), X-ray diffraction spectroscopy (XRD), UV–visible spectroscopy, and Fourier transform infrared spectroscopy (FTIR) techniques. The cytotoxic effect of biologically synthesized Te NRs and potassium tellurite on four cell lines of MCF-7, HT1080, HepG2 and A549 was then determined using the MTT assay method. The obtained results revealed lower toxicity for the rod-shaped biogenic tellurium nanostructures (~ 22 nm diameter by 185 nm length) compared to K{sub 2}TeO{sub 3}. - Highlights: • Te NR producing bacterial strain were isolated from hot springs. • Organic–aqueous partitioning system was applied for purification of Te nanorods. • The rod-shaped biogenic Te NPs showed lower cytotoxicity compared to K{sub 2}TeO{sub 3}.

  9. Microbial-assisted synthesis and evaluation the cytotoxic effect of tellurium nanorods

    International Nuclear Information System (INIS)

    Forootanfar, Hamid; Amirpour-Rostami, Sahar; Jafari, Mandana; Forootanfar, Amir; Yousefizadeh, Zahra; Shakibaie, Mojtaba

    2015-01-01

    The present study was designed to isolate bacterial strain capable of tellurium nanorods' (Te NRs) production followed by purification and evaluation of the cytotoxic effect of Te NRs. Among 25 environmental samples collected for screening of Te NR-producer bacterial strains one bacterial colony (isolated from hot spring and identified as Pseudomonas pseudoalcaligenes strain Te) was selected and applied for biosynthesis of Te NRs. Thereafter, an organic–aqueous partitioning system was applied for the purification of the biogenic Te NRs and the purified Te NRs were characterized using transmission electron microscopy (TEM), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), X-ray diffraction spectroscopy (XRD), UV–visible spectroscopy, and Fourier transform infrared spectroscopy (FTIR) techniques. The cytotoxic effect of biologically synthesized Te NRs and potassium tellurite on four cell lines of MCF-7, HT1080, HepG2 and A549 was then determined using the MTT assay method. The obtained results revealed lower toxicity for the rod-shaped biogenic tellurium nanostructures (~ 22 nm diameter by 185 nm length) compared to K 2 TeO 3 . - Highlights: • Te NR producing bacterial strain were isolated from hot springs. • Organic–aqueous partitioning system was applied for purification of Te nanorods. • The rod-shaped biogenic Te NPs showed lower cytotoxicity compared to K 2 TeO 3

  10. Resource recovery from urban stock, the example of cadmium and tellurium from thin film module recycling

    International Nuclear Information System (INIS)

    Simon, F.-G.; Holm, O.; Berger, W.

    2013-01-01

    Highlights: ► The semiconductor layer on thin-film photovoltaic modules can be removed from the glass-plate by vacuum blast cleaning. ► The separation of blasting agent and semiconductor can be performed using flotation with a valuable yield of 55%. ► PV modules are a promising source for the recovery of tellurium in the future. - Abstract: Raw material supply is essential for all industrial activities. The use of secondary raw material gains more importance since ore grade in primary production is decreasing. Meanwhile urban stock contains considerable amounts of various elements. Photovoltaic (PV) generating systems are part of the urban stock and recycling technologies for PV thin film modules with CdTe as semiconductor are needed because cadmium could cause hazardous environmental impact and tellurium is a scarce element where future supply might be constrained. The paper describes a sequence of mechanical processing techniques for end-of-life PV thin film modules consisting of sandblasting and flotation. Separation of the semiconductor material from the glass surface was possible, however, enrichment and yield of valuables in the flotation step were non-satisfying. Nevertheless, recovery of valuable metals from urban stock is a viable method for the extension of the availability of limited natural resources

  11. The influence of composition of fluoride electrolytes and conditions of the electrodeposition on some properties of tellurium

    International Nuclear Information System (INIS)

    Bugelis, V.M.; Kum, G.N.; Abrarov, O.A.; Madumarov, A.; Navalikhin, L.V.; Ajnakulov, Eh.B.

    1981-01-01

    Effect of electrolytic bath content, cathode current density, illumination and temperature on specific resistance, photosensitivity, structure and chemical purity of plated tellurium coatings is studied. Deposition is realized from moderately acid fluoride electrolytes at the constant temperature with a platinum working electrode. X-ray studies of precipitates obtained are carried out

  12. Exploratory studies of element substitutions in synthetic tetrahedrite. Part II. Selenium and tellurium as anions in Zn-Fe tetrahedrites

    DEFF Research Database (Denmark)

    Karup-Møller, Sven; Makovicky, E.

    1999-01-01

    -free) compositons do not materialize. The substituted Se tetrahedrite coexists with Cu3SbSe3, (iron-bearing) Cu2-xSe, Cu3SbSe4 plus/minus low Zn-sulfide melt. Selenium does not adopt the role of cation and tellurium that of anion in the tetrahedrite structure. The explanation of the severely restricted composition...

  13. The enhancing of Au-Ag-Te content in tellurium-bearing ore mineral by bio-oxidation-leaching

    Science.gov (United States)

    Kim, PyeongMan; Kim, HyunSoo; Myung, EunJi; Kim, YoonJung; Lee, YongBum; Park*, CheonYoung

    2015-04-01

    The purpose of this study is to enhance the content of valuable metals such as Au-Ag-Te in tellurium-bearing minerals by bio-oxidation-leaching. It was confirmed that pyrite, chalcopyrite, sphalerite and galena were produced together with tellurium-bearing minerals including hessite, sylvanite and tellurobismuthite from ore minerals and concentrates through microscopic observation and SEM/EDS analysis. In a bio-oxidation-leaching experiment, with regard to Au, Ag, Te, Cu and Fe, the changes in the amount of leaching and the content of leaching residues were compared and analyzed with each other depending on the adaptation of an indigenous microbe identified as Acidithiobacillus ferrooxidans. As a result of the experiment, the Au-Ag-Te content in tellurium-bearing ore mineral was enhanced in the order of physical oxidation leaching, physical/non-adaptive bio-oxidation-leaching and physical/adaptive biological leaching. It suggests that the bio-oxidation-leaching using microbes adapted in tellurium-bearing ore mineral can be used as a pre-treatment and a main process in a recovery process of valuable metals. "This research was supported by Basic Science Research Program through the National Research Foundation of Korea(NRF) funded by the Ministry of Education(NRF-2013R1A1A2004898)"

  14. Phenylethynyl-butyltellurium inhibits the sulfhydryl enzyme Na+, K+ -ATPase: an effect dependent on the tellurium atom.

    Science.gov (United States)

    Quines, Caroline B; Rosa, Suzan G; Neto, José S S; Zeni, Gilson; Nogueira, Cristina W

    2013-11-01

    Organotellurium compounds are known for their toxicological effects. These effects may be associated with the chemical structure of these compounds and the oxidation state of the tellurium atom. In this context, 2-phenylethynyl-butyltellurium (PEBT) inhibits the activity of the sulfhydryl enzyme, δ-aminolevulinate dehydratase. The present study investigated on the importance of the tellurium atom in the PEBT ability to oxidize mono- and dithiols of low molecular weight and sulfhydryl enzymes in vitro. PEBT, at high micromolar concentrations, oxidized dithiothreitol (DTT) and inhibited cerebral Na(+), K(+)-ATPase activity, but did not alter the lactate dehydrogenase activity. The inhibition of cerebral Na(+), K(+)-ATPase activity was completely restored by DTT. By contrast, 2-phenylethynyl-butyl, a molecule without the tellurium atom, neither oxidized DTT nor altered the Na(+), K(+)-ATPase activity. In conclusion, the tellurium atom of PEBT is crucial for the catalytic oxidation of sulfhydryl groups from thiols of low molecular weight and from Na(+), K(+)-ATPase.

  15. Extraction-spectrophotometric method for silicon determination in high-purity substances. 1. Silicon determination in tellurium

    Energy Technology Data Exchange (ETDEWEB)

    Shaburova, V P; Yudelevich, I G [AN SSSR, Novosibirsk (USSR). Inst. Neorganicheskoj Khimii

    1989-01-01

    The extraction-spectrophotometric method for silicon determination in tellurium based on extraction isolation of the base by tributyl phosphate from hydrochloride solutions and with addition of HNO/sub 3/ and spectrophotometric silicon determination using malachite green is developed. The method permits to determine 2x10/sup -1/-3x10/sup -4/ % Si.

  16. An Overview of NCRP Report No. 138 on Terrorist Activities

    Science.gov (United States)

    Poston, John, Sr.

    2005-04-01

    In late 1998, the National Council on Radiation Protection and Measurements (NCRP) convened Scientific Committee 46-14 to prepare a report on the radiological safety aspects of terrorist activities involving radioactivity. The work of this committee was funded through a contract with the Planning and Preparedness Division of the Office of Emergency Management of the Department of Energy. The committee was composed of a diverse group of individuals with expertise in many areas in addition to radiation safety and emergency response. These areas included law (both federal and state), public communications, and psychosocial aspects of such incidents. The statement of work focused the work of the committee, and the resulting report did not necessarily address all issues of such activities. One of the charges of the committee was to provide guidance as to necessary research and make recommendations regarding the present infrastructure with the responsibility for responding to such incidents. This presentation will provide an overview of NCRP Report No. 138 and focus on some of the critical issues raised in the report. These issues include recognition of the event, the interface between federal, state, and local authorities, exposure limits for the first-responders, clean-up criteria, training and resources, the psychosocial aspects of such events, and communications with the media and the public. This report represented the ``beginning'' of such considerations. It pointed the way for additional studies and research in this very important area.

  17. Determination of tellurium in coal samples by means of graphite furnace atomic absorption spectrometry after coprecipitation with iron(III) hydroxide

    Energy Technology Data Exchange (ETDEWEB)

    Oda, S.; Arikawa, Y. [Japan Womens University, Tokyo (Japan)

    2005-11-01

    A simple and accurate method for the determination of tellurium in coal samples was investigated by the combustion of samples under a high pressure of oxygen and coprecipitation with Fe(OH){sub 3}, followed by a measurement by graphite furnace atomic absorption spectrometry (GF-AAS). About 0.5 g of an accurately weighed ground coal sample and 0.5 g of starch were combusted in an oxygen combustion bomb filled with oxygen to 3 MPa and added with 3 ml of water as an absorbing solution. The formed tellurium trioxide TeOs dissolved in water as TeO{sub 4}{sup 2-}, which was in turn reduced to TeO{sub 3}{sup 2-} by heating. After diluting the above-mentioned solution up to about 50 ml with water, Fe(OH){sub 3} is formed upon adding Fe(NO{sub 3}){sub 3} and sodium hydroxide solutions at pH 8-9 and left standing overnight. After dissolving the precipitate by HCl, the solution was diluted to 10 ml with water and the concentration of tellurium was measured by GF-AAS at a wavelength of 214.3 nm. The standard addition method was employed for the determination of tellurium in real coal samples, because those processes for the formation of tellurium(VI) oxide and coprecipitation with Fe(OH)3 were interfered by matrices. For NIST SRM 1632c, the standard coal sample tellurium content of 0.057 {+-} 0.004 mg kg{sup -1} was in good agreement with the information value of 0.05 mg kg{sup -1} with 7% of RSD in five replicate analyses. The tellurium contents in 20 real coal samples given by Center for Coal Utilization, Japan were also determined. The tellurium contents in these samples were scattered over the narrow range between 0.032 and 0.100 mg kg{sup -1}.

  18. Intrinsic two-dimensional states on the pristine surface of tellurium

    Science.gov (United States)

    Li, Pengke; Appelbaum, Ian

    2018-05-01

    Atomic chains configured in a helical geometry have fascinating properties, including phases hosting localized bound states in their electronic structure. We show how the zero-dimensional state—bound to the edge of a single one-dimensional helical chain of tellurium atoms—evolves into two-dimensional bands on the c -axis surface of the three-dimensional trigonal bulk. We give an effective Hamiltonian description of its dispersion in k space by exploiting confinement to a virtual bilayer, and elaborate on the diminished role of spin-orbit coupling. These intrinsic gap-penetrating surface bands were neglected in the interpretation of seminal experiments, where two-dimensional transport was otherwise attributed to extrinsic accumulation layers.

  19. Calculations of energy levels and electromagnetic properties for tellurium pair isotopes, by unified method

    International Nuclear Information System (INIS)

    Teixeira, R.R.P.

    1988-01-01

    Calculations with the Unified Model (vibrator coupled to two particles), of the energy levels and the eletromagnetic properties have been performed and compared with the twelve pair isotopes from tellurium with A between 112 and 134. The results were analysed using as particles interaction: pairing and SDI (Surface Delta Interaction). The SDI and 3 fonons collective states were used in the fittings, and a syntematic comparison between the theoretical and experimental results was made. The dependence of the results with the model parameters was determined, through large variation sof them. Calculations using 4 fonons have been made, and the importance of the introduced variations in the results was discussed. Calculations have been made in the VAX Computer of the Pelletron at IFUSP. (author) [pt

  20. Studies on nickel (II and palladium (II complexes with some tetraazamacrocycles containing tellurium

    Directory of Open Access Journals (Sweden)

    Rathee Nitu

    2012-01-01

    Full Text Available The synthesis of 10-membered and 12-membered tellurium containing tetraazamacrocyclic complexes of divalent nickel and palladium by template condensation of diaryltellurium dichlorides, (aryl = p-hydroxyphenyl, 3-methyl-4-hydroxyphenyl, p-methoxyphenyl with 1,2-diaminoethane and 1,3-diaminopropane in the presence of metal dichloride is reported. The resulting complexes have been subjected to elemental analyses, magnetic measurements, electronic absorption, infra-red, and proton magnetic resonance spectral studies. The formation of proposed macrocyclic skeletons and their donor sites have been identified on the basis of spectral studies. Distorted octahedral structure for the nickel complexes in the solid state and squareplanar structure for the palladium complexes have been suggested.

  1. Effect of aging and temperature on alternating current conductivity of tellurium thin films

    Energy Technology Data Exchange (ETDEWEB)

    Tsiulyanu, D. [Technical University, Department of Physics, bul. Dacia 41, MD-2060, Chisinau (Moldova, Republic of)], E-mail: tsiu@cni.md; Marian, T.; Tiuleanu, A. [Technical University, Department of Physics, bul. Dacia 41, MD-2060, Chisinau (Moldova, Republic of); Liess, H.-D.; Eisele, I. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany)

    2009-02-27

    The impedance spectra of tellurium films with interdigital platinum electrodes were investigated in air at temperatures between 10 and 50 deg. C . Cole-Cole analysis made it possible to assess time constants, resistance, and capacitance of the film at characteristic frequencies and the dependence of these parameters on aging and temperature. Aging under normal conditions over 12 months led to a relative increase of only {approx} 5% in film impedance at the characteristic frequency. However, aging noticeably influences the electrical resistance of the film at high (> 500 kHz) frequencies, and capacitance diminished after 12 months by more than 50% throughout the spectrum. Scanning electron microscopy confirmed that the effect of aging is due to structural changes in the film. Temperature does not influence the capacitance of the film but uncommonly influences its resistance, which reaches a maximum at around 20 deg. C . This is ascribed to desorption of oxygen previously adsorbed from the environment.

  2. Effect of aging and temperature on alternating current conductivity of tellurium thin films

    International Nuclear Information System (INIS)

    Tsiulyanu, D.; Marian, T.; Tiuleanu, A.; Liess, H.-D.; Eisele, I.

    2009-01-01

    The impedance spectra of tellurium films with interdigital platinum electrodes were investigated in air at temperatures between 10 and 50 deg. C . Cole-Cole analysis made it possible to assess time constants, resistance, and capacitance of the film at characteristic frequencies and the dependence of these parameters on aging and temperature. Aging under normal conditions over 12 months led to a relative increase of only ∼ 5% in film impedance at the characteristic frequency. However, aging noticeably influences the electrical resistance of the film at high (> 500 kHz) frequencies, and capacitance diminished after 12 months by more than 50% throughout the spectrum. Scanning electron microscopy confirmed that the effect of aging is due to structural changes in the film. Temperature does not influence the capacitance of the film but uncommonly influences its resistance, which reaches a maximum at around 20 deg. C . This is ascribed to desorption of oxygen previously adsorbed from the environment

  3. Thermodynamic assessment of the palladium-tellurium (Pd-Te) system

    International Nuclear Information System (INIS)

    Gosse, S.; Gueneau, C.

    2011-01-01

    Among the fission products formed in nuclear fuels, the platinum-group metal palladium and the chalcogen element tellurium exhibit strong interaction. It is therefore of interest to be able to predict the chemical equilibria involving the Pd and Te fission products. A thermodynamic assessment is carried out using the Calphad (Calculation of Phase Diagram) method to investigate the behaviour of Pd-Te alloy system in nuclear fuels under irradiation and under waste disposal conditions. The Pd-Te binary description was optimized using experimental data found in literature including thermodynamic properties and phase diagram data. To validate the calculated phase diagram and thermodynamic properties, the results are compared with data from the literature. Both calculated and experimental phase diagrams and thermodynamic properties are in good agreement in the whole Pd-Te composition range. (authors)

  4. Melt-gas phase equilibria and state diagrams of the selenium-tellurium system

    Science.gov (United States)

    Volodin, V. N.; Trebukhov, S. A.; Burabaeva, N. M.; Nitsenko, A. V.

    2017-05-01

    The partial pressures of saturated vapor of the components in the Se-Te system are determined and presented in the form of temperature-concentration dependences from which the boundaries of the melt-gas phase transition are calculated at atmospheric pressure and vacuums of 2000 and 100 Pa. The existence of azeotropic mixtures is revealed. It is found that the points of inseparably boiling melts correspond to 7.5 at % of Se and 995°C at 101325 Pa, 10.9 at % at 673°C and 19.5 at % at 522°C in vacuums of 2000 and 100 Pa, respectively. A complete state diagram is constructed, including the fields of gas-liquid equilibria at atmospheric and low pressures, the boundaries of which allow us to assess the behavior of selenium and tellurium upon distillation fractionation.

  5. Modelling the chemical behaviour of tellurium species in the reactor pressure vessel and the reactor cooling system under severe accident conditions

    International Nuclear Information System (INIS)

    Alonso, A.; Gonzalez, C.

    1991-07-01

    This state of the art report contains information on the behaviour of tellurium and its compounds in the reactor pressure vessel and the reactor coolant system under light water reactor severe accident conditions. To characterise tellurium behaviour, it is necessary the previous knowledge of the species of tellurium released from the core, and simultaneity of its release with that of other materials which can alter the transport, for instance, control rod and structural materials. Release and transport experiments have been reviewed along with the models implemented in the codes which are used in the international community: TRAPMELT, RAFT, VICTORIA and SOPHIE. From the experiments, it can be concluded that other species different to Te 2 , such as tin telluride and cesium telluride, may be released from the fuel. That is why they must be considered in the transport phenomena. There is also experimental evidence of the strong interaction of Te 2 with Inconel 600 and stainless steel of the pipe walls and structures, however this strong interaction is in competition with the interaction of tellurium with aerosols, which under severe accident conditions may represent an area greater than that of the primary system. It is for the absence of significant tellurium species in the transport models, and also for the interaction of tellurium with aerosols, for which some codes show the greatest deficiencies

  6. In vitro and in vivo activity of an organic tellurium compound on Leishmania (Leishmania chagasi.

    Directory of Open Access Journals (Sweden)

    Isabella Aparecida Salerno Pimentel

    Full Text Available Tellurium compounds have shown several biological properties and recently the leishmanicidal effect of one organotellurane was demonstrated. These findings led us to test the effect of the organotellurium compound RF07 on Leishmania (Leishmania chagasi, the agent of visceral leishmaniasis in Latin America. In vitro assays were performed in L. (L. chagasi-infected bone marrow derived macrophages treated with different concentrations of RF07. In in vivo experiments Golden hamsters were infected with L. (L. chagasi and injected intraperitoneally with RF07 whereas control animals received either Glucantime or PBS. The effect of RF07 on cathepsin B activity of L. (L. chagasi amastigotes was assayed spectrofluorometrically using fluorogenic substrates. The main findings were: 1 RF07 showed significant leishmanicidal activity against intracellular parasites at submicromolar concentrations (IC50 of 529.7±26.5 nM, and the drug displayed 10-fold less toxicity to macrophages (CC50 of 5,426±272.8 nM; 2 kinetics assays showed an increasing leishmanicidal action of RF07 at longer periods of treatment; 3 one month after intraperitoneal injection of RF07 L. (L. chagasi-infected hamsters showed a reduction of 99.6% of parasite burden when compared to controls that received PBS; 4 RF07 inhibited the cathepsin B activity of L. (L. chagasi amastigotes. The present results demonstrated that the tellurium compound RF07 is able to destroy L. (L. chagasi in vitro and in vivo at concentrations that are non toxic to the host. We believe these findings support further study of the potential of RF07 as a possible alternative for the chemotherapy of visceral leishmaniasis.

  7. Revision and extension to the analysis of the third spectrum of tellurium: Te III

    International Nuclear Information System (INIS)

    Tauheed, A.; Naz, A.

    2011-01-01

    The spectrum of doubly ionized tellurium atom (Te III) has been investigated in the vacuum ultraviolet wavelength region. The ground configuration of Te III is 5s 2 5p 2 and the excited configurations are of the type 5s 2 5p nl. The core excitation leads to a 5s5p 3 configuration. Cowan's multi-configuration interaction code was utilized to predict the ion structure. The observed spectrum of tellurium was recorded on a 3-m normal incidence vacuum spectrograph of Antigonish Laboratory (Canada) in the wavelength region of 300 - 2000 A by using a triggered spark light source for the excitation of the spectrum. The 5s 2 5p 2 - [ 5s 2 5p (5d + 6d + 7d + 6s + 7s + 8s) + 5s5p 3 ] transition array has been analyzed. Previously reported levels by Joshi et al have been confirmed while the older analysis by Crooker and Joshi has been revised and extended to include the 5s 2 5p (5d, 6d, 7d, 6s,7s, 8s) and 5s5p 3 configurations. Least-squares- fitted parametric calculations were used to interpret the final results. One hundred and fifty spectral lines have been identified to establish 60 energy levels. Our wavelength accuracy for unblended and sharp lines is better than ±0.005 A. The ionization potential of Te III was found to be 224550 ± 300 cm -1 (27.841 ± 0.037eV).

  8. Reprint of “Extracellular production of tellurium nanoparticles by the photosynthetic bacterium Rhodobacter capsulatus”

    Energy Technology Data Exchange (ETDEWEB)

    Borghese, Roberto, E-mail: roberto.borghese@unibo.it [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy); Brucale, Marco [Institute for the Study of Nanostructured Materials (CNR-ISMN), Rome (Italy); Fortunato, Gianuario [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy); Lanzi, Massimiliano [Dept. of Industrial Chemistry “Toso Montanari”, University of Bologna (Italy); Mezzi, Alessio [Institute for the Study of Nanostructured Materials (CNR-ISMN), Rome (Italy); Valle, Francesco; Cavallini, Massimiliano [Institute for the Study of Nanostructured Materials (CNR-ISMN), Bologna (Italy); Zannoni, Davide [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy)

    2017-02-15

    Highlights: • Tellurite is reduced by R. capsulatus as cytosolic tellurium nanoprecipitates TeNPs. • Lawsone allows R. capsulatus to produce extracellular TeNPs. • Extracellular TeNPs production depends on the carbon source used for cells growth. • Both lawsone concentration and the incubation time determine the TeNPs size. • Extracellular TeNPs are coated with extracellular polymeric substances (EPS). - Abstract: The toxic oxyanion tellurite (TeO{sub 3}{sup 2−}) is acquired by cells of Rhodobacter capsulatus grown anaerobically in the light, via acetate permease ActP2 and then reduced to Te{sup 0} in the cytoplasm as needle-like black precipitates. Interestingly, photosynthetic cultures of R. capsulatus can also generate Te{sup 0} nanoprecipitates (TeNPs) outside the cells upon addition of the redox mediator lawsone (2-hydroxy-1,4-naphtoquinone). TeNPs generation kinetics were monitored to define the optimal conditions to produce TeNPs as a function of various carbon sources and lawsone concentration. We report that growing cultures over a 10 days period with daily additions of 1 mM tellurite led to the accumulation in the growth medium of TeNPs with dimensions from 200 up to 600–700 nm in length as determined by atomic force microscopy (AFM). This result suggests that nucleation of TeNPs takes place over the entire cell growth period although the addition of new tellurium Te{sup 0} to pre-formed TeNPs is the main strategy used by R. capsulatus to generate TeNPs outside the cells. Finally, X-ray photoelectron spectroscopy (XPS) and Fourier transform infrared (FT-IR) analysis of TeNPs indicate they are coated with an organic material which keeps the particles in solution in aqueous solvents.

  9. Potential for improved extraction of tellurium as a byproduct of current copper mining processes

    Science.gov (United States)

    Hayes, S. M.; Spaleta, K. J.; Skidmore, A. E.

    2016-12-01

    Tellurium (Te) is classified as a critical element due to its increasing use in high technology applications, low average crustal abundance (3 μg kg-1), and primary source as a byproduct of copper extraction. Although Te can be readily recovered from copper processing, previous studies have estimated a 4 percent extraction efficiency, and few studies have addressed Te behavior during the entire copper extraction process. The goals of the present study are to perform a mass balance examining Te behavior during copper extraction and to connect these observations with mineralogy of Te-bearing phases which are essential first steps in devising ways to optimize Te recovery. Our preliminary mass balance results indicate that less than 3 percent of Te present in copper ore is recovered, with particularly high losses during initial concentration of copper ore minerals by flotation. Tellurium is present in the ore in telluride minerals (e.g., Bi-Te-S phases, altaite, and Ag-S-Se-Te phases identified using electron microprobe) with limited substitution into sulfide minerals (possibly 10 mg kg-1 Te in bulk pyrite and chalcopyrite). This work has also identified Te accumulation in solid-phase intermediate extraction products that could be further processed to recover Te, including smelter dusts (158 mg kg-1) and pressed anode slimes (2.7 percent by mass). In both the smelter dusts and anode slimes, X-ray absorption spectroscopy indicates that about two thirds of the Te is present as reduced tellurides. In anode slimes, electron microscopy shows that the remaining Te is present in an oxidized form in a complex Te-bearing oxidate phase also containing Pb, Cu, Ag, As, Sb, and S. These results clearly indicate that more efficient, increased recovery of Te may be possible, likely at minimal expense from operating copper processing operations, thereby providing more Te for manufacturing of products such as inexpensive high-efficiency solar panels.

  10. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    Science.gov (United States)

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan; Abdallah, Basem M.; Ditzel, Nicholas; Nossent, Anne Yael; Bak, Mads; Kauppinen, Sakari; Kassem, Moustapha

    2011-01-01

    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators of diverse biological processes by mediating translational repression or mRNA degradation of their target genes. Here, we show that miRNA-138 (miR-138) modulates osteogenic differentiation of hMSCs. miRNA array profiling and further validation by quantitative RT-PCR (qRT-PCR) revealed that miR-138 was down-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore, overexpression of miR-138 reduced ectopic bone formation in vivo by 85%, and conversely, in vivo bone formation was enhanced by 60% when miR-138 was antagonized. Target prediction analysis and experimental validation by luciferase 3′ UTR reporter assay confirmed focal adhesion kinase, a kinase playing a central role in promoting osteoblast differentiation, as a bona fide target of miR-138. We show that miR-138 attenuates bone formation in vivo, at least in part by inhibiting the focal adhesion kinase signaling pathway. Our findings suggest that pharmacological inhibition of miR-138 by antimiR-138 could represent a therapeutic strategy for enhancing bone formation in vivo. PMID:21444814

  11. NMR spectroscopy of organic compounds of selenium and tellurium. Communication 8. Constants of spin-spin interaction of /sup 125/Te-/sup 1/o/sup 3/C in nmr spectra of unsaturated organtellurides

    Energy Technology Data Exchange (ETDEWEB)

    Kalabin, G.A.; Kushnarev, D.F.; Valeev, R.B. (Irkutskij Gosudarstvennyj Univ. (USSR))

    1981-06-01

    On the basis of /sup 13/C NMR spectra of a series of unsaturated and aromatic tellurium compounds the constants of spin-spin interaction (SSIC) (sup(1.2)J(Te, C)) are measured. A reliable linear relation between /sup 1/J(Te, C) and s-character of a carbon orbitale forming bond with tellurium is found. Correlation of straight SSIC of carbon with selenium and tellurium in isological compounds is established.

  12. Comparison of analytical possibilities of inversion voltammetry of tellurium with cathodic and anodic potential scanning taking layer-by-layer analysis of GaAs-Te films as example

    International Nuclear Information System (INIS)

    Kaplin, A.A.; Portnyagina, Eh.O.; Gridaev, V.F.

    1979-01-01

    Possibility of application in analytical purposes of the process of tellurium precipitation electrosolution from the surfaces of graphite and mercury-graphite electrodes at the cathode scanning of the potential is shown. As a result of comparison of direct and inversion scanning with cathodic and anodic scanning of the potential, variants of voltammetric method of tellurium determination in artificial solutions and, taking the developed method of layer-by-layer analysis of the GaAsTe films as an example, advantage of mercury-graphite electrode with cathodic scanning as compared to graphite electrode with cathode scanning of the potential is shown. Reproducibility of the GaAs film analysis results according to anodic and cathodic tellurium peaks is satisfactory. Maximum deviation from the results of analysis of oxidation peaks and tellurium peduction does not exceed 15 rel. %. Thus, for tellurium concentrations, exceeding 5x10 -6 g-ion/l, both anodic and cathodic scanning of the potential can be used, though error in tellurium determination according to cathodic peaks is 1.5-2.0 times higher. At tellurium amounts lower 5x10 -6 g-ion/l the determination should be carried out according to the peaks of tellurium anodic oxidation from the surface of graphite electrode or according to the peaks of tellurium cathodic reduction from the surface of mercury-graphite electrode

  13. Investigation of evaporation characteristics of polonium and its lighter homologues selenium and tellurium from liquid Pb-Bi-eutecticum

    CERN Document Server

    Neuhausen, J; Eichler, B

    2004-01-01

    The evaporation behaviour of polonium and its lighter homologues selenium and tellurium dissolved in liquid Pb-Bi-eutecticum (LBE) has been studied at various temperatures in the range from 482 K up to 1330 K under Ar/H2 and Ar/H2O-atmospheres using γ-ray spectroscopy. Polonium release in the temperature range of interest for technical applications is slow. Within short term (1h) experiments measurable amounts of polonium are evaporated only at temperatures above 973 K. Long term experiments reveal that a slow evaporation of polonium occurs at temperatures around 873 K resulting in a fractional polonium loss of the melt around 1% per day. Evaporation rates of selenium and tellurium are smaller than those of polonium. The presence of H2O does not enhance the evaporation within the error limits of our experiments. The thermodynamics and possible reaction pathways involved in polonium release from LBE are discussed.

  14. Synthesis of Novel E-2-Chlorovinyltellurium Compounds Based on the Stereospecific Anti-addition of Tellurium Tetrachloride to Acetylene

    Directory of Open Access Journals (Sweden)

    Svetlana V. Amosova

    2012-05-01

    Full Text Available The reaction of tellurium tetrachloride with acetylene proceeds in a stereospecific anti-addition manner to afford the novel products E-2-chlorovinyltellurium trichloride and E,E-bis(2-chlorovinyltellurium dichloride. Reaction conditions for the selective preparation of each of these products were found. The latter was obtained in 90% yield in CHCl3 under a pressure of acetylene of 10–15 atm, whereas the former product was formed in up to 72% yield in CCl4 under a pressure of acetylene of 1–3 atm. Synthesis of the previously unknown E,E-bis(2-chlorovinyl telluride, E,E-bis(2-chlorovinyl ditelluride, E-2-chlorovinyl 1,2,2-trichloroethyl telluride and E,E-bis(2-chlorovinyl-tellurium dibromide is described.

  15. Deposition of tellurium films by decomposition of electrochemically-generated H{sub 2}Te: application to radiative cooling devices

    Energy Technology Data Exchange (ETDEWEB)

    Engelhard, T.; Jones, E.D.; Viney, I. [Coventry Univ. (United Kingdom). Centre for Data Storage Mater.; Mastai, Y.; Hodes, G. [Department of Materials and Interfaces, Weizmann Institute of Science, 76100, Rehovot (Israel)

    2000-07-17

    The preparation of homogenous, large area thin layers of tellurium on thin polyethylene foils is described. The tellurium was formed by room temperature decomposition of electrochemically generated H{sub 2}Te. Pre-treatment of the polyethylene substrates with KMnO{sub 4} to give a Mn-oxide layer was found to improve the Te adhesion and homogeneity. Optical characterization of the layers was performed using UV/VIS/NIR spectroscopy. Such coatings have favorable characteristics for use as solar radiation shields in radiative cooling devices. The simplicity of generation of the very unstable H{sub 2}Te was also exploited to demonstrate formation of size-quantized CdTe nanocrystals. (orig.)

  16. The application of three-phase liquid-liquid extraction to the analysis of bismuth and tellurium in sulphide concentrates

    International Nuclear Information System (INIS)

    Nicholas, D.J.

    1976-01-01

    An extraction system consisting of one aqueous and two organic phases is described. Diantipyrylmethane (DAM) is used as the extractant for bismuth and tellurium, which are extracted into the smaller of the two organic phases from nitric acid and perchloric acid respectively. The extraction efficiency is in the range of 90 to 95 per cent, compensation for incomplete extraction being made by the technique of standard addition. Copper, lead, and zinc are not extracted in either procedure. When the solutions contain high concentrations of iron, thioglycolic acid is used as a masking agent for iron in the extraction of bismuth. Atomic-absorption spectrophotometry is used for the analysis of the third phase after it has been diluted with methanol. The precision for bismuth and tellurium is in the range of 3 to 4 per cent. The accuracy, as ascertained from comparative analyses of sulphide concentrates, is good

  17. Total β-decay energies and masses of tin, antimony and tellurium isotopes in the vicinity of 50132Sn82

    International Nuclear Information System (INIS)

    Lund, E.; Aleklett, K.; Rudstam, G.

    1977-01-01

    Experimental β-decay energies for short-lived isotopes of tin, antimony and tellurium are presented. Mass-separated sources were produced at the on-line isotope separator OSIRIS. By applying β-γ coincidence methods, total β-decay energies have been determined for the following nuclides: 127-131 Sn, 128 130 131 134 Sb and 134 135 Te. The atomic mass excess has been derived for these nuclei, and comparisons are made with mass formula predictions. (Auth.)

  18. Solvent Extraction of Tellurium from Chloride Solutions Using Tri-n-butyl Phosphate: Conditions and Thermodynamic Data

    Directory of Open Access Journals (Sweden)

    Dongchan Li

    2014-01-01

    Full Text Available The extractive separation of tellurium (IV from hydrochloric acid media with tri-n-butyl phosphate (TBP in kerosene was investigated. The dependence on the extraction of tellurium species, concentrations of tellurium and TBP, extraction time and stage, organic/aqueous ratio, and interferences from coexist metallic ions were examined and are discussed. Besides, the stripping agent and stripping time were also studied. It was found that the extraction reaction corresponds to the neutral complex formation mechanism and the extracted species is TeCl4·3TBP and that the extraction process is exothermic. The thermodynamic parameters of enthalpy ΔH, entropy ΔS, and free energy ΔG of the extraction process were evaluated at −26.2 kJ·mol−1, −65.6 J·mol−1·K−1, and −7.0 kJ·mol−1, respectively at 293 K.

  19. Synthesis of ultra-thin tellurium nanoflakes on textiles for high-performance flexible and wearable nanogenerators

    Energy Technology Data Exchange (ETDEWEB)

    He, Wen; Van Ngoc, Huynh; Qian, Yong Teng; Hwang, Jae Seok; Yan, Ya Ping [Department of Physics and Interdisciplinary Course of Physics and Chemistry, Sungkyunkwan University, 2066, Seobu-ro, Jangan-gu, Suwon 16419, Gyeoggi-do (Korea, Republic of); Choi, Hongsoo [Department of Robotics Engineering, Daegu Gyeongbuk Institute of Science and Technology (DGIST), 711-873, Daegu (Korea, Republic of); Kang, Dae Joon, E-mail: djkang@skku.edu [Department of Physics and Interdisciplinary Course of Physics and Chemistry, Sungkyunkwan University, 2066, Seobu-ro, Jangan-gu, Suwon 16419, Gyeoggi-do (Korea, Republic of)

    2017-01-15

    Highlights: • Ultra-thin tellurium (Te) nanoflakes were successfully grown on textile and used as an active piezoelectric material. • Te nanoflake nanogenerator device was systematically studied by bending and compressing test. • The ultra-high output power during compressing test can light up 10 LEDs without any external power source. • The device can offer a breakthrough in applying tellurium nanoflakes into high-performance flexible and wearable piezoelectric nanogenerator. - Abstract: We report that ultra-thin tellurium (Te) nanoflakes were successfully grown on a sample of a gold-coated textile, which then was used as an active piezoelectric material. An output voltage of 4 V and a current of 300 nA were obtained from the bending test under a driving frequency of 10 Hz. To test the practical applications, Te nanoflake nanogenerator (TFNG) device was attached to the subject’s arm, and mechanical energy was converted to electrical energy by means of periodic arm-bending motions. The optimized open-circuit voltage and short-circuit current density of approximately 125 V and 17 μA/cm{sup 2}, respectively, were observed when a TFNG device underwent a compression test with a compressive force of 8 N and driving frequency of 10 Hz. This high-power generation enabled the instantaneous powering of 10 green light-emitting diodes that shone without any assistance from an external power source.

  20. Effect of sample preparation methods on photometric determination of the tellurium and cobalt content in the samples of copper concentrates

    Directory of Open Access Journals (Sweden)

    Viktoriya Butenko

    2016-03-01

    Full Text Available Methods of determination of cobalt and nickel in copper concentrates currently used in factory laboratories are very labor intensive and time consuming. The limiting stage of the analysis is preliminary chemical sample preparation. Carrying out the decomposition process of industrial samples with concentrated mineral acids in open systems does not allow to improve the metrological characteristics of the methods, for this reason improvement the methods of sample preparation is quite relevant and has a practical interest. The work was dedicated to the determination of the optimal conditions of preliminary chemical preparation of copper concentrate samples for the subsequent determination of cobalt and tellurium in the obtained solution using tellurium-spectrophotometric method. Decomposition of the samples was carried out by acid dissolving in individual mineral acids and their mixtures by heating in an open system as well as by using ultrasonification and microwave radiation in a closed system. In order to select the optimal conditions for the decomposition of the samples in a closed system the phase contact time and ultrasonic generator’s power were varied. Intensification of the processes of decomposition of copper concentrates with nitric acid (1:1, ultrasound and microwave radiation allowed to transfer quantitatively cobalt and tellurium into solution spending 20 and 30 min respectively. This reduced the amount of reactants used and improved the accuracy of determination by running the process in strictly identical conditions.

  1. 9 CFR 3.138 - Primary conveyances (motor vehicle, rail, air, and marine).

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Primary conveyances (motor vehicle, rail, air, and marine). 3.138 Section 3.138 Animals and Animal Products ANIMAL AND PLANT HEALTH... (motor vehicle, rail, air, and marine). (a) The animal cargo space of primary conveyances used in...

  2. Galvanic interactions of HE15 /MDN138 & HE15 /MDN250 alloys in natural seawater

    Science.gov (United States)

    Parthiban, G. T.; Subramanian, G.; Muthuraman, K.; Ramakrishna Rao, P.

    2017-06-01

    HE15 is a heat treatable high strength alloy with excellent machinability find wide applications in aerospace and defence industries. In view of their excellent mechanical properties, workability, machinability, heat treatment characteristics and good resistance to general and stress corrosion cracking, MDN138 & MDN250 have been widely used in petrochemical, nuclear and aerospace industries. The galvanic corrosion behaviour of the metal combinations HE15 /MDN138 and HE15 /MDN250, with 1:1 area ratio, has been studied in natural seawater using the open well facility of CECRI's Offshore Platform at Tuticorin for a year. The open circuit potentials of MDN138, MDN250 and HE15 of the individual metal, the galvanic potential and galvanic current of the couples HE15 /MDN138 and HE15 /MDN250 were periodically monitored throughout the study period. The calcareous deposits on MDN138 and MDN250 in galvanic contact with HE15 were analyzed using XRD. The electrochemical behaviors of MDN138, MDN250 and HE15 in seawater have been studied using an electrochemical work station. The surface characteristics of MDN138 and MDN250 in galvanic contact with HE15 have been examined with scanning electron microscope. The results of the study reveal that HE15 offered required amount of protection to MDN138 & MDN250.

  3. Complete genome sequence of a virulent Streptococcus agalactiae strain 138P isolated from diseased Nile tilapia

    Science.gov (United States)

    Streptococcus agalactiae strain 138P was isolated from the kidney of diseased Nile tilapia in Idaho during a 2007 streptococcal disease outbreak. The full genome of S. agalactiae 138P is 1,838,716 bp. The availability of this genome will allow comparative genomics to identify genes for antigen disco...

  4. 33 CFR 138.240 - Procedure for calculating limit of liability adjustments for inflation.

    Science.gov (United States)

    2010-07-01

    ... of liability adjustments for inflation. 138.240 Section 138.240 Navigation and Navigable Waters COAST... calculating limit of liability adjustments for inflation. (a) Formula for calculating a cumulative percent... later than every three years from the year the limits of liability were last adjusted for inflation, the...

  5. 11 CFR 100.138 - Sale of food and beverages by vendor.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Sale of food and beverages by vendor. 100.138...) Exceptions to Expenditures § 100.138 Sale of food and beverages by vendor. The sale of any food or beverage..., is not an expenditure, provided that the charge is at least equal to the cost of such food or...

  6. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    DEFF Research Database (Denmark)

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.

    2006-01-01

    on the delayed disease status. However, the results demonstrate a high incidence of a single amino acid polymorphism (cysteine 138) in HIV-1 Nef. The allelic frequency of cysteine 138 between the delayed disease progression group and the progressor group was found to be statistically significant (P = 0.......0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased...... viral replication (Premkumar DR, et al. AIDS Res Hum Retroviruses 1996; 12(4): 337-45). A sequence database search for comparative mutations revealed a high frequency of cysteine 138 in patients with reported SP AIDS...

  7. Tellurium stable isotope fractionation in chondritic meteorites and some terrestrial samples

    Science.gov (United States)

    Fehr, Manuela A.; Hammond, Samantha J.; Parkinson, Ian J.

    2018-02-01

    New methodologies employing a 125Te-128Te double-spike were developed and applied to obtain high precision mass-dependent tellurium stable isotope data for chondritic meteorites and some terrestrial samples by multiple-collector inductively coupled plasma mass spectrometry. Analyses of standard solutions produce Te stable isotope data with a long-term reproducibility (2SD) of 0.064‰ for δ130/125Te. Carbonaceous and enstatite chondrites display a range in δ130/125Te of 0.9‰ (0.2‰ amu-1) in their Te stable isotope signature, whereas ordinary chondrites present larger Te stable isotope fractionation, in particular for unequilibrated ordinary chondrites, with an overall variation of 6.3‰ for δ130/125Te (1.3‰ amu-1). Tellurium stable isotope variations in ordinary chondrites display no correlation with Te contents or metamorphic grade. The large Te stable isotope fractionation in ordinary chondrites is likely caused by evaporation and condensation processes during metamorphism in the meteorite parent bodies, as has been suggested for other moderately and highly volatile elements displaying similar isotope fractionation. Alternatively, they might represent a nebular signature or could have been produced during chondrule formation. Enstatite chondrites display slightly more negative δ130/125Te compared to carbonaceous chondrites and equilibrated ordinary chondrites. Small differences in the Te stable isotope composition are also present within carbonaceous chondrites and increase in the order CV-CO-CM-CI. These Te isotope variations within carbonaceous chondrites may be due to mixing of components that have distinct Te isotope signatures reflecting Te stable isotope fractionation in the early solar system or on the parent bodies and potentially small so-far unresolvable nucleosynthetic isotope anomalies of up to 0.27‰. The Te stable isotope data of carbonaceous and enstatite chondrites displays a general correlation with the oxidation state and hence might

  8. Thermoelectric properties of bismuth antimony tellurium thin films through bilayer annealing prepared by ion beam sputtering deposition

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Zhuang-hao [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Fan, Ping, E-mail: fanping308@126.com [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Luo, Jing-ting [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Cai, Xing-min; Liang, Guang-xing; Zhang, Dong-ping [College of Physics Science and Technology, Shenzhen University, 518060 (China); Ye, Fan [Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China)

    2014-07-01

    Bismuth antimony tellurium is one of the most important tellurium-based materials for high-efficient thermoelectric application. In this paper, ion beam sputtering was used to deposit Bi{sub 2}Te{sub 3} and Sb{sub 2}Te{sub 3} bilayer thin films on borosilicate substrates at room-temperature. Then the bismuth antimony tellurium thin films were synthesized via post thermal treatment of the Bi{sub 2}Te{sub 3} and Sb{sub 2}Te{sub 3} bilayer thin films. The effect of annealing temperature and compositions on the thermoelectric properties of the thin films was investigated. After the thin films were annealed from 150 °C to 350 °C for 1 h in the high vacuum condition, the Seebeck coefficient changed from a negative sign to a positive sign. The X-ray diffraction results showed that the synthesized tellurium-based thermoelectric thin film exhibited various alloys phases, which contributed different thermoelectricity conductivity to the synthesized thin film. The overall Seebeck coefficient of the synthesized thin film changed from negative sign to positive sign, which was due to the change of the primary phase of the tellurium-based materials at different annealing conditions. Similarly, the thermoelectric properties of the films were also associated with the grown phase. High-quality thin film with the Seebeck coefficient of 240 μV K{sup −1} and the power factor of 2.67 × 10{sup −3} Wm{sup −1} K{sup −2} showed a single Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} phase when the Sb/Te thin film sputtering time was 40 min. - Highlights: • Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} thermoelectric thin films synthesized via bilayer annealing • The film has single Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} phase with best thermoelectric performance. • The film has high thermoelectric properties comparable with other best results.

  9. Validation of a new design of tellurium dioide-irradiated target

    Energy Technology Data Exchange (ETDEWEB)

    Fllaoui, Aziz; Ghamad, Younes; Zoubir, Brahim; Ayaz, Zinel Abidine; El Morabiti, Aissam; Amayoud, Hafid [Centre National de l' Energie des Sciences et des Techniques Nucleaires, Rabat (Morocco); Chakir, El Mahjoub [Nuclear Physics Department, University Ibn Toufail, Kenitra (Morocco)

    2016-10-15

    Production of iodine-131 by neutron activation of tellurium in tellurium dioxide (TeO{sub 2}) material requires a target that meets the safety requirements. In a radiopharmaceutical production unit, a new lid for a can was designed, which permits tight sealing of the target by using tungsten inert gas welding. The leakage rate of all prepared targets was assessed using a helium mass spectrometer. The accepted leakage rate is ≤ 10 - 4 mbr.L/s, according to the approved safety report related to iodine-131 production in the TRIGA Mark II research reactor (TRIGA: Training, Research, Isotopes, General Atomics). To confirm the resistance of the new design to the irradiation conditions in the TRIGA Mark II research reactor's central thimble, a study of heat effect on the sealed targets for 7 hours in an oven was conducted and the leakage rates were evaluated. The results show that the tightness of the targets is ensured up to 600 .deg. C with the appearance of deformations on lids beyond 450 .deg. C. The study of heat transfer through the target was conducted by adopting a one-dimensional approximation, under consideration of the three transfer modes-convection, conduction, and radiation. The quantities of heat generated by gamma and neutron heating were calculated by a validated computational model for the neutronic simulation of the TRIGA Mark II research reactor using the Monte Carlo N-Particle transport code. Using the heat transfer equations according to the three modes of heat transfer, the thermal study of I-131 production by irradiation of the target in the central thimble showed that the temperatures of materials do not exceed the corresponding melting points. To validate this new design, several targets have been irradiated in the central thimble according to a preplanned irradiation program, going from 4 hours of irradiation at a power level of 0.5 MW up to 35 hours (7 h/d for 5 days a week) at 1.5 MW. The results show that the irradiated targets are

  10. Validation of a New Design of Tellurium Dioxide-Irradiated Target

    Directory of Open Access Journals (Sweden)

    Aziz Fllaoui

    2016-10-01

    Full Text Available Production of iodine-131 by neutron activation of tellurium in tellurium dioxide (TeO2 material requires a target that meets the safety requirements. In a radiopharmaceutical production unit, a new lid for a can was designed, which permits tight sealing of the target by using tungsten inert gas welding. The leakage rate of all prepared targets was assessed using a helium mass spectrometer. The accepted leakage rate is ≤ 10−4 mbr.L/s, according to the approved safety report related to iodine-131 production in the TRIGA Mark II research reactor (TRIGA: Training, Research, Isotopes, General Atomics. To confirm the resistance of the new design to the irradiation conditions in the TRIGA Mark II research reactor's central thimble, a study of heat effect on the sealed targets for 7 hours in an oven was conducted and the leakage rates were evaluated. The results show that the tightness of the targets is ensured up to 600°C with the appearance of deformations on lids beyond 450°C. The study of heat transfer through the target was conducted by adopting a one-dimensional approximation, under consideration of the three transfer modes—convection, conduction, and radiation. The quantities of heat generated by gamma and neutron heating were calculated by a validated computational model for the neutronic simulation of the TRIGA Mark II research reactor using the Monte Carlo N-Particle transport code. Using the heat transfer equations according to the three modes of heat transfer, the thermal study of I-131 production by irradiation of the target in the central thimble showed that the temperatures of materials do not exceed the corresponding melting points. To validate this new design, several targets have been irradiated in the central thimble according to a preplanned irradiation program, going from 4 hours of irradiation at a power level of 0.5 MW up to 35 hours (7 h/d for 5 days a week at 1.5 MW. The results show that the irradiated targets are

  11. Flow Cytometry Assessment of In Vitro Generated CD138+ Human Plasma Cells

    Directory of Open Access Journals (Sweden)

    Rayelle Itoua Maïga

    2014-01-01

    Full Text Available The in vitro CD40-CD154 interaction promotes human B lymphocytes differentiation into plasma cells. Currently, CD138 is the hallmark marker enabling the detection of human plasma cells, both in vitro and in vivo; its presence can be monitored by flow cytometry using a specific antibody. We have developed a culture system allowing for the differentiation of memory B lymphocytes. In order to detect the newly formed plasma cells, we have compared their staining using five anti-CD138 monoclonal antibodies (mAbs. As a reference, we also tested human cell lines, peripheral blood mononuclear cells, and bone marrow samples. The five anti-CD138 mAbs stained RPMI-8226 cells (>98% with variable stain index (SI. The highest SI was obtained with B-A38 mAb while the lowest SI was obtained with DL-101 and 1D4 mAbs. However, the anti-CD138 mAbs were not showing equivalent CD138+ cells frequencies within the generated plasma cells. B-A38, B-B4, and MI-15 were similar (15–25% while DL-101 mAb stained a higher proportion of CD138-positive cells (38–42%. DL-101 and B-A38 mAbs stained similar populations in bone marrow samples but differed in their capacity to bind to CD138high and CD138lo cell lines. In conclusion, such cellular fluctuations suggest heterogeneity in human plasma cell populations and/or in CD138 molecules.

  12. Equilibrium evaporation behavior of polonium and its homologue tellurium in liquid lead-bismuth eutectic

    International Nuclear Information System (INIS)

    Ohno, Shuji; Miyahara, Shinya; Kurata, Yuji; Katsura, Ryoei; Yoshida, Shigeru

    2006-01-01

    Experimental study using the transpiration method investigates equilibrium evaporation behavior of radionuclide polonium ( 210 Po) generated and accumulated in liquid lead-bismuth eutectic (LBE) cooled nuclear systems. The experiment consists of two series of tests: preliminary evaporation tests for homologue element tellurium (Te) in LBE, and evaporation tests for 210 Po-accumulated LBE in which test specimens are prepared by neutron irradiation. The evaporation tests of Te in LBE provide the suggestion that Te exists in a chemical form of PbTe as well as the information for confirming the validity of technique and conditions of Po test. From the evaporation tests of 210 Po in LBE, we obtain fundamental data and empirical equations such as 210 Po vapor concentration in the gas phase, 210 Po partial vapor pressure, thermodynamic activity coefficients, and gas-liquid equilibrium partition coefficient of 210 Po in LBE in the temperature range from 450 to 750degC. Additionally, radioactivity concentration of 210 Po and 210m Bi vapor in a cover gas region of a typical LBE-cooled nuclear system is specifically estimated based on the obtained experimental results, and the importance of 210 Po evaporation behavior is quantitatively demonstrated. (author)

  13. Raman and DSC studies of fragility in tellurium-zinc oxide glass formers

    International Nuclear Information System (INIS)

    Stavrou, Elissaios; Kripotou, Sotiria; Raptis, Constantine; Turrell, Sylvia; Syassen, Karl

    2011-01-01

    Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out in four mixed (TeO 2 ) 1-x (ZnO) x (x = 0.1, 0.2, 0.3, 0.4) glasses at high temperatures (Raman and DSC through the glass transition) and high pressures (Raman) with the aim of determining the fragility of these glass forming oxides. Four different criteria, corresponding to four parameters, were applied to assess the fragility of the glasses. From the DSC studies, we have obtained the fragility parameter m which corresponds to the slopes of Arrhenius (lnQ vs. 1/T g , were Q is the heating rate) plots, and the glass transition width ΔT g . Also, from the low-frequency Raman scattering, and in particular the boson peak intensity of the glasses at T g , we have estimated the fragility ratio r R (T g ) = I min /I max whose value serves as another (empirical) fragility criterion. Finally, from high pressure Raman measurements on the glasses, we have estimated the Grueneisen parameter γ T for each glass, which constitutes the fourth fragility parameter adopted in this work. Considering the four parameters ΔT g , m, r (T g ) and γ T and the generally accepted (empirical) fragility criteria, we conclude that the mixed tellurium-zinc oxides constitute strong-to-intermediate glass formers (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  14. Structural Modeling of Djenkolic Acid with Sulfur Replaced by Selenium and Tellurium

    Directory of Open Access Journals (Sweden)

    Petr Melnikov

    2014-04-01

    Full Text Available The comparative structural modeling of djenkolic acid and its derivatives containing selenium and tellurium in chalcogen sites (Ch = Se, Te has provided detailed information about the bond lengths and bond angles, filling the gap in what we know about the structural characteristics of these aminoacids. The investigation using the molecular mechanics technique with good approximation confirmed the available information on X-ray refinements for the related compounds methionine and selenomethionine, as well as for an estimate made earlier for telluromethionine. It was shown that the Ch-C(3 and Ch-C(4 bond lengths grow in parallel with the increasing anionic radii. Although the distances C-C, C-O, and C-N are very similar, the geometry of conformers is quite different owing to the possibility of rotation about four carbon atoms, hence the remarkable variability observed in dihedral angles. It was shown that the compounds contain a rigid block with two Ch atoms connected through a methylene group. The standard program Gaussian 03 with graphical interface Gaussview 4.1.2 has proved to be satisfactory tool for the structural description of less-common bioactive compositions when direct X-ray results are absent.

  15. Agglomeration during wet milling of LAST (lead-antimony-silver-tellurium) powders

    International Nuclear Information System (INIS)

    Hall, B.D.; Case, E.D.; Ren, F.; Johnson, J.R.; Timm, E.J.

    2009-01-01

    LAST (lead-antimony-silver-tellurium) compounds comprise a family of semiconducting materials with good thermoelectric properties. However, the as-cast form of LAST exhibits large grain size and hence low mechanical strength. Powder processing can produce a fine powder particle size that enhances fracture strength, however the powders tend to agglomerate if the individual powder diameters are less than a few microns across. Dry milling or wet milling (hexane additions of 0 cm 3 and 10 cm 3 ) produced hard agglomerates roughly 40 μm in diameter while wet milling with hexane additions of 25 cm 3 , 30 cm 3 or 50 cm 3 resulted in small, porous agglomerates roughly 20 μm in diameter. Thus, by adjusting the amount of milling liquid used while milling LAST powders, one can shift from hard to soft agglomerates, where the literature shows that soft agglomerates are less harmful to the final, sintered product. Also, in agreement with the results from the literature on other materials, wet milling of LAST powders produced smaller particle sizes but required longer times to reach the grindability limit

  16. From Selenium- to Tellurium-Based Glass Optical Fibers for Infrared Spectroscopies

    Directory of Open Access Journals (Sweden)

    Jacques Lucas

    2013-05-01

    Full Text Available Chalcogenide glasses are based on sulfur, selenium and tellurium elements, and have been studied for several decades regarding different applications. Among them, selenide glasses exhibit excellent infrared transmission in the 1 to 15 µm region. Due to their good thermo-mechanical properties, these glasses could be easily shaped into optical devices such as lenses and optical fibers. During the past decade of research, selenide glass fibers have been proved to be suitable for infrared sensing in an original spectroscopic method named Fiber Evanescent Wave Spectroscopy (FEWS. FEWS has provided very nice and promising results, for example for medical diagnosis. Then, some sophisticated fibers, also based on selenide glasses, were developed: rare-earth doped fibers and microstructured fibers. In parallel, the study of telluride glasses, which can have transmission up to 28 µm due to its atom heaviness, has been intensified thanks to the DARWIN mission led by the European Space Agency (ESA. The development of telluride glass fiber enables a successful observation of CO2 absorption band located around 15 µm. In this paper we review recent results obtained in the Glass and Ceramics Laboratory at Rennes on the development of selenide to telluride glass optical fibers, and their use for spectroscopy from the mid to the far infrared ranges.

  17. Dibromidochlorido{2-[(dimethylaminomethyl]phenyl-κ2N,C1}tellurium(IV

    Directory of Open Access Journals (Sweden)

    Prakul Rakesh

    2012-01-01

    Full Text Available The title compound, C9H13Br2ClNTe, was synthesized by reacting [2-(dimethylaminomethylphenyl]tellurium(II chloride with Br2. As a consequence, the Cl and Br atoms are not well ordered but distributed over the three possible positions such that the overall stiochiometry is two Br atoms and one Cl atom. The scrambling of the Br and Cl atoms indicates a small energy barrier for the exchange process between the apical and equatorial positions. Overall, the Te atom geometry is slightly distorted square pyramidal (τ = 0.052 for the major component. However, there is a weak secondary interaction between the Te atoms and the disordered Br/Cl atoms of a nearby molecule. The Te—Br and Te—Cl distances in both disorder components fall into two groups; a longer distance for the Br/Cl involved in this secondary interaction [2.6945 (17 Å for Br and 2.601 (9Å for Cl] and shorter bond distances to the remaining halogen atoms, indicating that this interaction has slightly weakened the Te—X bond, as is the case in the previously reported tribromido structure [Singh et al. (1990. J. Chem. Soc. Dalton Trans. pp. 907–913]. Otherwise, the metrical parameters in the two structures are not significantly different. An intermolecular C—H...Br interaction occurs.

  18. Size Controlled Synthesis of Tellurium Nanorices by Galvanic Displacement Reaction of Aluminum

    International Nuclear Information System (INIS)

    Wu, Tingjun; Myung, Lawrence Youngjae; Zhang, Miluo; Lee, Kyu-Hwan; Lee, Yeheun Laura; Lim, Hyo-Ryong; Kim, Bum Sung; Choa, Yong-Ho; Myung, Nosang V.

    2015-01-01

    ABSTRACT: Tellurium nanostructures were synthesized by galvanic displacement reaction (GDR) of aluminum in an alkaline solution containing TeO 3 2− ions. Due to negative redox potential of Al/AlO 2 − (i.e., −2.50 V vs. sat. Ag/AgCl), TeO 3 2− (+IV) can be reduced to Te 2 2− (-I) and Te 2− (-II), which resulted in the deposition of Te (0) nanostructures in the solution via chemical reaction between Te 2 2− or Te 2− and TeO 3 2− . The deposition mechanism led to the formation of unique “rice-like” nanostructures in the solution instead of branched structures on the substrate. The sharp tips of the “rice-like” nanostructures may be attributed to the high density of surface charges at the tips. The morphology, diameter and aspect ratio of Te “rice-like” nanostructures were altered by the TeO 3 2− concentration, solution pH, reaction time and the reaction temperature. Electrochemical analytical methods, including open circuit potential (OCP) and linear polarizations (LPs), were used to investigate the reaction mechanisms. The enhancement of piezoelectric constant (d 11 ) of nanorices at small diameter was probably due to a flexoelectric effect

  19. Determination of tellurium in gallium by alternating current stripping voltammetry with a mercury/graphite electrode

    International Nuclear Information System (INIS)

    Berengard, I.B.; Kaplan, B. Ya.

    1986-01-01

    The analytical signal in ac stripping coltammetry (ACSV) with mercury indicator electrodes depends on the weight of the electrolytically collected analyte at the electrode surface, the depth of the collection layer being equal to the effective diffusion-layer thickness. Replacement of the static mercury drop electrode (SMDE) by the mercury/graphite electrode (MGE) is of practical interest in that the analyte detection limit can be lowered by decreasing the colume of the telluriumcontaining polarographed solution; in addition, plant laboratories find it difficult to control the SDME uniformity. The work in this article was done on a PU-1 universal polarograph in a square-wave vol tage component mode using the three-electrode cell shown. The rotating mercury/graphite electrode is found by the authors to be superior to the static mercury drop electrode in that it can lower the detection limit for tellurium in gallium to 5.10 /SUP -7percent/ , due to the smaller volume of the polarographed solution

  20. Iron-tellurium-selenium mixed oxide catalysts for the selective oxidation of propylene to acrolein

    International Nuclear Information System (INIS)

    Patel, B.M.; Price, G.L.

    1990-01-01

    This paper reports on iron-tellurium-selenium mixed oxide catalysts prepared by coprecipitation from aqueous solution investigated for the propylene to acrolein reaction in the temperature range 543-773 K. Infrared spectroscopy, electron dispersive X-ray analysis, X-ray diffraction, and isotopic tracer techniques have also been employed to characterize this catalytic system. Properties of the Fe-Te-Se mixed oxide catalysts have been compared with Fe-Te mixed oxides in an effort to deduce the functionality of Se. The selenium in the Fe-Te-Se-O catalyst has been found to be the hydrocarbon activating site. The activation energies for the acrolein and carbon dioxide formation are 71 and 54 kJ/mol, respectively. Reactions carried out with 18 O 2 have shown lattice oxygen to be primarily responsible for the formation of both acrolein and carbon dioxide. The initial and rate-determining step for acrolein formation is hydrogen abstraction as determined by an isotope effect associated with the C 3 D 6 reaction. No isotope effect is observed for carbon dioxide formation from C 3 D 6 suggesting that CO 2 is formed by parallel, not consecutive, oxidation of propylene

  1. Study on concentration nonlinearity of interacting acoustic flows in cadmium sulfide and tellurium

    International Nuclear Information System (INIS)

    Ilisavskij, Yu.V.; Kulakova, L.A.; Yakhkind, Eh.Z.

    1976-01-01

    The ratio of an one-mode (self-action of an external monochromatic sound wave) and a many-mode (interaction of an external wave with crystal thermal phonons) concentration nonlinearity has been experimentally investigated on sound amplification in cadmium sulphide and tellurium. It has been shown that in a strong piezoelectric the main part in the nonlinear limitation of the sound amplification in a drift field is played by the wave interaction, i.e., the transfer of the sound wave energy into the crystal sound modes starts before the nonlinear self-action of a wave. In Te characterized by a large value of the electromechanical coupling constant value at the sound frequency of about 250 MHz the threshold of many-mode nonlinearity is achieved in fields much below the critical one, and corresponds to the sound intensity as low as 10 -7 W/cm 2 , as compared with 10 -2 W/cm 2 -the threshold of the one-mode nonlinearity

  2. Enhanced Flexural Strength of Tellurium Nanowires/epoxy Composites with the Reinforcement Effect of Nanowires

    Science.gov (United States)

    Balguri, Praveen Kumar; Harris Samuel, D. G.; Aditya, D. B.; Vijaya Bhaskar, S.; Thumu, Udayabhaskararao

    2018-02-01

    Investigating the mechanical properties of polymer nanocomposite materials has been greatly increased in the last decade. In particular, flexural strength plays a major role in resisting bending and shear loads of a composite material. Here, one dimensional (1D) tellurium nanowires (TeNWs) reinforced epoxy composites have been prepared and the flexural properties of resulted TeNWs/epoxy nanocomposites are studied. The diameter and length of the TeNWs used to make TeNWs/epoxy nanocomposites are 21±2.5 nm and 697±87 nm, respectively. Plain and TeNWs/epoxy nanocomposites are characterized by X-ray diffraction (XRD), thermogravimetric analysis (TGA), and differential thermal analysis (DTA). Furthermore, significant enhancement in the flexural strength of TeNWs/epoxy nanocomposite is observed in comparison to plain epoxy composite, i.e. flexural strength is increased by 65% with the addition of very little amount of TeNWs content (0.05 wt.%) to epoxy polymer. Structural details of plain and TeNWs/epoxy at micrometer scale were examined by scanning electron microscopy (SEM). We believe that our results provide a new type of semiconductor nanowires based high strength epoxy polymer nanocomposites.

  3. Antiparasitic activity of 1,3-dioxolanes containing tellurium in Trichomonas vaginalis.

    Science.gov (United States)

    Sena-Lopes, Ângela; das Neves, Raquel Nascimento; Bezerra, Francisco Silvestre Brilhante; de Oliveira Silva, Mara Thais; Nobre, Patrick C; Perin, Gelson; Alves, Diego; Savegnago, Lucielli; Begnini, Karine Rech; Seixas, Fabiana Kommling; Collares, Tiago; Borsuk, Sibele

    2017-05-01

    The increased prevalence of metronidazole-resistant infections has resulted in a search for alternative drugs for the treatment of trichomoniasis. In the present study, we report the preparation and in vitro activity of three 1,3-dioxolanes that contain tellurium (PTeDOX 01, PTeDOX 02, and PTeDOX 03) against Trichomonas vaginalis. Six concentrations of these compounds were analyzed for in vitro activity against ATCC 30236 isolate of T. vaginalis. PTeDOX 01 reported a cytotoxic effect against 100% of T. vaginalis trophozoites at a final concentration of 90μM with an IC 50 of 60μM. The kinetic growth curve of trophozoites indicated that PTeDOX 01 reduced the growth by 22% at a concentration of 90μM after an exposure of 12h, and induced complete parasite death at 24h. It induced cytotoxicity of 44% at 90μM concentration but and had no effect in lower concentrations in a culture of CHO-K1 cells. These results confirmed that PTeDOX 01 is an important drug for the treatment of T. vaginalis, and should be evaluated in other infectious agents as well. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  4. MicroRNA-138 regulates osteogenic differentiation of human stromal (mesenchymal) stem cells in vivo

    DEFF Research Database (Denmark)

    Eskildsen, Tilde; Taipaleenmäki, Hanna; Stenvang, Jan

    2011-01-01

    Elucidating the molecular mechanisms that regulate human stromal (mesenchymal) stem cell (hMSC) differentiation into osteogenic lineage is important for the development of anabolic therapies for treatment of osteoporosis. MicroRNAs (miRNAs) are short, noncoding RNAs that act as key regulators......-regulated during osteoblast differentiation of hMSCs. Overexpression of miR-138 inhibited osteoblast differentiation of hMSCs in vitro, whereas inhibition of miR-138 function by antimiR-138 promoted expression of osteoblast-specific genes, alkaline phosphatase (ALP) activity, and matrix mineralization. Furthermore...

  5. 25 CFR 170.138 - Can roads be built in roadless and wild areas?

    Science.gov (United States)

    2010-04-01

    ... RESERVATION ROADS PROGRAM Indian Reservation Roads Program Policy and Eligibility Recreation, Tourism and Trails § 170.138 Can roads be built in roadless and wild areas? Under 25 CFR part 265 no roads can be...

  6. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    Energy Technology Data Exchange (ETDEWEB)

    Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN, CH-1211 Geneva 23 (Switzerland); School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Fedorov, D. [Petersburg Nuclear Physics Institute, 188350 Gatchina (Russian Federation); Fedosseev, V.N.; Forster, L.; Marsh, B.A. [CERN, CH-1211 Geneva 23 (Switzerland); Rossel, R.E. [CERN, CH-1211 Geneva 23 (Switzerland); Institut für Physik, Johannes Gutenberg Universität, D-55099 Mainz (Germany); Faculty of Design, Computer Science and Media, Hochschule RheinMain, Wiesbaden (Germany); Rothe, S.; Veinhard, M. [CERN, CH-1211 Geneva 23 (Switzerland)

    2016-09-11

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  7. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    CERN Document Server

    Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

    2016-01-01

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  8. Reaction of 1-bromo-3-chloropropane with tellurium and dimethyl telluride in the system of hydrazine hydrate-alkali

    International Nuclear Information System (INIS)

    Russavskaya, N.V.; Levanova, E.P.; Sukhomazova, Eh.N.; Grabel'nykh, V.A.; Elaev, A.V.; Klyba, L.V.; Zhanchipova, E.R.; Albanov, A.I.; Korotaeva, I.M.; Toryashinova, D.S.D.; Korchevin, N.A.

    2006-01-01

    A synthesis of oligomeric substance of thiocol type, the poly(trimethyleneditelluride), from 1-bromo-3-chloropropane and elemental tellurium is performed using a hydrazine hydrate-alkali system. Reductive splitting of the tellurocol followed by alkylation with methyl iodide give rise to preparation of bis(methyltelluro)propane, which was synthesized also from dimethyl telluride and 1,3-dihalopropanes using the N 2 H 4 ·H 2 O/KOH system. The reaction products were characterized by elementary analysis, NMR, and IR spectra. Mass spectra of the synthesized low molecular weight organotellurium compounds are considered [ru

  9. Luminescent Tellurium-Doped Cadmium Sulfide Electrodes as Probes of Semiconductor Excited-State Deactivation Processes in Photoelectrochemical Cells.

    Science.gov (United States)

    1980-08-12

    photocurrent and emission intensity. Whereas CdS:Te electrochemistry consisted of oxidation of an electrolyte 2+ reductant, ZnO underwent photoanodic...employed n- and 1 3 2,3 3 3,4p-type GaPl’ n-type ZnO , n-type CdS , and n- and p-type GaAs. We have focussed our attention recently on n-type, tellurium...should point out that our treatment of Or and 0x is not without precedent. Both GaP- and ZnO -based PECs have been examined in this regard.l12 The

  10. 15 CFR 13.8 - Opportunity to comment on proposed Federal financial assistance and direct Federal development.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Opportunity to comment on proposed Federal financial assistance and direct Federal development. 13.8 Section 13.8 Commerce and Foreign Trade Office of the Secretary of Commerce INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF COMMERCE PROGRAMS AND ACTIVITIES § 13.8 Opportunity to comment on...

  11. Evaluation of the Content of Antimony, Arsenic, Bismuth, Selenium, Tellurium and Their Inorganic Forms in Commercially Baby Foods.

    Science.gov (United States)

    Ruiz-de-Cenzano, M; Rochina-Marco, A; Cervera, M L; de la Guardia, M

    2017-12-01

    Baby foods, from the Spanish market and prepared from meat, fish, vegetables, cereals, legumes, and fruits, were analyzed to obtain the concentration of antimony (Sb), arsenic (As), bismuth (Bi), and tellurium (Te) as toxic elements and selenium (Se) as essential element. An analytical procedure was employed based on atomic fluorescence spectroscopy which allowed to obtain accurate data at low levels of concentration. Values of 14 commercial samples, expressed in nanograms per gram fresh weight, ranged for Sb 0.66-6.9, As 4.5-242, Te 1.35-2.94, Bi 2.18-4.79, and Se 5.4-109. Additionally, speciation studies were performed based on data from a non-chromatographic screening method. It was concluded that tellurium and bismuth were mainly present as inorganic forms and selenium as organic form, and antimony and arsenic species depend on the ingredients of each baby food. Risk assessment considerations were made by comparing dietary intake of the aforementioned elements through the consumption of one baby food portion a day and recommended or tolerable guideline values.

  12. Tellurium rings as electron pair donors in cluster compounds and coordination polymers; Tellurringe als Elektronenpaardonoren in Clusterverbindungen und Koordinationspolymeren

    Energy Technology Data Exchange (ETDEWEB)

    Guenther, Anja

    2011-11-08

    In this dissertation novel and already known molecular tellurium rings are presented in cluster compounds and quasi-one-dimensional coordination polymers. The cyclic, homonuclear units are always stabilized by coordination to electron-rich transition metal atoms, with the coordinating tellurium atoms acting as two-electron donors. As a synthesis route, the solid-state reaction in quartz glass vials was used uniformly. In addition to structural determination, the focus was on the characterization of the resulting compounds. For this purpose, resistance measurements were carried out on selected compounds, the magnetic behavior and the thermal degradation reactions were investigated and accompanying quantum chemical calculations were carried out. [German] In dieser Dissertation werden neuartige sowie bereits bekannte molekulare Tellurringe in Clusterverbindungen und quasi-eindimensionalen Koordinationspolymeren vorgestellt. Die Stabilisierung der zyklischen, homonuklearen Einheiten erfolgt dabei stets durch die Koordination an elektronenreiche Uebergangsmetallatome, wobei die koordinierenden Telluratome gegenueber diesen als Zwei-Elektronendonoren fungieren. Als Syntheseroute wurde dabei einheitlich auf die Festkoerperreaktion in Quarzglasampullen zurueckgegriffen. Neben der Strukturaufklaerung stand die Charakterisierung der erhaltenden Verbindungen im Fokus der Arbeit. Dazu wurden an ausgewaehlten Verbindungen Widerstandsmessungen durchgefuehrt, das magnetische Verhalten sowie die thermischen Abbaureaktionen untersucht und begleitende quantenchemische Rechnungen durchgefuehrt.

  13. A138

    Directory of Open Access Journals (Sweden)

    K. Yurchenko

    2015-11-01

    Thus, results suggest that vascular disruption in the NDV-treated group indicates the virus ability to directly or indirectly affect tumor angiogenesis and regulate tissue trophism in that way. Understanding how and in which step this effect occurs may provide capacity to use oncolytic NDV strains for therapeutic benefit.

  14. Surface studies on graphite furnace platforms covered with Pd, Rh and Ir as modifiers in graphite furnace atomic absorption spectrometry of tellurium

    Energy Technology Data Exchange (ETDEWEB)

    Pedro, Juana [Area de Química Analítica, Departamento de Química, Facultad de Ingeniería Química, Universidad Nacional del Litoral, Santiago del Estero 2829 (S3000GL.N), Santa Fe (Argentina); Stripekis, Jorge [Laboratorio de Análisis de Trazas, Departamento de Química Inorgánica, Analítica y Química Física, INQUIMAE, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria (1428), Buenos Aires (Argentina); Departamento de Ingeniería Química, Instituto Tecnológico de Buenos Aires, Av. Eduardo Madero 399 (1106), Buenos Aires (Argentina); Bonivardi, Adrian [Area de Química Analítica, Departamento de Química, Facultad de Ingeniería Química, Universidad Nacional del Litoral, Santiago del Estero 2829 (S3000GL.N), Santa Fe (Argentina); Tudino, Mabel, E-mail: tudino@qi.fcen.uba.ar [Laboratorio de Análisis de Trazas, Departamento de Química Inorgánica, Analítica y Química Física, INQUIMAE, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria (1428), Buenos Aires (Argentina)

    2015-05-01

    The main objective of this work is the study of correlations between the efficiency of the distribution of the permanent platinum group modifiers Pd, Rh and Ir over the graphite surface with the aim of improving analytical signal of tellurium. Modifier solution was deposited onto the platform and pyrolysed after drying. In the case of Pd, the physical vaporization/deposition technique was also tested. In order to analyze the differences amongst coverings (morphology, topology and distribution), the graphite surfaces were studied with scanning electron microscopy and energy dispersive X-ray microscopy. Micrographs for physical vaporization and pyrolytic deposition of Pd were also analyzed in order to explain the lack of signal obtained for tellurium with the first alternative. Similar micrographs were obtained for pyrolytic deposition of Ir and Rh and then, compared to those of Pd. Ir showed the most homogeneous distribution on the graphite surface and the tallest and sharpest transient. With the aim of improving the analytical signal of tellurium, the correlation between the surface studies and the tellurium transient signal (height, area and shape) is discussed. - Highlights: • Distribution of Rh, Pd and Ir onto graphite furnaces is evaluated by SEM and EDX • Micrographs and spectra showed that surface distribution could influence Te signal. • Ir showed the best signal together with the most homogeneous surface distribution. • Pd-PVD micrographs revealed the absence of graphite and no signal for Te.

  15. Chemical processes for the extreme enrichment of tellurium into marine ferromanganese oxides

    Science.gov (United States)

    Kashiwabara, Teruhiko; Oishi, Yasuko; Sakaguchi, Aya; Sugiyama, Toshiki; Usui, Akira; Takahashi, Yoshio

    2014-04-01

    Tellurium, an element of growing economic importance, is extremely enriched in marine ferromanganese oxides. We investigated the mechanism of this enrichment using a combination of spectroscopic analysis and adsorption/coprecipitation experiments. X-ray Absorption Near-Edge Structure (XANES) analysis showed that in adsorption/coprecipitation systems, Te(IV) was oxidized on δ-MnO2 and not oxidized on ferrihydrite. Extended X-ray Absorption Fine Structure (EXAFS) analysis showed that both Te(IV) and Te(VI) were adsorbed on the surface of δ-MnO2 and ferrihydrite via formation of inner-sphere complexes. In addition, Te(VI) can be structurally incorporated into the linkage of Fe octahedra through a coprecipitation process because of its molecular geometry that is similar to the Fe octahedron. The largest distribution coefficient obtained in the adsorption/coprecipitation experiments was for the Te(VI)/ferrihydrite coprecipitation system, and it was comparable to those calculated from the distribution between natural ferromanganese oxides and seawater. Our XAFS and micro-focused X-ray fluorescence (μ-XRF) mapping of natural ferromanganese oxides showed that Te was structurally incorporated as Te(VI) in Fe (oxyhydr)oxide phases. We conclude that the main process for the enrichment of Te in ferromanganese oxides is structural incorporation of Te(VI) into Fe (oxyhydr)oxide phases through coprecipitation. This mechanism can explain the unique degree of enrichment of Te compared with other oxyanions, which are mainly enriched via adsorption on the surface of the solid structures. In particular, the great contrast in the distributions of Te and Se is caused by their oxidized species: (i) the similar geometry of the Te(VI) molecule to Fe octahedron, and (ii) quite soluble nature of Se(VI). Coexisting Mn oxide phases may promote structural incorporation of Te(VI) by oxidation of Te(IV), although the surface oxidation itself may not work as the critical enrichment process as

  16. 28 CFR 0.138 - Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco...

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of Alcohol, Tobacco, Firearms, and Explosives, Bureau of Prisons, Federal... Administrative Matters § 0.138 Federal Bureau of Investigation, Drug Enforcement Administration, Bureau of...

  17. Analysis on metallogenetic geological and physicochemical conditions in uranium deposit No.138

    International Nuclear Information System (INIS)

    Tang Qitao

    1996-01-01

    The uranium deposit No.138 is of Mesozoic volcano-sedimentary transformation type. This paper discusses such geological conditions as source of uranium, stratigraphy and lithology, lithofacies and paleogeography, paleoclimate, structure and reworking-regeneration, and such physicochemical conditions as uranium adsorbent and reductant, effective porosity, chemical compositions, pH and Eh of rocks in the deposit

  18. Down-regulation of human cytomegalovirus UL138, a novel latency ...

    Indian Academy of Sciences (India)

    2013-07-12

    Jul 12, 2013 ... observed a 74.6% decrease in luciferase activity and a 46.2% decrease in HCMV UL138 protein expression. Our .... Trizol agent (Takara, Dalian, China), according to the man- ... hybrid primer and polyA structure were found in the se- quence. ..... resolution profiling and analysis of viral and host small RNAs.

  19. Complete genome sequence of an attenuated Sparfloxacin-resistant Streptococcus agalactiae strain 138spar

    Science.gov (United States)

    The complete genome of a sparfloxacin-resistant Streptococcus agalactiae vaccine strain 138spar is 1,838,126 bp in size. The genome has 1892 coding sequences and 82 RNAs. The annotation of the genome is added by the NCBI Prokaryotic Genome Annotation Pipeline. The publishing of this genome will allo...

  20. Semaphorin 4C Protects against Allergic Inflammation: Requirement of Regulatory CD138+ Plasma Cells.

    Science.gov (United States)

    Xue, Di; Kaufman, Gabriel N; Dembele, Marieme; Beland, Marianne; Massoud, Amir H; Mindt, Barbara C; Fiter, Ryan; Fixman, Elizabeth D; Martin, James G; Friedel, Roland H; Divangahi, Maziar; Fritz, Jörg H; Mazer, Bruce D

    2017-01-01

    The regulatory properties of B cells have been studied in autoimmune diseases; however, their role in allergic diseases is poorly understood. We demonstrate that Semaphorin 4C (Sema4C), an axonal guidance molecule, plays a crucial role in B cell regulatory function. Mice deficient in Sema4C exhibited increased airway inflammation after allergen exposure, with massive eosinophilic lung infiltrates and increased Th2 cytokines. This phenotype was reproduced by mixed bone marrow chimeric mice with Sema4C deficient only in B cells, indicating that B lymphocytes were the key cells affected by the absence of Sema4C expression in allergic inflammation. We determined that Sema4C-deficient CD19 + CD138 + cells exhibited decreased IL-10 and increased IL-4 expression in vivo and in vitro. Adoptive transfer of Sema4c -/- CD19 + CD138 + cells induced marked pulmonary inflammation, eosinophilia, and increased bronchoalveolar lavage fluid IL-4 and IL-5, whereas adoptive transfer of wild-type CD19 + CD138 + IL-10 + cells dramatically decreased allergic airway inflammation in wild-type and Sema4c -/- mice. This study identifies a novel pathway by which Th2-mediated immune responses are regulated. It highlights the importance of plasma cells as regulatory cells in allergic inflammation and suggests that CD138 + B cells contribute to cytokine balance and are important for maintenance of immune homeostasis in allergic airways disease. Furthermore, we demonstrate that Sema4C is critical for optimal regulatory cytokine production in CD138 + B cells. Copyright © 2016 by The American Association of Immunologists, Inc.

  1. Leaching of cadmium and tellurium from cadmium telluride (CdTe) thin-film solar panels under simulated landfill conditions

    Science.gov (United States)

    Ramos-Ruiz, Adriana; Wilkening, Jean V.; Field, James A.; Sierra-Alvarez, Reyes

    2017-01-01

    A crushed non-encapsulated CdTe thin-film solar cell was subjected to two standardized batch leaching tests (i.e., Toxicity Characteristic Leaching Procedure (TCLP) and California Waste Extraction Test (WET)) and to a continuous-flow column test to assess cadmium (Cd) and tellurium (Te) dissolution under conditions simulating the acidic- and the methanogenic phases of municipal solid waste landfills. Low levels of Cd and Te were solubilized in both batch leaching tests (leaching behavior of CdTe in the columns is related to different aqueous pH and redox conditions promoted by the microbial communities in the columns, and is in agreement with thermodynamic predictions. PMID:28472709

  2. Development of tellurium oxide and lead-bismuth oxide glasses for mid-wave infra-red transmission optics

    Science.gov (United States)

    Zhou, Beiming; Rapp, Charles F.; Driver, John K.; Myers, Michael J.; Myers, John D.; Goldstein, Jonathan; Utano, Rich; Gupta, Shantanu

    2013-03-01

    Heavy metal oxide glasses exhibiting high transmission in the Mid-Wave Infra-Red (MWIR) spectrum are often difficult to manufacture in large sizes with optimized physical and optical properties. In this work, we researched and developed improved tellurium-zinc-barium and lead-bismuth-gallium heavy metal oxide glasses for use in the manufacture of fiber optics, optical components and laser gain materials. Two glass families were investigated, one based upon tellurium and another based on lead-bismuth. Glass compositions were optimized for stability and high transmission in the MWIR. Targeted glass specifications included low hydroxyl concentration, extended MWIR transmission window, and high resistance against devitrification upon heating. Work included the processing of high purity raw materials, melting under controlled dry Redox balanced atmosphere, finning, casting and annealing. Batch melts as large as 4 kilograms were sprue cast into aluminum and stainless steel molds or temperature controlled bronze tube with mechanical bait. Small (100g) test melts were typically processed in-situ in a 5%Au°/95%Pt° crucible. Our group manufactured and evaluated over 100 different experimental heavy metal glass compositions during a two year period. A wide range of glass melting, fining, casting techniques and experimental protocols were employed. MWIR glass applications include remote sensing, directional infrared counter measures, detection of explosives and chemical warfare agents, laser detection tracking and ranging, range gated imaging and spectroscopy. Enhanced long range mid-infrared sensor performance is optimized when operating in the atmospheric windows from ~ 2.0 to 2.4μm, ~ 3.5 to 4.3μm and ~ 4.5 to 5.0μm.

  3. Flavoprotein-mediated tellurite reduction: structural basis and applications to the synthesis of tellurium-containing nanostructures

    Directory of Open Access Journals (Sweden)

    Mauricio Arenas-Salinas

    2016-07-01

    Full Text Available The tellurium oxyanion tellurite (TeO32- is extremely harmful for most organisms. It has been suggested that a potential bacterial tellurite resistance mechanism would consist of an enzymatic, NAD(PH-dependent, reduction to the less toxic form elemental tellurium (Te0. To date, a number of enzymes such as catalase, type II NADH dehydrogenase and terminal oxidases from the electron transport chain, nitrate reductases, and dihydrolipoamide dehydrogenase (E3, among others, have been shown to display tellurite-reducing activity. This activity is generically referred to as tellurite reductase (TR. Bioinformatic data resting on some of the abovementioned enzymes enabled the identification of common structures involved in tellurite reduction including vicinal catalytic cysteine residues and the FAD/NAD(P+-binding domain, which is characteristic of some flavoproteins. Along this line, thioredoxin reductase (TrxB, alkyl hydroperoxide reductase (AhpF, glutathione reductase (GorA, mercuric reductase (MerA, NADH: flavorubredoxin reductase (NorW, dihydrolipoamide dehydrogenase, and the putative oxidoreductase YkgC from Escherichia coli or environmental bacteria were purified and assessed for TR activity. All of them displayed in vitro TR activity at the expense of NADH or NADPH oxidation. In general, optimal reducing conditions occurred around pH 9-10 and 37 °C.Enzymes exhibiting strong TR activity produced Te-containing nanostructures (TeNS. While GorA and AhpF generated TeNS of 75 nm average diameter, E3 and YkgC produced larger structures (> 100 nm. Electron-dense structures were observed in cells over-expressing genes encoding TrxB, GorA and YkgC.

  4. MicroRNA-138 is a potential regulator of memory performance in humans

    Directory of Open Access Journals (Sweden)

    Julia eSchröder

    2014-07-01

    Full Text Available Genetic factors underlie a substantial proportion of individual differences in cognitive functions in humans, including processes related to episodic and working memory. While genetic association studies have proposed several candidate memory genes, these currently explain only a minor fraction of the phenotypic variance. Here, we performed genome-wide screening on 13 episodic and working memory phenotypes in 1,318 participants of the Berlin Aging Study II aged 60 years or older. The analyses highlight a number of novel single nucleotide polymorphisms (SNPs associated with memory performance, including one located in a putative regulatory region of microRNA (miRNA hsa-mir-138-5p (rs9882688, P-value = 7.8x10-9. Expression quantitative trait locus analyses on next-generation RNA-sequencing data revealed that rs9882688 genotypes show a significant correlation with the expression levels of this miRNA in 309 human lymphoblastoid cell lines (P-value = 5x10-4. In silico modeling of other top-ranking GWAS signals identified an additional memory-associated SNP in the 3' untranslated region (3'UTR of DCP1B, a gene encoding a core component of the mRNA decapping complex in humans, predicted to interfere with hsa-mir-138-5p binding. This prediction was confirmed in vitro by luciferase assays showing differential binding of hsa-mir-138-5p to 3'UTR reporter constructs in two human cell lines (HEK293: P-value = 0.0470; SH-SY5Y: P-value = 0.0866. Finally, expression profiling of hsa-mir-138-5p and DCP1B mRNA in human post-mortem brain tissue revealed that both molecules are expressed simultaneously in frontal cortex and hippocampus, suggesting that the proposed interaction between hsa-mir-138-5p and DCP1B may also take place in vivo. In summary, by combining unbiased genome-wide screening with extensive in silico modeling, in vitro functional assays, and gene expression profiling, our study identified miRNA-138 as a potential molecular regulator of human memory

  5. Cysteine 138 mutation in HIV-1 Nef from patients with delayed disease progression

    DEFF Research Database (Denmark)

    Tolstrup, Martin; Laursen, Alex Lund; Gerstoft, J.

    2006-01-01

    .0139). The phylogeny of isolates was investigated and the variants harbouring the cysteine 138 mutation clustered independently. CONCLUSION: The present study describes a viral genetic polymorphism related to AIDS disease progression. The polymorphism (cysteine 138) has previously been reported to confer decreased......-1 isolates from patients in a long-term non-progressor (LTNP) cohort and a slow-progressor (SP) cohort (n = 11) was analysed and compared with isolates from a control patient group of progressors (n = 18). Most of the patients with delayed disease progression had extensive medical records, providing...... an insight into the LTNP disease profile and allowing for the stratification of patients based on their CD4 cell decline. RESULTS: In sequences from nine patients, most of the functional domains of HIV-1 Nef appeared intact, and no major deletions were observed to possibly account for an effect...

  6. Natural radioactive nuclides 138La and 176Lu in rare earth ore samples

    International Nuclear Information System (INIS)

    Zhang Weiping; Shen Jianfeng; Lu Zhaolun; Jiang Rangrong

    1993-01-01

    The contents of 1 '3 8 La and 176 Lu in some rare earth mines have been measured with a HPGE γ spectrometer. The measurements show that the contents of 138 La and 176 Lu in one rare earth mine are remarkably different from those in the other and they do not display a proportional relation, and that the contents of 40 K in this mine are very low

  7. Radioiodine therapy in management of thyroid carcinoma - A review of 138 patients

    International Nuclear Information System (INIS)

    Hossain, A.S.; Hossain, S.; Hafiz, N.; Taslima, D.A.; Rashid, H.

    2001-01-01

    Differentiated thyroid carcinomas are being treated by using a widely accepted protocol of surgery and radioiodine therapy followed by supplementation of thyroid hormones in the Nuclear Medicine Centre (NMC), Dhaka Medical College Hospital (DMCH) since 1990. In the present study 138 patients(Male-54, Female-84) with differentiated thyroid cancers received radioiodine therapy for ablation of residual thyroid tissue with a dose of 2.77-3.7 GBq (75-100 mCi), for lymph node metastases 5.55-6.5 GBq(150-175mCi), for lung metastases 5.55 GBq(150 mCi) and for bony metastases 7.4 GBq (200 mCi). Among 138 patients papillary carcinoma was observed in 94 cases (68%; Male-42, Female-52), follicular type was found in 30 cases (22%; Male-8, Female-22) and mixed type in 14 patients (10%, Male-4, Female-10). Single dose of 2.77-3.7 GBq(75-100 mCi) of radioiodine was received by all 138 patients. Among the unablated patients 62 received double doses totalling 9.25 GBq (250 mCi), 44 received three doses 12.95 GBq (350 mCi) and one patient received 8 doses 33.3 GBq (900 mCi). Out of 138 patients single dose ablated 76 cases and 62 remain unablated. Multiple doses ablated 28 patients and 34 still remain unablated and is under follow up. The success and failure in management of patients with differentiated thyroid cancer over 8 years period have been discussed here revealing a satisfactory outcome. (author)

  8. Determination of gold, indium, tellurium and thallium in the same sample digest of geological materials by atomic-absorption spectroscopy and two-step solvent extraction

    Science.gov (United States)

    Hubert, A.E.; Chao, T.T.

    1985-01-01

    A rock, soil, or stream-sediment sample is decomposed with hydrofluoric acid, aqua regia, and hydrobromic acid-bromine solution. Gold, thallium, indium and tellurium are separated and concentrated from the sample digest by a two-step MIBK extraction at two concentrations of hydrobromic add. Gold and thallium are first extracted from 0.1M hydrobromic acid medium, then indium and tellurium are extracted from 3M hydrobromic acid in the presence of ascorbic acid to eliminate iron interference. The elements are then determined by flame atomic-absorption spectrophotometry. The two-step solvent extraction can also be used in conjunction with electrothermal atomic-absorption methods to lower the detection limits for all four metals in geological materials. ?? 1985.

  9. Post-irradiation characterization of PH13-8Mo martensitic stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Jong, M.; Schmalz, F.; Rensman, J.W. [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Luzginova, N.V., E-mail: luzginova@nrg.eu [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands); Wouters, O.; Hegeman, J.B.J.; Laan, J.G. van der [Nuclear Research and consultancy Group, Westerduinweg 3, 1755 ZG Petten (Netherlands)

    2011-10-01

    The irradiation response of PH13-8Mo stainless steel was measured up to 2.5 dpa at 200 and 300 deg. C irradiation temperatures. The PH13-8Mo, a martensitic precipitation-hardened steel, was produced by Hot Isostatic Pressing at 1030 deg. C. The fatigue tests (high cycle fatigue and fatigue crack propagation) showed a test temperature dependency but no irradiation effects. Tensile tests showed irradiation hardening (yield stress increase) of approximately 37% for 200 deg. C irradiated material tested at 60 deg. C and approximately 32% for 300 deg. C irradiated material tested at 60 deg. C. This contradicts the shift in reference temperature (T{sub 0}) measured in toughness tests (Master Curve approach), where the {Delta}T{sub 0} for 300 deg. C irradiated is approximately 170 deg. C and the {Delta}T{sub 0} for the 200 deg. C irradiated is approximately 160 deg. C. This means that the irradiation hardening of PH13-8Mo steel is not suitable to predict the shift in the reference temperature for the Master Curve approach.

  10. 14 CFR 91.138 - Temporary flight restrictions in national disaster areas in the State of Hawaii.

    Science.gov (United States)

    2010-01-01

    ... disaster areas in the State of Hawaii. 91.138 Section 91.138 Aeronautics and Space FEDERAL AVIATION... areas in the State of Hawaii. (a) When the Administrator has determined, pursuant to a request and justification provided by the Governor of the State of Hawaii, or the Governor's designee, that an inhabited...

  11. 40 CFR 63.138 - Process wastewater provisions-performance standards for treatment processes managing Group 1...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process wastewater provisions-performance standards for treatment processes managing Group 1 wastewater streams and/or residuals removed from Group 1 wastewater streams. 63.138 Section 63.138 Protection of Environment ENVIRONMENTAL...

  12. Use of Iodine-131 to Tellurium-132 Ratios for Assessing the Relationships between Human Inhaled Radioactivity and Environmental Monitoring after the Accident in Fukushima

    Directory of Open Access Journals (Sweden)

    Koji Uchiyama

    2018-03-01

    Full Text Available Significant differences in findings were seen between the intake amounts of iodine-131 that were derived from direct measurements and the estimated intake from environmental monitoring data at the Fukushima accident. To clarify these discrepancies, we have investigated the iodine-131 and tellurium-132 body burdens of five human subjects, who after being exposed to a radioactive plume, underwent 21.5 h whole body counter measurements at Fukui Prefectural Hospital, so clear intake scenario and thyroid counter measurement data were available. To determine the iodine-131 and tellurium-132 body burdens, we introduced a new method of whole body counter calibration composed of a self-consistent approach with the time-dependent correction efficiency factors concept. The ratios of iodine-131 to tellurium-132, ranging from 0.96 ± 0.05 to 2.29 ± 0.38, were consistent with results of the environmental measurements. The 24 h iodine uptake values ranging from 12.1–16.0% were within euthyroid range in Japanese people. These results suggest, even if the relatively low thyroid iodine uptake in the Japanese population was taken into consideration, that there is no doubt about the consistency between direct measurements and environmental monitoring data. Adequate intake scenario is suggested to be principally important to estimate the inhaled radioactivity in areas in or around nuclear accidents.

  13. miR-138 protects cardiomyocytes from hypoxia-induced apoptosis via MLK3/JNK/c-jun pathway

    Energy Technology Data Exchange (ETDEWEB)

    He, Siyi; Liu, Peng; Jian, Zhao; Li, Jingwei; Zhu, Yun; Feng, Zezhou; Xiao, Yingbin, E-mail: xiaoyb@vip.sina.com

    2013-11-29

    Highlights: •First time to find miR-138 is up-regulated in hypoxic cardiomyocytes. •First time to find miR-138 targets MLK3 and regulates JNK/c-jun pathway. •Rare myocardial biopsy of patients with CHD were collected. •Both silence and overexpression of miR-138 were implemented. •Various methods were used to detect cell function. -- Abstract: Cardiomyocytes experience a series of complex endogenous regulatory mechanisms against apoptosis induced by chronic hypoxia. MicroRNAs are a class of endogenous small non-coding RNAs that regulate cellular pathophysiological processes. Recently, microRNA-138 (miR-138) has been found related to hypoxia, and beneficial for cell proliferation. Therefore, we intend to study the role of miR-138 in hypoxic cardiomyocytes and the main mechanism. Myocardial samples of patients with congenital heart disease (CHD) were collected to test miR-138 expression. Agomir or antagomir of miR-138 was transfected into H9C2 cells to investigate its effect on cell apoptosis. Higher miR-138 expression was observed in patients with cyanotic CHD, and its expression gradually increased with prolonged hypoxia time in H9C2 cells. Using MTT and LDH assays, cell growth was significantly greater in the agomir group than in the negative control (NC) group, while antagomir decreased cell survival. Dual luciferase reporter gene and Western-blot results confirmed MLK3 was a direct target of miR-138. It was found that miR-138 attenuated hypoxia-induced apoptosis using TUNEL, Hoechst staining and Annexin V-PE/7-AAD flow cytometry analysis. We further detected expression of apoptosis-related proteins. In the agomir group, the level of pro-apoptotic proteins such as cleaved-caspase-3, cleaved-PARP and Bad significantly reduced, while Bcl-2 and Bcl-2/Bax ratio increased. Opposite changes were observed in the antagomir group. Downstream targets of MLK3, JNK and c-jun, were also suppressed by miR-138. Our study demonstrates that up-regulation of miR-138 plays

  14. Characterization of deamidation at Asn138 in L-chain of recombinant humanized Fab expressed from Pichia pastoris.

    Science.gov (United States)

    Ohkuri, Takatoshi; Murase, Eri; Sun, Shu-Lan; Sugitani, Jun; Ueda, Tadashi

    2013-10-01

    A method was previously established for evaluating Asn deamidation by matrix-assisted laser desorption/ionization time of flight-mass spectrometry using endoproteinase Asp-N. In this study, we demonstrated that this method could be applied to the identification of the deamidation site of the humanized fragment antigen-binding (Fab). First, a system for expressing humanized Fab from methylotrophic yeast Pichia pastoris was constructed, resulting in the preparation of ∼30 mg of the purified humanized Fab from 1 l culture. Analysis of the L-chain derived from recombinant humanized Fab that was heated at pH 7 and 100°C for 1 h showed the deamidation at Asn138 in the constant region. Then, we prepared L-N138D Fab and L-N138A Fab and examined their properties. The circular dichroism (CD) spectrum of the L-N138D Fab was partially different from that of the wild-type Fab. The measurement of the thermostability showed that L-N138D caused a significant decrease in the thermostability of Fab. On the other hand, the CD spectrum and thermostability of L-N138A Fab showed the same behaviour as the wild-type Fab. Thus, it was suggested that the introduction of a negative charge at position 138 in the L-chain by the deamidation significantly affected the stability of humanized Fab.

  15. Raman scattering boson peak and differential scanning calorimetry studies of the glass transition in tellurium-zinc oxide glasses.

    Science.gov (United States)

    Stavrou, E; Tsiantos, C; Tsopouridou, R D; Kripotou, S; Kontos, A G; Raptis, C; Capoen, B; Bouazaoui, M; Turrell, S; Khatir, S

    2010-05-19

    Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out on four mixed tellurium-zinc oxide (TeO(2))(1 - x)(ZnO)(x) (x = 0.1, 0.2, 0.3, 0.4) glasses under variable temperature, with particular attention being given to the respective glass transition region. From the DSC measurements, the glass transition temperature T(g) has been determined for each glass, showing a monotonous decrease of T(g) with increasing ZnO content. The Raman study is focused on the low-frequency band of the glasses, the so-called boson peak (BP), whose frequency undergoes an abrupt decrease at a temperature T(d) very close to the respective T(g) values obtained by DSC. These results show that the BP is highly sensitive to dynamical effects over the glass transition and provides a means for an equally reliable (to DSC) determination of T(g) in tellurite glasses and other network glasses. The discontinuous temperature dependence of the BP frequency at the glass transition, along with the absence of such a behaviour by the high-frequency Raman bands (due to local atomic vibrations), indicates that marked changes of the medium range order (MRO) occur at T(g) and confirms the correlation between the BP and the MRO of glasses.

  16. Raman scattering boson peak and differential scanning calorimetry studies of the glass transition in tellurium-zinc oxide glasses

    International Nuclear Information System (INIS)

    Stavrou, E; Tsiantos, C; Tsopouridou, R D; Kripotou, S; Kontos, A G; Raptis, C; Capoen, B; Bouazaoui, M; Turrell, S; Khatir, S

    2010-01-01

    Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out on four mixed tellurium-zinc oxide (TeO 2 ) 1-x (ZnO) x (x = 0.1, 0.2, 0.3, 0.4) glasses under variable temperature, with particular attention being given to the respective glass transition region. From the DSC measurements, the glass transition temperature T g has been determined for each glass, showing a monotonous decrease of T g with increasing ZnO content. The Raman study is focused on the low-frequency band of the glasses, the so-called boson peak (BP), whose frequency undergoes an abrupt decrease at a temperature T d very close to the respective T g values obtained by DSC. These results show that the BP is highly sensitive to dynamical effects over the glass transition and provides a means for an equally reliable (to DSC) determination of T g in tellurite glasses and other network glasses. The discontinuous temperature dependence of the BP frequency at the glass transition, along with the absence of such a behaviour by the high-frequency Raman bands (due to local atomic vibrations), indicates that marked changes of the medium range order (MRO) occur at T g and confirms the correlation between the BP and the MRO of glasses.

  17. Enhancement of Thermoelectric Properties of PEDOT:PSS and Tellurium-PEDOT:PSS Hybrid Composites by Simple Chemical Treatment

    Science.gov (United States)

    Jin Bae, Eun; Hun Kang, Young; Jang, Kwang-Suk; Yun Cho, Song

    2016-01-01

    The thermoelectric properties of poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) and tellurium-PEDOT:PSS (Te-PEDOT:PSS) hybrid composites were enhanced via simple chemical treatment. The performance of thermoelectric materials is determined by their electrical conductivity, thermal conductivity, and Seebeck coefficient. Significant enhancement of the electrical conductivity of PEDOT:PSS and Te-PEDOT:PSS hybrid composites from 787.99 and 11.01 to 4839.92 and 334.68 S cm-1, respectively was achieved by simple chemical treatment with H2SO4. The power factor of the developed materials could be effectively tuned over a very wide range depending on the concentration of the H2SO4 solution used in the chemical treatment. The power factors of the developed thermoelectric materials were optimized to 51.85 and 284 μW m-1 K-2, respectively, which represent an increase of four orders of magnitude relative to the corresponding parameters of the untreated thermoelectric materials. Using the Te-PEDOT:PSS hybrid composites, a flexible thermoelectric generator that could be embedded in textiles was fabricated by a printing process. This thermoelectric array generates a thermoelectric voltage of 2 mV using human body heat.

  18. Acousto-optic control of internal acoustic reflection in tellurium dioxide crystal in case of strong elastic energy walkoff [Invited].

    Science.gov (United States)

    Voloshinov, Vitaly; Polikarpova, Nataliya; Ivanova, Polina; Khorkin, Vladimir

    2018-04-01

    Peculiar cases of acoustic wave propagation and reflection may be observed in strongly anisotropic acousto-optical crystals. A tellurium dioxide crystal serves as a prime example of such media, since it possesses record indexes of acoustic anisotropy. We studied one of the unusual scenarios of acoustic incidence and reflection from a free crystal-vacuum boundary in paratellurite. The directions of the acoustic waves in the (001) plane of the crystal were determined, and their basic characteristics were calculated. The carried-out acousto-optic experiment at the wavelength of light 532 nm and the acoustic frequency 73 MHz confirmed the theoretical predictions. The effects examined in the paper include the acoustic wave propagation with the record walkoff angle 74°. We also observed the incidence of the wave on the boundary at the angle exceeding 90°. Finally, we registered the close-to-back reflection of acoustic energy following the incidence. One of the stunning aspects is the distribution of energy between the incident and the back-reflected wave. The unusual features of the acoustic wave reflections pointed out in the paper are valuable for their possible applications in acousto-optic devices.

  19. Resonant ionization by laser beams: application to ions sources and to study the nuclear structure of radioactive tellurium isotopes

    International Nuclear Information System (INIS)

    Sifi, R.

    2007-07-01

    The radioactive ion beams that are produced through current isotope separators are well separated according to the A mass but not according to the Z parameter. The resonant ionization through laser beams applied to ion sources allows the production of radioactive ion beam in a very selective and efficient way by eliminating the isobaric contamination. The first chapter is dedicated to the resonant ionization by laser beams, we describe the principle, the experimental setting, the lasers used, the ionization schemes and the domain of application. The second chapter deals with the application of resonant ionization to laser ion sources for the production of radioactive ion beams. We present experimental tests performed for getting copper ion beams. Resonant ionization through laser is also used in the spectroscopy experiments performed at the Isolde (isotope separation on-line device) installation in CERN where more than 20 elements are ionized very efficiently. The technique is based on a frequency scanning around the excitation transition of the atoms in order to probe the hyperfine structure. Laser spectroscopy allows the determination of the hyperfine structure as well as the isotopic shift of atoms. In the third chapter the method is applied to the spectroscopy of tellurium atoms. First, we define the 2 parameters on which the extraction is based: charge radius and nuclear moments, then we present several theoretical models that we have used to assess our experimental results. (A.C.)

  20. Comparative Analysis of Supply Risk-Mitigation Strategies for Critical Byproduct Minerals: A Case Study of Tellurium.

    Science.gov (United States)

    Bustamante, Michele L; Gaustad, Gabrielle; Alonso, Elisa

    2018-01-02

    Materials criticality assessment is a screening framework increasingly applied to identify materials of importance that face scarcity risks. Although these assessments highlight materials for the implicit purpose of informing future action, the aggregated nature of their findings make them difficult to use for guidance in developing nuanced mitigation strategy and policy response. As a first step in the selection of mitigation strategies, the present work proposes a modeling framework and accompanying set of metrics to directly compare strategies by measuring effectiveness of risk reduction as a function of the features of projected supply demand balance over time. The work focuses on byproduct materials, whose criticality is particularly important to understand because their supplies are inherently less responsive to market balancing forces, i.e., price feedbacks. Tellurium, a byproduct of copper refining, which is critical to solar photovoltaics, is chosen as a case study, and three commonly discussed byproduct-relevant strategies are selected: dematerialization of end-use product, byproduct yield improvement, and end-of-life recycling rate improvement. Results suggest that dematerialization will be nearly twice as effective at reducing supply risk as the next best option, yield improvement. Finally, due to its infrequent use at present and its dependence upon long product lifespans, recycling end-of-life products is expected to be the least effective option despite potentially offering other benefits (e.g., cost savings and environmental impact reduction).

  1. On the study of proton-irradiated Tellurium targets relevant for production of medical radioisotopes 123I and 124I

    International Nuclear Information System (INIS)

    Imam Kambali; Hari Suryanto; Daya Agung Sarwono; Cahyana Amiruddin

    2014-01-01

    The energy loss distribution and range of energetic proton beams in tellurium (Te) target have been simulated using the Stopping and Range of Ion in Matter (SRIM 2013) codes. The calculated data of the proton's range were then used to determine the optimum thickness of Te targets for future production of 123 I and 124 I from 123 Te(p,n) 123 I, 124 Te(p,n) 124 I and 124 Te(p,2n) 123 I nuclear reactions using the BATAN's Cs-30 cyclotron. It was found that for an incidence angle of 0° with respect to the target normal, the optimum thickness of 123 Te and 124 Te targets for 123 I production should be 644 µm and 1.8 mm respectively, whereas a 649 µm thick 124 Te target would be Required for 124 I production. In addition, the thickness should be decreased with increasing incidence angle. The EOB yield could theoretically reach up to 13.62 Ci of 123 I at proton energy of 22 Me V and beam current of 30 µA if the 124 Te is irradiated over a period of 3 hours. The theoretical EOB yield is comparable to the experimental data with accuracy within 10%. (author)

  2. Leaching of cadmium and tellurium from cadmium telluride (CdTe) thin-film solar panels under simulated landfill conditions.

    Science.gov (United States)

    Ramos-Ruiz, Adriana; Wilkening, Jean V; Field, James A; Sierra-Alvarez, Reyes

    2017-08-15

    A crushed non-encapsulated CdTe thin-film solar cell was subjected to two standardized batch leaching tests (i.e., Toxicity Characteristic Leaching Procedure (TCLP) and California Waste Extraction Test (WET)) and to a continuous-flow column test to assess cadmium (Cd) and tellurium (Te) dissolution under conditions simulating the acidic- and the methanogenic phases of municipal solid waste landfills. Low levels of Cd and Te were solubilized in both batch leaching tests (<8.2% and <3.6% of added Cd and Te, respectively). On the other hand, over the course of 30days, 73% of the Cd and 21% of the Te were released to the synthetic leachate of a continuous-flow column simulating the acidic landfill phase. The dissolved Cd concentration was 3.24-fold higher than the TCLP limit (1mgL -1 ), and 650-fold higher than the maximum contaminant level established by the US-EPA for this metal in drinking water (0.005mgL -1 ). In contrast, the release of Cd and Te to the effluent of the continuous-flow column simulating the methanogenic phase of a landfill was negligible. The remarkable difference in the leaching behavior of CdTe in the columns is related to different aqueous pH and redox conditions promoted by the microbial communities in the columns, and is in agreement with thermodynamic predictions. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Clinical characteristics of 138 Chinese female patients with idiopathic hypogonadotropic hypogonadism

    Directory of Open Access Journals (Sweden)

    Rui-yi Tang

    2017-11-01

    Full Text Available Objective: To evaluate the clinical features of Chinese women with idiopathic hypogonadotropic hypogonadism (IHH. Methods: We retrospectively reviewed the clinical characteristics, laboratory and imaging findings, therapeutic management and fertility outcomes of 138 women with IHH. All patients had been treated and followed up at an academic medical centre during 1990–2016. Results: Among the 138 patients, 82 patients (59.4% were diagnosed with normosmic IHH and 56 patients (40.6% were diagnosed with Kallmann syndrome (KS. The patients with IHH experienced occasional menses (4.3%, spontaneous thelarche (45.7% or spontaneous pubarche (50.7%. Women with thelarche had a higher percentage of pubarche (P < 0.001 and higher gonadotropin concentrations (P < 0.01. Olfactory bulb/sulci abnormalities were found during the magnetic resonance imaging (MRI of all patients with KS. Most patients with IHH had osteopenia and low bone age. Among the 16 women who received gonadotropin-releasing hormone treatment, ovulation induction or assisted reproductive technology, the clinical pregnancy rate was 81.3% and the live birth rate was 68.8%. Conclusions: The present study revealed that the phenotypic spectrum of women with IHH is broader than typical primary amenorrhoea with no secondary sexual development, including occasional menses, spontaneous thelarche or pubarche. MRI of the olfactory system can facilitate the diagnosis of KS. Pregnancy can be achieved after receiving appropriate treatment.

  4. CORRELATION OF 48Ca, 50Ti, AND 138La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

    International Nuclear Information System (INIS)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang

    2015-01-01

    Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

  5. [Clinical analysis of 138 multiple primary cancers diagnosed of digestive system malignant tumor initially].

    Science.gov (United States)

    Lyu, J M; Xiong, H C; Wu, B; Zhou, X Q; Hu, J

    2018-02-23

    Objective: To study the clinical characteristics, strategy of treatment and prognosis of multiple primary cancers(MPC) diagnosed of digestive system malignant tumor firstly. Methods: From January, 2000 to December, 2015, the clinical, follow-up and prognostic data of 138 MPC patients diagnosed of digestive system malignant tumor firstly were retrospectively analyzed. Results: 138 cases were found in 10 580 cases with malignant tumors, and the incidence was 1.30%. There were 129 cases of duplex primary cancers, 8 cases of triple primary cancers and 1 case of quintuple primary cancers. The repetitive primary cancer was occurred in digestive system (61cases, 44.2%) most frequently, with the next in respiratory system (46 cases, 33.3%). 52.2% (72 cases) suffered second primary cancer in 2 years after first primary cancer diagnosed, and 75.4% (104 cases) in 5 years. The median overall survival in patients with all cancer lesions radically treated was 168 months, better than any other treatment (68 months, P digestive system malignant tumor most frequently occurred in the digestive system and respiratory system. More concern should be attracted in follow-up, especially in the first 5 years. The key to improve patient' prognosis was radical treatment to every primary cancer.

  6. Spin-dependent γ softness or triaxiality in even-even 132-138Nd nuclei

    Science.gov (United States)

    Chai, Qing-Zhen; Wang, Hua-Lei; Yang, Qiong; Liu, Min-Liang

    2015-02-01

    The properties of γ instability in rapidly rotating even-even 132-138Nd isotopes have been investigated using the pairing-deformation self-consistent total-Routhian-surface calculations in a deformation space of (β2, γ, β4). It is found that even-even 134-138Nd nuclei exhibit triaxiality in both ground and excited states, even up to high-spin states. The lightest isotope possesses a well-deformed prolate shape without a γ deformation component. The current numerical results are compared with previous calculations and available observables such as quadrupole deformation β2 and the feature of γ-band levels, showing basically a general agreement with the observed trend of γ correlations (e.g. the pattern of the odd-even energy staggering of the γ band). The existing differences between theory and experiment are analyzed and discussed briefly. Supported by National Natural Science Foundation of China (10805040,11175217), Foundation and Advanced Technology Research Program of Henan Province(132300410125) and S & T Research Key Program of Henan Province Education Department (13A140667)

  7. 75 FR 54921 - Withdrawal of Regulatory Guides 1.38, 1.94, and 1.116

    Science.gov (United States)

    2010-09-09

    ... Guide 1.38, ``Quality Assurance Requirements for Packaging, Shipping, Receiving, Storage, and Handling....116, ``Quality Assurance Requirements for Installation, Inspection, and Testing of Mechanical... Development Branch, Division of Engineering, Office of Nuclear Regulatory Research, U.S. Nuclear Regulatory...

  8. Effect of miR-138 on the antioxidant function of lens epithelial cells affected by age-related cataracts

    Directory of Open Access Journals (Sweden)

    Bo Lu

    2018-03-01

    Full Text Available AIM: To investigate the effects and mechanism of miR-138 in mediating the antioxidant function of lens epithelial cells affected by age-related cataracts. METHODS: Real-time quantitative PCR(RT-qPCRwas used to detect miR-138 expression in the anterior lens capsules of healthy people, the anterior lens capsules of patients with age-related cataracts, and human epithelial cell line(SRA01/04cells exposed to oxidative stress. A 2', 7'-dichloro-fluorescein diacetate(DCFH-DAprobe was used to measure the levels of endogenous reactive oxygen species(ROSin human lens epithelial cells(hLECsexposed to 400μmol/L H2O2 for 1h. SRA01/04 cells were transfected with either miR-138 mimics, mimic controls, miR-138 inhibitors or inhibitor controls. After 72h, these cells were exposed to 400μmol/L H2O2 for 1h, then p53 and Bax mRNA expression were measured using RT-qPCR. Expression of p53 and Bax protein were also measured by western blotting analysis. Finally, cell viability was assessed using an MTS assay. RESULTS: Compared to the control group, expression of miR-138 in the anterior lens capsules of age-related cataract patients and in SRA01/04 cells exposed to oxidative stress significantly increased(PPPPCONCLUSION: The expression of miR-138 is upregulated in the anterior lens capsules of age-related cataract patients. MiR-138 decreases the anti-oxidative stress capacity of lens epithelial cells by upregulating p53 and Bax, while inhibiting cell proliferation and repair. This finding suggests that miR-138 may play a key role in the development of age-related cataracts.

  9. The use of masking agents in the determination, by hydride generation and atomic-absorption spectrophotometry, of arsenic, antimony, selenium, tellurium, and bismuth in the presence of noble metals

    International Nuclear Information System (INIS)

    Kellerman, S.P.

    1982-01-01

    The effectiveness of thiosemicarbazide, tellurium, and potassium iodide as masking agents to eliminate interferences was assessed. Thiosemicarbazide was found to be effective in eliminating or reducing the interferences on arsenic, antimony, and bismuth, and tellurium reduced the interferences on selenium. The interferences on tellurium could not be eliminated. Arsenic, antimony, selenium, and bismuth were determined in metal sulphide concentrates that were spiked with the noble metals (defined here as gold plus all the platinum-group metals except osmium). The relative standard deviations for arsenic, antimony, bismuth, and selenium were 0,061, 0,017, 0,029, and 0,145 respectively. The values obtained for all the analytes agreed favourably with the preferred values for two in-house reference samples. The laboratory method is detailed in an appendix

  10. Silencing of microRNA-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes by targeting FOXC1: miR-138 promotes cartilage degradation.

    Science.gov (United States)

    Yuan, Y; Zhang, G Q; Chai, W; Ni, M; Xu, C; Chen, J Y

    2016-10-01

    Osteoarthritis (OA) is characterised by articular cartilage degradation. MicroRNAs (miRNAs) have been identified in the development of OA. The purpose of our study was to explore the functional role and underlying mechanism of miR-138-5p in interleukin-1 beta (IL-1β)-induced extracellular matrix (ECM) degradation of OA cartilage. Human articular cartilage was obtained from patients with and without OA, and chondrocytes were isolated and stimulated by IL-1β. The expression levels of miR-138-5p in cartilage and chondrocytes were both determined. After transfection with miR-138-5p mimics, allele-specific oligonucleotide (ASO)-miR-138-5p, or their negative controls, the messenger RNA (mRNA) levels of aggrecan (ACAN), collagen type II and alpha 1 (COL2A1), the protein levels of glycosaminoglycans (GAGs), and both the mRNA and protein levels of matrix metalloproteinase (MMP)-13 were evaluated. Luciferase reporter assay, quantitative real-time polymerase chain reaction (qRT-PCR), and Western blot were performed to explore whether Forkhead Box C1 (FOCX1) was a target of miR-138-5p. Further, we co-transfected OA chondrocytes with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 and then stimulated with IL-1β to determine whether miR-138-5p-mediated IL-1β-induced cartilage matrix degradation resulted from targeting FOXC1. MiR-138-5p was significantly increased in OA cartilage and in chondrocytes in response to IL-1β-stimulation. Overexpression of miR-138-5p significantly increased the IL-1β-induced downregulation of COL2A1, ACAN, and GAGs, and increased the IL-1β-induced over expression of MMP-13.We found that FOXC1 is directly regulated by miR-138-5p. Additionally, co-transfection with miR-138-5p mimics and pcDNA3.1 (+)-FOXC1 resulted in higher levels of COL2A1, ACAN, and GAGs, but lower levels of MMP-13. miR-138-5p promotes IL-1β-induced cartilage degradation in human chondrocytes, possibly by targeting FOXC1.Cite this article: Y. Yuan, G. Q. Zhang, W. Chai,M. Ni, C. Xu, J

  11. Crossing 138: two approaches to churn under the Affordable Care Act.

    Science.gov (United States)

    Ravel, Gabriel; DeSantis, J Angelo

    2014-01-01

    A predicted side effect of the Medicaid expansion and state-based Exchanges under the Affordable Care Act is churn. Churn is the shifting into and out of eligibility for insurance affordability programs due to income changes. Because the line between Medicaid and Exchange eligibility is fine -138% of the federal poverty level -millions of Americans are expected to gain and lose eligibility. Frequently, this churning undermines continuity of care, raises costs, and frustrates those affected. This article explores two proposed programs to mitigate the effects of churn: the Basic Health Program and the Bridge Program. This article evaluates both programs' ability to mitigate the effects of churn, the likely side effects to states' implementing them, and legal and practical obstacles to their implementation. It concludes that the Bridge Program is the better approach.

  12. Results of the radiological survey at 23 Yardboro Avenue, Albany, New York (AL138)

    International Nuclear Information System (INIS)

    Marley, J.L.

    1987-12-01

    A number of properties in the Albany/Colonie area have been identified as being potentially contaminated with uranium originating from the former National Lead Company's uranium forming plant in Colonie, New York. The property at 23 Yardboro Avenue in Albany, New York (AL138) was the subject of a radiological investigation initiated May 7, 1986. The property was a residence with a one and one-half-story frame house located on a rectangular lot. An asphalt driveway or parking area is located at the east side of the house. An area of /approximately/10 m /times/ 14 m at the rear was inaccessible. A diagram of the property showing the approximate boundaries and the 3-m grid network established for measurements outside the house is shown. The lot included in the radiological survey was /approximately/14 m wide by 36 m deep. Front and rear views of the property are shown. 13 refs., 5 figs., 5 tabs

  13. PCB138, but not PCB153 and PCB180, acts as a weak antiandrogen in vitro

    DEFF Research Database (Denmark)

    Vinggaard, A.M.; Bonefeld-Jørgensen, Eva Cecilie

    2000-01-01

    The polychlorinated biphenyls (PCBs) constitute a group of persistent environmental chemicals including 209 possible congeners exhibiting a variety of chlorine substitution patterns. Due to their lipophilic nature and resistance toward biotransformation, PCBs accumulate in the food chain and all...... environmental matrixes including human adipose tissue, blood and milk. In most biological extracts PCB#138 (2,2',3,4,4',5-hexaCB), PCB#153 (2,2',4,4',5,5'-hexaCB), and PCB#180 (2,2',3,4,4',5,5'-heptaCB) are the dominating components. Depending on the position and number of chlorine substitutions, different...... classes of PCB congeners elicit a complex spectrum of biological and toxic responses in in vivo and in vitro models. Some PCBs exert dioxin-like activities mediated through the aryl hydrocarbon receptor (Ah receptor) giving rise to health risk such as organ toxicity and carcinogenesis. Although reports...

  14. Challenges in assessment of clean energy supply-chains based on byproduct minerals: A case study of tellurium use in thin film photovoltaics

    International Nuclear Information System (INIS)

    Bustamante, Michele L.; Gaustad, Gabrielle

    2014-01-01

    Highlights: • Byproduct mining presents unique challenges to quantifying energy security issues. • This case study shows Te scarcity is closely tied to Cu demand and production. • Material intensity changes over time have a significant impact on projections. • Recycling as a mitigation strategy is shown to have poor short-term results. - Abstract: Transitioning to a sustainable energy supply will be critical to meeting future economic and environmental goals. This transition will require optimizing and commercializing a portfolio of new clean energy technologies. However, many promising clean energy technologies are based on materials with inherent risks in their supply; these risks include scarcity, price volatility, criticality, and other potential supply-chain disruptions. Using tellurium use in CdTe photovoltaics as a case study, this paper presents analysis of some of the key challenges associated with modeling byproduct systems (a supply-chain where a key material is actually a byproduct of extraction of another material, copper in the case of tellurium). This work presents a novel modeling approach; the results of the case study are used to identify potential supply risks facing this clean technology, with a unique focus on sensitivity to changes in the preliminary lifecycle stages. Supply-chain sensitivities are connected with direct environmental impacts to frame the implications in a broader sustainability context and to emphasize the future role of recycling. Ultimately, it was shown that if historical supply and demand trends continue, supply gap conditions will emerge before the end of the current decade. However, improvements in byproduct yield, end-use recycling rate, and end-use material intensity exhibit significant leverage to minimize risk in the energy-critical tellurium supply-chain

  15. Determination of tellurium at ultra-trace levels in drinking water by on-line solid phase extraction coupled to graphite furnace atomic absorption spectrometer

    International Nuclear Information System (INIS)

    Pedro, Juana; Stripekis, Jorge; Bonivardi, Adrian; Tudino, Mabel

    2008-01-01

    In this paper, two time-based flow injection (FI) separation pre-concentration systems coupled to graphite furnace atomic absorption spectrometry (GFAAS) for tellurium determination are studied and compared. The first alternative involves the pre-concentration of the analyte onto Dowex 1X8 employed as packaging material of a micro-column inserted in the flow system. The second set-up is based on the co-precipitation of tellurium with La(OH) 3 followed by retention onto XAD resins. Both systems are compared in terms of limit of detection, linear range, RSD%, sample throughput, micro-columns lifetime and aptitude for fully automatic operation. The features of the Dowex system are: 37% efficiency of retention and an enhancement factor of 42 for a pre-concentration time of 180 seconds (sample flow rate = 3 ml min -1 ) with acetic acid elution volumes of 80 μl. The detection limit (3 s) is 7 ng l -1 and the relative standard deviation (n = 7200 ng l -1 ) is 5.8%. The analytical performance of the XAD system is: 72% efficiency of retention and an enhancement factor of 25 for a pre-concentration time of 180 s (sample flow rate = 3 ml min -1 ) with nitric acid elution volumes of 300 μl. The detection limit is 66 ng l -1 and the relative standard deviation (n = 7200 ng l -1 ) is 8.3%. Applications to the determination of tellurium in tap water and the validation of the analytical methodology employing SRM 1643e as certified reference material are shown

  16. Sh2-138: physical environment around a small cluster of massive stars

    Science.gov (United States)

    Baug, T.; Ojha, D. K.; Dewangan, L. K.; Ninan, J. P.; Bhatt, B. C.; Ghosh, S. K.; Mallick, K. K.

    2015-12-01

    We present a multiwavelength study of the Sh2-138, a Galactic compact H II region. The data comprise of optical and near-infrared (NIR) photometric and spectroscopic observations from the 2-m Himalayan Chandra Telescope, radio observations from the Giant Metrewave Radio Telescope (GMRT), and archival data covering radio through NIR wavelengths. A total of 10 Class I and 54 Class II young stellar objects (YSOs) are identified in a 4.6 arcmin×4.6 arcmin area of the Sh2-138 region. Five compact ionized clumps, with four lacking of any optical or NIR counterparts, are identified using the 1280 MHz radio map, and correspond to sources with spectral type earlier than B0.5. Free-free emission spectral energy distribution fitting of the central compact H II region yields an electron density of ˜2250 ± 400 cm-3. With the aid of a wide range of spectra, from 0.5-15 μm, the central brightest source - previously hypothesized to be the main ionizing source - is characterized as a Herbig Be type star. At large scale (15 arcmin ×15 arcmin), the Herschel images (70-500 μm) and the nearest neighbour analysis of YSOs suggest the formation of an isolated cluster at the junction of filaments. Furthermore, using a greybody fit to the dust spectrum, the cluster is found to be associated with the highest column density (˜3 × 1022 cm-2) and high temperature (˜35 K) regime, as well as with the radio continuum emission. The mass of the central clump seen in the column density map is estimated to be ˜3770 M⊙.

  17. Assessment of bone marrow plasma cell infiltrates in multiple myeloma: the added value of CD138 immunohistochemistry

    Science.gov (United States)

    Al-Quran, Samer Z.; Yang, Lijun; Magill, James M.; Braylan, Raul C.; Douglas-Nikitin, Vonda K.

    2012-01-01

    Summary Assessment of bone marrow involvement by malignant plasma cells is an important element in the diagnosis and follow-up of patients with multiple myeloma and other plasma cell dyscrasias. Microscope-based differential counts of bone marrow aspirates are used as the primary method to evaluate bone marrow plasma cell percentages. However, multiple myeloma is often a focal process, a fact that impacts the accuracy and reliability of the results of bone marrow plasma cell percentages obtained by differential counts of bone marrow aspirate smears. Moreover, the interobserver and intraobserver reproducibility of counting bone marrow plasma cells microscopically has not been adequately tested. CD138 allows excellent assessment of plasma cell numbers and distribution in bone marrow biopsies. We compared estimates of plasma cell percentages in bone marrow aspirates and in hematoxylin-eosin– and CD138-stained bone marrow biopsy sections (CD138 sections) in 79 bone marrows from patients with multiple myeloma. There was a notable discrepancy in bone marrow plasma cell percentages using the different methods of observation. In particular, there was a relatively poor concordance of plasma cell percentage estimation between aspirate smears and CD138 sections. Estimates of plasma cell percentage using CD138 sections demonstrated the highest interobserver concordance. This observation was supported by computer-assisted image analysis. In addition, CD138 expression highlighted patterns of plasma cell infiltration indicative of neoplasia even in the absence of plasmacytosis. We conclude that examination of CD138 sections should be considered for routine use in the estimation of plasma cell load in the bone marrow. PMID:17714757

  18. Test of irradiation of tellurium oxide for obtaining iodine-131 by dry distillation; Prueba de irradiacion de dioxido de telurio para obtener yodo-131 por destilacion seca

    Energy Technology Data Exchange (ETDEWEB)

    Alanis M, J. [ININ, Departamento de Materiales Radiactivos, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2003-07-15

    With the purpose of optimizing to the maximum independently the work of the reactor of those mathematical calculations of irradiation that are already optimized, now it corresponds to carry out irradiation tests in the different positions with their respective neutron fluxes that it counts the reactor for samples irradiation. Then, it is necessary to carry out the irradiation of the tellurium dioxide through cycles, with the purpose of observing the activity that it goes accumulating in each cycle and this way to obtain an activity of the Iodine-131 obtained when finishing the last cycle. (Author)

  19. Formation of tellurium nanocrystals during anaerobic growth of bacteria that use Te oxyanions as respiratory electron acceptors

    Science.gov (United States)

    Baesman, S.M.; Bullen, T.D.; Dewald, J.; Zhang, Dongxiao; Curran, S.; Islam, F.S.; Beveridge, T.J.; Oremland, R.S.

    2007-01-01

    Certain toxic elements support the metabolism of diverse prokaryotes by serving as respiratory electron acceptors for growth. Here, we demonstrate that two anaerobes previously shown to be capable of respiring oxyanions of selenium also achieve growth by reduction of either tellurate [Te(VI)] or tellurite [Te(IV)] to elemental tellurium [Te(0)]. This reduction achieves a sizeable stable-Te-isotopic fractionation (isotopic enrichment factor [??] = -0.4 to -1.0 per ml per atomic mass unit) and results in the formation of unique crystalline Te(0) nanoarchitectures as end products. The Te(0) crystals occur internally within but mainly externally from the cells, and each microorganism forms a distinctly different structure. Those formed by Bacillus selenitireducens initially are nanorods (???10-nm diameter by 200-nm length), which cluster together, forming larger (???1,000-nm) rosettes composed of numerous individual shards (???100-nm width by 1,000-nm length). In contrast, Sulfurospirillium barnesii forms extremely small, irregularly shaped nanospheres (diameter < 50 nm) that coalesce into larger composite aggregates. Energy-dispersive X-ray spectroscopy and selected area electron diffraction indicate that both biominerals are composed entirely of Te and are crystalline, while Raman spectroscopy confirms that they are in the elemental state. These Te biominerals have specific spectral signatures (UV-visible light, Raman) that also provide clues to their internal structures. The use of microorganisms to generate Te nanomaterials may be an alternative for bench-scale syntheses. Additionally, they may also generate products with unique properties unattainable by conventional physical/chemical methods. Copyright ?? 2007, American Society for Microbiology. All Rights Reserved.

  20. Extracellular proteases from Streptomyces phaeopurpureus ExPro138 inhibit spore adhesion, germination and appressorium formation in Colletotrichum coccodes.

    Science.gov (United States)

    Palaniyandi, S A; Yang, S H; Suh, J-W

    2013-07-01

    To study the antifungal mechanism of proteases from Streptomyces phaeopurpureus strain ExPro138 towards Colletotrichum coccodes and to evaluate its utilization as biofungicide. We screened proteolytic Streptomyces strains from the yam rhizosphere with antifungal activity. Forty proteolytic Streptomyces were isolated, among which eleven isolates showed gelatinolytic activity and antagonistic activity on C. coccodes. Of the 11 isolates, protease preparation from an isolate designated ExPro138 showed antifungal activity. 16S rDNA sequence analysis of the strain showed 99% similarity with Streptomyces phaeopurepureus (EU841588.1). Zymography analysis of the ExPro138 culture filtrate revealed that the strain produced several extracellular proteases. The protease preparation inhibited spore germination, spore adhesion to polystyrene surface and appressorium formation. Microscopic study of the interaction between ExPro138 and C. coccodes revealed that ExPro138 was mycoparasitic on C. coccodes. The protease preparation also reduced anthracnose incidence on tomato fruits compared with untreated control. This study demonstrates possibility of utilizing antifungal proteases derived from antagonistic microbes as biofungicide. Microbial proteases having the ability to inhibit spore adhesion and appressorium formation could be used to suppress infection establishment by foliar fungal pathogens at the initial stages of the infection process. Journal of Applied Microbiology © 2013 The Society for Applied Microbiology.

  1. Stability studies of arsenic, selenium, antimony and tellurium species in water, urine, fish and soil extracts using HPLC/ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Lindemann, T.; Prange, A.; Neidhart, B. [GKSS Research Centre, Geesthacht (Germany). Inst. of Physical and Chemical Analysis; Dannecker, W. [Hamburg Univ. (Germany). Inst. fuer Anorganische und Angewandte Chemie

    2000-10-01

    The stability of arsenic, selenium, antimony and tellurium species in water and urine (NIST SRM 2670n) as well as in extracts of fish and soil certified reference materials (DORM-2 and NIST SRM 2710) has been investigated. Stability studies were carried out with As(III), As(V), arsenobetaine, monomethylarsonic acid (MMA), dimethylarsinic acid (DMA), phenylarsonic acid (PAA), Se(IV), Se(VI), selenomethionine, Sb(III), Sb(V) and Te(VI). Speciation analysis was performed by on-line coupling of anion exchange high-performance liquid chromatography (HPLC) with inductively coupled plasma mass spectrometry (ICP-MS). Best storage of aqueous mixtures of the examined species was achieved at 3 C whereas at -20 C species transformation especially of selenomethionine and Sb(V) took place and a new selenium species appeared within a period of 30 days. Losses and species transformations during extraction processes were investigated. Extraction of the spiked fish material with methanol/water led to partial conversion of Sb(III), Sb(V) and selenomethionine to two new antimony and one new selenium species. The other arsenic, selenium and tellurium species were almost quantitatively extracted. For soil spiked with MMA, PAA, Se(IV) and Sb(III), recoveries after extraction with water and sulfuric acid (0.01 mol/L) were below 20%. (orig.)

  2. A functional screen implicates microRNA-138-dependent regulation of the depalmitoylation enzyme APT1 in dendritic spine morphogenesis

    DEFF Research Database (Denmark)

    Siegel, Gabriele; Obernosterer, Gregor; Fiore, Roberto

    2009-01-01

    of acyl protein thioesterase 1 (APT1), an enzyme regulating the palmitoylation status of proteins that are known to function at the synapse, including the alpha(13) subunits of G proteins (Galpha(13)). RNA-interference-mediated knockdown of APT1 and the expression of membrane-localized Galpha(13) both...... suppress spine enlargement caused by inhibition of miR-138, suggesting that APT1-regulated depalmitoylation of Galpha(13) might be an important downstream event of miR-138 function. Our results uncover a previously unknown miRNA-dependent mechanism in neurons and demonstrate a previously unrecognized...

  3. Isolation of Human CD138+ Microparticles from the Plasma of Patients with Multiple Myeloma

    Directory of Open Access Journals (Sweden)

    Sabna Rajeev Krishnan

    2016-01-01

    Full Text Available The confinement of multiple myeloma (MM to the bone marrow microenvironment requires an invasive bone marrow biopsy to monitor the malignant compartment. The existing clinical tools used to determine treatment response and tumor relapse are limited in sensitivity mainly because they indirectly measure tumor burden inside the bone marrow and fail to capture the patchy, multisite tumor infiltrates associated with MM. Microparticles (MPs are 0.1- to 1.0-μm membrane vesicles, which contain the cellular content of their originating cell. MPs are functional mediators and convey prothrombotic, promalignant, proresistance, and proinflammatory messages, establishing intercellular cross talk and bypassing the need for direct cell-cell contact in many pathologies. In this study, we analyzed plasma cell–derived MPs (CD138+ from deidentified MM patients (n = 64 and normal subjects (n = 18 using flow cytometry. The morphology and size of the MPs were further analyzed using scanning electron microscopy. Our study shows the proof of a systemic signature of MPs in MM patients. We observed that the levels of MPs were significantly elevated in MM corresponding to the tumor burden. We provide the first evidence for the presence of MPs in the peripheral blood of MM patients with potential applications in personalized MM clinical monitoring.

  4. Ten Good Reasons for the Use of the Tellurium-Centered Anderson-Evans Polyoxotungstate in Protein Crystallography.

    Science.gov (United States)

    Bijelic, Aleksandar; Rompel, Annette

    2017-06-20

    Protein crystallography represents at present the most productive and most widely used method to obtain structural information on target proteins and protein-ligand complexes within the atomic resolution range. The knowledge obtained in this way is essential for understanding the biology, chemistry, and biochemistry of proteins and their functions but also for the development of compounds of high pharmacological and medicinal interest. Here, we address the very central problem in protein crystallography: the unpredictability of the crystallization process. Obtaining protein crystals that diffract to high resolutions represents the essential step to perform any structural study by X-ray crystallography; however, this method still depends basically on trial and error making it a very time- and resource-consuming process. The use of additives is an established process to enable or improve the crystallization of proteins in order to obtain high quality crystals. Therefore, a more universal additive addressing a wider range of proteins is desirable as it would represent a huge advance in protein crystallography and at the same time drastically impact multiple research fields. This in turn could add an overall benefit for the entire society as it profits from the faster development of novel or improved drugs and from a deeper understanding of biological, biochemical, and pharmacological phenomena. With this aim in view, we have tested several compounds belonging to the emerging class of polyoxometalates (POMs) for their suitability as crystallization additives and revealed that the tellurium-centered Anderson-Evans polyoxotungstate [TeW 6 O 24 ] 6- (TEW) was the most suitable POM-archetype. After its first successful application as a crystallization additive, we repeatedly reported on TEW's positive effects on the crystallization behavior of proteins with a particular focus on the protein-TEW interactions. As electrostatic interactions are the main force for TEW binding

  5. Outpatient management of pulmonary embolism in cancer: data on a prospective cohort of 138 consecutive patients.

    Science.gov (United States)

    Font, Carme; Carmona-Bayonas, Alberto; Fernández-Martinez, Aranzazu; Beato, Carmen; Vargas, Andrés; Gascon, Pere; Otero, Remedios

    2014-03-01

    The purpose of this prospective cohort study was to assess the feasibility of outpatient treatment in patients with cancer and objectively confirmed pulmonary embolism (PE), and to compare the performance of the different prognostic scales available in this setting. Patients were selected for outpatient management according to a set of exclusion criteria. Outcomes at 30 and 90 days of follow-up included thromboembolic recurrences, major bleeding, and all-cause death. The performance of 4 prognostic scales (Pulmonary Embolism Severity Index, Geneva Prognostic Score, POMPE-C, and Registro Informatizado de Enfermedad Tromboembólica [RIETE registry]) was evaluated. Of 138 patients, 62 (45%) were managed as outpatients. Incidental PE constituted 47% of the sample. Most patients treated at home had an incidentally detected PE (89%). The rate of recurrence and major bleeding events was similar in both groups. Mortality rates were higher for patients admitted to the hospital compared with outpatients at 30 days (18% vs 3%; P=.06) and 90 days (34% vs 10%; P=.001) of follow-up. None of the patients selected for home treatment required further admission because of PE complications. None of the prognostic models developed for symptomatic PE was significantly associated with 30-day mortality. Improved survival outcomes were observed in incidentally detected PEs compared with acute symptomatic events (overall mortality rates, 3.2% vs 18.4%; P=.006). A large proportion of patients with cancer and PE may be safely treated as outpatients, especially those with incidental PE. Cancer-specific prognostic scales including incidental PE should be developed for the optimal management of PE in this setting.

  6. The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

    Directory of Open Access Journals (Sweden)

    Miguel Muñoz

    2010-04-01

    Full Text Available It has been recently demonstrated that substance P (SP and neurokinin-1 (NK-1 receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679. We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma.

  7. The NK-1 Receptor Antagonist L-732,138 Induces Apoptosis and Counteracts Substance P-Related Mitogenesis in Human Melanoma Cell Lines

    Energy Technology Data Exchange (ETDEWEB)

    Muñoz, Miguel, E-mail: mmunoz@cica.es; Rosso, Marisa; González-Ortega, Ana [Research Laboratory on Neuropeptides, Virgen del Rocío University Hospital, Sevilla (Spain); Coveñas, Rafael [Institute of Neurosciences of Castilla y León (INCYL), Laboratory of Neuroanatomy of the Peptidergic Systems (Laboratory 14), Salamanca (Spain)

    2010-04-20

    It has been recently demonstrated that substance P (SP) and neurokinin-1 (NK-1) receptor antagonists induce cell proliferation and cell inhibition in human melanoma cells, respectively. However, the antitumor action of the NK-1 receptor antagonist L-732,138 on such cells is unknown. The aim of this study was to demonstrate an antitumor action of L-732,138 against three human melanoma cell lines (COLO 858, MEL HO, COLO 679). We found that L-732,138 elicits cell growth inhibition in a concentration dependent manner in the melanoma cells studied. Moreover, L-732,138 blocks SP mitogen stimulation. The specific antitumor action of L-732,138 occurred through the NK-1 receptor and melanoma cell death was by apoptosis. These findings indicate that the NK-1 receptor antagonist L-732,138 could be a new antitumor agent in the treatment of human melanoma.

  8. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    OpenAIRE

    Maurilo Monteiro Terra; Erasmo José Paioli Pires; Sônia Maria Bonilha Marcondes Coelho; Ilene Ribeiro da Silva Passos; Rui Ribeiro dos Santos; Celso Valdevino Pommer; André Camargo Pereira da Silva; Ivan José Antunes Ribeiro

    1990-01-01

    Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo) de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. T...

  9. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP Rootstocks for wine grape cultivar IAC 138-22

    Directory of Open Access Journals (Sweden)

    Maurilo Monteiro Terra

    1990-01-01

    Full Text Available Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. Todos os outros porta-enxertos apresentaram desempenho inferior.A long term experiment was conducted at Monte Alegre do Sul, State of São Paulo, Brazil, to study the behaviour of wine grape cultivar IAC 138-22 Máximo on five rootstocks: RR 101 14, 'Golia', "Ripária do Traviú', IAC 313 and IAC 572 The yields of eight consecutive annual harvests (from 1974 to 1981 were analysed. The results indicated that IAC 572 was the best rootstock. IAC 313 can also be used but with fair results. "Ripária do Traviú', RR 101-14 and 'Golia' are not recommended as rootstocks for IAC 138-22. Considering the row spacing (2 x 1m which allows 5,000 plants/ha, the difference between average yields of the best and the worst rootstock was 8,475kg/ha of grapes, a considerable figure for the grape grower.

  10. Direct determination of tellurium and its redox speciation at the low nanogram level in natural waters by catalytic cathodic stripping voltammetry.

    Science.gov (United States)

    Biver, Marc; Quentel, François; Filella, Montserrat

    2015-11-01

    Tellurium is one of the elements recently identified as technologically critical and is becoming a new emergent contaminant. No reliable method exists for its determination in environmental samples such as natural waters. This gap is filled by the method described here; it allows the rapid detection of trace concentrations of Te(IV) and Te(VI) in surface waters by differential pulse cathodic stripping voltammetry. It is based on the proton reduction catalysed by the absorption of Te(IV) on the mercury electrode. Under our conditions (0.1 mol L(-1) HCl) a detection limit of about 5 ng L(-1) for a deposition time of 300 s is achieved. Organic matter does not represent a problem at low concentrations; higher concentrations are eliminated by adsorptive purification. Tellurium occurs primarily as Te(IV) and Te(VI) in natural waters. Thus, determining total Te requires the reduction of Te(VI) that it is not electroactive. A number of reduction procedures have been carefully evaluated and a method based on the addition of TiCl3 to the acidified samples has been proven to reduce Te(VI) at the trace level to Te(IV) reliably and quantitatively. Therefore, the procedure described allows the direct determination of total Te and its redox speciation. It is flexible, reliable and cost effective compared to any possible alternative method based on the common preconcentration-ICPMS approach. It is readily implementable as a routine method and can be deployed in the field with relative ease. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Optical properties of tellurium-doped InxGa1-xAsySb1-y epitaxial layers studied by photoluminescence spectroscopy

    International Nuclear Information System (INIS)

    Diaz-Reyes, J; Cardona-Bedoya, J A; Gomez-Herrera, M L; Herrera-Perez, J L; Riech, I; Mendoza-Alvarez, J G

    2003-01-01

    Controlled doping of quaternary alloys of In x Ga 1-x As y Sb 1-y with tellurium is fundamental to obtain the n-type layers needed for the development of optoelectronic devices based on p-n heterojunctions. InGaAsSb epitaxial layers were grown by liquid phase epitaxy and Te doping was obtained by incorporating small Sb 3 Te 2 pellets in the growth melt. The tellurium doping levels were in the range 10 16 -10 17 cm -3 . We have used low-temperature photoluminescence (PL) spectroscopy to study the influence of the Te donor levels on the radiative transitions shown in the PL spectra. The PL measurements were done by exciting the samples with the 448 nm line of an Ar ion laser with varying excitation powers in the range from 10 to 200 mW. For the low-doped sample the PL spectrum showed a narrow exciton-related peak centred at around 610 meV with a full width at half maximum (FWHM) of about 7 meV which is evidence of the good crystalline quality of the layers. For higher Te doping, the PL spectra show the presence of band-to-band and donor-to-acceptor transitions which overlap as the Te concentration increases. The peak of the PL band shifts to higher energies as Te doping increases due to a band-filling effect as the Fermi level enters into the conduction band. From the peak energy of the PL spectra, and using a model that includes the band-filling and band-shrinkage effects due to the carriers, we have estimated the effective carrier concentration due to doping with Te in the epilayers

  12. Chemical Abundances of M-Dwarfs from the Apogee Survey. I. The Exoplanet Hosting Stars Kepler-138 and Kepler-186

    Energy Technology Data Exchange (ETDEWEB)

    Souto, D.; Cunha, K. [Observatório Nacional, Rua General José Cristino, 77, 20921-400 São Cristóvão, Rio de Janeiro, RJ (Brazil); García-Hernández, D. A.; Zamora, O.; Prieto, C. Allende; Jönsson, H.; Pérez, A. E. García [Instituto de Astrofísica de Canarias (IAC), Vía Lactea S/N, E-38205, La Laguna, Tenerife (Spain); Smith, V. V. [National Optical Astronomy Observatory, 950 North Cherry Avenue, Tucson, AZ 85719 (United States); Mahadevan, S. [Department of Astronomy and Astrophysics, The Pennsylvania State University (United States); Blake, C. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104 (United States); Johnson, J. A.; Pinsonneault, M. [Department of Astronomy, The Ohio State University, Columbus, OH 43210 (United States); Holtzman, J. [New Mexico State University, Las Cruces, NM 88003 (United States); Majewski, S. R.; Sobeck, J. [Department of Astronomy, University of Virginia, Charlottesville, VA 22904-4325 (United States); Shetrone, M. [University of Texas at Austin, McDonald Observatory (United States); Teske, J. [Department of Terrestrial Magnetism, Carnegie Institution for Science, Washington, DC 20015 (United States); Nidever, D. [Department of Astronomy, University of Michigan, Ann Arbor, MI, 48104 (United States); Schiavon, R. [Astrophysics Research Institute, Liverpool John Moores University, 146 Brownlow Hill, Liverpool, L3 5RF (United Kingdom); and others

    2017-02-01

    We report the first detailed chemical abundance analysis of the exoplanet-hosting M-dwarf stars Kepler-138 and Kepler-186 from the analysis of high-resolution ( R ∼ 22,500) H -band spectra from the SDSS-IV–APOGEE survey. Chemical abundances of 13 elements—C, O, Na, Mg, Al, Si, K, Ca, Ti, V, Cr, Mn, and Fe—are extracted from the APOGEE spectra of these early M-dwarfs via spectrum syntheses computed with an improved line list that takes into account H{sub 2}O and FeH lines. This paper demonstrates that APOGEE spectra can be analyzed to determine detailed chemical compositions of M-dwarfs. Both exoplanet-hosting M-dwarfs display modest sub-solar metallicities: [Fe/H]{sub Kepler-138} = −0.09 ± 0.09 dex and [Fe/H]{sub Kepler-186} = −0.08 ± 0.10 dex. The measured metallicities resulting from this high-resolution analysis are found to be higher by ∼0.1–0.2 dex than previous estimates from lower-resolution spectra. The C/O ratios obtained for the two planet-hosting stars are near-solar, with values of 0.55±0.10 for Kepler-138 and 0.52±0.12 for Kepler-186. Kepler-186 exhibits a marginally enhanced [Si/Fe] ratio.

  13. A novel nano-immunoassay method for quantification of proteins from CD138-purified myeloma cells: biological and clinical utility.

    Science.gov (United States)

    Misiewicz-Krzeminska, Irena; Corchete, Luis Antonio; Rojas, Elizabeta A; Martínez-López, Joaquín; García-Sanz, Ramón; Oriol, Albert; Bladé, Joan; Lahuerta, Juan-José; Miguel, Jesús San; Mateos, María-Victoria; Gutiérrez, Norma C

    2018-05-01

    Protein analysis in bone marrow samples from patients with multiple myeloma has been limited by the low concentration of proteins obtained after CD138 + cell selection. A novel approach based on capillary nano-immunoassay could make it possible to quantify dozens of proteins from each myeloma sample in an automated manner. Here we present a method for the accurate and robust quantification of the expression of multiple proteins extracted from CD138-purified multiple myeloma samples frozen in RLT Plus buffer, which is commonly used for nucleic acid preservation and isolation. Additionally, the biological and clinical value of this analysis for a panel of 12 proteins essential to the pathogenesis of multiple myeloma was evaluated in 63 patients with newly diagnosed multiple myeloma. The analysis of the prognostic impact of CRBN /Cereblon and IKZF1 /Ikaros mRNA/protein showed that only the protein levels were able to predict progression-free survival of patients; mRNA levels were not associated with prognosis. Interestingly, high levels of Cereblon and Ikaros proteins were associated with longer progression-free survival only in patients who received immunomodulatory drugs and not in those treated with other drugs. In conclusion, the capillary nano-immunoassay platform provides a novel opportunity for automated quantification of the expression of more than 20 proteins in CD138 + primary multiple myeloma samples. Copyright © 2018 Ferrata Storti Foundation.

  14. 25 CFR 224.138 - What must the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical...

    Science.gov (United States)

    2010-04-01

    ... noncompliance with the TERA or a Federal law has caused imminent jeopardy to a physical trust asset. ... caused imminent jeopardy to a physical trust asset? 224.138 Section 224.138 Indians BUREAU OF INDIAN... the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical trust asset? If...

  15. 42 CFR 137.138 - Once the Indian Tribe's final offer has been accepted or deemed accepted by operation of law...

    Science.gov (United States)

    2010-10-01

    ... accepted or deemed accepted by operation of law, what is the next step? 137.138 Section 137.138 Public... final offer has been accepted or deemed accepted by operation of law, what is the next step? After the... the acceptance or the deemed acceptance. Rejection of Final Offers ...

  16. Ab-initio study of pure sup 7 sup 7 Se and sup 1 sup 2 sup 5 Te systems and of the sup 7 sup 7 Se nuclear quadrupole interaction in tellurium

    CERN Document Server

    Oh, Y K; Cho, H S

    1999-01-01

    Using the Hartree-Fock cluster procedure, we have studied the electric-field gradient tensors at the nuclear sites of sup 7 sup 7 Se and sup 1 sup 2 sup 5 Te in pure sup 1 sup 2 sup 5 Te systems and in tellurium crystalline system's with a sup 7 sup 7 Se impurity. From the results for the pure systems, sup 7 sup 7 Se in selenium and sup 1 sup 2 sup 5 Te in tellurium, using the observed quadrupole moments: Q( sup 7 sup 7 Se) 0.75 +- 0.07 barns and Q( sup 1 sup 2 sup 5 Te) = 0.35 +- 0.04 barns. Comparison is made with earlier values obtained by different methods. Using our calculated values of Q and the results of a study of the field-gradient tensors for sup 7 sup 7 Se in tellurium, the theoretical values of the quadrupole coupling constants are found to agree, within about 7 percent, with experiment. The calculated asymmetry parameters are also found to be in reasonable agreement with the experiment values, although the agreement not as close as in the case of the quadrupole -coupling constants. Directions fo...

  17. Características de las fallas en alimentadores de 13,8 kV del sistema soterrado de La Habana;Characteristic of 13,8 kV feeders faults of the Havana underground system

    Directory of Open Access Journals (Sweden)

    Boris Alba - Valle

    2011-06-01

    Full Text Available El sistema soterrado de La Habana enfrenta problemas de continuas fallas en sus alimentadores de 13,8 kV. En este trabajo se determinan las características de estas averías, en el período comprendido entre los años 2007 y 2009, y se proponen algunas medidas objetivas con el fin de contribuir a su disminución. La investigación se basó fundamentalmente en el estudio de la base de datos de los alimentadores de 13,8 kV proporcionada por el departamento técnico de la Unidad Empresarial Básica (UEB Soterrada y en el uso de herramientas estadísticas digitales. Como resultado se pudo constatar que las fallas son más frecuentes en los alimentadores de la subestación de Tallapiedra producto de la humedad en cables y empalmes con aislamiento de PILC (papel impregnado en aceite y con cubierta de plomo, dispuestos por tierra muerta. Finalmente, las medidas propuestas tuvieron un impacto positivo en la disminución de estas fallas, en un período inferior a un año.The Havana underground system has problems of continuous faults in their 13,8 kV feeders. In this article the characteristics of these mishaps in the period of 2007 to 2009 are determined and purpose some objective measurements with the end of contributing to their decrease. The investigation was fundamentally based on the study of the 13,8 kV feeders database proportioned by the technical department of the Underground Basic Managerial Unit (UEB and the use of digital statistical tools. As a result, it was verified that the faults occur with more frequency in the Tallapiedra substation feeders, due to the humidity in cables and connections with PILC isolation (impregnated in oil and lead covered paper, prepared for undergrounding directly in the earth. Finally, the proposed measures had a positive impact in the decrease of these faults, in a period less than to a year.

  18. Effects of Mo Content on Microstructure and Mechanical Property of PH13-8Mo Martensitic Precipitation-Hardened Stainless Steel

    Science.gov (United States)

    Yubing, Pei; Tianjian, Wang; Zhenhuan, Gao; Hua, Fan; Gongxian, Yang

    This paper introduces the effects of Mo content on microstructure and mechanical property of PH13-8Mo martensitic precipitation-hardened stainless steel which is used for LP last stage blade in steam turbine. Thermodynamic software Thermo-Calc has been used to calculate precipitation temperature and the mass fraction of precipitated phases in PH13-8Mo steel with different Mo content. The result shows that when the mass of Mo is below 0.6wt.%, chi-phase mu-phase and sigma-phase could disappear. The microstructure and mechanical property of high Mo PH13-8Mo (Mo=0.57wt.%) and low Mo PH13-8Mo (Mo=2.15wt.%)have been investigated in different heat treatments. The investigations reveal that austenitizing temperature decrease with the reduce of Mo content, so the optimum solution temperature for low Mo PH13-8Mo is lower than that for high Mo PH13-8Mo.The influence of solution temperature on grain size is weakened with the increase of Mo content, Mo rich carbides could retard coarsening of grain. An enormous amount of nano-size uniformly distributed β-NiAl particles are found in both kinds of steels using transmission electron microscopy, they are the most important strengthening phase in PH13-8Mo.

  19. ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

    Directory of Open Access Journals (Sweden)

    MARLON JOCIMAR RODRIGUES DA SILVA

    2017-09-01

    Full Text Available ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and soluble solids/acidity ratio. The wines were evaluated for density, alcohol content; total, volatile and fixed acidity; pH, dry extract, reducing sugars, reduced dry extract, alcohol in weight/reduced dry extract; free and total sulfur dioxide; anthocyanins, polyphenols index (I 280; polyphenols and total flavonoids and antioxidant activity. The ‘Bordô’, ‘Isabel’ and IAC 138-22 ‘Máximo’ musts had low soluble solids for winemaking. The ‘106-8 Mgt’ rootstock promoted higher dry extract content and reduced dry extract in Bordô wine, and lower total and fixed acidity in IAC 138-22 Máximo wine. In Isabel wine, higher pH was promoted by the ‘IAC 766’ rootstock. Aside from low total acidity of the Bordô wine, all the physicochemical characteristics of the wines studied are in accordance with Brazilian law. There was no effect of rootstocks in the phenolics content and antioxidant activity of wines.

  20. ROOTSTOCKS EFFECTS ON THE PHYSICOCHEMICAL CHARACTERISTICS OF BORDÔ, ISABEL AND IAC 138-22 MÁXIMO MUST AND WINE

    OpenAIRE

    MARLON JOCIMAR RODRIGUES DA SILVA; LUCIANA TREVISAN BRUNELLI; MARA FERNANDES MOURA; JOSÉ LUIZ HERNANDES; SARITA LEONEL; MARCO ANTONIO TECCHIO

    2017-01-01

    ABSTRACT It has been demonstrated that rootstocks can influence grape characteristics, but there are few data in literature about the rootstocks influence in the wine characteristics, especially in wines elaborated with Vitis labrusca or hybrid grapes. This study evaluated the influence of ‘IAC 766’ and ‘106-8 Mgt’ rootstocks on the physicochemical characteristics of ‘Bordô’, ‘Isabel’ and ‘IAC 138-22 ‘Máximo’ musts and wines. The musts were evaluated for pH, soluble solids, total acidity and...

  1. Crystal structure and tautomerism of Pigment Yellow 138 determined by X-ray powder diffraction and solid-state NMR

    DEFF Research Database (Denmark)

    Gumbert, Silke D.; Körbitzer, Meike; Alig, Edith

    2016-01-01

    The crystal structure of C.I. Pigment Yellow 138 was determined from X-ray powder diffraction data using real-space methods with subsequent Rietveld refinements. The tautomeric state was investigated by solid-state 1D and 2D multinuclear NMR experiments. In the crystals, the compound exhibits...... the NH-tautomer with a hydrogen atom situated at the nitrogen of the quinoline moiety. Direct evidence of the presence of the NH-tautomer is provided by 1H–14N HMQC solid-state NMR at very fast MAS. Solid-state dispersion-corrected density functional theory calculations with BLYP-D3 confirm...

  2. MiR-138 promotes smooth muscle cells proliferation and migration in db/db mice through down-regulation of SIRT1

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Juan [Department of Gynecology, Changzhou Maternity and Children Health Hospital, Changzhou, Jiangsu 213003 (China); Li, Li; Yun, Hui-fang [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China); Han, Ye-shan, E-mail: yeshanhan123@163.com [Department of Anesthesiology, Changzhou No. 2 People' s Hospital, Changzhou, Jiangsu 213003 (China)

    2015-08-07

    Background: Diabetic vascular smooth muscle cells (VSMCs) exhibit significantly increased rates of proliferation and migration, which was the most common pathological change in atherosclerosis. In addition, the study about the role for miRNAs in the regulation of VSMC proliferation is just beginning to emerge and additional miRNAs involved in VSMC proliferation modulation should be identified. Methods: The expression of miR-138 and SIRT1 were examined in SMCs separated from db/db mice and in SMC lines C-12511 exposed to high glucose with qRT-PCR and western blot. The regulation of miR-138 on the expression of SMCs was detected with luciferase report assay. VSMCs proliferation and migration assays were performed to examine the effect of miR-138 inhibitor on VSMCs proliferation and migration. Results: We discovered that higher mRNA level of miR-138 and reduced expression of SIRT1 were observed in SMCs separated from db/db mice and in SMC lines C-12511. Moreover, luciferase report assay showed that the activity of SIRT1 3′-UTR was highly increased by miR-138 inhibitor and reduced by miR-138 mimic. In addition, we examined that the up-regulation of NF-κB induced by high glucose in SMCs was reversed by resveratrol and miR-138 inhibitor. MTT and migration assays showed that miR-138 inhibitor attenuated the proliferation and migration of smooth muscle cells. Conclusion: In this study, we revealed that miR-138 might promote proliferation and migration of SMC in db/db mice through suppressing the expression of SIRT1. - Highlights: • Higher mRNA level of miR-138 was observed in SMCs from db/db mice. • The mRNA and protein level of SIRT1 in SMCs from db/db mice were greatly reduced. • miR-138 could regulate the expression of SIRT1 in SMCs. • SIRT1 overexpression reversed the up-regulation of acetylized p65 and NF-κB induced by high glucose. • MiR-138 inhibitor reversed VSMCs proliferation and migration induced by high glucose.

  3. Photocatalytic dechlorination of PCB 138 using leuco-methylene blue and visible light; reaction conditions and mechanisms

    International Nuclear Information System (INIS)

    Izadifard, Maryam; Langford, Cooper H.; Achari, Gopal

    2010-01-01

    A study of dechlorination of PCB 138, under visible light employing methylene blue (MB) and triethylamine (TEA) in acetonitrile/water has been conducted to investigate the details of the mechanism of dechlorination and to determine the efficiency of the process for this representative congener. Two other amines, N-methyldiethanolamine (MEDA) and (triethanolamine) TEOA also replaced TEA and two other solvents, methanol and ethanol replacing acetonitrile were examined for effects on reaction rates. The results show that PCB 138 can be dechlorinated efficiently in this photocatalytic reaction. Clarifying ambiguities in several previous reports, the reduced form of MB, leuco-methylene blue (LMB) was identified as responsible for the photoreaction with its excited state transferring an electron to PCBs; oxidized LMB (i.e. MB) is reduced back to LMB by the excess amine present. The reaction depends on a cycle driven by the amine as a sacrificial electron donor. MEDA proved to be the most efficient electron donor; apparently in consequence of the most favourable steady state concentration of LMB. Methanol and ethanol may be used to replace acetonitrile with little change in the efficiency of the reaction.

  4. Moessbauer spectroscopy study on the corrosion resistance of plasma nitrided ASTM F138 stainless steel in chloride solution

    International Nuclear Information System (INIS)

    Souza, S.D. de; Olzon-Dionysio, M.; Basso, R.L.O.; Souza, S. de

    2010-01-01

    Plasma nitriding of ASTM F138 stainless steel samples has been carried out using dc glow discharge under 80% H 2 -20% N 2 gas mixture, at 673 K, and 2, 4, and 7 h time intervals, in order to investigate the influence of treatment time on the microstructure and the corrosion resistance properties. The samples were characterized by scanning electron microscopy, glancing angle X-ray diffraction and conversion electron Moessbauer spectroscopy, besides electrochemical tests in NaCl aerated solution. A modified layer of about 6 μm was observed for all the nitrided samples, independent of nitriding time. The X-ray diffraction analysis shows broad γ N phase peaks, signifying a great degree of nitrogen supersaturation. Besides γ N, the Moessbauer spectroscopy results indicated the occurrence of γ' and ε phases, as well as some other less important phases. Corrosion measurements demonstrate that the plasma nitriding time affects the corrosion resistance and the best performance is reached at 4 h treatment. It seems that the ε/γ' fraction ratio plays an important role on the resistance corrosion. Additionally, the Moessbauer spectroscopy was decisive in this study, since it was able to identify and quantify the iron phases that influence the corrosion resistance of plasma nitrided ASTM F138 samples.

  5. Addressing the psychosocial and communication challenges posed by radiological/nuclear terrorism: key developments since NCRP Report No. 138.

    Science.gov (United States)

    Becker, Steven M

    2005-11-01

    One of the most innovative aspects of NCRP Report No. 138 (Management of Terrorist Incidents Involving Radioactive Material) was the high priority it accorded to psychosocial and communication issues. While previous discussions of radiological and nuclear terrorism had occasionally referred to these topics, NCRP Report No. 138 was the first report of its kind to recognize the profound challenges posed by these issues and to place them at the heart of preparedness and response efforts. In the years since the report's release, a host of important developments have taken place in relation to psychosocial and communication issues. This paper reviews key changes and advances in five broad areas: (1) training exercises, (2) policy and guidance development, (3) findings on hospital and clinician needs, (4) survey research on public perceptions of radiological terrorism, and (5) risk communication for radiological and nuclear terrorism situations. The article concludes with a discussion of continuing psychosocial and communication challenges, including critical areas needing further attention as the nation moves to meet the threat of terrorism involving radioactive materials.

  6. CORRELATION OF {sup 48}Ca, {sup 50}Ti, AND {sup 138}La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang, E-mail: hart.chen@bristol.ac.uk [Institute of Earth Sciences, Academia Sinica, Taipei, Taiwan, ROC (China)

    2015-06-10

    Precise determinations of {sup 48}Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive {sup 48}Ca/{sup 44}Ca anomalies in all analyzed CAIs after normalization to {sup 42}Ca/{sup 44}Ca, and it is clearly shown that there is no simple correlation between {sup 48}Ca/{sup 44}Ca and {sup 50}Ti/{sup 48}Ti anomalies, in agreement with Jungck et al. Compared to the {sup 48}Ca/{sup 44}Ca versus {sup 50}Ti/{sup 48}Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated {sup 50}Ti/{sup 48}Ti. Assuming the {sup 48}Ca/{sup 44}Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess {sup 50}Ti anomalies in CAIs can be calculated by subtracting the part associated with {sup 48}Ca/{sup 44}Ca. These excesses show a linear correlation with {sup 138}La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system {sup 48}Ca, {sup 50}Ti, and {sup 138}La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II.

  7. Study of 138 Neisseria meningitidis strains isolated from blood or cerebrospinal fluid in Lombardy between 2007 and 2010

    Directory of Open Access Journals (Sweden)

    Laura Daprai

    2012-06-01

    Full Text Available Neisseria meningitidis, Streptococcus pneumoniae, and Haemophilus influenzae type b cause the majority of cases of bacterial septicaemia in children and young adults. Disease epidemiology is evolving rapidly due to the introduction of vaccines and changing in bacterial antibiotic-resistance patterns. (Asymptomatic nasopharyngeal colonization with Neisseria meningitides occurs in 5-10% of adult. The aim of this study was to calculate the frequency of each serogroup of this pathogens involved in invasive infection and to study susceptibility to antibiotics of these strains. Between March 2007 and June 2010 we received, from 43 hospitals of Lombardy, 138 strains of Neisseria meningitidis, from 138 patients aged (2-80yrs. The most frequent serogroup was B (58%, followed by serogroup C (34%, serogroup G (4% and W 135 (2%. Serogroup A end X accounted for 1% of invasive infection, each. We observed a decrease in susceptibility towards penicillin in 38% of strains. In addition we studied, by REP- PCR, genotype of 9 strains selected on the basis of epidemiological data.Among these strains, 3 different clusters according to the 3 small epidemic outbreaks occurred between June and September 2009, were recognised. Seven of these strains, although belonged to the same serogroup, brought about two different clusters. The present findings demonstrated that phenotypic data are not sufficient to define epidemic clusters, therefore molecular genotyping is required.

  8. A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

    International Nuclear Information System (INIS)

    Cobben, Lodewijk; Groot, Ingrid; Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien; Blickman, Johan

    2009-01-01

    To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

  9. A simple MRI protocol in patients with clinically suspected appendicitis: results in 138 patients and effect on outcome of appendectomy

    Energy Technology Data Exchange (ETDEWEB)

    Cobben, Lodewijk [Medisch Centrum Haaglanden, Department of Radiology, Leidschendam (Netherlands); Groot, Ingrid [Medisch Centrum Haaglanden, Department of Surgery, Leidschendam (Netherlands); Kingma, Lucas; Coerkamp, Emile; Puylaert, Julien [Medisch Centrum Haaglanden, Department of Radiology, Den Haag (Netherlands); Blickman, Johan [Universitair Medisch Centrum St Radboud, Department of Radiology, Geert Grooteplein 10, GA, Nijmegen (Netherlands)

    2009-05-15

    To establish the value of breathhold magnetic resonance imaging (MRI) in the diagnosis of acute appendicitis. Over a 14-month period, 138 patients clinically suspected of having appendicitis were evaluated prospectively with MRI and comprised the study group. Fast turbo spin-echo breathhold T1, T2 and T2 fat suppression sequences were used in coronal and axial planes. The imaging results were recorded separately and subsequently correlated with clinical, radiological and histopathological follow-up. The effect of imaging strategies in patients suspected of appendicitis on hospital resources was calculated. Sixty-two of the 138 patients had a histopathologically proven appendicitis. MRI determined appendicitis in 63 patients, with one examination being false positive. The resulting sensitivity and specificity were 100% and 99%, respectively. MRI showed an alternative diagnosis in 41 of the 75 remaining patients. In 22 of the remaining 34 patients, a normal appendix was depicted with MRI. In two patients, where MRI showed no appendicitis, an alternative diagnosis or normal appendix, an unnecessary appendectomy was performed. The overall effect of using MRI in patients suspected of appendicitis on the use of hospital resources could have been a net saving between EUR 55,746 and EUR 72,534. MRI has a high accuracy in detecting and excluding appendicitis, an alternative diagnosis or showing the normal appendix, and can be a valuable and cost-effective tool in the workup of patients clinically suspected of having appendicitis. (orig.)

  10. Promiscuity of MCMV immunoevasin of NKG2D: m138/fcr-1 down-modulates RAE-1epsilon in addition to MULT-1 and H60.

    Science.gov (United States)

    Arapović, Jurica; Lenac Rovis, Tihana; Reddy, Anil Butchi; Krmpotić, Astrid; Jonjić, Stipan

    2009-11-01

    Both human and mouse cytomegalovirus (CMV) encode proteins that inhibit the activation of NK cells by down-regulating the cellular ligands for activating NK cell receptor, NKG2D. MCMV proteins m145, m152 and m155 interfere with the expression of all known NKG2D ligands, MULT-1, RAE-1 family members and H60, respectively, whereas m138 affects the expression of MULT-1 and H60. Here we show that m152 affects the maturation of newly synthesized RAE-1 molecules, but is not sufficient to prevent surface expression of RAE-1varepsilon. We have identified m138 as a main inhibitor of the surface expression of RAE-1varepsilon. In contrast to m152, m138 affects the surface-resident protein leading to its endocytosis, which can be prevented by a dynamin inhibitor. Moreover, we demonstrated that m138 does not need other viral proteins to down-modulate the expression of RAE-1varepsilon.

  11. Growth of PbTe nanorods controlled by polymerized tellurium anions and metal(II) amides via composite-hydroxide-mediated approach

    Energy Technology Data Exchange (ETDEWEB)

    Wan Buyong [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); College of Physics and Information Technology, Chongqing Normal University, Chongqing 400047 (China); Hu Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Liu Hong [State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China); Xiong Yufeng [National Center for Nanoscience and Technology, Beijing 100080 (China); Li Feiyun; Xi Yi; He Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

    2009-09-15

    The pure face-centered-cubic PbTe nanorods have been synthesized by the composite-hydroxide-mediated approach using hydrazine as a reducing agent. The method is based on reaction among reactants in the melts of potassium hydroxide and sodium hydroxide eutectic at 170-220 deg. C and normal atmosphere without using any organic dispersant or surface-capping agent. Scanning electron microscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy were used to characterize the structure, morphology and composition of the samples. The diameters of nanorods are almost fixed, while the lengths can be tunable under different growth time and temperatures. The growth mechanism of PbTe nanorods is investigated via UV-vis absorption, demonstrating that polymerized tellurium anions and metal(II) amides in the hydrazine hydroxide melts could control the crystallization and growth process of PbTe nanostructures. The band gap of as-synthesized PbTe nanorods has been calculated based on UV-vis-NIR optical diffuse reflectance spectra data.

  12. Growth of PbTe nanorods controlled by polymerized tellurium anions and metal(II) amides via composite-hydroxide-mediated approach

    International Nuclear Information System (INIS)

    Wan Buyong; Hu Chenguo; Liu Hong; Xiong Yufeng; Li Feiyun; Xi Yi; He Xiaoshan

    2009-01-01

    The pure face-centered-cubic PbTe nanorods have been synthesized by the composite-hydroxide-mediated approach using hydrazine as a reducing agent. The method is based on reaction among reactants in the melts of potassium hydroxide and sodium hydroxide eutectic at 170-220 deg. C and normal atmosphere without using any organic dispersant or surface-capping agent. Scanning electron microscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy were used to characterize the structure, morphology and composition of the samples. The diameters of nanorods are almost fixed, while the lengths can be tunable under different growth time and temperatures. The growth mechanism of PbTe nanorods is investigated via UV-vis absorption, demonstrating that polymerized tellurium anions and metal(II) amides in the hydrazine hydroxide melts could control the crystallization and growth process of PbTe nanostructures. The band gap of as-synthesized PbTe nanorods has been calculated based on UV-vis-NIR optical diffuse reflectance spectra data.

  13. Electrical properties of tellurium clusters on the void sublattice of an opal crystal the important role played by the Te-SiO$_{2}$ interface

    CERN Document Server

    Berezovets, V A; Farbshtein, I I; Nizhankovskii, V I

    2002-01-01

    The temperature dependences of electrical resistivity and of the Hall effect of nanocluster tellurium crystals obtained by filling the voids in a dielectric (opal) matrix with a melt of pure and doped Te were studied. The Hall hole concentration p/sub eff/ was found to increase anomalously (by more than two orders of magnitude) in a sample prepared from pure Te and cooled to helium temperatures. At T = 1.45 K, the hole concentration in this sample was p/sub eff/ = equivalent to 6 * 10/sup 17/ cm/sup -3/. At the same time, the Hall effect in this sample was observed to reverse sign at T equivalent to 200 K from positive for T < 200 K to negative at higher temperatures. This implies a low impurity concentration (N/sub A/ is less than at least 10/sup 15/ cm/sup -3/). A nanocluster crystal of doped Te does not exhibit this anomaly; here, we have p/sub eff/ equivalent to 6 * 10/sup 17/ cm/sup -3/ throughout the temperature region covered, as in the original Te. These features are assigned to the formation of a ...

  14. 13.8 the quest to find the true age of the Universe and the Theory of Everything

    CERN Document Server

    Gribbin, John

    2015-01-01

    The twentieth century gave us two great theories of physics. The general theory of relativity describes the behaviour of very large things; quantum theory the behaviour of very small things. In this landmark book, John Gribbin - one of the best-known writers of popular science over the past 30 years - presents his own version of the Holy Grail of physics, the search that has been going on for decades to find a unified 'Theory of Everything' that combines these ideas into one mathematical package, a single equation that could be printed on a T-shirt, containing the answer to life, the Universe and everything. With his inimitable mixture of science, history and biography, Gribbin shows how - despite scepticism among many physicists - these two great theories are indeed very compatible, and point to a deep truth about the nature of our existence. The answer lies, intriguingly, with the age of the Universe: 13.8 billion years.

  15. Comparative analysis of CD138 antigen targeting for the treatment of multiple myeloma with bismuth-213 and Melphalan chemotherapy

    International Nuclear Information System (INIS)

    Gouard, S.; Gaschet, J.; Maurel, C.; Barbet, J.; Davodeau, F.; Pallardy, A.; Faivre-Chauvet, A.; Kraeber-Bodere, F.; Bruchertseifer, F.; Morgenstern, A.; Cherel, M.

    2015-01-01

    Full text of publication follows. Aim: multiple myeloma (MM) is a B-cell malignancy of terminally differentiated plasma cells within the bone marrow, with the presence of a monoclonal immunoglobulin in serum and/or urine and development of osteolytic bone lesions in human. Despite intense research to develop new treatments, cure is almost never achieved. Alpha-radioimmunotherapy (RIT) has been shown to be effective in vivo in a multiple myeloma model and seems particularly suited for disseminated tumour cells or small clusters of tumour cells. CD138 (Syndecan-1) is found mainly in epithelial cells, but has been shown to be expressed by most myeloma cells, both in human and in mouse. In order to define where alpha RIT stands in MM treatment, the aim of this study was to compare Melphalan, MM standard treatment, with alpha RIT using a bismuth-213-labelled anti-mouse CD138 rat antibody in a syngeneic mouse MM model. Material and Methods: C57BL/KaLwRij mice were grafted with 10 6 5T33 cells (murine myeloma cells). Luciferase transfected 5T33 were used for in vivo localization of the cells during the course of disease. The first step of the study was to assess the dose-response of Melphalan (100, 200 et 300 μg/mouse), 21 days after engraftment. The second step consisted in therapeutic association: Melphalan followed by RIT at d22 et d25 after engraftment. Toxicity (animal weight, blood cell counts) and treatment efficacy were studied in animals receiving no treatment, injected with Melphalan alone (200 μg), RIT alone at d22 and d25 (3.7 MBq of 213 Bi-anti-CD138) and Melphalan combined with alpha RIT. Results: fifty percent of untreated mice died by d64 after MM engraftment. In mice treated with Melphalan alone, only the 200 μg dose improved median survival. No animal was cured after Melphalan treatment whereas 60% of the mice survived with RIT alone at d22 after tumour engraftment. However, the therapeutic window seems to be narrow, indeed no effect was observed with

  16. Observations of three bright extragalactic radiosources at the 1.38 cm wavelength with the resolution up to 8''

    International Nuclear Information System (INIS)

    Berlin, A.B.; Korenev, Yu.V.; Lesovoj, V.Yu.; Parijskij, Yu.N.; Smirnov, V.I.; Soboleva, N.S.

    1980-01-01

    New observations of radiogalaxies in the shortest wavelength region of the RATAN-600 radiotelescope were performed using the 1.38-cm radiometer. One-dimentional radiobrightness distribution of 3C 405 (Cyg A) and Cen A as well as instantaneous spectra of the nuclear sources in 3C 111, 3C 405 and Cen A are presented. Spectra of nuclear components in radiosources 3C 111 and Cen A show marked variations at the time scale of the order of three years. Fluxes for the nuclear component of Cyg A at the wavelengths greater than 3.9 cm have decreased during the last 5 years. Wavelength independence is pointed out for brightness distribution in the main components of all sources. This contradicts to some extragalactic radiosources models in which radiation losses of relativistic electrons when moving from the hot ''spots'' to ''tails'' are suggested

  17. COMPETITION BEETWEN DYNAMIC RECUPERATION AND RECRYSTALLIZATION OF ASTM F 138 AUSTENITIC STAINLESS STEEL UTILIZED IN MEDICAL DEVICES

    Directory of Open Access Journals (Sweden)

    Fabio Henrique Casarini Geronimo

    2013-06-01

    Full Text Available ASTM F 138 austenitic stainless steel has being used in the manufacture of orthopedical devices by hot forging. In this work, the flow stress curves are determined by hot torsion tests in a wide range of temperatures and strain rates. With the observed microestrutural evolution by optical microscopy in different hot forming conditions in addiction with EBSD (Electron Backscatter Diffraction techniques it is possible to obtained the recrystallized volume fraction and the misorientation angles of the samples. Due to the intermediate level of stacking fault energy of this material, during the dynamic softening occurs a competition between recrystallization and recovery. The aim of this work is to identify the softening mechanisms in this stainless steel, as well as in which hot work conditions they become more active.

  18. Validation of interphase fluorescence in situ hybridization (iFISH for multiple myeloma using CD138 positive cells

    Directory of Open Access Journals (Sweden)

    Renata Kiyomi Kishimoto

    2016-06-01

    Full Text Available ABSTRACT BACKGROUND: Multiple myeloma is a plasma cell neoplasm with acquired genetic abnormalities of clinical and prognostic importance. Multiple myeloma differs from other hematologic malignancies due to a high fraction of low proliferating malignant plasma cells and the paucity of plasma cells in bone marrow aspiration samples, making cytogenetic analysis a challenge. An abnormal karyotype is found in only one-third of patients with multiple myeloma and interphase fluorescence in situ hybridization is the most useful test for studying the chromosomal abnormalities present in almost 90% of cases. However, it is necessary to study the genetic abnormalities in plasma cells after their identification or selection by morphology, immunophenotyping or sorting. Other challenges are the selection of the most informative FISH panel and determining cut-off levels for FISH probes. This study reports the validation of interphase fluorescence in situ hybridization using CD138 positive cells, according to proposed guidelines published by the European Myeloma Network (EMN in 2012. METHOD: Bone marrow samples from patients with multiple myeloma were used to standardize a panel of five probes [1q amplification, 13q14 deletion, 17p deletion, t(4;14, and t(14;16] in CD138+ cells purified by magnetic cell sorting. RESULTS: This test was validated with a low turnaround time and good reproducibility. Five of six samples showed genetic abnormalities. Monosomy/deletion 13 plus t(4;14 were found in two cases. CONCLUSION: This technique together with magnetic cell sorting is effective and can be used in the routine laboratory practice. In addition, magnetic cell sorting provides a pure plasma cell population that allows other molecular and genomic studies.

  19. Grazing incidence synchrotron X-ray diffraction and Moessbauer spectroscopy analyses of plasma nitrided ASTM F138 stainless steel

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Danilo Olzon Dionysio de; Ardisson, Jose Domingos, E-mail: dolzon@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Silva, Edilaine Honorio [Studiecentrum voor Kernenergie (Belgium); Olzon-Dionysio, Maristela; Souza, Sylvio Dionysio de; Fabris, Jose Domingos [Universidade Federal dos Vales do Jequitinhonha e Mucuri (UFVJM), Diamantina, MG (Brazil); Martinez, L.G. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2016-07-01

    Full text: systematic investigation of samples of plasma-nitriding austenitic stainless steels ASTM F138 and AISI 316L is reported. The surface treatment of the steels through plasma-nitriding was used to improve further the hardness, wear and corrosion resistance of these stainless steels. The resulting layered crystallographic structure actually corresponds to several phases with close cell parameters, making their identification and quantification a real experimental challenge. The ASTM F138 and AISI 316L stainless steel disks were plasma nitrided for 4 h at 400 deg C in a 80% H{sub 2} -20% N2 atmosphere at 6 torr, using plasma current frequencies between 6 and 100 kHz. Data of Moessbauer (CEMS and CXMS) and grazing incidence synchrotron X-ray diffraction (XRD-SR) were systematically collected. The nitrided layer thickness were not in general influenced by the plasma frequency, except at 12 kHz, which produced a layer thickness of approximately 8.0 mm, being in average 40% thicker than for the other samples. CXMS and CEMS Moessbauer spectra for this 12 kHz-sample show a much more pronounced magnetic resonance lines than for the other samples. The Fe{sub 4}N phase presents a single magnetic hyperfine interaction; the other two (Fe{sub 2-3}N and the expanded austenite) present both paramagnetic and magnetic components, even though their hyperfine parameters may not be safely separated. We also present the results of XRD-SR that were probed at several depths. The data from these techniques may be consistently correlated and this leads to an improved model to explain the structure of the nitrided layers. (author)

  20. The "11K" gene family members sf68, sf95 and sf138 modulate transmissibility and insecticidal properties of Spodoptera frugiperda multiple nucleopolyhedrovirus.

    Science.gov (United States)

    Beperet, Inés; Simón, Oihane; Williams, Trevor; López-Ferber, Miguel; Caballero, Primitivo

    2015-05-01

    The "11K" gene family is notable for having homologs in both baculoviruses and entomopoxviruses and is classified as either type 145 or type 150, according to their similarity with the ac145 or ac150 genes of Autographa californica multiple nucleopolyhedrovirus (AcMNPV). One homolog of ac145 (sf138) and two homologs of ac150 (sf68 and sf95) are present in Spodoptera frugiperda multiple nucleopolyhedrovirus (SfMNPV). Recombinant bacmids lacking sf68, sf95 or sf138 (Sf68null, Sf95null and Sf138null, respectively) and the respective repair bacmids were generated from a bacmid comprising the complete virus genome. Occlusion bodies (OBs) of the Sf138null virus were ∼15-fold less orally infective to insects, which was attributed to a 100-fold reduction in ODV infectious titer. Inoculation of insects with Sf138null OBs in mixtures with an optical brightener failed to restore the pathogenicity of Sf138null OBs to that of the parental virus, indicating that the effects of sf138 deletion on OB pathogenicity were unlikely to involve an interaction with the gut peritrophic matrix. In contrast, deletion of sf68 and sf95 resulted in a slower speed-of-kill by 9h, and a concurrent increase in the yield of OBs. Phylogenetic analysis indicated that sf68 and sf95 were not generated after a duplication event of an ancestral gene homologous to the ac150 gene. We conclude that type 145 genes modulate the primary infection process of the virus, whereas type 150 genes appear to have a role in spreading systemic infection within the insect. Copyright © 2015 Elsevier Inc. All rights reserved.

  1. The anti-inflammatory effects of the tellurium redox modulating compound, AS101, are associated with regulation of NFκB signaling pathway and nitric oxide induction in macrophages

    Directory of Open Access Journals (Sweden)

    Sredni Benjamin

    2010-01-01

    Full Text Available Abstract Background LPS-activated macrophages produce mediators which are involved in inflammation and tissue injury, and especially those associated with endotoxic shock. The non toxic tellurium compound ammonium tri-chloro(dioxoethylene-O,O'-tellurate, AS101, has been recently shown to exert profound anti-inflammatory properties in animal models, associated with its Te(IV redox chemistry. This study explores the anti-inflammatory properties of AS101 with respect to modulation of inflammatory cytokines production and regulation of iNOS transcription and expression in activated macrophages via targeting the NFkB complex. Results AS101 decreased production of IL-6 and in parallel down-regulated LPS-induced iNOS expression and NO secretion by macrophages. AS101 reduced IkB phosphorylation and degradation, and reduced NFkB nuclear translocalization, albeit these effects were exerted at different kinetics. Chromatin immunoprecipitation assays showed that AS101 treatment attenuated p50-subunit ability to bind DNA at the NFkB consensus site in the iNOS promotor following LPS induction. Conclusions Besides AS101, the investigation of therapeutic activities of other tellurium(IV compounds is scarce in the literature, although tellurium is the fourth most abundant trace element in the human body. Since IKK and NFkB may be regulated by thiol modifications, we may thus envisage, inview of our integrated results, that Te(IV compounds, may have important roles in thiol redox biological activity in the human body and represent a new class of anti-inflammatory compounds.

  2. Long non-coding RNA TUG1 promotes cervical cancer progression by regulating the miR-138-5p-SIRT1 axis.

    Science.gov (United States)

    Zhu, Jie; Shi, Huirong; Liu, Huina; Wang, Xiaojuan; Li, Fengmei

    2017-09-12

    Increasing evidences showed that long non-coding RNAs (lncRNAs) play vital roles in tumor progression. Recent studies indicated that lncRNA TUG1 was upregulated and promoted tumor processes in several cancers. However, the expression and underlying mechanism of TUG1 in cervical cancer remain unclear. In the present study, we found that TUG1 expression was upregulated in cervical cancer tissues and correlated with advanced clinical features and poor overall survival. TUG1 knockdown suppressed cervical cancer cell growth and metastasis in vitro and tumor growth in vivo . In addition, our results indicated that TUG1 could act as an endogenous sponge by directly binding to miR-138-5p and suppressed miR-138-5p expression. Furthermore, we found that TUG1 could reverse the inhibitory effect of miR-138-5p on cervical cancer cells processes, which might be involved in the activation of SIRT1, a target gene of miR-138-5p, and activation of Wnt/β-catenin signaling pathway. Taken together, we elucidated that TUG1 might promote cervical cancer malignant progression via miR-138-5p-SIRT1-Wnt/β-catenin signaling pathway axis.

  3. Reaction of 1-bromo-3-chloropropane with tellurium and dimethyl telluride in the system of hydrazine hydrate-alkali; Reaktsiya 1-brom-3-khlorpropana s tellurom i dimetilditelluridom v sisteme gidrazin-gidrat-shcheloch'

    Energy Technology Data Exchange (ETDEWEB)

    Russavskaya, N V; Levanova, E P; Sukhomazova, Eh N; Grabel' nykh, V A; Elaev, A V; Klyba, L V; Zhanchipova, E R; Albanov, A I; Korotaeva, I M; Toryashinova, D S.D.; Korchevin, N A [SO RAN, Irkutskij Inst. Khimii imeni A.E. Favorskogo, Irkutsk (Russian Federation)

    2006-05-15

    A synthesis of oligomeric substance of thiocol type, the poly(trimethyleneditelluride), from 1-bromo-3-chloropropane and elemental tellurium is performed using a hydrazine hydrate-alkali system. Reductive splitting of the tellurocol followed by alkylation with methyl iodide give rise to preparation of bis(methyltelluro)propane, which was synthesized also from dimethyl telluride and 1,3-dihalopropanes using the N{sub 2}H{sub 4}{center_dot}H{sub 2}O/KOH system. The reaction products were characterized by elementary analysis, NMR, and IR spectra. Mass spectra of the synthesized low molecular weight organotellurium compounds are considered.

  4. Influence of a low calcium and phosphorus diet on the anabolic effect of human parathyroid hormone (1-38) in female rats

    DEFF Research Database (Denmark)

    Steiner, P.D.; Forrer, R.; Kneissel, Michaela

    2001-01-01

    Parathyroid hormone (PTH) or synthetic N-terminal PTH fragments administered intermittently have been established as anabolic agents in animal and human bones. In the present study, the influence of a low calcium diet on the anabolic effect of human PTH(1-38) [hPTH(1-38)] was investigated. Forty......-eight 10-week-old female Sprague-Dawley rats were randomly assigned to a diet with a low calcium content (LCa) or a diet with the recommended amount of calcium (RCa). After an adaptation period of 15 days, the rats were randomly assigned to hPTH(1-38) treatment (+LCa/+RCa) or vehicle only (-LCa....../-RCa) for an additional 14 days. Total bone mineral density (BMD) values of several bones were determined using quantitative computed tomography and from ratios of ash weight to volume. Biomechanical competence of the fourth lumbar vertebrae and of the right femora was assessed. An anabolic effect could be detected...

  5. Quantitative analysis of T-wave morphology increases confidence in drug-induced cardiac repolarization abnormalities: evidence from the investigational IKr inhibitor Lu 35-138

    DEFF Research Database (Denmark)

    Graff, Claus; Matz, Jørgen; Christensen, Ellen B

    2009-01-01

    prolongation. Seventy-nine healthy subjects were included in this parallel study. After a baseline day during which no drug was given, 40 subjects received an I(Kr)-blocking antipsychotic compound (Lu 35-138) on 7 consecutive days while 39 subjects received placebo. Resting ECGs were recorded and used...... to determine a combined measure of repolarization morphology (morphology combination score [MCS]), based on asymmetry, flatness, and notching. Replicate measurements were used to determine reliable change and study power for both measures. Lu 35-138 increased the QTc interval with corresponding changes in T......-wave morphology as determined by MCS. For subjects taking Lu 35-138, T-wave morphology was a more reliable indicator of I(Kr) inhibition than QTcF (chi(2) = 20.3, P = .001). At 80% study power for identifying a 5-millisecond placebo-adjusted change from baseline for QTcF, the corresponding study power for MCS...

  6. Ubiquitin Ligase RNF138 Promotes Episodic Ataxia Type 2-Associated Aberrant Degradation of Human Cav2.1 (P/Q-Type) Calcium Channels.

    Science.gov (United States)

    Fu, Ssu-Ju; Jeng, Chung-Jiuan; Ma, Chia-Hao; Peng, Yi-Jheng; Lee, Chi-Ming; Fang, Ya-Ching; Lee, Yi-Ching; Tang, Sung-Chun; Hu, Meng-Chun; Tang, Chih-Yung

    2017-03-01

    Voltage-gated Ca V 2.1 channels comprise a pore-forming α 1A subunit with auxiliary α 2 δ and β subunits. Ca V 2.1 channels play an essential role in regulating synaptic signaling. Mutations in the human gene encoding the Ca V 2.1 subunit are associated with the cerebellar disease episodic ataxia type 2 (EA2). Several EA2-causing mutants exhibit impaired protein stability and exert dominant-negative suppression of Ca V 2.1 wild-type (WT) protein expression via aberrant proteasomal degradation. Here, we set out to delineate the protein degradation mechanism of human Ca V 2.1 subunit by identifying RNF138, an E3 ubiquitin ligase, as a novel Ca V 2.1-binding partner. In neurons, RNF138 and Ca V 2.1 coexist in the same protein complex and display notable subcellular colocalization at presynaptic and postsynaptic regions. Overexpression of RNF138 promotes polyubiquitination and accelerates protein turnover of Ca V 2.1. Disrupting endogenous RNF138 function with a mutant (RNF138-H36E) or shRNA infection significantly upregulates the Ca V 2.1 protein level and enhances Ca V 2.1 protein stability. Disrupting endogenous RNF138 function also effectively rescues the defective protein expression of EA2 mutants, as well as fully reversing EA2 mutant-induced excessive proteasomal degradation of Ca V 2.1 WT subunits. RNF138-H36E coexpression only partially restores the dominant-negative effect of EA2 mutants on Ca V 2.1 WT functional expression, which can be attributed to defective membrane trafficking of Ca V 2.1 WT in the presence of EA2 mutants. We propose that RNF138 plays a critical role in the homeostatic regulation of Ca V 2.1 protein level and functional expression and that RNF138 serves as the primary E3 ubiquitin ligase promoting EA2-associated aberrant degradation of human Ca V 2.1 subunits. SIGNIFICANCE STATEMENT Loss-of-function mutations in the human Ca V 2.1 subunit are linked to episodic ataxia type 2 (EA2), a dominantly inherited disease characterized by

  7. Heat treatment of investment cast PH 13-8 Mo stainless steel: Part II. Isothermal aging kinetics

    Science.gov (United States)

    Robino, C. V.; Cieslak, M. J.; Hochanadel, P. W.; Edwards, G. R.

    1994-04-01

    The hardening response of investment cast PH 13-8 Mo stainless steel has been evaluated by hardness measurements following aging in the temperature range normally specified for this alloy (510 °C to 593 °C). A new relationship between fraction transformed and hardness was developed, and analysis of the data in terms of the kinetics of precipitation, in a manner similar to that frequently applied to other precipitation-hardenable martensitic steels, yielded low time exponents and a low value for the apparent activation energy. The values of the time exponents were 0.49, 0.37, 0.56, and 0.53 at 510 °C, 538 °C, 566 °C, and 593 °C, respectively, and that for the apparent activation energy was 139 kJ/mole. As has been proposed for other maraging type steels, these estimates suggest that Β-NiAl precipitates along or near dislocations and that growth of the precipitates is dominated by dislocation pipe diffusion. However, these predictions were neither supported nor refuted by transmission electron microscopy (TEM) because of difficulties in imaging the Β-NiAl precipitates at the aging times and temperatures used. Further, analysis of the data using the formalism of Wert and Zener for the growth of precipitates with interfering diffusion fields indicated that the estimates of fraction transformed from hardness data are not fully appropriate for maraging type steels. Consideration of the nature of the Avrami analysis and the electron microscopy results suggests that other phenomena, including dislocation recovery and reversion of martensite to austenite, occur at rates sufficient to convolute the Avrami analysis. It is further suggested that these results cast doubt on the fundamental implications of previous analyses of precipitation kinetics in age-hardening martensitic steels. Although the Avrami analysis was found not to provide a tenable description of the precipitation kinetics, it does provide a reasonable methodology for portrayal of the hardening response

  8. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss

    International Nuclear Information System (INIS)

    Gomez Aleixandre, J. L.

    1967-01-01

    145 stars with N h >8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c π- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs

  9. Carrageenan-based semi-IPN nanocomposite hydrogels: Swelling kinetic and slow release of sequestrene Fe 138 fertilizer

    Directory of Open Access Journals (Sweden)

    Mohammad Kazem Bahrami

    2016-09-01

    Full Text Available Nanocomposite hydrogels based on kappa-carrageenan were synthesized by incorporating natural sodium montmorillonite (Cloisite nanoclay. Acrylamide (AAm and methylenebisacrylamide (MBA were used as a monomer and a crosslinker, respectively. Effects of reaction variables on the swelling kinetics were studied. The results revealed that the rate of swelling for nanocomposites with high content of MBA was higher than those of nanocomposites consisting of low content of MBA. Similar to the effect of MBA, the rate of swelling enhanced as the carrageenan content was decreased. The influence of clay content on swelling rate was not remarkable. The experimental swelling data were evaluated by pseudo-first-order and pseudo-second-order kinetic models. The swelling data described well by pseudo-second-order kinetic model. Sequestrene Fe 138 (Sq as an agrochemical was loaded into nanocomposites and releasing of this active agent from nanocomposites was studied. The clay-free hydrogel released the whole loaded Sq; whereas the presence of clay restricted the release of Sq.

  10. The prognostic value of time parameters in adjuvant radiotherapy of head and neck cancer. A retrospective analysis of 138 patients

    International Nuclear Information System (INIS)

    Dietl, B.; Schaefer, C.; Koelbl, O.

    2005-01-01

    Purpose: to answer the question, how the parameters waiting time, radiation treatment time and overall treatment time (OTT) influenced the endpoints overall (OS), event-free (EFS) and local recurrence-free survival (LRFS) in patients with locally advanced head-and-neck cancer, who had received postoperative radiotherapy. Patients and methods: 138 patients were included into a retrospective analysis from 10/1993 to 05/2000. Besides the time parameters waiting time, radiation treatment time and OTT, tumor- and therapy-related parameters (T-, N-, R-status, grading, tumor site, surgical technique, and postoperative hemoglobin < 12 g/dl) with potential impact on the endpoints were investigated in the univariate analysis (Kaplan-Meier log-rank test). Individual parameters with a significant impact (p = 0.05) were subjected to a multivariate Cox regression analysis. Results: besides a postoperative hemoglobin value < 12 g/dl, in the univariate analysis an OTT ≥ 105 days negatively influenced all endpoints, as well as a radiation treatment time ≥ 60 days. On multivariate Cox regression analysis, postoperative hemoglobin < 12 g/dl and an OTT ≥ 105 days were identified as independent negative prognostic factors for all endpoints. Conclusion: the waiting time should be managed according to the ASARA (as short as reasonably achievable) recommendation, radiation treatment should not be protracted exceeding an overall treatment of 105 days. Generally, time parameters should be routinely included in the standard tumor documentation, thus facilitating further evaluation of these prognostically relevant factors. (orig.)

  11. Improved selectivity for Pb(II) by sulfur, selenium and tellurium analogues of 1,8-anthraquinone-18-crown-5: synthesis, spectroscopy, X-ray crystallography and computational studies.

    Science.gov (United States)

    Mariappan, Kadarkaraisamy; Alaparthi, Madhubabu; Hoffman, Mariah; Rama, Myriam Alcantar; Balasubramanian, Vinothini; John, Danielle M; Sykes, Andrew G

    2015-07-14

    We report here a series of heteroatom-substituted macrocycles containing an anthraquinone moiety as a fluorescent signaling unit and a cyclic polyheteroether chain as the receptor. Sulfur, selenium, and tellurium derivatives of 1,8-anthraquinone-18-crown-5 (1) were synthesized by reacting sodium sulfide (Na2S), sodium selenide (Na2Se) and sodium telluride (Na2Te) with 1,8-bis(2-bromoethylethyleneoxy)anthracene-9,10-dione in a 1 : 1 ratio. The optical properties of the new compounds are examined and the sulfur and selenium analogues produce an intense green emission enhancement upon association with Pb(II) in acetonitrile. Selectivity for Pb(II) is markedly improved as compared to the oxygen analogue 1 which was also competitive for Ca(II) ion. UV-Visible and luminescence titrations reveal that 2 and 3 form 1 : 1 complexes with Pb(II), confirmed by single-crystal X-ray studies where Pb(II) is complexed within the macrocycle through coordinate covalent bonds to neighboring carbonyl, ether and heteroether donor atoms. Cyclic voltammetry of 2-8 showed classical, irreversible oxidation potentials for sulfur, selenium and tellurium heteroethers in addition to two one-electron reductions for the anthraquinone carbonyl groups. DFT calculations were also conducted on 1, 2, 3, 6, 6 + Pb(II) and 6 + Mg(II) to determine the trend in energies of the HOMO and the LUMO levels along the series.

  12. The Present, Mid-Term, and Long-Term Supply Curves for Tellurium; and Updates in the Results from NREL's CdTe PV Module Manufacturing Cost Model (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Woodhouse, M.; Goodrich, A.; Redlinger, M.; Lokanc, M.; Eggert, R.

    2013-09-01

    For those PV technologies that rely upon Te, In, and Ga, first-order observations and calculations hint that there may be resource constraints that could inhibit their successful deployment at a SunShot level. These are only first-order approximations, however, and the possibility for an expansion in global Te, In, and Ga supplies needs to be considered in the event that there are upward revisions in their demand and prices.In this study, we examine the current, mid-term, and long-term prospects of Tellurium (Te) for use in PV. We find that the current global supply base of Te would support <10 GW of annual traditional CdTe PV manufacturing production. But as for the possibility that the supply base for Te might be expanded, after compiling several preliminary cumulative availability curves we find that there may be significant upside potential in the supply base for this element - principally vis a vis increasing demand and higher prices. Primarily by reducing the Tellurium intensity in manufacturing and by increasing the recovery efficiency of Te in Cu refining processes, we calculate that it may prove affordable to PV manufacturers to expand the supply base for Te such that 100 GW, or greater, of annual CdTe PV production is possible in the 2030 - 2050 timeframe.

  13. TGFβ1-induced down-regulation of microRNA-138 contributes to epithelial-mesenchymal transition in primary lung cancer cells.

    Science.gov (United States)

    Zhang, Fang; Li, Tiepeng; Han, Lu; Qin, Peng; Wu, Zhao; Xu, Benling; Gao, Quanli; Song, Yongping

    2018-02-19

    The existence of cancer stem cells within the tumor could lead to cancer therapy resistance. TGFβ1 is considered as one of the most powerful players in the generation of CSCs through induction of epithelial-mesenchymal transition in different types of cancer including lung cancer, however, the detailed mechanisms by which TGFβ1 contribute to EMT induction and CSC maintenance remains unclear. Here, we showed primary lung cancer cells treated by TGFβ1 exhibit mesenchymal features, including morphology and expression of mesenchymal marker in a time-dependent manner. We also observed long-term TGFβ1 exposure leads to an enrichment of a sub-population of CD44 + CD90 + cells which represent CSCs in lung cancer cells. Moreover, the differential expression microRNAs between CSCs and non-CSCs were identified using next-generation sequencing to screen key miRNAs which might contribute to TGFβ1-induced EMT and CSCs generation. Among those differentially expressed miRNAs, the expression of microRNA-138 was time-dependently down-regulated by TGFβ1 treatment. We further demonstrated primary lung cancer cells, in which we knockdown the expression of miR-138, exhibit mesenchymal phenotypes and stem cell properties. Taken together, these findings indicate TGFβ1-induced down-regulation of microRNA-138 contributes to EMT in primary lung cancer cells, and suggest that miR-138 might serve as a potential therapeutic target. Copyright © 2018 Elsevier Inc. All rights reserved.

  14. Targeting of human GGT in a renal cell carcinoma mouse model with 99mTc-HYNIC-mAb 138H11

    International Nuclear Information System (INIS)

    Kuenstler, J.U.; Seifert, S.; Zimmermann, J.; Fischer, P.; Invancevic, V.; Johannsen, B.

    2002-01-01

    The study shows that the specific tumor uptake of 99m Tc-HYNIC-mAb 138H11 in GGT positive tumours was 2 to 5 times as high as in the controls. A high unspecific background activity was observed in the blood and in all organs well supplied with blood. (orig.)

  15. Single-dose radiosurgical treatment for hepatic metastases - therapeutic outcome of 138 treated lesions from a single institution

    International Nuclear Information System (INIS)

    Habermehl, Daniel; Herfarth, Klaus K; Bermejo, Justo Lorenzo; Hof, Holger; Rieken, Stefan; Kuhn, Sabine; Welzel, Thomas; Debus, Jürgen; Combs, Stephanie E

    2013-01-01

    Local ablative therapies such as stereotactically guided single-dose radiotherapy or helical intensity-modulated radiotherapy (tomotherapy) with high single-doses are successfully applied in many centers in patients with liver metastasis not suitable for surgical resection. This study presents results from more than 10 years of clinical experience and evaluates long-term outcome and efficacy of this therapeutic approach. From 1997 to 2009 a total of 138 intrahepatic tumors of 90 patients were irradiated with single doses of 17 to 30 Gy (median dose 24 Gy). Median age of the patients was 64 years (range 31–89 years). Most frequent underlying tumor histologies were colorectal adenocarcinoma (70 lesions) and breast cancer (27 lesions). In 35 treatment sessions multiple targets were simultaneously irradiated (up to four lesions at once). Local progression-free (PFS) and overall survival (OS) after treatment were investigated using uni- and multiple survival regression models. Median overall survival of all patients was 24.3 months. Local PFS was 87%, 70% and 59% after 6, 12 and 18 months, respectively. Median time to local progression was 25.5 months. Patients with a single lesion and no further metastases at time of RT had a favorable median PFS of 43.1 months according to the Kaplan-Meier estimator. The type of tumor showed a statistical significant influence on local PFS, with a better prognosis for breast cancer histology than for colorectal carcinoma in uni- and multiple regression analysis (p = 0.05). Multiple regression analysis revealed no influence of planning target volume (PTV), patient age and radiation dose on local PFS. Treatment was well tolerated with no severe adverse events. This study confirms safety of SBRT in liver lesions, with 6- and 12 months local control of 87% and 70%. The dataset represents the clinical situation in a large oncology setting, with many competing treatment options and heterogeneous patient characteristics

  16. HIGH-TIME-RESOLUTION MEASUREMENTS OF THE POLARIZATION OF THE CRAB PULSAR AT 1.38 GHz

    Energy Technology Data Exchange (ETDEWEB)

    Słowikowska, Agnieszka [Kepler Institute of Astronomy, University of Zielona Góra, Lubuska 2, 65-265 Zielona Góra (Poland); Stappers, Benjamin W. [Jodrell Bank Centre for Astrophysics, University of Manchester, Manchester M13 9PL (United Kingdom); Harding, Alice K. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); O' Dell, Stephen L.; Elsner, Ronald F.; Weisskopf, Martin C. [Astrophysics Office, NASA Marshall Space Flight Center, ZP12, Huntsville, AL 35812 (United States); Van der Horst, Alexander J. [Astronomical Institute, University of Amsterdam, Science Park 904, 1098 XH Amsterdam (Netherlands)

    2015-01-20

    Using the Westerbork Synthesis Radio Telescope, we obtained high-time-resolution measurements of the full polarization of the Crab pulsar. At a resolution of 1/8192 of the 34 ms pulse period (i.e., 4.1 μs), the 1.38 GHz linear-polarization measurements are in general agreement with previous lower-time-resolution 1.4 GHz measurements of linear polarization in the main pulse (MP), in the interpulse (IP), and in the low-frequency component (LFC). We find the MP and IP to be linearly polarized at about 24% and 21% with no discernible difference in polarization position angle. However, contrary to theoretical expectations and measurements in the visible, we find no evidence for significant variation (sweep) in the polarization position angle over the MP, the IP, or the LFC. We discuss the implications, which appear to be in contradiction to theoretical expectations. We also detect weak circular polarization in the MP and IP, and strong (≈20%) circular polarization in the LFC, which also exhibits very strong (≈98%) linear polarization at a position angle of 40° from that of the MP or IP. The properties are consistent with the LFC, which is a low-altitude component, and the MP and IP, which are high-altitude caustic components. Current models for the MP and IP emission do not readily account for the absence of pronounced polarization changes across the pulse. We measure IP and LFC pulse phases relative to the MP consistent with recent measurements, which have shown that the phases of these pulse components are evolving with time.

  17. Association between gender inequality index and child mortality rates: a cross-national study of 138 countries.

    Science.gov (United States)

    Brinda, Ethel Mary; Rajkumar, Anto P; Enemark, Ulrika

    2015-03-09

    Gender inequality weakens maternal health and harms children through many direct and indirect pathways. Allied biological disadvantage and psychosocial adversities challenge the survival of children of both genders. United Nations Development Programme (UNDP) has recently developed a Gender Inequality Index to measure the multidimensional nature of gender inequality. The global impact of Gender Inequality Index on the child mortality rates remains uncertain. We employed an ecological study to investigate the association between child mortality rates and Gender Inequality Indices of 138 countries for which UNDP has published the Gender Inequality Index. Data on child mortality rates and on potential confounders, such as, per capita gross domestic product and immunization coverage, were obtained from the official World Health Organization and World Bank sources. We employed multivariate non-parametric robust regression models to study the relationship between these variables. Women in low and middle income countries (LMICs) suffer significantly more gender inequality (p Gender Inequality Index (GII) was positively associated with neonatal (β = 53.85; 95% CI 41.61-64.09), infant (β = 70.28; 95% CI 51.93-88.64) and under five mortality rates (β = 68.14; 95% CI 49.71-86.58), after adjusting for the effects of potential confounders (p gender inequality and child mortality. We present the socio-economic problems, which sustain higher gender inequality and child mortality in LMICs. We further discuss the potential solutions pertinent to LMICs. Dissipating gender barriers and focusing on social well-being of women may augment the survival of children of both genders.

  18. Food Insecurity Is Associated with Subjective Well-Being among Individuals from 138 Countries in the 2014 Gallup World Poll.

    Science.gov (United States)

    Frongillo, Edward A; Nguyen, Hoa T; Smith, Michael D; Coleman-Jensen, Alisha

    2017-04-01

    Background: Food insecurity is an aspect of living conditions that is particularly important for quality of life, health, and subjective well-being. The implementation of the 8-item Food Insecurity Experience Scale in 147 countries in the 2014 Gallup World Poll provided an unprecedented opportunity to understand the association of food insecurity with subjective well-being. Objective: We examined how food insecurity relates with measures of living conditions and how food insecurity and other living conditions relate with physical health and, in turn, subjective well-being. Methods: Data were collected from individuals aged ≥15 y by telephone in 38 countries and via face-to-face interviews in 111 others. The available sample was 132,618 (138 countries) and 122,137 (137 countries) for the daily experience and life evaluation indexes of subjective well-being, respectively. Daily experience was a continuous measure and life evaluation was categorized into thriving, struggling, and suffering. We estimated 6 linear or logistic regression models for each index controlling for country as a fixed effect. Results: Food insecurity was associated with the other 3 measures of living conditions: household income, shelter and housing, and employment. Food insecurity explained poor physical health and lower subjective well-being beyond other measures of living conditions. Instrumental and emotional support was associated with higher subjective well-being. The associations of food insecurity with subjective well-being were larger than with other explanatory variables. Food insecurity was associated with subjective well-being within each of the 4 World Bank income classes of countries, with a larger magnitude of differences for the higher-income classes. Conclusions: Food insecurity was strongly and negatively associated with subjective well-being in a large global sample of individuals aged ≥15 y. These results demonstrate the consistency of goal 2 of the Sustainable

  19. Reducing Striping and Near Field Response Influence in the MODIS 1.38um Cirrus Detection Band.

    Science.gov (United States)

    Ackerman, S. A.; Moeller, C. C.; Frey, R. A.; Gumley, L. E.; Menzel, W. P.

    2002-05-01

    Since first light in February 2000, the MODIS L1B data from Terra has exhibited detector striping in the cirrus detection band at 1.38 um (B26). This band's unique characteristic is that it is potentially able to discriminate very thin cirrus (optical depth of 0.1) because water vapor absorption effectively attenuates the upwelling signal from the earth's surface, leaving a flat dark background underneath the thin cirrus. The striping has diminished the power of this band for detecting thin cirrus in the MODIS Cloud Mask (MOD35) over the global environment by imparting a structure on the background. The striping amplitude (valley to peak) is 10 - 15% of the MODIS Ltyp radiance in B26 over land backgrounds, thus exceeding the 5% radiance prelaunch accuracy specification for the band. Also unexpected has been the presence of earth surface reflectance in B26. Forward model calculations indicate that the two-way transmittance of B26 in-band (1% to 1% response) should be water (TPW) exceeds about 12 mm. However, MODIS B26 imagery has routinely shown land surface reflectance, such as Florida, even in very moist (TPW > 30 mm) tropical air masses. MODIS prelaunch test data suggests that a near field response (NFR) at about 1.3 um in the B26 filter may be contributing to this behavior. A destriping and out-of-band correction algorithm has been under development at the University of Wisconsin to address the these issues. The simple linear algorithm is based on tuning detector dependent influence coefficients for B26 as a function of B5 (1.24 um) radiance so that the corrected B26 radiance is near zero for all B26 detectors in moist atmospheric conditions. B5 was chosen as a surrogate to characterize the NFR leak in the B26 filter because of its close spectral proximity to the NFR leak. Real MODIS L1B data is being used to estimate the influence coefficients. The paper will describe the B5 based destriping and NFR correction algorithm and influence coefficient development. It

  20. New limits on 2ε, εβ{sup +} and 2β{sup +} decay of {sup 136}Ce and {sup 138}Ce with deeply purified cerium sample

    Energy Technology Data Exchange (ETDEWEB)

    Belli, P.; Bernabei, R. [INFN Sezione Roma ' ' Tor Vergata' ' , Rome (Italy); Universita di Roma ' ' Tor Vergata' ' , Dipartimento di Fisica, Rome (Italy); Boiko, R.S. [Institute for Nuclear Research, Kyiv (Ukraine); National University of Life and Environmental Sciences of Ukraine, Kyiv (Ukraine); Cappella, F. [INFN Sezione Roma, Rome (Italy); Cerulli, R.; Laubenstein, M. [INFN, Laboratori Nazionali del Gran Sasso, Assergi (Italy); Danevich, F.A.; Kropivyansky, B.N.; Polischuk, O.G.; Tretyak, V.I. [Institute for Nuclear Research, Kyiv (Ukraine); Incicchitti, A. [INFN Sezione Roma, Rome (Italy); Universita di Roma ' ' La Sapienza' ' , Dipartimento di Fisica, Rome (Italy); Mokina, V.M. [Institute for Nuclear Research, Kyiv (Ukraine); INFN Sezione Roma, Rome (Italy)

    2017-08-15

    A search for double electron capture (2ε), electron capture with positron emission (εβ{sup +}), and double positron emission (2β{sup +}) in {sup 136}Ce and {sup 138}Ce was realized with a 465 cm{sup 3} ultra-low background HP Ge γ spectrometer over 2299 h at the Gran Sasso underground laboratory. A 627 g sample of cerium oxide deeply purified by liquid-liquid extraction method was used as a source of γ quanta expected in double β decay of the cerium isotopes. New improved half-life limits were set on different modes and channels of double β decay of {sup 136}Ce and {sup 138}Ce at the level of T{sub 1/2} > 10{sup 17}-10{sup 18} yr. (orig.)

  1. Porta-enxertos para o cultivar Máximo IAC 138-22 de uvas de vinho em Monte Alegre do Sul, SP

    OpenAIRE

    Terra, Maurilo Monteiro; Pires, Erasmo José Paioli; Coelho, Sônia Maria Bonilha Marcondes; Passos, Ilene Ribeiro da Silva; Santos, Rui Ribeiro dos; Pommer, Celso Valdevino; Silva, André Camargo Pereira da; Ribeiro, Ivan José Antunes

    1990-01-01

    Em Monte Alegre do Sul, SP, efetuou-se um experimento de longa duração para observar o comportamento do cultivar IAC 138-22 (Máximo) de uvas para vinho, sobre cinco porta-enxertos: RR 101-14, 'Golia', "Ripária do Traviú', IAC 572 e IAC 313. Em oito colheitas sucessivas anuais, de 1974 a 1981, analisaram-se as produções médias de uvas por planta. Os resultados indicaram que o IAC 572' foi o melhor porta-enxerto para o IAC 138-22 'Máximo'. O IAC 313 superou o IAC 572 em um dos anos estudados. T...

  2. Emodin (1,3,8-trihydroxy-6-methylanthraquinone): a spectrophotometric reagent for the determination of beryllium(II), magnesium(II) and calcium(II)

    International Nuclear Information System (INIS)

    Pal, T.; Jana, N.R.

    1993-01-01

    The individual determination of Be II , Mg II or Ca II by conventional spectrophotometry and simultaneous determination of Mg II and Ca II in mixtures by first-derivative spectrophotometry are possible at trace levels, using emodin (1,3,8-trihydroxy-6-methylanthraquinone) as spectrophotometric reagent. Interference from other metal species, application of these methods to rock samples and statistical analysis of the results are discussed. (author)

  3. Study of the interactions of 13.8 GeV/c protons with the heavy nuclei of the emulsions exposed in magnetic fuel of 170 kgauss; Estudio de las interacciones de protones de 13,8 geV/c con los nucleos pesados de emusiones

    Energy Technology Data Exchange (ETDEWEB)

    Gomez Aleixandre, J L

    1967-07-01

    145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.

  4. The K2-138 System: A Near-resonant Chain of Five Sub-Neptune Planets Discovered by Citizen Scientists

    DEFF Research Database (Denmark)

    Christiansen, Jessie L.; Crossfield, Ian J. M.; Barentsen, Geert

    2018-01-01

    K2-138 is a moderately bright (V = 12.2, K = 10.3) main-sequence K star observed in Campaign 12 of the NASA K2 mission. It hosts five small (1.6-3.3 R⊕) transiting planets in a compact architecture. The periods of the five planets are 2.35, 3.56, 5.40, 8.26, and 12.76 days, forming an unbroken...... chain of near 3:2 resonances. Although we do not detect the predicted 2-5 minute transit timing variations (TTVs) with the K2 timing precision, they may be observable by higher-cadence observations with, for example, Spitzer or CHEOPS. The planets are amenable to mass measurement by precision radial...... velocity measurements, and therefore K2-138 could represent a new benchmark system for comparing radial velocity and TTV masses. K2-138 is the first exoplanet discovery by citizen scientists participating in the Exoplanet Explorers project on the Zooniverse platform....

  5. Tellurium sulfates from reactions in oleum and sulfur trioxide: syntheses and crystal structures of TeO(SO_4), Te_4O_3(SO_4)_5, and Te(S_2O_7)_2

    International Nuclear Information System (INIS)

    Logemann, Christian; Bruns, Joern; Schindler, Lisa Verena; Zimmermann, Vanessa; Wickleder, Mathias S.

    2015-01-01

    The reaction of K_2TeO_4 with fuming sulfuric acid (65 % SO_3) in sealed glass ampoules at 250 C led to colorless single crystals of TeO(SO_4) [triclinic, P anti 1, Z = 8, a = 819.89(3) pm, b = 836.95(4) pm, c = 1179.12(5) pm, α = 82.820(2) , β = 70.645(2) , γ = 81.897(2) , V = 753.11(6) x 10"6 pm"3]. A horseshoe type [Te_4O_3] fragment is the basic motif in the layer structure of the compound. The [Te_4O_3] moieties are linked to infinite chains by further oxide ions. Monomeric [Te_4O_3] horseshoes are found in the crystal structure of Te_4O_3(SO_4)_5 [trigonal, P3_221, Z = 3, a = 859.05(2) pm, c = 2230.66(7) pm, V = 1425.61(6) x 10"6 pm"3], which was obtained from TeO_2 and fuming sulfuric acid (65 % SO_3) at 200 C as colorless single crystals. By switching to neat SO_3 as reaction medium colorless crystals of Te(S_2O_7)_2 [P2_1/n, Z = 4, a = 1065.25(3) pm, b = 818.50(2) pm, c = 1206.27(3) pm, β = 102.097(1) , V = 1028.40(5) x 10"6 pm"3] form when ortho-telluric acid, H_6TeO_6, is used as the tellurium source. The compound was reported previously, however, obviously with a wrong crystallographic description. In the crystal structure the tellurium atoms are coordinated by two chelating disulfate ions. Further Te-O contacts link the [Te(S_2O_7)_2] units to an extended network. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  6. Anomalous behavior of tellurium abundances

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, B L

    1984-01-01

    The cosmic abundance of Te is larger than for any element with atomic number greater than 40, but it is one of the least abundant elements in the earth's lithosphere and it is one of the five elements never reported in sea water. On the other hand, it is the fourth most abundant element in the human body (after Fe, Zn and Rb), and is unusually abundant in human food. It is shown that the high abundance in human food combined with the low abundance in soil requires that it be picked up by plant roots very much more efficiently than any other trace element.

  7. Recurrent De Novo Mutations Affecting Residue Arg138 of Pyrroline-5-Carboxylate Synthase Cause a Progeroid Form of Autosomal-Dominant Cutis Laxa.

    Science.gov (United States)

    Fischer-Zirnsak, Björn; Escande-Beillard, Nathalie; Ganesh, Jaya; Tan, Yu Xuan; Al Bughaili, Mohammed; Lin, Angela E; Sahai, Inderneel; Bahena, Paulina; Reichert, Sara L; Loh, Abigail; Wright, Graham D; Liu, Jaron; Rahikkala, Elisa; Pivnick, Eniko K; Choudhri, Asim F; Krüger, Ulrike; Zemojtel, Tomasz; van Ravenswaaij-Arts, Conny; Mostafavi, Roya; Stolte-Dijkstra, Irene; Symoens, Sofie; Pajunen, Leila; Al-Gazali, Lihadh; Meierhofer, David; Robinson, Peter N; Mundlos, Stefan; Villarroel, Camilo E; Byers, Peter; Masri, Amira; Robertson, Stephen P; Schwarze, Ulrike; Callewaert, Bert; Reversade, Bruno; Kornak, Uwe

    2015-09-03

    Progeroid disorders overlapping with De Barsy syndrome (DBS) are collectively denoted as autosomal-recessive cutis laxa type 3 (ARCL3). They are caused by biallelic mutations in PYCR1 or ALDH18A1, encoding pyrroline-5-carboxylate reductase 1 and pyrroline-5-carboxylate synthase (P5CS), respectively, which both operate in the mitochondrial proline cycle. We report here on eight unrelated individuals born to non-consanguineous families clinically diagnosed with DBS or wrinkly skin syndrome. We found three heterozygous mutations in ALDH18A1 leading to amino acid substitutions of the same highly conserved residue, Arg138 in P5CS. A de novo origin was confirmed in all six probands for whom parental DNA was available. Using fibroblasts from affected individuals and heterologous overexpression, we found that the P5CS-p.Arg138Trp protein was stable and able to interact with wild-type P5CS but showed an altered sub-mitochondrial distribution. A reduced size upon native gel electrophoresis indicated an alteration of the structure or composition of P5CS mutant complex. Furthermore, we found that the mutant cells had a reduced P5CS enzymatic activity leading to a delayed proline accumulation. In summary, recurrent de novo mutations, affecting the highly conserved residue Arg138 of P5CS, cause an autosomal-dominant form of cutis laxa with progeroid features. Our data provide insights into the etiology of cutis laxa diseases and will have immediate impact on diagnostics and genetic counseling. Copyright © 2015 The American Society of Human Genetics. Published by Elsevier Inc. All rights reserved.

  8. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure

    International Nuclear Information System (INIS)

    Gil Perez, D.

    1967-01-01

    We present he re an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs

  9. MERLIN observations of the OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5

    International Nuclear Information System (INIS)

    Chapman, J.; Cohen, R.J.; Norris, R.P.; Diamond, P.J.; Booth, R.S.

    1984-01-01

    OH maser emission from the three OH/IR stars OH 53.6-0.2, OH 138.0+7.2 and OH 141.7+3.5 has been mapped with an angular resolution of 0.28 arcsec and a velocity resolution of 0.7 km s -1 using the Jodrell Bank MERLIN array. Maps are presented of the 1612-MHz OH emission over individual velocity ranges. The maps are consistent with a uniform expanding shell model, and by fitting such models to the data the angular diameters of the shells have been estimated to an accuracy of approx. 25 per cent. (author)

  10. Synthesis of dihydropyrimidin-2-one/thione library and cytotoxic activity against the human U138-MG and Rat C6 glioma cell lines

    International Nuclear Information System (INIS)

    Canto, Romulo F.S.; Eifler-Lima, Vera Lucia; Bernardi, Andressa; Battastini, Ana Maria O.; Russowsky, Dennis

    2011-01-01

    Two series of 4-aryl-3,4-dihydropyrimidin-2(1H)-(thio)ones including monastrol (1a), have been synthesized by an environment-friendly methodology based on the combined use of citric acid or oxalic acid and TEOF (triethylorthoformate). The library was evaluated as inhibitor of cell proliferation on two glioma cell lines (human-U138-MG and Rat-C6). The compounds derived from thiourea 1f and 1d were more cytotoxic than monastrol. The compound derived from urea 2d showed the highest cytotoxic activity among the analyzed compounds. (author)

  11. The effect of equal channel angular pressing on the tensile properties and microstructure of two medical implant materials: ASTM F-138 austenitic steel and Grade 2 titanium

    Science.gov (United States)

    Mendes Filho, A. de A.; Sordi, V. L.; Kliauga, A. M.; Ferrante, M.

    2010-07-01

    Titanium and F-138 stainless steel are employed in bone replacement and repair. The former material was ECAP-deformed at room temperature and at 300°C, followed in some cases by cold rolling. The steel was ECAP-deformed at room temperature only. Work-hardening behavior was studied by making use of the Kocks-mecking plots and microstructural evolution was followed by TEM. Conclusions show that for Ti, ECAP combined with cold rolling gives the best strength-ductility combination, whilst room temperature ECAP increases the tensile strength of the steel but caused substantial ductility loss.

  12. The effect of equal channel angular pressing on the tensile properties and microstructure of two medical implant materials: ASTM F-138 austenitic steel and Grade 2 titanium

    Energy Technology Data Exchange (ETDEWEB)

    Filho, A de A Mendes; Sordi, V L; Kliauga, A M; Ferrante, M, E-mail: ferrante@ufscar.b [Federal University of Sao Carlos, Materials Engineering Department, Sao Carlos, 13565-905 (Brazil)

    2010-07-01

    Titanium and F-138 stainless steel are employed in bone replacement and repair. The former material was ECAP-deformed at room temperature and at 300{sup 0}C, followed in some cases by cold rolling. The steel was ECAP-deformed at room temperature only. Work-hardening behavior was studied by making use of the Kocks-mecking plots and microstructural evolution was followed by TEM. Conclusions show that for Ti, ECAP combined with cold rolling gives the best strength-ductility combination, whilst room temperature ECAP increases the tensile strength of the steel but caused substantial ductility loss.

  13. Mechanical properties of Zr41.2Ti13.8Ni10Cu12.5Be22.5 bulk metallic glass with different geometric confinements

    Science.gov (United States)

    Zhang, Changqin; Zhang, Haifeng; Sun, Qilei; Liu, Kegao

    2018-03-01

    Zr41.2Ti13.8Ni10Cu12.5Be22.5 (Vit 1) bulk metallic glass with Cu sleeves at different positions was prepared by the Cu mold casting method, and the effects of different geometric confinements offered by Cu sleeves on the mechanical properties of Vit 1 were investigated. It was found that the mechanical properties were prominently influenced by different geometric confinements and the plasticity could be modified by optimizing the positions of Cu sleeves. The results revealed that shear band initiation and propagation could be efficiently intervened by changing the radial boundary restraints, which led to quite different mechanical behaviors.

  14. Effect of increasing tellurium content on the electronic and optical properties of cadmium selenide telluride alloys CdSe{sub 1-x}Te{sub x}: An ab initio study

    Energy Technology Data Exchange (ETDEWEB)

    Reshak, Ali Hussain, E-mail: maalidph@yahoo.co.uk [Institute of Physical Biology-South Bohemia University, Nove Hrady 37333 (Czech Republic); School of Material Engineering, Malaysia University of Perlis, P.O Box 77, d/a Pejabat Pos Besar, 01007 Kangar, Perlis (Malaysia); Kityk, I.V. [Electrical Engineering Department, Technical University of Czestochowa, Al. Armii Krajowej 17/19, Czestochowa (Poland); Khenata, R. [Laboratoire de Physique Quantique et de Modelisation Mathematique de la Matiere (LPQ3 M), universite de Mascara, Mascara 29000 (Algeria); Department of Physics and Astronomy, King Saud University, P.O. Box 2455, Riyadh 11451 (Saudi Arabia); Auluck, S. [National Physical Laboratory Dr. K S Krishnan Marg, New Delhi 110012 (India)

    2011-06-16

    Highlights: > Theoretical study of effect of vary Te content on band structure, density of states, linear and nonlinear optical susceptibilities of CdSe{sub 1-x}Te{sub x}. > Increasing Te content leads to a decrease in the energy band gap. > Significant enhancement of the electronic properties as a function of tellurium concentration - Abstract: An all electron full potential linearized augmented plane wave method, within a framework of GGA (EV-GGA) approach, has been used for an ab initio theoretical study of the effect of increasing tellurium content on the band structure, density of states, and the spectral features of the linear and nonlinear optical susceptibilities of the cadmium-selenide-telluride ternary alloys CdSe{sub 1-x}Te{sub x} (x = 0.0, 0.25, 0.5, 0.75 and 1.0). Our calculations show that increasing Te content leads to a decrease in the energy band gap. We find that the band gaps are 0.95 (1.76), 0.89 (1.65), 0.83 (1.56), 0.79 (1.44) and 0.76 (1.31) eV for x = 0.0, 0.25, 0.5, 0.75 and 1.0 in the cubic structure. As these alloys are known to have a wurtzite structure for x less than 0.25, the energy gaps are 0.8 (1.6) eV and 0.7 (1.55) eV for the wurtzite structure (x = 0.0, 0.25) for the GGA (EV-GGA) exchange correlation potentials. This reduction in the energy gaps enhances the functionality of the CdSe{sub 1-x}Te{sub x} alloys, at least for these concentrations, leading to an increase in the effective second-order susceptibility coefficients from 16.75 pm/V (CdSe) to 18.85 pm/V (CdSe{sub 0.75}Te{sub 0.25}), 27.23 pm/V (CdSe{sub 0.5}Te{sub 0.5}), 32.25 pm/V (CdSe{sub 0.25}Te{sub 0.75}), and 37.70 pm/V (CdTe) for the cubic structure and from 12.65 pm/V (CdSe) to 21.11 pm/V (CdSe{sub 0.75}Te{sub 0.25}) in the wurtzite structure. We find a nonlinear relationship between the absorption/emission energies and composition, and a significant enhancement of the electronic properties as a function of tellurium concentration. This variation will help in

  15. A laser system for the spectroscopy on highly charged ions, tellurium molecules, and Rydberg states of rubidium atoms; Ein Lasersystem zur Spektroskopie von hochgeladenen Ionen, Tellurmolekuelen und Rubidium-Rydberg-Zustaenden

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht, Sebastian

    2014-08-15

    Optical measuring methods allow the detection and identification of the atomic structure with extraordinary precision. Deviations to theoretical predictions can indicate unknown physical effects. Therefore, precise measurements on the atomic structure continue to be of large relevance. In this work, a laser system for precision spectroscopy on Bismuth ({sup 209}Bi{sup 82+}), Tellurium ({sup 130}Te{sub 2}) and Rydberg states of Rubidium ({sup 85}Rb) has been built and characterized. Spectroscopic measurements on Tellurium and Rubidium have been achieved with this setup. The system consists of a two-stage frequency doubled diode laser, stabilized via a cavity and an RF-offsetlock to arbitrary wavelengths with absolute high stability. The setup of the laser system will be presented and the systematic error caused by the refractive index of air inside the transfer cavity will be discussed. A stability of better then 6.14 MHz at 244 nm is obtained for planned experiments on the ground state hyperfine splitting of {sup 209}Bi{sup 82+}. This will allow an increase in precision of more then four orders of magnitude for this measurement. Further increase in precision can be achieved by using an evacuated cavity. The obtained stability is measured by comparison of the laser frequency to absorption lines of Tellurium ({sup 130}Te{sub 2}). Eight reference lines, known from literature, spanning the region from 613720.717 GHz to 616803.545 GHz have been measured. The frequency measurements of three lines, coinciding with the emission spectrum of an argon-ion-laser, show deviations with respect to the published frequencies. Further inconsistencies in literature are cleared. Part of this work is also the precise measurement of 843 Doppler-free {sup 130}Te{sub 2} reference lines spanning the frequency range from 613881.150 GHz to 616614.258 GHz at a precision of better then 4 MHz for most lines. Additionally, measurements on electromagnetically induced transparency (EIT) using

  16. Crystallization in Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk metallic glass under pressure

    DEFF Research Database (Denmark)

    Jiang, Jianzhong; Zhou, T.J.; Rasmussen, Helge Kildahl

    2000-01-01

    The effect of pressure on the crystallization behavior of the bulk metallic glass-forming Zr41.2Ti13.8Cu12.5Ni10Be22.5 alloy with a wide supercooled liquid region has been investigated by in situ high-pressure and high-temperature x-ray powder diffraction measurements using synchrotron radiation......)], reporting a decrease of the crystallization temperature under pressure in a pressure range of 0-6 GPa for the bulk glass Zr41Ti14Cu12.5Ni9Be22.5C1 alloy. Compressibility with a volume reduction of approximately 22% at room temperature does not induce crystallization in the Zr41.2Ti13.8Cu12.5Ni10Be22.5 bulk...... glass alloy. This indicates that the densification effect induced by pressure in the pressure range investigated plays a minor role in the crystallization behavior of this bulk glass alloy. The different crystallization behavior of the carbon-free and the carbon-containing glassy alloys has been...

  17. Percepce rodičovského chování a jeho souvislost se sebehodnocením. 138. klinicko-psychologický den. Praha, 8. 1. 2007.

    OpenAIRE

    Macek Petr; Širůček Jan

    2007-01-01

    Prezentace, 138. klinicko-psychologický den. Praha, 8.1.2007. Příspěvek byl zaměřen na výzkum souvislostí mezi sebehodnocením adolescentů a jejich hodnocení obou rodičů. Presentation, 138th clinical-psychology workshop. Prague, 8.1.2007. Paper was focused on perception of parenting style during childhood and perception of parents as predictors of adolescent's self-esteem

  18. Propuesta del programaS-GeMS para el análisis estadístico espacial de fallas en alimentadores soterrados de 13,8 kV; PropodedS-GEMS program for statistical analysis of failure space of 13.8 kV underground feeders

    Directory of Open Access Journals (Sweden)

    Boris Alba Valle

    2011-06-01

    Full Text Available Actualmente, el sistema soterrado de Ciudad de La Habana, carece de herramientas gráficas de trabajo con lascuales poder visualizar zonas con alta incidencia de fallas en alimentadores de 13,8 kV y que permitan tomardecisiones certeras en cuanto a los tramos de alimentadores a reparar o sustituir por su deterioro. En este trabajo sepropone el uso de los programas S-GeMS (Stanford Geostatistical Modeling Software y Autocad comoherramientas para el análisis estadístico espacial de la cantidad de fallas. Se realiza, en lo fundamental, el estudiode toda la documentación referente a las aplicaciones del programa S-GeMS y la Base de Datos de la cantidad defallas del 2007 al 2009, de los alimentadores de 13,8 kV perteneciente a la Unidad Empresarial Básica (UEBSoterrada. Finalmente se muestran, a modo de ejemplo, los resultados obtenidos con su aplicación al determinarsela dirección preferencial de distribución de la cantidad de fallas.   Nowadays, the Havana City underground system, lacks of graphical working tools which not only allow to visualizehigh faults incidence areas in 13,8 kV feeders but also make good decisions in reference to the feeder sections to berepaired or substituted due to their impairment. The use of S-GeMS (Stanford Geostatistical Modeling Software andAutocad programs as tools for the spatial statistic analysis of faults quantity is proposed in this article. The study ofthe whole documentation related to the S-GeMS program applications is carried out as well as the UndergroundManagement Basic Unit (UEB 13,8 kV feeders faults quantity database from 2007 to 2009. Finally, the results afterdetermining the faults quantity distribution preferential address with the program application are shown, as anexample.

  19. Propuesta del programa S-GeMS para el análisis estadístico espacial de fallas en alimentadores soterrados de 13,8 kV;PropodedS-GEMS program for statistical analysis of failure space of 13.8 kV underground feeders

    Directory of Open Access Journals (Sweden)

    Boris Alba - Valle

    2011-06-01

    Full Text Available Actualmente, el sistema soterrado de Ciudad de La Habana, carece de herramientas gráficas de trabajo con lascuales poder visualizar zonas con alta incidencia de fallas en alimentadores de 13,8 kV y que permitan tomardecisiones certeras en cuanto a los tramos de alimentadores a reparar o sustituir por su deterioro. En este trabajo sepropone el uso de los programas S-GeMS (Stanford Geostatistical Modeling Software y Autocad comoherramientas para el análisis estadístico espacial de la cantidad de fallas. Se realiza, en lo fundamental, el estudiode toda la documentación referente a las aplicaciones del programa S-GeMS y la Base de Datos de la cantidad defallas del 2007 al 2009, de los alimentadores de 13,8 kV perteneciente a la Unidad Empresarial Básica (UEBSoterrada. Finalmente se muestran, a modo de ejemplo, los resultados obtenidos con su aplicación al determinarsela dirección preferencial de distribución de la cantidad de fallas.Nowadays, the Havana City underground system, lacks of graphical working tools which not only allow to visualizehigh faults incidence areas in 13,8 kV feeders but also make good decisions in reference to the feeder sections to berepaired or substituted due to their impairment. The use of S-GeMS (Stanford Geostatistical Modeling Software andAutocad programs as tools for the spatial statistic analysis of faults quantity is proposed in this article. The study ofthe whole documentation related to the S-GeMS program applications is carried out as well as the UndergroundManagement Basic Unit (UEB 13,8 kV feeders faults quantity database from 2007 to 2009. Finally, the results afterdetermining the faults quantity distribution preferential address with the program application are shown, as anexample.

  20. Free radical scavenging activity and neuroprotective potentials of D138, one Cu(II)/Zn(II) Schiff-base complex derived from N,N'-bis(2-hydroxynaphthylmethylidene)-1,3-propanediamine.

    Science.gov (United States)

    Wang, Che; Cai, Zheng-Xu; You, Zhong-Lu; Guo, Hui-Shu; Shang, De-Jing; Wang, Xiao-Ling; Zhang, Liang; Ma, Li-Jie; Tan, Jun; Le, Wei-Dong; Li, Song

    2014-09-01

    There is increasing evidence that free radicals play an important role in neuronal damages induced by diabetes mellitus or cerebral ischemia insults. Antioxidants with free radical scavenging activities have been shown to be beneficial and neuroprotective for these pathological conditions. Here, we report free radical scavenging activity and neuroprotective potential of D138, one copper(II)/zinc(II) Schiff-base complex derived from N,N'-2(2-hydroxynaphthylmethylidene)-1,3-propanediamine. The data from three in vitro assays, 2,2-diphenyl-1-picrylhydrazyl assay, nitro blue tetrazolium assay and hydroxyl radical scavenging assay, indicated that D138 presented a potent free radical scavenging activity. The neuroprotective and antioxidative effects of D138 were further evaluated in vivo using bilateral common carotid artery occlusion (BCCAO) mouse model and streptozotocin (STZ) diabetic mouse model. Our results indicated that treatment of D138 significantly ameliorated the hippocampal neuronal damage and the oxidative stress levels in these animal models. Moreover, D138 also reversed the behavioral deficiencies induced by BCCAO or STZ, as assessed by Y-maze test and fear conditioning test. In conclusion, all these findings support that D138 exerts free radical scavenging and neuroprotective activities and has the potentials to be a potent therapeutic candidate for brain oxidative damage induced by cerebral ischemia or diabetes mellitus.

  1. A de novo 1.38 Mb duplication of 1q31.1 in a boy with hemifacial microsomia, anophthalmia, anotia, macrostomia, and cleft lip and palate.

    Science.gov (United States)

    Huang, Xue-shuang; Zhu, Bao; Jiang, Hai-ou; Wu, Su-fan; Zhang, Zai-qi; Xiao, Lin; Yi, Li-lan; Zhang, Jian-xiang

    2013-04-01

    We reported a 2-year-old boy with developmental delay, mild mental retardation, and severe craniofacial malformation, including facial asymmetry with hypoplasia of the left zygoma, maxilla, and mandible, and left anophthalmia and anotia. A genome-wide screen revealed a 1.38 Mb duplication on chromosome 1q31.1, which was absent in his parents and 27 healthy controls. The duplication region contains two Refseq genes, PLA2G4A and C1orf99, which have not been reported to be implicated in craniofacial malformation. Functional studies of these genes and additional clinical analysis are necessary to elucidate the pathogenesis of craniofacial malformation. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  2. Estudio seccional de crecimiento, desarrollo y nutrición en 12.138 niños de Bogotá, Colombia

    Directory of Open Access Journals (Sweden)

    Helberto Luna Jaspe

    1971-01-01

    Full Text Available Se informan los resultados de un estudio antropométrico practicado en 12.138 individuos de ambos sexos, pertenecientes a 4 clases socio-económicas de Bogotá, Colombia. Los valores centilares encontrados en grupo de edad y sexo, se proponen como patrones de referencia en la evaluación del crecimiento de niños de comunidades de características similares a la estudiada. Se comenta acerca de la influencia de los factores ambientales sobre el potencial genético de crecimiento, así como de la capacidad de adaptación de la especie humana a las influencias ambientales.

  3. Synthesis and evaluation of 3-[(2,4-dioxo-1,3,8-triazaspiro[4.6]undec-3-yl)methyl]benzonitrile derivatives as potential anticonvulsants.

    Science.gov (United States)

    Madaiah, Malavalli; Prashanth, Maralekere K; Revanasiddappa, Hosakere D; Veeresh, Bantal

    2013-03-01

    New 3-[(2,4-dioxo-1,3,8-triazaspiro[4.6]undec-3-yl)methyl]benzonitrile derivatives 8-37 were synthesized and their pharmacological activities were determined with the objective to better understand their structure-activity relationship (SAR) for anticonvulsant activity. All the compounds were evaluated for their possible anticonvulsant activity by maximal electroshock seizure (MES) and pentylenetetrazole (PTZ) test. Compounds 11, 18, 31, and 32 showed significant and protective effect on seizure, when compared with the standard drug valproate. The same compounds were found to exhibit advanced anticonvulsant activity as well as lower neurotoxicity than the reference drug. From this study, it is quite apparent that there are at least three parameters for the activity of anticonvulsant drugs, that is, a lipophilic domain, a hydrophobic center, and a two-electron donor. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  4. Alignment creation in atomic ensembles by elastic electron scattering; the case of 138Ba(...6s6p 1P1) atoms

    International Nuclear Information System (INIS)

    Trajmar, S.; Kanik, I.; LeClair, L.R.; Khakoo, M.A.; Bray, I.; Fursa, D.; Csanak, G.

    1998-01-01

    We describe some of our results from a joint experimental and theoretical program concerning elastic electron scattering by 138 Ba(...6s6p 1 P 1 ) atoms. From the experimental results, we derived various scattering parameters and magnetic sublevel specific differential elastic scattering cross sections at impact energy (E 0 ) of 20.0 eV and at scattering angles (θ) of 10deg, 15deg, and 20deg. The same parameters and cross sections were calculated by the convergent close coupling (CCC) approximation and compared to the experimental results. An excellent agreement, found for the two sets of data, gave us confidence in the CCC method and allowed us to extend the angular and energy ranges for the purpose of generating integral elastic scattering cross sections needed for the deduction of the alignment creation cross sections. (J.P.N.)

  5. Association between the porcine Escherichia coli F18 receptor genotype and phenotype and susceptibility to colonisation and postweaning diarrhoea caused by E-coli O138 : F18

    DEFF Research Database (Denmark)

    Frydendahl, K.; Jensen, Tim Kåre; Andersen, Jens Strodl

    2003-01-01

    Porcine postweaning Escherichia coli enteritis is a cause of significant morbidity and mortality in pigs worldwide, and effective prevention remains an unsolved problem. This study examined the correlation between susceptibility of pigs to experimental infection with an E. coli F18 strain...... and the porcine intestinal F18 receptor genotypes. Thirty-one pigs classified as either belonging to the susceptible or the resistant genotype were inoculated with cultures of an E. coli 0138:F18 isolated from a pig with postweaning diarrhoea. Susceptibility to colonisation and diarrhoea was assessed by clinical...... and heterozygotic susceptible pigs. Faecal shedding of the challenge strain correlated with the genetic receptor profile. Twenty pigs examined immunohistochemically revealed focal to extensive small intestinal mucosal colonisation by E. coli O138:F18 in nine of 10 susceptible and three of 10 resistant pigs. Results...

  6. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gil Perez, D

    1967-07-01

    We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

  7. Avaliação da resistência à corrosão de implantes em aços inoxidáveis ISO 5832-9 e F138 removidos de pacientes

    Directory of Open Access Journals (Sweden)

    Elison da Fonseca e Silva

    2012-01-01

    Full Text Available This work has compared the surfaces of two different steel samples used as orthopedical implants, classified as ASTM F138 and ISO5832-9, through optical emission spectroscopy, by means of SEM and EDS. The samples (implants were also submitted to potentiodynamic cyclic polarization in Ringer lactate and NaCl 0.9 M L-1 solutions; ISO5832-9 sample did not show any kind of localized corrosion, but in the case of F138 steel was observed a pit localized corrosion in both solutions. In Ringer lactate solution it was observed a loss of about 63% for nickel and 26% for iron for F138 stell, compared to the initial composition.

  8. Lasing transition at 1.06 μm emission in Nd3+ -doped borate-based tellurium calcium zinc niobium oxide glasses for high-power solid-state lasers.

    Science.gov (United States)

    Ravi, O; Prasad, K; Jain, Rajiv; Venkataswamy, M; Chaurasia, Shivanand; Deva Prasad Raju, B

    2017-08-01

    The spectroscopic properties of Tellurium Calcium Zinc Niobium oxide Borate (TCZNB) glasses of composition (in mol%) 10TeO 2  + 15CaO + 5ZnO + 10 Nb 2 O 5  + (60 - x)B 2 O 3  + Nd 2 O 3 (x = 0.1, 0.5, 1.0 or 1.5 mol%) have been investigated experimentally. The three phenomenological intensity parameters Ω 2 , Ω 4, Ω 6 have been calculated using the Judd-Ofelt theory and in turn radiative properties such as radiative transition probabilities, emission cross-sections, branching ratios and radiative lifetimes have been estimated. The trend found in the JO intensity parameter is Ω 2  > Ω 6  > Ω 4 If Ω 6  > Ω 4 , the glass system is favourable for the laser emission 4 F 3 /2  →  4 I 11 /2 in the infrared (IR) wavelength. The experimental values of branching ratio of 4 F 3 /2  →  4 I 11 /2 transition indicate favourable lasing action with low threshold power. The evaluated total radiative transition probabilities (A T ), stimulated emission cross-section (σ e ) and gain bandwidth parameters (σ e  × Δλ p ) were compared with earlier reports. An energy level analysis has been carried out considering the experimental energy positions of the absorption and emission bands. Copyright © 2016 John Wiley & Sons, Ltd.

  9. Constitutional studies in the palladium-rhodium-tellurium (-oxygen) system. A contribution to elucidate the behaviour of Pd, Rh and Te in the vitrification process of high-level waste concentrates (HLWC)

    International Nuclear Information System (INIS)

    Hartmann, T.

    1996-01-01

    In the vitrification process of high-level waste concentrates (HLWC) from the reprocessing of nuclear spent fuel elements, about 30 different elements have to be immobilized in a solid matrix consisting of an alkali borosilicate glass. Most of the waste oxides are dissolved in the alkali borosilicate melt and become structural elements of the glasses when cooled. This, however, applies only partly to the platinum metals Ru, which forms RuO 2 , and palladium and rhodium, which deposit as sparingly soluble and electrically conducting tellurides. This might considerably impair the technical process of HLWC vitrification. Therefore, constitutional studies on the Pd-Rh-Te system became necessary. The phase diagram of the Pd-Rh-Te ternary system at temperatures of 1150, 1100, 1050, 1000, 950, 900 and 750 C was determined under inertial conditions. Oxygen exerts a major influence on the system. Already under limited availability of oxygen, the rhodium contents of the solid solution phases α 1 and α 2 are clearly diminished. Rhodium of the phases becomes oxidized selectively. The three-phase field α 1 +α 2 +L is shifted to higher palladium and tellurium contents, even oxygen is available to a limited extend only. With the oxygen in the air, the extension of the three-phase space is reduced markedly. The complex process chemistry of Pf, Rh and Te during the vitrification can be described by the state of the Pd-Rh-Te ternary system after annealing in (air) oxygen for limited periods of time. (orig./MM) [de

  10. A Study of the r-Process Path Nuclides,$^{137,138,139}$Sb using the Enhanced Selectivity of Resonance Ionization Laser Ionization

    CERN Multimedia

    Walters, W

    2002-01-01

    The particular features of the r-process abundances with 100 < A < 150 have demonstrated the close connection between knowledge of nuclear structure and decay along the r-process path and the astrophysical environement in which these elements are produced. Key to this connection has been the measurement of data for nuclides (mostly even-N nuclides) that lie in the actual r-process path. Such data are of direct use in r-process calculations and they also serve to refine and test the predictive power of nuclear models where little or no data now exist. In this experiment we seek to use the newly developed ionization scheme for the Resonance Ionization Laser Ion Source (RILIS) to achieve selective ionization of neutron-rich antimony isotopes in order to measure the decay properties of r-process path nuclides $^{137,138,139}$Sb. These properties include the half-lives, delayed neutron branches, and daughter $\\gamma$-rays. The new nuclear structure data for the daughter Te nuclides is also of considerable in...

  11. Neutron Activation Resonance Integrals of 74Se, 78Se, 80Se, 81Br, 127I, 130Te, 138Ba, 140Ce, and 142Ce

    International Nuclear Information System (INIS)

    Ricabarra, M. D.; Turjanskl, R.; Ricabarra, G. H.; Bigham, C.B.

    1968-01-01

    A lithium-drift germanium γ-ray spectrometer has been used to make accurate intercomparisons of the ratio of resonance-integral to thermal-activation cross section by measuring cadmium ratios or relative activation rates in two different neutron spectra. The standard, gold, or secondary standard, indium, was mixed uniformly in the samples and the activities resolved with the spectrometer. Expressed as Westcott S 0 values, the results relative to S 0 = 17.7 for gold were as follows: 74 Se = 10.3 +± 0.1, 78 Se = 12.3 ± 0.3, 80 Sc = 2.65 ± 0.02, 81 Br = 24.3 ± 0.5, 127 I = 27.8 ± 0.5, 130 Te = 2.10 ± 0.07, 138 Ba = 0.649 ± 0.004, 140 Ce = 0.476 ± 0.003, 142 Ce = 0.865 ± 0.005. (author)

  12. Microstructural Evolution and Mechanical Properties of Simulated Heat-Affected Zones in Cast Precipitation-Hardened Stainless Steels 17-4 and 13-8+Mo

    Science.gov (United States)

    Hamlin, Robert J.; DuPont, John N.

    2017-01-01

    Cast precipitation-hardened (PH) stainless steels 17-4 and 13-8+Mo are used in applications that require a combination of high strength and moderate corrosion resistance. Many such applications require fabrication and/or casting repair by fusion welding. The purpose of this work is to develop an understanding of microstructural evolution and resultant mechanical properties of these materials when subjected to weld thermal cycles. Samples of each material were subjected to heat-affected zone (HAZ) thermal cycles in the solution-treated and aged condition (S-A-W condition) and solution-treated condition with a postweld thermal cycle age (S-W-A condition). Dilatometry was used to establish the onset of various phase transformation temperatures. Light optical microscopy (LOM), scanning electron microscopy (SEM), and energy dispersive spectrometry (EDS) were used to characterize the microstructures, and comparisons were made to gas metal arc welds that were heat treated in the same conditions. Tensile testing was also performed. MatCalc thermodynamic and kinetic modeling software was used to predict the evolution of copper (Cu)-rich body center cubic precipitates in 17-4 and β-NiAl precipitates in 13-8+Mo. The yield strength was lower in the simulated HAZ samples of both materials prepared in the S-A-W condition when compared to their respective base metals. Samples prepared in the S-W-A condition had higher and more uniform yield strengths for both materials. Significant changes were observed in the matrix microstructure of various HAZ regions depending on the peak temperature, and these microstructural changes were interpreted with the aid of dilatometry results, LOM, SEM, and EDS. Despite these significant changes to the matrix microstructure, the changes in mechanical properties appear to be governed primarily by the precipitation behavior. The decrease in strength in the HAZ samples prepared in the S-A-W condition was attributed to the dissolution of precipitates

  13. T-138C and A-7G polymorphisms in the MGP gene and the association with coronary arthery disease: Iranian patients

    Directory of Open Access Journals (Sweden)

    Abiri M

    2009-05-01

    Full Text Available "n Normal 0 false false false EN-GB X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: Coronary Artery Disease (CAD is a major cause of death worldwide including Iran.  The risk of developing disease in patients without symptoms is assessed in part by factors that are associated with disease. Among these factors family history points to the significance of genetic component in the risk of CAD. The identification of the genetic variants that confer risk for CAD is essential for detecting high-risk individuals, so preventative life style and therapeutic action can be taken before overt disease develops. So far more than 100 genes have been reported with possible role in developing risk for CAD. Matrix- Gla Protein (MGP is one of these genes that association of its single nucleotide polymorphism (SNP with CAD has been reported.  Among the polymorphisms, there are two promoter SNPs at position -7 & -138 that their association with CAD has been reported before. Here we investigated the association of these SNPs with CAD in Iranian population. "n"n Methods: 150 cases and 150 controls were selected on the basis of their clinical assessments and angiographic reports. DNA was extracted from blood samples. The genotypes for both SNPs were determined using Polymerase Chain Reaction

  14. Understanding Statin Use in America and Gaps in Patient Education (USAGE): an internet-based survey of 10,138 current and former statin users.

    Science.gov (United States)

    Cohen, Jerome D; Brinton, Eliot A; Ito, Matthew K; Jacobson, Terry A

    2012-01-01

    Statins substantially reduce the risk of cardiovascular disease and are generally well-tolerated. Despite this, many patients discontinue therapy. A better understanding of the characteristics of current and former statin users may be helpful for formulating strategies to improve long-term adherence. The Understanding Statin Use in America and Gaps in Education (USAGE) survey assessed the attitudes, beliefs, practices, and behavior of current and former statin users. Individuals 18 years or older who reported a history of high cholesterol and current or former statin use were identified within a registered consumer panel cohort in the United States and invited to participate in an Internet survey. Of the 10,138 respondents, 8918 (88%) were current statin users and 1220 (12%) were former users. Participants (mean age 61 years) were predominantly white (92%), female (61%), of middle income (median $44,504/yr), and had health insurance (93%). Among current users, 95% took a statin alone, and 70% had not missed a dose in the past month. Although ∼70% reported that their physicians had explained the importance of cholesterol levels for their heart health former users were less satisfied with the discussions (65% vs. 83%, P users, respectively (P users was cost (32%) and the primary reason for discontinuation was side effects (62%). This survey provides important insights into behavior and attitudes among current and former statin users and the results suggest that more effective dialogue between healthcare providers and patients may increase persistence of statin use, particularly when the patient has concerns about side effects and drug costs. Copyright © 2012 National Lipid Association. Published by Elsevier Inc. All rights reserved.

  15. The K2 Ecliptic Plane Input Catalog (EPIC) and Stellar Classifications of 138,600 Targets in Campaigns 1-8

    Science.gov (United States)

    Huber, Daniel; Bryson, Stephen T.; Haas, Michael R.; Barclay, Thomas; Barentsen, Geert; Howell, Steve B.; Sharma, Sanjib; Stello, Dennis; Thompson, Susan E.

    2016-05-01

    The K2 Mission uses the Kepler spacecraft to obtain high-precision photometry over ≈80 day campaigns in the ecliptic plane. The Ecliptic Plane Input Catalog (EPIC) provides coordinates, photometry, and kinematics based on a federation of all-sky catalogs to support target selection and target management for the K2 mission. We describe the construction of the EPIC, as well as modifications and shortcomings of the catalog. Kepler magnitudes (Kp) are shown to be accurate to ≈0.1 mag for the Kepler field, and the EPIC is typically complete to Kp ≈ 17 (Kp ≈ 19 for campaigns covered by Sloan Digital Sky Survey). We furthermore classify 138,600 targets in Campaigns 1-8 (≈88% of the full target sample) using colors, proper motions, spectroscopy, parallaxes, and galactic population synthesis models, with typical uncertainties for G-type stars of ≈3% in {T}{{eff}}, ≈0.3 dex in {log} g, ≈40% in radius, ≈10% in mass, and ≈40% in distance. Our results show that stars targeted by K2 are dominated by K-M dwarfs (≈41% of all selected targets), F-G dwarfs (≈36%), and K giants (≈21%), consistent with key K2 science programs to search for transiting exoplanets and galactic archeology studies using oscillating red giants. However, we find significant variation of the fraction of cool dwarfs with galactic latitude, indicating a target selection bias due to interstellar reddening and increased contamination by giant stars near the galactic plane. We discuss possible systematic errors in the derived stellar properties, and differences with published classifications for K2 exoplanet host stars. The EPIC is hosted at the Mikulski Archive for Space Telescopes (MAST): http://archive.stsci.edu/k2/epic/search.php.

  16. Therapeutic Efficacy of Alpha-RIT Using a (213)Bi-Anti-hCD138 Antibody in a Mouse Model of Ovarian Peritoneal Carcinomatosis.

    Science.gov (United States)

    Derrien, Aurélie; Gouard, Sébastien; Maurel, Catherine; Gaugler, Marie-Hélène; Bruchertseifer, Frank; Morgenstern, Alfred; Faivre-Chauvet, Alain; Classe, Jean-Marc; Chérel, Michel

    2015-01-01

    Ovarian peritoneal carcinomatosis is a pathology for which effective cures are currently lacking. New research protocols seek to eradicate residual micrometastases following cytoreductive surgery by using hyperthermic intraperitoneal chemotherapy (HIPEC) or radioimmunotherapy (RIT). This study aims to first develop alpha-RIT using an anti-CD138 mAb radiolabeled with an alpha-emitter, bismuth-213 ((213)Bi-B-B4) and HIPEC in a nude mouse model and second to compare and combine these techniques. A murine model of postoperative ovarian peritoneal carcinomatosis was established. A pilot group of six mice received an intraperitoneal injection of luciferase-tagged SHIN-3 cells and bioluminescence was measured every day. Cytoreductive surgery was performed at day 14 (n = 4) and 29 (n = 2). Because the residual bioluminescence signal measured after surgery was equivalent to that obtained 3 days after the graft, HIPEC or alpha-RIT treatments were applied 3 days after the graft. Ten mice were treated by HIPEC with cisplatine (37.5 mg/mL), 11 with 7.4 MBq of (213)Bi-B-B4, seven with 11.1 MBq of (213)Bi-B-B4, and 10 mice were treated with the combined therapy (HIPEC + 7.4 MBq of (213)Bi-B-B4). Eleven mice received no treatment. Bioluminescence imaging and survival were assessed. Alpha-RIT 7.4 MBq and 11.1 MBq significantly improved survival (p = 0.0303 and p = 0.0070, respectively), whereas HIPEC and HIPEC + alpha-RIT treatments did not significantly ameliorate survival as compared to the control group. Survival was significantly increased by alpha-RIT treatment in mice with peritoneal carcinomatosis of ovarian origin; however, HIPEC alone or in combination with alpha-RIT had no significant effect.

  17. Investigation of precipitation and hardening response of maraging stainless steels 17-4 and 13-8+Mo during multi-pass welding

    Science.gov (United States)

    Hamlin, Robert J.

    Martensitic precipitation strengthened stainless steels 17-4 and 13-8+Mo are candidate alloys for high strength military applications. These applications will require joining by fusion welding processes thus, it is necessary to develop an understanding of microstructural and mechanical property changes that occur during welding. Previous investigations on these materials have demonstrated that significant softening occurs in the heat affected zone (HAZ) during welding, due to dissolution of the strengthen precipitates. It was also observed that post weld heat treatments (PWHT's) were required to restore the properties. However, PWHT's are expensive and cannot be applied when welding on a large scale or making a repair in the field. Thus, the purpose of the current work is to gain a fundamental understanding of the precipitation kinetics in these systems so that optimized welding procedures can be developed that do not require a PWHT. Multi-pass welding provides an opportunity to restore the strengthening precipitates that dissolve during primary weld passes using the heat from secondary weld passes. Thus, a preliminary investigation was performed to determine whether the times and temperatures associated with welding thermal cycles were sufficient to restore the strength in these systems. A Gleeble thermo-mechanical simulator was used to perform multi-pass welding simulations on samples of each material using a 1000 J/mm and 2000 J/mm heat input. Additionally, base metal and weld metal samples were used as starting conditions to evaluate the difference in precipitation response between each. Hardness measurements were used to estimate the extent of precipitate dissolution and growth. Microstructures were characterized using light optical microscopy (LOM), scanning electron microscopy (SEM), and energy dispersive spectrometry (EDS). It was determined that precipitate dissolution occurred during primary welding thermal cycles and that significant hardening could be

  18. Recurrent novae as a consequence of the accretion of solar material onto a 1.38 M/sub sun/ white dwarf

    International Nuclear Information System (INIS)

    Starrfield, S.; Sparks, W.M.; Truran, J.W.; and Theoretical Division,Los Alamos National Laboratory)

    1985-01-01

    We have computed three evolutionary sequences which treat the accretion of hydrogen-rich material onto 1.38 M/sub sun/ white dwarfs. In each of these sequences the accreting matter had only a solar composition of the CNO nuclei (Z = 0.015). In the first sequence we utilized an accretion rate of 1.7 x 10/sup hyphen8/ M/sub sun/ yr/sup hyphen1/ onto a white dwarf with an initial luminosity of 0.1 L/sub sun/ . It took this sequence '33 yr to reach the peak of the thermonuclear runaway which resulted in an outburst that ejected 3x10/sup hyphen8/ M/sub sun/ . of material moving at speeds up to 2900 kn s/sup hyphen1/. The light curve, the time to outburst, and the amount of mass ejected during the evolution are in excellent agreement with the observed outburst of Nova U Sco 1979. However, only 6% of the accreted envelope was ejected during the outburst. The remaining material quickly burned to helium ('2 yr) and settled back onto the white dwarf. The second study involved an accretion rate of 1.7x10/sup hyphen9/ M/sub sun/ yr/sup hyphen1/ onto a white dwarf with an initial luminosity of 10/sup hyphen2/ L/sub sun/ . It took nearly 1600 yr to reach the burst phase of the evolution, and by this time the dwarf had accreted '3x10/sup hyphen6/ M/sub sun/ . Peak temperature in the shell source reached 3.5x10 8 K, about 1.3x10 8 K higher than was found for model 1. This sequence ejected 3x10/sup hyphen7/ M/sub sun/, only 13% of the accreted envelope, moving at low velocities. For both of these evolutionary sequences, we find that as a result of the accretion of matter onto a massive white dwarf, the mass of the white dwarf grows toward the Chandrasekhar limit. If our study is a realistic representation of the evolution of U Sco, then this star is well on its way to becoming an SN I

  19. Paclitaxel-Fe3O4 nanoparticles inhibit growth of CD138–  CD34– tumor stem-like cells in multiple myeloma-bearing mice

    Directory of Open Access Journals (Sweden)

    Yang C

    2013-04-01

    Full Text Available Cuiping Yang,1,3,* Jing Wang,2,* Dengyu Chen,1,* Junsong Chen,1 Fei Xiong,4 Hongyi Zhang,1 Yunxia Zhang,2 Ning Gu,4 Jun Dou11Department of Pathogenic Biology and Immunology, Medical School, 2Department of Gynecology and Obstetrics, Zhongda Hospital, Southeast University, Nanjing, 3Department of Pathogenic Biology and Immunology, School of Basic Medicine, Jiangxi University of Traditional Chinese Medicine, Nanchang, 4School of Biological Science and Medical Engineering, Southeast University, Nanjing, People’s Republic of China*These authors contributed equally to this workBackground: There is growing evidence that CD138– CD34– cells may actually be tumor stem cells responsible for initiation and relapse of multiple myeloma. However, effective drugs targeted at CD138– CD34– tumor stem cells are yet to be developed. The purpose of this study was to investigate the inhibitory effect of paclitaxel-loaded Fe3O4 nanoparticles (PTX-NPs on CD138– CD34– tumor stem cells in multiple myeloma-bearing mice.Methods: CD138– CD34– cells were isolated from a human U266 multiple myeloma cell line using an immune magnetic bead sorting method and then subcutaneously injected into mice with nonobese diabetic/severe combined immunodeficiency to develop a multiple myeloma-bearing mouse model. The mice were treated with Fe3O4 nanoparticles 2 mg/kg, paclitaxel 4.8 mg/kg, and PTX-NPs 0.64 mg/kg for 2 weeks. Tumor growth, pathological changes, serum and urinary interleukin-6 levels, and molecular expression of caspase-3, caspase-8, and caspase-9 were evaluated.Results: CD138– CD34– cells were found to have tumor stem cell characteristics. All the mice developed tumors in 40 days after injection of 1 × 106 CD138– CD34– tumor stem cells. Tumor growth in mice treated with PTX-NPs was significantly inhibited compared with the controls (P <  0.005, and the groups that received nanoparticles alone (P < 0.005 or paclitaxel alone (P < 0.05. In addition

  20. Corrosion fatigue investigation of a high nitrogen 12% Cr-steel and of a high strength martensitic PH 13-8 Mo steel under simulated steam turbine conditions. Final report

    International Nuclear Information System (INIS)

    Schmitt-Thomas, K.G.; Schweigart, H.

    1992-01-01

    This report summarizes the results of the corrosion fatigue investigations of two martensitic stainless steels (PH 13-8 Mo, X20 CrMoV 12 1; corrosion medium: 0,01 m NaCl or 22 wt% NaCl; pH value 3 or 7). The working programm includes electrochemical and corrosion fatigue tests. Also chemical analysis, mechanical-technological and metallographical as SEM investigations were performed. (orig.)

  1. An UHPLC-MS/MS method for simultaneous quantification of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid using micro-elution solid phase extraction.

    Science.gov (United States)

    Lin, Ping-Ping; Chen, Wei-Li; Yuan, Fei; Sheng, Lei; Wu, Yu-Jia; Zhang, Wei-Wei; Li, Guo-Qing; Xu, Hong-Rong; Li, Xue-Ning

    2017-12-01

    Amyloid beta (Aβ) peptides in cerebrospinal fluid are extensively estimated for identification of Alzheimer's disease (AD) as diagnostic biomarkers. Unfortunately, their pervasive application is hampered by interference from Aβ propensity of self-aggregation, nonspecifically bind to surfaces and matrix proteins, and by lack of quantitive standardization. Here we report on an alternative Ultra-high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) method for simultaneous measurement of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid (CSF) using micro-elution solid phase extraction (SPE). Samples were pre-processing by the mixed-mode micro-elution solid phase extraction and quantification was performed in the positive ion multiple reaction monitoring (MRM) mode using electrospray ionization. The stable-isotope labeled Aβ peptides 15 N 51 - Aβ1-38, 15 N 53 - Aβ1-40 and 15 N 55 - Aβ1-42 peptides were used as internal standards. And the artificial cerebrospinal fluid (ACSF) containing 5% rat plasma was used as a surrogate matrix for calibration curves. The quality control (QC) samples at 0.25, 2 and 15ng/mL were prepared. A "linear" regression (1/x 2 weighting): y=ax+b was used to fit the calibration curves over the concentration range of 0.1-20ng/mL for all three peptides. Coefficient of variation (CV) of intra-batch and inter-batch assays were all less than 6.44% for Aβ1-38, 6.75% for Aβ1-40 and 10.74% for Aβ1-42. The precision values for all QC samples of three analytes met the acceptance criteria. Extract recoveries of Aβ1-38, Aβ1-40 and Aβ1-42 were all greater than 70.78%, both in low and high QC samples. The stability assessments showed that QC samples at both low and high levels could be stable for at least 24h at 4°C, 4h at room temperature and through three freeze-thaw cycles without sacrificing accuracy or precision. And no significant carryover effect was observed. This validated UHPLC

  2. A educação como projeto de melhoramento racial: uma análise do art. 138 da Constituição de 1934 (Education as a racial enhancement project: an analysis of art. 138 of the 1934 Brazilian Constitution

    Directory of Open Access Journals (Sweden)

    Simone Rocha

    2018-01-01

    Full Text Available Historically, laws are created to meet the needs of a particular place and time, taking into account cultural, ideological and political aspects on which they act. In this sense, the Brazilian parliamentarians intended to encourage the promotion of an “eugenic education” by adopting legislative and administrative measures related to social hygiene, seeking racial “improvement” through socio-educational measures. For the eugenics, the “education” factor would only have the purpose of stimulating the good strains of the “well born.” The bill advocated in Art. 138 of the 1934 Constitution would pretend to act before a population constituted mostly of blacks and mulattos, making it diffcult for them to contract marriage with white people of high social status. The present article sought to analyze the discourse of parliamentarians and eugenics that defended and articulated the preliminary project that advocated the encouragement of eugenic education in a moment of signifcant historical and educational importance. Approaching this theme leads us to think how political actions, articulated aiming at racial improvement, influenced the decisions in the educational policy of the country, and for which social segments did they effectively act as a propellant of social and human development though education. Historicamente as leis são criadas visando atender às necessidades de um determinado local e tempo, levando em consideração aspectos culturais, ideológicos e políticos sobre os quais atuam. Nesse sentido, os parlamentares brasileiros pretendiam fomentar o estímulo a uma “educação eugênica” pela adoção de medidas legislativas e administrativas relacionadas à higiene social buscando o “melhoramento” racial através de medidas sócio/educativas. Logo, para os eugenistas, o fator “educação” teria apenas o objetivo de estimular as boas estirpes dos “bem nascidos”. O projeto de lei defendido no Art. 138, da

  3. Tellurium purification: various techniques and limitations

    Indian Academy of Sciences (India)

    Unknown

    -chemical techniques such as vacuum distillation and zone refining are discussed. It was found that the clean environments, design, handling and cleaning of quartz ware are equally important in achieving the desired purity levels. Keywords.

  4. Tetrabromido[4-(triphenylphosphanyloxybutyl]tellurium acetonitrile monosolvate

    Directory of Open Access Journals (Sweden)

    Sari M. Närhi

    2013-02-01

    Full Text Available In the title compound, [TeBr4(C22H23OP]·CH3CN, the Te atom exhibits a square-pyramidal coordination with an apical Te—C bond and four basal Te—Br bonds. The conformation of the aliphatic C—C—C—C chain is gauche [torsion angle = −67.7 (8°]. A weak C—H...Br interaction helps to establish the conformation. In the crystal, there is a weak secondary bonding interaction [Te...N = 3.456 (11 Å] between the Te atom and the N atom of the solvent molecule, which completes a distorted TeNCBr4 octahedron. Inversion dimers linked by pairs of C—H...Br interactions are also observed.

  5. Avaliação de compostos fenólicos em geléia de uva produzida com a variedade IAC-138-22 (máximo)

    OpenAIRE

    Luciula Lemos Lima Morelli

    2011-01-01

    Resumo: O presente trabalho buscou avaliar a presença de compostos fenólicos antioxidantes em geleia de uva produzida com a variedade Máximo (IAC-138-22), por meio de (1) métodos colorimétricos e (2) cromatografia liquida de alta eficiência. Foram produzidas 3 formulações de geleia com a nova variedade e 3 outras com a mistura entre as variedades Niágara Rosada e Isabel, para efeito comparativo. As formulações diferiam em relação à quantidade de casca de uva incorporada à formulação, sendo a ...

  6. Effect of heat treatment on the electrochemical behaviour and catalytic activity of metal-glass of an Fe76.1Cu1.0Nb3.0Si13.8B6.1

    International Nuclear Information System (INIS)

    Zhdanova, L.I.; Sharipova, E.Kh.; Lad'yanov, V.I.; Volkov, V.A.

    1999-01-01

    Effect of the different degree of the initial surface crystallization of Fe 76.1 Cu 1.0 Nb 3.0 Si 13.8 B 6.1 metal glasses on the electrochemical behaviour and catalytic activity of the alloy during thermal treatment of tapes was studied. Growth of amorphous-nanocrystalline structure during annealing is shown to improve protective properties of fast-hardened tapes. The highest corrosion resistance of the material is manifested when in nanocrystalline state subsequent to annealing under 550 deg C [ru

  7. Establishment and antitumor effects of dasatinib and PKI-587 in BD-138T, a patient-derived muscle invasive bladder cancer preclinical platform with concomitant EGFR amplification and PTEN deletion.

    Science.gov (United States)

    Chang, Nakho; Lee, Hye Won; Lim, Joung Eun; Jeong, Da Eun; Song, Hye Jin; Kim, Sudong; Nam, Do-Hyun; Sung, Hyun Hwan; Jeong, Byong Chang; Seo, Seong Il; Jeon, Seong Soo; Lee, Hyun Moo; Choi, Han-Yong; Jeon, Hwang Gyun

    2016-08-09

    Muscle-invasive bladder cancer (MIBC) consists of a heterogeneous group of tumors with a high rate of metastasis and mortality. To facilitate the in-depth investigation and validation of tailored strategies for MIBC treatment, we have developed an integrated approach using advanced high-throughput drug screening and a clinically relevant patient-derived preclinical platform. We isolated patient-derived tumor cells (PDCs) from a rare MIBC case (BD-138T) that harbors concomitant epidermal growth factor receptor (EGFR) amplification and phosphatase and tensin homolog (PTEN) deletion. High-throughput in vitro drug screening demonstrated that dasatinib, a SRC inhibitor, and PKI-587, a dual PI3K/mTOR inhibitor, exhibited targeted anti-proliferative and pro-apoptotic effects against BD-138T PDCs. Using established patient-derived xenograft models that successfully retain the genomic and molecular characteristics of the parental tumor, we confirmed that these anti-tumor responses occurred through the inhibition of SRC and PI3K/AKT/mTOR signaling pathways. Taken together, these experimental results demonstrate that dasatinib and PKI-587 might serve as promising anticancer drug candidates for treating MIBC with combined EGFR gene amplification and PTEN deletion.

  8. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  9. Tellurium sulfates from reactions in oleum and sulfur trioxide: syntheses and crystal structures of TeO(SO{sub 4}), Te{sub 4}O{sub 3}(SO{sub 4}){sub 5}, and Te(S{sub 2}O{sub 7}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Logemann, Christian; Bruns, Joern; Schindler, Lisa Verena; Zimmermann, Vanessa; Wickleder, Mathias S. [Carl von Ossietzky University of Oldenburg, Institute of Chemistry (Germany)

    2015-04-15

    The reaction of K{sub 2}TeO{sub 4} with fuming sulfuric acid (65 % SO{sub 3}) in sealed glass ampoules at 250 C led to colorless single crystals of TeO(SO{sub 4}) [triclinic, P anti 1, Z = 8, a = 819.89(3) pm, b = 836.95(4) pm, c = 1179.12(5) pm, α = 82.820(2) , β = 70.645(2) , γ = 81.897(2) , V = 753.11(6) x 10{sup 6} pm{sup 3}]. A horseshoe type [Te{sub 4}O{sub 3}] fragment is the basic motif in the layer structure of the compound. The [Te{sub 4}O{sub 3}] moieties are linked to infinite chains by further oxide ions. Monomeric [Te{sub 4}O{sub 3}] horseshoes are found in the crystal structure of Te{sub 4}O{sub 3}(SO{sub 4}){sub 5} [trigonal, P3{sub 2}21, Z = 3, a = 859.05(2) pm, c = 2230.66(7) pm, V = 1425.61(6) x 10{sup 6} pm{sup 3}], which was obtained from TeO{sub 2} and fuming sulfuric acid (65 % SO{sub 3}) at 200 C as colorless single crystals. By switching to neat SO{sub 3} as reaction medium colorless crystals of Te(S{sub 2}O{sub 7}){sub 2} [P2{sub 1}/n, Z = 4, a = 1065.25(3) pm, b = 818.50(2) pm, c = 1206.27(3) pm, β = 102.097(1) , V = 1028.40(5) x 10{sup 6} pm{sup 3}] form when ortho-telluric acid, H{sub 6}TeO{sub 6}, is used as the tellurium source. The compound was reported previously, however, obviously with a wrong crystallographic description. In the crystal structure the tellurium atoms are coordinated by two chelating disulfate ions. Further Te-O contacts link the [Te(S{sub 2}O{sub 7}){sub 2}] units to an extended network. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  10. miR-371, miR-138, miR-544, miR-145, and miR-214 could modulate Th1/Th2 balance in asthma through the combinatorial regulation of Runx3.

    Science.gov (United States)

    Qiu, Yu-Ying; Zhang, Ying-Wei; Qian, Xiu-Fen; Bian, Tao

    2017-01-01

    Asthma is tightly related to the imbalance of Th1/Th2 cells, and Runx3 plays a pivotal role in the differentiation of T helper cells. The present study aimed to investigate dysregulated microRNAs that may target Runx3 in CD4 + T cells from asthmatic patients and reveal Runx3 function in Th1/Th2 balance regulation. We detected the levels of Th1- and Th2-related cytokines by ELISA and analyzed the differentiation marker gene of T helper cells by qRT-PCR. Results indicated that an imbalance of Th1/Th2 cells was present in our asthmatic subject. Runx3 expression was reduced in the CD4 + T cells from asthmatic patients. Overexpression of Runx3 could restore the Th1/Th2 balance. After performing microRNA microarray assay, we found a series of microRNAs that were considerably altered in the CD4 + T cells from asthmatic patients. Among these upregulated microRNAs, eight microRNAs that may target Runx3 were selected by bioinformatics prediction. Five microRNAs, namely miR-371, miR-138, miR-544, miR-145, and miR-214, were confirmed by qRT-PCR and selected as candidate microRNAs. Luciferase reporter assay showed that these five microRNAs could directly target the 3'-UTR of Runx3. However, only simultaneous inhibition of these five microRNAs could alter the expression of Runx3. Most importantly, only simultaneous inhibition could improve the Th1/Th2 balance. Thus, we suggest that miR-371, miR-138, miR-544, miR-145, and miR-214 can modulate the Th1/Th2 balance in asthma by regulating Runx3 in a combinatorial manner.

  11. Quantitation of amyloid beta peptides Aβ(1-38), Aβ(1-40), and Aβ(1-42) in human cerebrospinal fluid by ultra-performance liquid chromatography-tandem mass spectrometry.

    Science.gov (United States)

    Lame, Mary E; Chambers, Erin E; Blatnik, Matthew

    2011-12-15

    Critical events in Alzheimer's disease (AD) involve an imbalance between the production and clearance of amyloid beta (Aβ) peptides from the brain. Current methods for Aβ quantitation rely heavily on immuno-based techniques. However, these assays require highly specific antibodies and reagents that are time-consuming and expensive to develop. Immuno-based assays are also characterized by poor dynamic ranges, cross-reactivity, matrix interferences, and dilution linearity problems. In particular, noncommercial immunoassays are especially subject to high intra- and interassay variability because they are not subject to more stringent manufacturing controls. Combinations of these factors make immunoassays more labor-intensive and often challenging to validate in support of clinical studies. Here we describe a mixed-mode solid-phase extraction method and an ultra-performance liquid chromatography tandem mass spectrometry (SPE UPLC-MS/MS) assay for the simultaneous quantitation of Aβ(1-38), Aβ(1-40), and Aβ(1-42) from human cerebrospinal fluid (CSF). Negative ion versus positive ion species were compared using their corresponding multiple reaction monitoring (MRM) transitions, and negative ions were approximately 1.6-fold greater in intensity but lacked selectivity in matrix. The positive ion MRM assay was more than sufficient to quantify endogenous Aβ peptides. Aβ standards were prepared in artificial CSF containing 5% rat plasma, and quality control samples were prepared in three pooled CSF sources. Extraction efficiency was greater than 80% for all three peptides, and the coefficient of variation during analysis was less than 15% for all species. Mean basal levels of Aβ species from three CSF pools were 1.64, 2.17, and 1.26 ng/ml for Aβ(1-38); 3.24, 3.63, and 2.55 ng/ml for Aβ(1-40); and 0.50, 0.63, and 0.46 ng/ml for Aβ(1-42). Copyright © 2011 Elsevier Inc. All rights reserved.

  12. Avaliação da apoptose de leucócitos polimorfonucleares CH138+ em leite bovino de alta e baixa contagem de células somáticas : dados preliminares

    Directory of Open Access Journals (Sweden)

    R.B Pessoa

    2012-06-01

    Full Text Available A apoptose de leucócitos polimorfonucleares (PMN é um evento central no processo de resolução da inflamação. Sendo a contagem de células somáticas (CCS um indicador da situação imunológica da glândula mamária, o presente estudo buscou esclarecer a influência que esses fatores têm um sobre o outro e sobre a evolução do processo inflamatório. Marcaram-se as amostras de leite com anexina-V, iodeto de propídeo (PI, anticorpo anti-CH138A. Encontrou-se correlação negativa entre apoptose de PMN e CCS, além de diferença estatística entre um grupo de alta CCS e um grupo de baixa CCS quanto à taxa de PMN viáveis, em apoptose, em necrose e em necrose e/ou apoptose. De modo geral, o grupo de alta celularidade apresentou menos CH138+ em apoptose e mais células em necrose ou viáveis do que o grupo de baixa celularidade. Conclui-se que apoptose de PMN e CCS estão relacionados, e que em mamas com CCS elevada este evento está diminuído. Apesar de haver maior disponibilidade de fagócitos para a defesa nessa situação, os efeitos anti-inflamatórios da apoptose também estão diminuídos, enquanto os efeitos pró-inflamatórios da necrose estão aumentados, o que pode colaborar com a cronificação da inflamação.

  13. Resonant ionization by laser beams: application to ions sources and to study the nuclear structure of radioactive tellurium isotopes; Ionisation resonante par faisceaux laser: application aux sources d'ions et a l'etude de la structure des noyaux radioactifs de tellure

    Energy Technology Data Exchange (ETDEWEB)

    Sifi, R

    2007-07-15

    The radioactive ion beams that are produced through current isotope separators are well separated according to the A mass but not according to the Z parameter. The resonant ionization through laser beams applied to ion sources allows the production of radioactive ion beam in a very selective and efficient way by eliminating the isobaric contamination. The first chapter is dedicated to the resonant ionization by laser beams, we describe the principle, the experimental setting, the lasers used, the ionization schemes and the domain of application. The second chapter deals with the application of resonant ionization to laser ion sources for the production of radioactive ion beams. We present experimental tests performed for getting copper ion beams. Resonant ionization through laser is also used in the spectroscopy experiments performed at the Isolde (isotope separation on-line device) installation in CERN where more than 20 elements are ionized very efficiently. The technique is based on a frequency scanning around the excitation transition of the atoms in order to probe the hyperfine structure. Laser spectroscopy allows the determination of the hyperfine structure as well as the isotopic shift of atoms. In the third chapter the method is applied to the spectroscopy of tellurium atoms. First, we define the 2 parameters on which the extraction is based: charge radius and nuclear moments, then we present several theoretical models that we have used to assess our experimental results. (A.C.)

  14. 33 CFR 138.15 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION FINANCIAL RESPONSIBILITY FOR WATER POLLUTION (VESSELS) AND OPA 90 LIMITS OF LIABILITY (VESSELS AND DEEPWATER PORTS) Financial Responsibility for Water... exclusive economic zone to transship or lighter oil (whether delivering or receiving) destined for a place...

  15. Search Results | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... of the Social Sciences and Humanities Research Council (SSHRC) and IDRC. ... SAIC experts explored poverty, violence, and inequality in 40 cities across ... IDRC and Fundación Capital launch digital tool to empower Colombian youth.

  16. 40 CFR 52.138 - Conformity procedures.

    Science.gov (United States)

    2010-07-01

    ... considering any growth likely to result from the project; (3) for each transportation control measure in the... described in 40 CFR 81.303 (i.e., the MAG urban planning area). (7) Transportation control measure (TCM...) the disaggregated population projections and employment which were assumed in: (1) the applicable plan...

  17. 21 CFR 133.138 - Edam cheese.

    Science.gov (United States)

    2010-04-01

    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN... having the same physical and chemical properties. The minimum milkfat content is 40 percent by weight of... this section may be warmed and is subjected to the action of a lactic acid-producing bacterial culture...

  18. Publications | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Infectious disease has a great impact on livestock production and livelihoods in Africa. ... Small and medium enterprises under the global economic crisis : evidence ... Social networks, research evidence, and innovation in health policymaking ...

  19. Search Results | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    ... Argentina 78 Apply Argentina filter · Colombia 74 Apply Colombia filter .... an opportunity to inform new or strengthen existing legislation arises requiring a ... Addressing inequality and environmental insecurity in the Middle East and ... gender analysis in environment and natural resource management (ENRM) research.

  20. Search Results | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    South of Sahara 357 Apply South of Sahara filter · North of Sahara 313 Apply .... Journal articles ... A systemic lack of access to finance, markets, and knowledge networks is ... The Coastal Cities at Risk project takes an interdisciplinary approach involving natural, social, and health scientists, engineers, and economists.

  1. 33 CFR 138.130 - Fees.

    Science.gov (United States)

    2010-07-01

    ... in paragraphs (c) and (d) of this section have been paid. (b) For those using E-COFR, credit card... Certificate, Fleet Certificate, or Master Certificate), except as follows: (1) An Application for an...

  2. 45 CFR 147.138 - Patient protections.

    Science.gov (United States)

    2010-10-01

    ..., issuer, or any person (including a primary care provider) in the case of a female participant... the participant and the participant's family. Participant A, a female, requests a gynecological exam.... If a covered individual notifies the plan within two business days after the day an individual...

  3. 37 CFR 1.138 - Express abandonment.

    Science.gov (United States)

    2010-07-01

    ... before the date of issue or publication unless it is actually received by appropriate officials in time... application to avoid publication of the application (see § 1.211(a)(1)) must submit a declaration of express abandonment by way of a petition under this paragraph including the fee set forth in § 1.17(h) in sufficient...

  4. Publications | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Knowledge management is about identifying critical knowledge areas that makes a ''big difference or big change in target groups/trainees through ... demand for healthcare, and carries out an analysis as detailed as the input data allows for.

  5. Ground-state and isomeric-state cross sections for the {sup 138}Ce(n,2n){sup 137}Ce reaction from its threshold to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Junhua [Hexi Univ., Zhangye (China). Inst. of Theoretical Physics; Hexi Univ., Zhangye (China). School of Physics and Electromechanical Engineering; An, Li; Jiang, Li [Chinese Academy of Engineering Physics, Mianyang (China). Inst. of Nuclear Physics and Chemistry

    2015-07-01

    The cross sections of the {sup 138}Ce(n,2n){sup 137}Ce reactions and their isomeric cross section ratios σ{sub m}/σ{sub g} were measured at three neutron energies between 13.5 and 14.8 MeV using the activation technique. CeO{sub 2} samples and Nb monitor foils were activated together to determine the reaction cross section and the incident neutron flux. The monoenergetic neutron beams were formed via the {sup 3}H(d,n){sup 4}He reaction. The activities induced in the reaction products were measured using high-resolution γ-ray spectroscopy. The pure cross section of the ground-state was derived from the absolute cross section of the metastable state and the residual nuclear decay analysis. The cross sections were also estimated using the nuclear model code, TALYS-1.6 with different level density options at neutron energies varying from the reaction threshold to 20 MeV. Results are discussed and compared with the corresponding literature data.

  6. Atomic structure of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass alloy

    Energy Technology Data Exchange (ETDEWEB)

    Hui, X. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China)], E-mail: huixd01@hotmail.com; Fang, H.Z.; Chen, G.L. [State Key Laboratory for Advanced Metals and Materials, University of Science and Technology Beijing, Beijing 100083 (China); Shang, S.L.; Wang, Y. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States); Qin, J.Y. [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University - Southern Campus, Jinan 250061 (China); Liu, Z.K. [Department of Materials Science and Engineering, Pennsylvania State University, University Park, PA 16802 (United States)

    2009-01-15

    Ab initio molecular dynamics (AIMD) calculations were performed on the atomic configuration of Zr{sub 41.2}Ti{sub 13.8}Cu{sub 12.5}Ni{sub 10}Be{sub 22.5} bulk metallic glass. The local structures were characterized in terms of structure factors (SF), pair correlation functions (PCF), coordinate numbers, bond pairs and Voronoi polyhedra. The glass transition temperature, generalized PCF and SF predicated by AIMD are in good agreement with the experimental data. Icosahedral short-range orders (ISRO) are found to be the most dominant, in view of the presence of the majority of bond pairs with 1551, 1541 and 1431, and Voronoi polyhedra with <0,3,6,1>, <0,2,8,1>, <0,0,12,0> and <0,2,8,4>. Icosahedral medium range orders (IMROs) are formed from icosahedra via the linkage of vertex-, edge-, face- and intercross-shared atoms. The glass structure on the nanometer scale is accumulated by polyhedra through an efficient packing mode. It is suggested that the extraordinary glass-forming ability of this alloy is essentially attributable to the formation of ISRO and IMRO, and the dense packing of atoms.

  7. Comparison of the corrosion resistance of DIN W. Nr. 1.4970 (15%Cr-15%Ni-1.2%Mo-Ti and ASTM F-138 (17%Cr-13%Ni-2.5%Mo austenitic stainless steels for biomedical applications

    Directory of Open Access Journals (Sweden)

    Maysa Terada

    2006-09-01

    Full Text Available The resistance to localised corrosion of the full austenitic 15%Cr-15%Ni-1.2%Mo titanium stabilized stainless steel (DIN W. Nr. 1.4970 was investigated by electrochemical methods including electrochemical impedance spectroscopy (EIS, potentiodynamic polarization and potentiostatic polarization measurements in a phosphate-buffered solution (PBS. The low carbon and non-stabilized austenitic stainless steel, AISI 316L (ASTM F-138, widely used for surgical implants, was also tested for comparison. The tests were conducted at room temperature after a stable potential had been reached. After the electrochemical measurements, the surfaces of the specimens were observed using SEM to evaluate the presence of pits. Potentiodynamic polarization results showed that both steels are prone to localized corrosion. Larger pits were found on the surface of AISI 316L specimens after the electrochemical tests. EIS response has indicated the duplex structure of the passive oxides. The results showed that the electrochemical behaviour of the DIN W. Nr. 1.4970 is better than of AISI 316L steel. Therefore, their application as an implant material may be considered.

  8. Surgical, pathological and clinical correlation of Tc-99m DISIDA hepatobiliary imaging in 138 adult males, in the diagnosis of functional cystic duct obstruction VS acute or chronic cholecystitis

    International Nuclear Information System (INIS)

    Yoo, J.H.K.; Beal, W.H.; Ware, R.W.; Straw, J.D.; Chaudhuri, T.K.

    1985-01-01

    Despite the wide acceptance of the hepatobiliary scintigraphy as a popular diagnostic imaging modality for gallbladder and hepatobiliary disease, correlation between radionuclide diagnoses and the final clinical and/or pathologic findings have not been thoroughly evaluated. The lack of correlative studies frequently generates difficulties in making appropriate diagnostic interpretation of the objective findings. A retrospective clinical pathological and surgical correlative study was undertaken by the authors in 138 male veteran patients, who underwent computer assisted minute by minute Tc-99m DISIDA cholescintigraphy. A very high percentage (75%) revealed abnormalities; non-visualization of gallbladder (GB) with normal choledochus system (46%), choledochal obstruction with no GB visualization (13%), choledochal obstruction with normal GB visualization (6%), severe hepatocellular disease with non-diagnostic GB (4%), and delayed GB visualization (longer than 60 minutes) (3%). Non-visualization of GB but normal choledochus demonstrated diverse pathologic etiologies, acute and chronic cholecystitis (64%), S/P cholecystectomy (8%), functional obstruction secondary to sepsis or pancreatitis (6%), and various other pathologies including porcelain GB and cholangitis (22%). The most important cause of choledochal obstruction was mass lesions or local infiltration with metastases (33%) rather than acute cholecystitis (27%). Although the sensitivity (98%) and specificity (92%) for cystic duct obstruction were very high, the specificity decreases significantly for cholecystitis

  9. Current data on the background burden to the persistent organochlorine pollutants HCB, p,p'-DDE as well as PCB 138, PCB 153 and PCB 180 in plasma of the general population in Germany.

    Science.gov (United States)

    Schettgen, Thomas; Alt, Anne; Esser, Andre; Kraus, Thomas

    2015-06-01

    Despite their long-term ban, persistent organochlorine compounds like hexachlorobenzene (HCB), p,p'-dichlorodiphenylethylene (DDE) as well as polychlorinated biphenyls (PCBs) are still of environmental concern. For the evaluation of potential occupational or environmental exposures to these substances, it is essential to know the current background burden of the general population. As representative and up-to-date information is missing for Germany, we have analysed a large dataset generated in studies on potential exposure to lower chlorinated PCBs to fill this gap for the levels of HCB, DDE as well as PCB 138, PCB 153 and PCB 180. We have investigated n=2750 plasma samples of persons of the general population living in North Rhine-Westfalia and Hesse aged 6-65 years and sampled between September 2010 and March 2014. For evaluation of the age-dependent accumulation in the general population we have generated seven age groups in the collective. Our laboratory used a validated and quality controlled procedure using GC/MS for quantification of the organochlorine compounds in plasma (LOQ: 0.01μg/L). The median (95th percentile) levels for ∑ PCB 138+PCB 153+PCB 180 were 0.14 (0.73); 0.30 (0.82); 0.38 (0.88); 0.50 (1.14); 0.92; 1.58 (3.54) and 2.41 (4.82)μg/L plasma in the age groups 6-10 years (n=102), 11-17 years (n=499), 18-25 years (n=157), 26-35 years (n=710), 36-45 years (n=400), 46-55 years (n=525) and 56-65 years (n=357), respectively. Similarly, the median (95th percentile) levels of p,p'-DDE were 0.18 (1.24); 0.18 (0.74); 0.24 (0.85); 0.30 (1.20); 0.45 (1.74); 0.64 (3.25) and 0.94 (4.7)μg/L plasma. Finally, the median (95th percentile) of HCB in plasma in these age groups was 0.05 (0.10); 0.06 (0.11); 0.08 (0.15); 0.08 (0.15); 0.11 (0.22); 0.14 (0.42) and 0.20 (0.68)μg/L plasma. Our results prove an overall substantial reduction in the body burden to organochlorine compounds in Germany compared to earlier studies. However, 15% and 3.6% of the examined

  10. CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

    Energy Technology Data Exchange (ETDEWEB)

    Hill, K.D.; Steele, A.G. [National Research Council of Canada, Institute for National Measurement Standards, Ottawa, ON (Canada); Dedikov, Y.A.; Shkraba, V.T. [Institute for Physical-Technical and Radiotechnical Measurements (VNIIFTRI), Moscow (Russian Federation)

    2005-04-01

    The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 {omega} capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L and N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. (authors)

  11. KEY COMPARISON: CCT-K2.1: NRC/VNIIFTRI bilateral comparison of capsule-type standard platinum resistance thermometers from 13.8 K to 273.16 K

    Science.gov (United States)

    Hill, K. D.; Steele, A. G.; Dedikov, Y. A.; Shkraba, V. T.

    2005-01-01

    The Consultative Committee for Thermometry Key Comparison 2 (CCT-K2) results were published two years ago (2002 Metrologia 39 551-71). NRC served as the pilot laboratory for CCT-K2 and remains able to provide a scale and measurement system suitable for performing bilateral comparisons linked to the original key comparison results. In March 2003, measurements of two VNIIFTRI 100 Ω capsule-style platinum resistance thermometers (CSPRTs), S/N 356 and 476, were undertaken to relate their local calibration to the results from the CCT-K2 exercise. The NRC Leeds and Northrup (L&N) CSPRT S/N 1872174 provides the link to the CCT-K2 results. The three CSPRTs were compared at the eight defining cryogenic temperatures of the International Temperature Scale of 1990 (ITS-90) in the range from 13.8033 K to 273.16 K. The reader is referred to the full text of the CCT-K2 report for a detailed explanation of the methodology employed for the comparison. Only the details unique to the measurements reported here will be addressed in this article. The NRC/VNIIFTRI bilateral comparison of capsule-style platinum resistance thermometers over the range 13.8 K to 273.16 K has revealed calibrations at VNIIFTRI to be in agreement with the KCRV of CCT-K2 within the expanded uncertainty for all temperatures of the comparison with the exception of the triple point of hydrogen at 13.8033 K. One of the two CSPRTs supplied by VNIIFTRI was found to be discrepant as revealed by differences at the triple point of water and at the lowest temperatures of the comparison, and was therefore excluded from further analysis. The linkage to the CCT-K2 data supports the evaluation of the VNIIFTRI CMCs in Appendix C of the KCDB. Main text. To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCT, according to the provisions

  12. 49 CFR 571.138 - Standard No. 138; Tire pressure monitoring systems.

    Science.gov (United States)

    2010-10-01

    ... following statement in English: Each tire, including the spare (if provided), should be checked monthly when... level to trigger illumination of the TPMS low tire pressure telltale. [The following paragraph is.... If necessary, drive the vehicle until the telltale has extinguished. (o) The test may be repeated...

  13. Iodine-131 production by a dry method using reactor-irradiated elementary tellurium. Part 1 - Conditions for obtaining iodine emanation and its capture. Part 2 - comparative study of preparation conditions using Pyrex, stainless steel and alumina equipment. Part 3 - production on a semi-industrial scale; Production de l'iode 131 par voie seche a partir de tellure elementaire irradie a la pile. 1ere partie - Etudes des conditions pour obtenir l'emanation de l'iode et le capter. 2eme partie - Etude comparee des conditions pour effectuer cette preparation avec des appareils en Pyrex, en acier inoxydable et en alumine. 3eme partie - production a l'echelle semi-industrielle

    Energy Technology Data Exchange (ETDEWEB)

    Bardy, A; Beydon, J; Murthy, T S; Doyen, J B; Lefrancois, J [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1967-04-15

    A previous report has described how iodine 131 can be prepared from elementary tellurium by a dry method which consists in treating irradiated tellurium at 400 degrees in argon. The possibility of carrying out this treatment in a stainless steel or alumina apparatus has been considered. The behavior of gaseous iodine 131 towards these materials has thus been studied. If the adsorption of iodine on stainless steel is superficial desorption is rapid at 250 degrees in oxygen or 400 degrees in argon. If the adsorption is chemical in nature it becomes necessary to heat to higher temperatures. Adsorption of iodine on alumina is very weak and the iodine can be desorbed rapidly. With these materials tests have been carried out on 300 gms of tellurium containing 41 curies of iodine 131; the yields were very satisfactory ( 98 per cent). (author) [French] La methode de preparation de l iode 131 par voie seche a partir de tellure elementaire decrite dans un precedent rapport consiste a traiter le tellure irradie a 400 degres sous argon. Nous avons examine la possibilite d effectuer ce traitement dans un appareil en acier inoxidable ou en alumine. Le comportement de l iode 131 gazeux vis a vis de ces materiaux a donc ete etudie. Si l adsorption de l iode sur l acier inoxidable est superficielle la desorption est rapide a 250 degres sous oxygene ou 400 degres sous argon. Si la fixation est de nature chimique il est necessaire de chauffer a des temperatures plus elevees. L adsorption de l iode sur l alumine est res faible et l iode peut etre desorbe rapideemnt. En employant ces materiaux des essais ont ete obtenus sur 300 g de tellure contenant 41 curies d iode 131 avec un bon rendement (98 pour cent). (auteur00.

  14. Dielectric relaxation of selenium-tellurium mixed former glasses

    Science.gov (United States)

    Palui, A.; Ghosh, A.

    2017-05-01

    We report the study of dielectric properties of mixed network former glasses of composition 0.3Ag2O-0.7(xSeO2-(1-x)TeO2); x=0, 0.1, 0.3, 0.4, 0.5 and 0.6 in a wide frequency 10 Hz - 2 MHz and temperature range 223 K - 403 K. The experimental data have been analyzed in the framework of complex dielectric permittivity. The dielectric permittivity data have been analyzed using the Cole-Cole function. The inverse temperature dependence of relaxation time obtained from real part of dielectric permittivity data follows the Arrhenius relation. The activation energy shows mixed glass former effect with variation of mixed former ratio. A non-zero value of shape parameters is observed and it is almost independent of temperature and composition.

  15. Bis(ethyleneglycolato-κ2O,O′tellurium(IV

    Directory of Open Access Journals (Sweden)

    Neil R. Brooks

    2013-07-01

    Full Text Available The title compound, C4H8O4Te, crystallized from a solution of Te4+ in ethylene glycol. The TeIV atom is in a distorted seesaw coordination defined by four O atoms from two different ethyleneglycate ligands. The C atoms of the ethyleneglycate ligands are disorderd over two positions, with population parameters of 50.3 (6 and 49.7 (6% indicating a statistical distribution. Due to the possibility to transform the primitive monoclinic unit cell into a metrically orthorhombic C unit cell, the data are twinned and were refined with the twin law -100/0-10/101 with the relative scale factor refining to 1.82 (4% for the minor component.

  16. Nanoscale Device Properties of Tellurium-based Chalcogenide Compounds

    Science.gov (United States)

    Dahal, Bishnu R.

    The great progress achieved in miniaturization of microelectronic devices has now reached a distinct bottleneck, as devices are starting to approach the fundamental fabrication and performance limit. Even if a major breakthrough is made in the fabrication process, these scaled down electronic devices will not function properly since the quantum effects can no longer be neglected in the nanoscale regime. Advances in nanotechnology and new materials are driving novel technologies for future device applications. Current microelectronic devices have the smallest feature size, around 10 nm, and the industry is planning to switch away from silicon technology in the near future. The new technology will be fundamentally different. There are several leading technologies based on spintronics, tunneling transistors, and the newly discovered 2-dimensional material systems. All of these technologies are at the research level, and are far from ready for use in making devices in large volumes. This dissertation will focus on a very promising material system, Te-based chalcogenides, which have potential applications in spintronics, thermoelectricity and topological insulators that can lead to low-power-consumption electronics. Very recently it was predicted and experimentally observed that the spin-orbit interaction in certain materials can lead to a new electronic state called topological insulating phase. The topological insulator, like an ordinary insulator, has a bulk energy gap separating the highest occupied electronic band from the lowest empty band. However, the surface states in the case of a three-dimensional or edge states in a two-dimensional topological insulator allow electrons to conduct at the surface, due to the topological character of the bulk wavefunctions. These conducting states are protected by time-reversal symmetry, and cannot be eliminated by defects or chemical passivation. The edge/surface states satisfy Dirac dispersion relations, and hence the physics of relativistic Dirac fermions becomes relevant. This results in peculiar quantum oscillations in transport measurements which make it possible to unambiguously identify surface Dirac fermions. In order to lead us towards a better understanding of topological insulators and their applications, it is, however, necessary to develop techniques that will enable high quality materials to be obtained in a routine and reliable way. However, this has been an enormous challenge so far. Since highly volatile components are involved in most topological insulators, whether in bulk single crystal or epitaxial thin films or chemical vapor deposition grown nanoribbons, maintaining near stoichiometry has proven to be very difficult. Observing the predicted transport properties of these systems, particularly surface carriers of high mobility whilst maintaining bulk insulating states, is seriously impeded by the unintentional doping of bulk carriers. Moreover, in thin films and hetrostructures, at the all-important thickness range of a few nanometers, the additional limitation of the film-substrate lattice mismatch and the resulting strain in films is a major concern. In this thesis, we have developed a synthesis technique to obtain high quality SnTe nanoribbons, which is a topological crystalline insulator and its surface states are topologically protected by mirror symmetry of the lattice. The obtained ribbons are nearly stoichiometric and show strong semiconducting behavior with a bandgap of 240 meV. This is the first time high quality SnTe nanoribbons have been synthesized. High quality SnTe nanoribbons form a potential platform to understand the magnetic topological insulating behavior. In this thesis, it is also shown that magnetic behavior can be introduced in SnTe nanoribbons by means of chromium doping. Magnetically doped topological insulators, possessing an energy gap created at the Dirac point are predicted to exhibit exotic phenomena including the quantized anomalous Hall Effect and a dissipationless transport, which facilitate the development of low-power-consumption devices using electron spins. In addition, this thesis also discusses the growth and transport properties of another Te-based chalcogenide system, CoTe with ferrimagnetic and semiconducting behavior. We have shown that the structural, electrical and magnetic properties can be tuned by controlling the amount of cobalt in the system.

  17. High purity tellurium production using dry refining processes

    Indian Academy of Sciences (India)

    Unknown

    Centre for Materials for Electronics Technology (C-MET), IDA Phase II, Cherlapally, HCL Post, Hyderabad 500 051,. India ... The total content of gas and gas forming impurities like O, N and C are found to be .... (DIT), Government of India.

  18. Production of 131 Iodine in research reactors from elementary tellurium

    International Nuclear Information System (INIS)

    Silva, Constancia Pagano Goncalves da

    1970-01-01

    Presents the history of the production of iodine-131 in the Institute of Atomic Energy (IEA), SP, Brazil), the preliminary works for the development of the method, which were done in small scale and it was not necessary protection for the operators, the evolution of these operations until the final assembling of the equipment in shielded cells, the efficiency of operations and product purity. The problems linked to the presence of iodate in the preparations and the changes made for elimination of that ion, harmful to many types and use of iodine-131 are examined. The quality of the product delivered today, an average of 140 departures per month, and the number of departures, per year since the beginning of iodine-131 production were indicated

  19. Optical waveguiding in amorphous tellurium oxide thin films

    Energy Technology Data Exchange (ETDEWEB)

    Nayak, Ranu; Gupta, Vinay; Dawar, A.L.; Sreenivas, K

    2003-11-24

    Optical waveguiding characteristics of amorphous TeO{sub 2-x} films deposited by reactive sputtering under different O{sub 2}:Ar gas mixtures are investigated on fused quartz and Corning glass substrates. Infra-red absorption band in the range 641-658 cm{sup -1} confirmed the formation of a Te-O bond, and a 20:80 O{sub 2}:Ar gas mixture ratio is found to be optimum for achieving highly uniform and transparent films at a high deposition rate. As grown amorphous films exhibited a large band gap (3.76 eV); a high refractive index value (2.042-2.052) with low dispersion over a wide wavelength range of 500-2000 nm. Optical waveguiding with low propagation loss of 0.26 dB/cm at 633 nm is observed on films subjected to a post-deposition annealing treatment at 200 deg. C. Packing density and etch rates have been determined and correlated with the lowering of optical propagation loss in the annealed films.

  20. NMR spectroscopy of selenium and tellurium organic compounds

    International Nuclear Information System (INIS)

    Kalabin, G.A.; Projdakov, A.G.; Radchenko, S.I.

    1980-01-01

    13 C NMR spectra of the substituted methylthio (seleno, telluro) acetylenes, CH 3 EC 1 identity sign C 2 R, E=S, Se, Te are measured. High sensitivity of the chemical shifts of ternary bond carbons to specific effects of heteroatoms is established. The substituent nature produces considerable effect on the sensitivity of C 1 -carbon atom to these effects. Chemical shifts of the substituent carbons do not depend on heteroatoms nature

  1. Preparation of high-purity tellurium by the combination method

    International Nuclear Information System (INIS)

    Kogtev, P.M.; Khachishvili, V.I.; Mozdokeli, T.G.

    1978-01-01

    Vacuum distillation followed by condensation in hydrogen flow has been studied as a means of T-1 brand Te purification (particularly from Se). The distillation lasted for 4-5 hours at 530-550 deg C under residual pressure of 10 -3 Torr. A schematic of the apparatus for the purification is given. Condensation under hydrogen flow decreases the amount of impurities in Te; double condensation reduces the Se content by 2 orders of magnitude. The product obtained after vacuum distillation and double condensation under pure H sub(2) is 99.999 % Te

  2. Mechanism of tellurium isomers excitation in (γ, n) reactions

    International Nuclear Information System (INIS)

    Mazur, V.M.; Symochko, D.M.; Bigan, Z.M.; Poltorzhytska, T.V.; Derechkey, P.S.

    2012-01-01

    Isomeric yield ratios for the 119 Te, 121 Te, 123 Te, 127 Te, 129 Te nuclei were obtained in (γ, n) reactions with bremsstrahlung end point energies ranging 10 - 22 MeV with δE = 0.5 MeV step. Experimental isomeric ratios were used to calculate the cross-sections of (γ, n) m reactions, that were further compared with TALYS-1.4 calculations

  3. Electronic and atomic structures of liquid tellurium containing alkali elements

    International Nuclear Information System (INIS)

    Kawakita, Yukinobu; Yao, Makoto; Endo, Hirohisa.

    1997-01-01

    The measurements of electrical conductivity σ, density, EXAFS and neutron scattering were carried out for liquid K-Te and Rb-Te mixtures. The conductivity σ decreases rapidly with alkali concentration and a metal-semiconductor transition occurs at about 10 at.% alkali. It is found that the compositional variation of σ is nearly independent of the alkali species. The Te-Te bond length deduced from EXAFS and neutron scattering measurements is 2.8 A and changes little with alkali concentrations. The average distances from K and Rb atom to Te atoms are 3.6 A and 3.8 A, respectively. Two kinds of relaxation processes are observed in quasielastic neutron scattering for K 20 Te 80 . Upon the addition of alkali the interaction between the neighbouring Te chains, which is responsible for the metallic conduction, weaken considerably. (author)

  4. Thermal neutron capture cross sections of tellurium isotopes

    Czech Academy of Sciences Publication Activity Database

    Tomandl, Ivo; Honzátko, Jaroslav; Egidy, T. von; Wirth, HF.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Z.; Molnar, GL.; Firestone, RB.; Bondarenko, V.

    2003-01-01

    Roč. 68, č. 6 (2003), 067602 ISSN 0556-2813 R&D Projects: GA ČR GA202/03/0891; GA ČR GA202/99/D087 Institutional research plan: CEZ:AV0Z1048901 Keywords : nuclear -structure * resonance integrals * gamma Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 2.708, year: 2003

  5. The Fragmentation of Heavy Nuclei by 13.8 GeV/c Protons as a Contribution to the Study of the Interaction Mechanism and Nuclear Structure; Fragmentacion de nucleos pesados por protones de 13'8 GeV/c, como contribucion al estudio del mecanismo de interaccion y estructura nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gil Perez, D.

    1967-07-01

    We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.

  6. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis

    OpenAIRE

    Chen, Tianfeng; Yang,Fang; Wong,Ka-Hing; Yang,Yufeng; Li,Xiaoling; Jiang,Jie; Wu,Hualian; Zheng,Wenjie

    2014-01-01

    Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellu...

  7. 17 CFR 1.38 - Execution of transactions.

    Science.gov (United States)

    2010-04-01

    ... Management and Budget under control numbers 3038-0007 and 3038-0022) [46 FR 54523, Nov. 3, 1981, as amended... trades involving the exchange of futures for cash commodities or the exchange of futures in connection with cash commodity transactions, shall identify and mark by appropriate symbol or designation all such...

  8. 42 CFR 433.138 - Identifying liable third parties.

    Science.gov (United States)

    2010-10-01

    ... State law) to provide for obtaining— (i) From State Workers' Compensation or Industrial Accident... be met. (e) Diagnosis and trauma code edits. (1) Except as specified under paragraph (e)(2) or (l) of... recipients that contain diagnosis codes 800 through 999 International Classification of Disease, 9th Revision...

  9. 1/38 GROUNDS FOR DISPENSING WITH PUBLIC TENDER ...

    African Journals Online (AJOL)

    Administrator

    2010-01-25

    Jan 25, 2010 ... value of public procurement (excluding the procurement of public corporations) ... money in government contracting, the fair treatment of contractors and the use ... 6 For detailed discussion, see Bolton Government Procurement ch 3, par 4. ... 8 On 'cost-effectiveness', see Collins English Dictionary 380 and ...

  10. Reverted austenite in PH 13-8 Mo maraging steels

    International Nuclear Information System (INIS)

    Schnitzer, Ronald; Radis, Rene; Noehrer, Matthias; Schober, Michael; Hochfellner, Rainer; Zinner, Silvia; Povoden-Karadeniz, E.; Kozeschnik, Ernst; Leitner, Harald

    2010-01-01

    The mechanical properties of maraging steels are strongly influenced by the presence of reverted austenite. In this study, the morphology and chemical composition of reverted austenite in a corrosion resistant maraging steel was characterized using transmission electron microscopy (TEM) and atom probe tomography (APT). Two types of austenite, i.e. granular and elongated, are present after aging at 575 o C, whereby the content of the latter increases during aging. The investigations revealed that the austenite phase is enriched in Ni, which prevents the transformation to martensite during cooling. Inside and next to the austenitc areas, Mo and Cr-rich carbides, which form during the aging treatment, were found. Various aging treatments were performed to obtain the activation energy for the formation of reverted austenite. Additionally, the experimental data are compared with thermodynamic and kinetic simulations. Based on these results and the chemical composition changes of the phases, a model for the formation of reverted austenite is presented. It is concluded that precipitation of B2-ordered NiAl and formation of reverted austenite take place simultaneously during aging and that dissolution of precipitates is not essential for the initial formation of reverted austenite.

  11. Computed tomographic features of lymphangioleiomyomatosis: Evaluation in 138 patients

    Energy Technology Data Exchange (ETDEWEB)

    Tobino, Kazunori, E-mail: tobino@juntendo.ac.jp [Department of Respiratory Medicine, Iizuka Hospital, 3-83 Yoshiomachi, Iizuka, Fukuoka 820-0018 (Japan); Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Johkoh, Takeshi [Department of Radiology, Kinki Central Hospital of Mutual Aid Association of Public School Teachers, Kurumazuka 3-1, Itami, Hyogo 664-0872 (Japan); Fujimoto, Kiminori [Department of Radiology, Kurume University School of Medicine and Center for Diagnostic Imaging, Kurume University Hospital, 67 Asahi-machi, Kurume, Fukuoka 830-0011 (Japan); Sakai, Fumikazu [Department of Diagnostic Radiology, Saitama International Medical Center, Saitama Medical University, 1397-1 Yamane, Hidaka, Saitama 350-1298 (Japan); Arakawa, Hiroaki [Department of Radiology, Dokkyo Medical University, 880 Kita-Kobayashi, Mibu, Tochigi 321-0293 (Japan); Kurihara, Masatoshi [The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Pneumothorax Center, Nissan Tamagawa Hospital, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Kumasaka, Toshio [The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan); Department of Pathology, Japanese Red Cross Medical Center, 4-1-22 Hiroo, Shibuya-Ku, Tokyo 150-0012 (Japan); Koike, Kengo; Takahashi, Kazuhisa [Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); Seyama, Kuniaki [Division of Respiratory Medicine, Juntendo University Faculty of Medicine & Graduate School of Medicine, 2-1-1 Hongo, Bunkyo-Ku, Tokyo 113-8421 (Japan); The Study Group of Pneumothorax and Cystic Lung Diseases, 4-8-1 Seta, Setagaya-Ku, Tokyo 158-0095 (Japan)

    2015-03-15

    Highlights: •In our series, the frequency of pulmonary nodules was higher than in the previous reports. •Our sporadic LAM patients had a lower frequency of renal AML than in that of previous reports. •LAM patients may have a high incidence of renal and hepatic cysts. •LAM cells may originate in the pelvis then spread via the axial lymphatic system. -- Abstract: Purpose: The aim was to characterize the computed tomographic (CT) findings from Japanese patients with lymphangioleiomyomatosis (LAM). Materials and methods: CT scans of the chest, abdomen, and pelvis from 124 patients with sporadic LAM (S-LAM, mean age, 37.4 years) and 14 patients with tuberous sclerosis complex (TSC)-LAM (mean age, 35.6 years) were analyzed. Results: Pulmonary nodules (18.8%) and hepatic angiomyolipoma (AML, 24.3%) were more common in our patients than those in previous reports. Compared with TSC-LAM, S-LAM group had a higher frequency of pulmonary nodules (28.6% vs 32.3%, P < 0.01) and lower frequencies of air-space consolidation (21.4% vs 2.4%, P < 0.01), pneumothorax (28.6% vs 8.1%, P = 0.02), pulmonary hilar lymphadenopathy (14.3% vs 0.8%, P < 0.01), renal AML (85.7% vs 17.4%, P < 0.01), hepatic AML (71.4% vs 17.4%, P < 0.01), and retrocrural lymphadenopathy (14.3% vs 1.4%, P = 0.04). Axial lymphatic abnormalities (i.e., thoracic duct dilatation, lymphadenopathy, and lymphangioleiomyoma) were most common in the pelvis and tended to decrease in incidence with increased distance from the pelvis. Conclusion: The incidence of some CT findings in Japanese patients differed from those in previous reports. Axial lymphatic abnormalities noted here suggest that the origin of LAM cells may be the pelvis.

  12. Publications | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au Costa Rica, l'autorité de la concurrence inflige des amendes à Coca-Cola. Le consommateur moyen n'est pas toujours pleinement conscient des avantages que procure une politique de la concurrence. Mais les habitants du Costa Rica en ont pris conscience lorsqu'une décision de l'.

  13. 33 CFR 138.80 - Financial responsibility, how established.

    Science.gov (United States)

    2010-07-01

    ... must submit annual, current, and audited non-consolidated financial statements prepared in accordance... certificant, apart from any other affiliated entity, and identify the consolidated financial statement to...-insurance. By filing with the Director, NPFC, the financial statements specified in paragraph (b)(3)(i) of...

  14. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Understanding Impunity : the Right to Truth, Justice and Reparation ... There is a general perception that assisted reproductive technologies (ARTs) affect only a ... in China and India : Policy Interventions to address Discrimination against Girls.

  15. 32 CFR 719.138 - Fees of civilian witnesses.

    Science.gov (United States)

    2010-07-01

    ...) Method of Payment. The fees and mileage of a civilian witness shall be paid by the disbursing officer of... whose testimony is determined not to meet the standards of relevancy and materiality set forth in...

  16. Isotope instrument FD-138 for the hydrologic parameter

    Energy Technology Data Exchange (ETDEWEB)

    Rukuan, Zheng; Zengxin, Wu [Instituts of Enviromental Protection, Beijing, BJ (China); Heyi, Huang [Beijing Nuclear Instrument Factory, BJ (China)

    1988-07-01

    In order to determine the hydrologic parameters, such as filtration velocity, flow direction and dispersity, {sup 131}I isotope is used as tracer in the groundwater aquifer. This method has advantages over traditional methods in respect of power saving, and is simple, quick and economical.

  17. Isotope instrument FD-138 for the hydrologic parameter

    International Nuclear Information System (INIS)

    Zheng Rukuan; Wu Zengxin; Huang Heyi

    1988-01-01

    In order to determine the hydrologic paraemters, such as filtration velocity, flow direction and dispersity, 131 I isotope is used as tracer in the groundwater aquifer. This method has advantages over traditional methods in respect of power saving, and is simple, quick and economical

  18. All projects related to | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: AFRICA SOUTH OF SAHARA, SMALL FARMS, AGRICULTURE, WOMEN, Food security. Region: Burundi ... Program: Agriculture and Food Security. Total Funding: ... Topic: INFORMATION TECHNOLOGY, RESEARCH CAPACITY, RESEARCH METHODS, METHODOLOGY, SOUTH ASIA, Evaluation. Region: North ...

  19. Dicty_cDB: SHC138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CR044130 |CR044130.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 5...neering clone MHPP142o16. 50 0.13 1 CR034434 |CR034434.1... clone MHPP186g09. 50 0.13 1 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engi

  20. Dicty_cDB: VHA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ert in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434....1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...4 CR103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engine...ering clone MHPP142o16. 50 0.17 1 CR044130 |CR044130.1 Forward strand read from ins

  1. Page | 138 JUDICIAL REVIEW OF OUSTER CLAUSE PROVISIONS ...

    African Journals Online (AJOL)

    Fr. Ikenga

    ouster of jurisdiction of the courts on pre-election matters and impeachment of the executive do constitute an ... NAUJILJ 9 (1) 2018. Page | .... Ouster clauses are general provisions, which preclude an organ of government from exercising its.

  2. What we do | Page 138 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    More specifically, pollution is suspected of jeopardizing the health of aquatic species in ... can affect food systems and cause harm to the health of local communities. ... China's large population, fast-growing economy, rapidly evolving social ...

  3. Stored ions in the Paul trap. Preliminary investigations on life-time measurement of the metastable 6D3/2 state of 226Ra+, storage properties of 138Ba+ and 28N2+ at variation of the buffer-gas pressure

    International Nuclear Information System (INIS)

    Leuthner, Heiko

    2011-01-01

    Paul-traps are a widely used tool in scientific research and play an important role in atomic physics and mass spectrometry. (1) From the earth-alkaline ions only spectroscopic data of Ra + are lacking. Those are important for the test of theoretical models and for a future atomic parity violation experiment. The first part of this work describes the setting up of a Paul-trap based Laser-experiment for measuring the lifetime of the 6D 3/2 state of 226 Ra + . Basic tests with 138 Ba + ions are presented. (2) Damping and space charge effects on resonances in the stability region strongly affect the use of Paul-traps in mass spectrometry and analysis of reaction products. The second part of this work presents detailed investigations on the storage of big, buffer-gas-cooled ion clouds in two different Paul-trap experiments; the first of them uses 138 Ba + ions detected continuously by electronic and optical detection systems, the second one uses N 2 + molecular ions and an automated destructive time-of-flight-detection method. A high precision measurement with N 2 + of the first stability region of the trap not only gives the possibility of direct comparison of experimental and theoretical resonances but also provides absolute ion numbers over the whole region for the first time. Unlike previous measurements, the investigations on nonlinear resonances where done on the superimposed stability regions of 4 simultaneously stored ion species. The nonlinear resonances were studied by varying buffer gas pressure and ion number and showed collective resonances without external excitation. By varying the buffer gas pressure the spatial distribution of a Ba + -ion cloud was investigated as well as the change of the optimal storing parameters using N 2 + -ions. Optimum Pressures for catching and trapping of ions turned out to be unequal. Shape and position of externally excited collective and individual resonances were studied under variation of ion number, buffer-gas pressure

  4. A Novel β-Globin Chain Hemoglobin Variant, Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp], Associated with Low Oxygen Saturation, Intermittent Aplastic Crises and Splenomegaly.

    Science.gov (United States)

    Collier, Anderson B; Coon, Lea M; Monteleone, Philip; Umaru, Samuel; Swanson, Kenneth C; Hoyer, James D; Oliveira, Jennifer L

    2016-01-01

    Hemoglobin (Hb) variants may be associated with low oxygen saturation and exacerbated episodes of anemia from common stressors such as viral infections. These attributes frequently cause increased clinical concern and unnecessary and expensive testing if not considered early in the evaluation of the patient. Some clinically significant Hb variants result in a normal Hb electrophoresis result, which can be method-dependent. Herein we describe a patient with low oxygen saturation and a history of hemolytic anemia who was subsequently found to carry a novel, unstable β-globin variant that we have named Hb Allentown [β137(H15)Val→Trp (GTG>TGG) HBB: c.412_413delinsTG, p.Val138Trp] for the place of identification of the variant. Hb Allentown is formed by a rare double nucleotide substitution within the same codon. Additionally, positive identification of rare Hb variants characterized by a single method is discouraged, as the Hb variant was misclassified as Hb S-South End or β6(A3)Glu→Val;β132(H10)Lys→Asn (HBB: c.[20A > T;399A > C]) by the initial laboratory.

  5. Touch and step potential analysis at 23.9kV to 4.16kV & 13.8kV to 4.16kV distribution substations with pad-mounted transformers, floating grounds, and other exposed ungrounded metal bodies using WinIGS

    Science.gov (United States)

    Guzman, David G.

    An electrical substation is composed of various subsystems that allow for the effective and safe operation of the power grid. One of the subsystems integrating a conventional substation is defined as the ground grid system. This system allows for the effective operation of the power grid and all the electrical equipment connected to it by providing a ground potential reference, commonly known as the system ground. In addition, the ground grid system provides safety to the workers and the public transiting inside or living nearby a substation by reducing the step and touch potential (or voltage) levels present during a system fault. In today's utility industry practices there is an increasing trend for using pad-mounted electrical equipment for substation applications in an effort to construct new or upgrade existing electrical facilities inside limited property spaces. This thesis work presents an analysis for the effects of touch and step voltages at existing distribution substations where 23.9kV to 4.16kV & 13.8kV to 4.16kV pad-mounted transformers and other pad-mounted switchgear was installed to replace the traditional station class equipment. Moreover, this study will expose modeling techniques employed to define and determine the effects of floating grounds and other exposed metal bodies inside or surrounding these substations using WinIGS; this is in an effort to determine any risks of electric shock associated with this type of installations. The results presented in this work are intended to verify the requirements for the ground grid analysis and design for 4.16kV distribution substations with pad-mounted equipment in order to prevent dangerous step and touch voltage levels appearing at these sites during system faults; and ultimately prevent exposing individuals to the risk of an electric shock.

  6. Evaluation of peptide adsorption-controlled liquid chromatography-tandem mass spectrometric (PAC-LC-MS/MS) method for simple and simultaneous quantitation of amyloid β 1-38, 1-40, 1-42 and 1-43 peptides in dog cerebrospinal fluid.

    Science.gov (United States)

    Goda, Ryoya; Kobayashi, Nobuhiro

    2012-05-01

    To evaluate the usefulness of the peptide adsorption-controlled liquid chromatography-tandem mass spectrometry (PAC-LC-MS/MS) for reproducible measurement of peptides in biological fluids, simultaneous quantitation of amyloid β 1-38, 1-40, 1-42 and 1-43 peptides (Aβ38, Aβ40, Aβ42 and Aβ43) in dog cerebrospinal fluid (CSF) was tried. Each stable isotope labeled Aβ was used as the internal standard to minimize the influence of CSF matrix on the reproducible Aβ quantitation. To reduce a loss of Aβ during the pretreatment procedures, the dog CSF diluted by water-acetic acid-methanol (2:6:1, v/v/v) was loaded on PAC-LC-MS/MS directly. Quantification of the Aβ in the diluted dog CSF was carried out using multiple reaction monitoring (MRM) mode. The [M+5H(5+)] and b(5+) ion fragment of each peptide were chosen as the precursor and product ions for MRM transitions of each peptide. The calibration curves were drawn from Aβ standard calibration solutions using PAC-LC-MS/MS. Analysis of dog CSF samples suggests that the basal concentration of Aβ38, Aβ40, Aβ42 and Aβ43 in dog CSF is approximately 300, 900, 200 and 30 pM, respectively. This is the first time Aβ concentrations in dog CSF have been reported. Additionally, the evaluation of intra- and inter-day reproducibility of analysis of Aβ standard solution, the freeze-thaw stability and the room temperature stability of Aβ standard solution suggest that the PAC-LC-MS/MS method enables reproducible Aβ quantitation. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Kinetic parameters for the thermal decomposition reactions of mixed oxides of selenium and tellurium

    International Nuclear Information System (INIS)

    Jerez, A.; Castro, A.; Pico, C.; Veiga, M.L.

    1982-01-01

    A comparative study of the thermal decomposition processes of Te 3 SeO 8 and TeSeO 4 has been carried out based on the results obtained directly by a Mettler TA 3000 apparatus and from calculations using other differential and integral methods. (orig.)

  8. Synthesis, Processing, and Thermoelectric Properties of Germanium-Antimony-Tellurium Based Compounds and Alloys

    Science.gov (United States)

    Williams, Jared Brett

    Society has become increasingly more aware of the negative impacts which nonrenewable energy sources have on the environment, and therefore the search for new and more efficient means of energy production has become an important research endeavor. Thermoelectric modules possess the unique ability to convert wasted heat into useful electrical energy via solid state processes, which could vastly improve the efficiency of a number of applications. The materials which accomplish this are typically comprised of semiconductors which exhibit high electrical conductivity, Seebeck coefficient, and thermal resistivity. Together these properties give us a gauge for the overall efficiency of the thermal to electrical energy conversion. Phase change materials are a class of materials primarily used for optical data storage in CDs, DVDs, and Blu-Ray discs. Today's state of the art phase change materials are based on alloys of GeTe and Sb2Te3. These materials have also been found to exhibit high thermoelectric efficiencies. These high efficiencies stem from their complex crystal structure and degenerate semiconducting nature. The purpose of this work was to study and engineer the thermoelectric properties of various alloys and compounds which belong to this family of materials. Specifically studied were the compounds Ge4SbTe5 and Ge17Sb2Te20. In each case various synthesis and processing strategies were implemented to increase the thermoelectric performance and better understand the fundamental electrical and thermal properties. Finally various proposals for future work on these materials are presented, all of which are based on the findings described herein.

  9. Crystal structure of ammonium divanadium(IV,V tellurium(IV heptaoxide

    Directory of Open Access Journals (Sweden)

    William T. A. Harrison

    2014-07-01

    Full Text Available The polyhedral building blocks of the layered inorganic network in the mixed-valence title compound, (NH4(VIVO2(VVO2(TeO3, are vertex-sharing VVO4 tetrahedra, distorted VIVO6 octahedra and TeO3 pyramids, which are linked by V—O—V and V—O—Te bonds, forming double layers lying parallel to (100. The presumed TeIV lone-pairs of electrons appear to be directed inwards into cavities in the double layers. The charge-balancing ammonium cations lie between the layers and probably interact with them via N—H...O hydrogen bonds.

  10. Effect of tellurium doping on the structural, optical, and electrical properties of CdO

    Energy Technology Data Exchange (ETDEWEB)

    Dakhel, A.A. [Department of Physics, College of Science, University of Bahrain, P.O. Box 32038 (Bahrain)

    2010-08-15

    Te-doped CdO thin-films (1%, 3%, and 5%) have been prepared by a vacuum evaporation method on glass and silicon-wafer substrates. The prepared films were characterised by X-ray fluorescence, X-ray diffraction, UV-VIS-NIR absorption spectroscopy, and dc-electrical measurements. Experimental data indicate that Te ions doping slightly stresses the host CdO crystalline structure and changes the optical and electrical properties. The bandgap of the host CdO was suddenly narrowed by about 23% due to a little (1%) doping with Te ions. This bandgap shrinkage was explained by effects of trap levels overlapping with conduction band. The electrical behaviours of the Te-doped CdO films show that they are degenerate semiconductors with a bandgap of 1.7-2.2 eV. The 1% Te-doped CdO film shows increase its mobility by about 5 times, conductivity by {proportional_to}140 times, and carrier concentration by {proportional_to}27 times, relative to undoped CdO film. From transparent-conducting-oxide point of view, Te is sufficiently effective for CdO doping. Finally, the absorption in the NIR spectral region was studied in the framework of the classical Drude theory. (author)

  11. Mass spectrometric isotope dilution analyses of palladium, silver, cadmium and tellurium in carbonaceous chondrites

    International Nuclear Information System (INIS)

    Loss, R.D.; Rosman, K.J.R.; De Laeter, J.

    1984-01-01

    The mass spectrometric isotope dilution technique was used to measure the elemental abundances of Pd, Ag, Cd and Te in Orgueil (C1), Ivuna (C1), Murray (C2) and Allende (C3) chondrites. The Pd abundance of 554 ppb for the Cl chondrites is almost identical to the recommended value of Anders and Ebihara (1982); that for Cd (712 ppb) is approximately 5% higher, whereas that for Ag (198 ppb) is approximately 10% lower than the recommended values. A smooth distribution for the abundances of the odd-A nuclides between 65 128 Te and 130 Te to lie approximately 30% above the r-process peak at A = 130, whereas the new value fits smoothly into the general trend. (author)

  12. Grain boundary engineering for control of tellurium diffusion in GH3535 alloy

    Science.gov (United States)

    Fu, Cai-Tao; Yinling, Wang; Chu, Xiang-Wei; Jiang, Li; Zhang, Wen-Zhu; Bai, Qin; Xia, Shuang; Leng, Bin; Li, Zhi-Jun; Ye, Xiang-Xi; Liu, Fang

    2017-12-01

    The effect of grain boundary engineering (GBE) on the Te diffusion along the surface grain boundaries was investigated in GH3535 alloy. It can be found that GBE treatment increases obviously the fraction of low-Σ coincidence site lattice (CSL) boundaries, especially the Σ3 ones, and introduces the large-size grain clusters. When the as-received (AR) and GBE-treated (GBET) specimens were exposed to Te vapor, only Σ3 boundaries were found to be resistant to Te diffusion. From the cross section and the surface, the fewer Te-attacked grain boundaries and the thinner corrosion layer can be observed in the GBET sample. The improvement of resistance to Te diffusion in the GBET sample can be attributed to the large size grain-clusters associated with high proportion of the Σ3n boundaries.

  13. Natural defects and defects created by ionic implantation in zinc tellurium

    International Nuclear Information System (INIS)

    Roche, J.P.; Dupuy, M.; Pfister, J.C.

    1977-01-01

    Various defects have been studied in ZnTe crystals by transmission electron microscope and by scanning electron microscope in cathodo-luminescence mode: grain boundaries, sub-grain boundaries, twins. Ionic implants of boron (100 keV - 2x10 14 and 10 15 ions cm -2 ) were made on these crystals followed by isochrone annealing (30 minutes) of zinc under partial pressure at 550, 650 and 750 0 C. The nature of the defects was determined by transmission electron microscope: these are interstitial loops (b=1/3 ) the size of which varies between 20 A (non-annealed sample) and 180A (annealed at 750 0 C). The transmission electron microscope was also used to make concentration profiles of defects depending on depth. It is found that for the same implant (2x10 14 ions.cm -2 ), the defect peak moves towards the exterior of the crystal as the annealing temperature rises (400 - 1000 and 7000 A for the three annealings). These results are explained from a model which allows for the coalescence of defects and considers the surface of the sample as being the principal source of vacancies. During the annealings, the migration of vacancies brings about the gradual annihilation of the implant defects. The adjustment of certain calculation parameters on the computer result in giving 2 eV as energy value for the formation of vacancies [fr

  14. Current saturation in tellurium caused by the acoustoelectric effect at 4.2 K

    International Nuclear Information System (INIS)

    Bondar, V.M.; Radchenko, V.S.

    1980-01-01

    Current voltage characteristics of p-Te for x- and z-cuts have been taken for different time moments and at an electric field pulse with nonosecond duration at 77 and 4.2 K (incubation time). Experimental and calculational field dependences of incubation time of ac- aoustic electrical current for xnd z-cut in p-Te in 77-4.2 K temperature range have been obtained. Satisfactory (and unusual at 4.2 K) coincidence of experimental and calculational curves justifies aplication of the incubation time approximation. The results obtained allow to support an assumption of strengthening of extraaxial modes by ''supersonic'' carriers drifting along the C 3 axis. Obtained are experimental data permitting to eliminate the acoustic electric effect in studies of mechanisms of carrier scattering in Te by choosing the proper duration of field pulses

  15. A study of the giant dipole resonance in doubly even tellurium and cerium isotopes

    International Nuclear Information System (INIS)

    Lepretre, A.; Beil, H.; Bergere, R.; Carlos, P.; Fagot, J.; Miniac, A. de; Veyssiere, A.

    1976-01-01

    The partial photoneutron cross sections [sigma(γ,n)+sigma(γ,pn)] and sigma(γ,2n) of 124 Te, 126 Te, 128 Te, 130 Te and 140 Ce, 142 Ce were measured in the giant dipole resonance region by means of the monochromatic photon beam installation at SACLAY. Absolute total photoneutron cross sections, Lorentz line parameters and integrated cross sections are evaluated. The experimental behaviour of the GDR for the above nuclei and in particular its spreading, is then tentatively interpreted in terms of the improved dynamic collective model using the concept of potential energy surfaces. (Auth.)

  16. Thermoelectric properties of ternary phases of thallium-tin-tellurium system

    Energy Technology Data Exchange (ETDEWEB)

    Dichi, E. [Equipe materiaux et sante, faculte de pharmacie, universite Paris XI, 5, rue J.B, EA 401, Clement 92296 Chatenay-Malabry (France)], E-mail: emma.dichi@cep.u-psud.fr; Sghaier, M. [Equipe materiaux et sante, faculte de pharmacie, universite Paris XI, 5, rue J.B, EA 401, Clement 92296 Chatenay-Malabry (France); Kra, G. [Laboratoire de chimie minerale, universite de Cocody, 22, BP 582, Abidjan 22, Cote d' Ivoire (France)

    2008-06-30

    In this paper, we present the measurements of conductivity and of thermoelectric power. Measurements were taken for the temperature range of 100-330 K for the three ternary phases of Tl-Sn-Te system. The potential of these compounds as thermoelectric materials was studied.

  17. Synthesis and characterization of nanometer sized thermoelectric lead-antimony-silver-tellurium compounds and related materials

    International Nuclear Information System (INIS)

    Petri, Denis

    2012-01-01

    The present dissertation deals with different variants of synthesis and processing of nanocrystalline composites of various thermoelectric compounds based on lead telluride including LAST-m (AgPb m SbTe m+2 ), LASTT-m-x (AgPb m-x Sn x SbTe m+2 ), LABST-m-x (AgPb m Sb 1-x Bi x Te m+2 ), doped LAST-m and (PbTe) m (M 15 2 Te 3 ) and the characterization thereof. A new route of manufacturing nanocrystalline composites was developed. The so called co-ball milling-route includes the synthesis of bi- or multinary compounds by conventional solid state melting methods followed by combined milling of appropriate amounts in a planetary ball mill; a process related to the widely used mechanical alloying of elemental powders. The as produced powders were shortly annealed for one hour and a.erwards compacted either at room temperature followed by pressureless sintering or combined application of high pressure and elevated temperatures via spark-plasma-sintering or short-term-sintering. The ball milling yielded micron-sized agglomerates consisting of crystallites with diameters ranging from 10 to 50 nm. These crystallites exhibited complicated internal nanostructures severe crystal defects as a consequence of the high energy processing. During short-term annealing some grain coarsening occured and the crystal defects partly healed, which was confirmed by TEM and HRTEM investigations as well as profile analysis of XRD powder pattern. Local EDX-analysis showed different compositions at every point as a consequence of synthesis and decomposition of the compounds. Measurements of thermopower, electrical and thermal conductivity were carried out and the values of the figure of merit ZT and the powerfactor were calculated. In general the compounds exhibited larger thermopower than corresponding bulk materials, which might be attributed to energy filtering of charge carriers at partly oxidized grain boundaries. Due to enhanced phonon scattering at grain boundarys, nanoscopic precipitates and crystal defects the thermal conductivity was generally low. Similar to other reports the powder processing caused a deleterious effect on the electrical conductivity. The comparison between short term annealed and long term sintered polycrystalline bulk samples revealed that the annealing temperature caused partly connected particles for the LAST-derivates but well sintered compacts for the non-LAST-compounds. For both classes, long-term sintering caused a simultanious increase of both thermopower and electrical conductivity which shows that co-ball milling leads to a decoupling of those two properties. This could prove usefull in further investigations and the development of new thermoelectric materials and the processing thereof.

  18. EPR invastigation of glasses on the base of the oxides of vanadium and tellurium

    International Nuclear Information System (INIS)

    Imanov, L.M; Ibragimov, Z.A.

    1978-01-01

    The results of investigation of EPR spectra of the nV 2 O 5 (100-n)TeO 2 binary system in the range from 95 to 5 mol % V 2 O 5 with the 5 mol % step on the DRON-2 installation (X-ray diffraction measurements) are presented. The EPR spectra were read out on the RE-1301 spectrometer at liquid nitrogen and room temperatures. The concentration of the EPR centres was determined by comparing it with the signal from the known number of Cu 2+ ions in the CuSO 4 x5H 2 O crystal. It is established that the VO 2+ complexes were the EPR centres. In all prepared samples the EPR spectra were observed, and at n=70 the SFS components were revealed both in the crystalline (with the TeO 2 content up to 30 mol %) and in amorphous states. The singularities of the EPR spectrum are discussed on the basis of the spin-hamiltonian with axial asymmetry. The dependence of the spin-hamiltonian components on the content was revealed and the P=670 value characterizing the average value of the distance between the nucleus and noncoupled electron is found. Observation of the line with well resoluted SFS components in the amorphous samples is explained by 'a great freedom'' of paramagnetic ions in the choice of close environment, and consequently the field of ligand atoms localizing in the paramagnetic ion produces the ''strong field'' effect (D, E>>GβH, G=1.985+-0.005) and removes degeneration due to the presence of the I=7/2 nuclear momentum of the V 4+ ion. Conservation of the SFS lines even at room temperature is connected with great scattering of the spin-lattice relaxation time

  19. Glass formation and structure of calcium antimony phosphate glasses and those doped with tellurium oxide

    Science.gov (United States)

    Li, Jun; Zhang, Yin; Nian, Shangjiu; Wu, Zhenning; Cao, Weijing; Zhou, Nianying; Wang, Danian

    2017-03-01

    An approximate glass-forming region in the P2O5-Sb2O3-CaO ternary system was determined. The properties and structure of two compositional series of (A) (75- x)P2O5- xSb2O3-25CaO ( x = 20, 25, 30, 35 mol%) and (B) 45P2O5-30Sb2O3-(25- x)CaO- xTeO2 ( x = 5, 10, 15, 20 mol%) were studied systematically. Thermal properties were investigated by means of differential scanning calorimetry (DSC). The densities of all samples were measured by Archimedes' method using distilled water as the immersion liquid. The water durability of the glasses was described by their dissolution rate (DR) in the distilled water at 90 °C for some time periods. Density, thermal stability and water durability were improved with the addition of Sb2O3 and TeO2. Structural studies were carried out by X-ray diffraction (XRD), infrared spectroscopy and Raman spectroscopy. The phosphate chain depolymerization occurred with the increase of Sb2O3 and the Q2 structural units transformed to the Q1 and Q0 structural units with the addition of TeO2.

  20. Thermoelectric performance of tellurium-reduced quaternary p-type lead–chalcogenide composites

    International Nuclear Information System (INIS)

    Aminorroaya Yamini, Sima; Wang, Heng; Gibbs, Zachary M.; Pei, Yanzhong; Mitchell, David R.G.; Dou, Shi Xue; Snyder, G. Jeffrey

    2014-01-01

    Graphical abstract: - Abstract: A long-standing technological challenge to the widespread application of thermoelectric generators is obtaining high-performance thermoelectric materials from abundant elements. Intensive study on PbTe alloys has resulted in a high figure of merit for the single-phase ternary PbTe–PbSe system through band structure engineering, and the low thermal conductivity achieved due to nanostructuring leads to high thermoelectric performance for ternary PbTe–PbS compounds. Recently, the single-phase p-type quaternary PbTe–PbSe–PbS alloys have been shown to provide thermoelectric performance superior to the binary and ternary lead chalcogenides. This occurs via tuning of the band structure and from an extraordinary low thermal conductivity resulting from high-contrast atomic mass solute atoms. Here, we present the thermoelectric efficiency of nanostructured p-type quaternary PbTe–PbSe–PbS composites and compare the results with corresponding single-phase quaternary lead chalcogenide alloys. We demonstrate that the very low lattice thermal conductivity achieved is attributed to phonon scattering at high-contrast atomic mass solute atoms rather than from the contribution of secondary phases. This results in a thermoelectric efficiency of ∼1.4 over a wide temperature range (650–850 K) in a p-type quaternary (PbTe) 0.65 (PbSe) 0.1 (PbS) 0.25 composite that is lower than that of single-phase (PbTe) 0.85 (PbSe) 0.1 (PbS) 0.05 alloy without secondary phases

  1. Tellurium-123m-labeled isosteres of palmitoleic and oleic acids show high myocardial uptake

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Ambrose, K.R.; Callahan, A.P.; Grigsby, R.A.; Irgolic, K.J.

    1979-01-01

    These studies were directed at determining if the telluro fatty acids prepared by the isosteric replacement of the Δ 9 -double bonds of oleic and palmitoleic acids with /sup 123m/Te would show heart uptake in rats. The isostere of palmitoleic acid, 9-tellurapentadecanoic acid(II), was prepared by basic hydrolysis of the product formed by the coupling of /sup 123m/Te-sodium hexyl tellurol with methyl-8-bromooctadecanoate. Similarly, the isostere of oleic acid, 9-telluraheptadecanoic acid(IV), was prepared by the same route beginning with the reaction of /sup 123m/Te-sodium octyl tellurol with methyl-8-bromooctadecanoate. Both /sup 123m/Te-(II) and /sup 123m/Te-(IV) showed remarkably high heart uptake in rats (2 to 3% dose/gm) ten minutes after intravenous administration, and the heart/blood ratios were high (20-30/1). Finally, the hearts of rats injected with /sup 123m/Te-(IV) have been clearly imaged with a rectilinear scanner

  2. Tellurium adsorption on single crystal faces of molybdenum and tungsten field emitters

    International Nuclear Information System (INIS)

    Collins, R.A.; Kiwanga, C.A.

    1978-01-01

    The purpose of this letter is to report the extension of previous studies of Te adsorption on Mo and W field emitters to measurements on single crystal planes. The adsorption of semiconductors on metallic emitters has been found to be characterized by simultaneous decreases in emission current and the Fowler-Nordheim work function for adsorbate coverages of less than a monolayer. (Auth.)

  3. Crystallization kinetics in antimony and tellurium alloys used for phase change recording

    International Nuclear Information System (INIS)

    Kalb, J.A.

    2006-01-01

    This thesis makes a contribution to a fundamental understanding of the crystallization kinetics of amorphous and liquid phase change materials. In one project of this study, ex situ atomic force microscopy in combination with a high-precision furnace was identified as a powerful and accurate tool to determine isothermal crystallization parameters in thin films as a function of time and temperature. This method was employed for a systematic study of crystallization kinetics in sputtered amorphous Ag 0.055 In 0.065 Sb 0.59 Te 0.29 (hereafter: AgIn-SbTe), Ge 4 Sb 1 Te 5 , and Ge 1 Sb 2 Te 4 thin films used for phase change recording. The temperature dependence of the crystal nucleation rate and the crystal growth velocity were determined between 90 and 190 C by direct observation of crystals. The time dependence of the nucleation rate was also investigated. Ex situ transmission electron microscopy was used to study the crystal morphology in these alloys. In a second project, sputtered amorphous films in the compositions mentioned above were studied by differential scanning calorimetry. In a third project, droplets of molten alloys of composition Ge 12 Sb 88 , AgIn-Sb 2 Te, Ge 4 Sb 1 Te 5 and Ge 2 Sb 2 Te 5 , surrounded by a molten dehydrated B 2 O 3 flux, were undercooled to 40-80 K below their liquidus temperature in a differential thermal analyzer. The crystal-melt interfacial energy was determined from the nucleation temperature using the classical nucleation theory. (Orig.)

  4. 138 Caractérisation physico-chimique et microbiologique du mulet ...

    African Journals Online (AJOL)

    SETNORD

    3Institut National d'Hygiène, 27, Avenue Ibn Batouta, B.P. 769 – Agdal, Rabat, Maroc. *Correspondance, courriel : oahmed80@yahoo.fr. Résumé. Lekhlia est un produit d'origine Imraguen en Mauritanie, fabriqué à base de poisson (mulet jaune séché- pilé). Un totale de 163 échantillons de Lekhlia ont été prélevés à partir ...

  5. 29 CFR 784.138 - Perishable state of the aquatic product as affecting exemption.

    Science.gov (United States)

    2010-07-01

    ... with the performance of exempt operations on the aquatic forms of animal and vegetable life mentioned... or manufacturing operations on products previously rendered nonperishable, such as refining fish oil... 29 Labor 3 2010-07-01 2010-07-01 false Perishable state of the aquatic product as affecting...

  6. Onychomycosis in the elderly. A 2-year retrospective study of 138 cases

    Directory of Open Access Journals (Sweden)

    J. Araiza-Santibáñez

    2016-01-01

    Conclusions: Approximately 9 out of 10 nail disorders in the elderly were onychomycosis; many of these patients may present with comorbidities such as hypertension or diabetes mellitus, which often complicate treatment outcomes, affecting quality of life. Elderly patients should receive adequate health education and monitoring. This will improve their quality of life.

  7. Fretting corrosion tests on orthopedic plates and screws made of ASTM F138 stainless steel

    OpenAIRE

    Santos,Claudio Teodoro dos; Barbosa,Cássio; Monteiro,Maurício de Jesus; Abud,Ibrahim de Cerqueira; Caminha,Ieda Maria Vieira; Roesler,Carlos Rodrigo de Mello

    2015-01-01

    Introduction Although there has been significant progress in the design of implants for osteosynthesis, the occurrence of failures in these medical devices are still frequent. These implants are prone to suffer from fretting corrosion due to micromotion that takes place between the screw heads and plate holes. Consequently, fretting corrosion has been the subject of research in order to understand its influence on the structural integrity of osteosynthesis implants. The aim of this paper is t...

  8. https://www.jcoeng.edu.iq/index.php/main/article/view/155/138

    Directory of Open Access Journals (Sweden)

    Awatif Soaded Alsaqqar

    2016-08-01

    Full Text Available The need to create the optimal water quality management process has motivated researchers to pursue prediction modeling development. One of the widely important forecasting models is the sessional autoregressive integrated moving average (SARIMA model. In the present study, a SARIMA model was developed in R software to fit a time series data of monthly fluoride content collected from six stations on Tigris River for the period from 2004 to 2014. The adequate SARIMA model that has the least Akaike's information criterion (AIC and mean squared error (MSE was found to be SARIMA (2, 0, 0 (0,1,1. The model parameters were identified and diagnosed to derive the forecasting equations at each selected location. The correlation coefficient between the actual and predicted values for fluoride concentration at the six locations, Al-Karakh, East Tigris, Al-Wathbah, AL-Karamah, Al-Rashid and Al-Wahda WTP intakes, was 0.93, 0.82, 0.86, 0.90, 0.83 and 0.89, respectively. Model verification results indicated that the model forecasting outputs rationally estimated the actual monthly fluoride content in the selected locations.

  9. Monitoring of the incorporation of I-138 by inhalation in facilities of metabolic treatment

    International Nuclear Information System (INIS)

    Baquero, R.; Anton, D.; Miguel, D. de

    2013-01-01

    The measure of thyroid activity with a surface contamination meter allows you to rule out or confirm the presence of iodine in the thyroid of the nursing staff. You have these teams in all Nuclear Medicine facilities, which can be used with simplicity immediately. To carry out these measures is necessary to have a background environment in which are carried out low, so as the limit of detection got enable check low levels to determine. (Author)

  10. 75 FR 45096 - Foreign-Trade Zone 138 - Columbus, Ohio Area, Application for Reorganization under Alternative...

    Science.gov (United States)

    2010-08-02

    ... located within a grantee's ``service area'' in the context of the Board's standard 2,000-acre activation... Rickenbacker International Airport and Air Industrial Park, Alum Creek East Industrial Park, Alum Creek West Industrial Park, and Groveport Commerce Center, Franklin County; Site 2 (136 acres) -- Gateway Business Park...

  11. Psychosocial Aspects of Cleft Lip and Palate: Implications for Parental Education. Research Report 138.

    Science.gov (United States)

    Kalland, Mirjam

    This study focused on the psychosocial aspects of cleft lip and/or palate on maternal emotional reactions and the family, with emphasis on the effect on the maternal-infant bond. Interviews were conducted with 40 mothers of 1-year-old infants with non-syndromic cleft lip and/or palate. The interviews were analyzed using the phenomenological…

  12. Sud du Sahara | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Remarkable new research into HIV prevention among the "choice disabled" — vulnerable groups less able to make the right choices to protect ... and human health in agriculture-based livelihood systems within Uganda's "cattle corridor.".

  13. Ce que nous faisons | Page 138 | CRDI - Centre de recherches pour ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI finance des études de recherche dans les pays en voie de développement en vue de produire un changement durable à grande échelle. Pour que le savoir devienne un outil permettant de résoudre des problèmes urgents :

  14. 12 CFR 225.138 - Statement of policy concerning divestitures by bank holding companies.

    Science.gov (United States)

    2010-01-01

    ... divestiture period approaches the “forced sale” aspect of the divestiture may lead potential buyers to... have the potential for causing a serious adverse economic impact upon the divesting company, the Board... prospective purchases. Thus, delay in planning for divestiture may increase the likelihood that the company...

  15. ICRP Publication 138: Ethical Foundations of the System of Radiological Protection.

    Science.gov (United States)

    Cho, K-W; Cantone, M-C; Kurihara-Saio, C; Le Guen, B; Martinez, N; Oughton, D; Schneider, T; Toohey, R; ZöLzer, F

    2018-02-01

    Despite a longstanding recognition that radiological protection is not only a matter of science, but also ethics, ICRP publications have rarely addressed the ethical foundations of the system of radiological protection explicitly. The purpose of this publication is to describe how the Commission has relied on ethical values, either intentionally or indirectly, in developing the system of radiological protection with the objective of presenting a coherent view of how ethics is part of this system. In so doing, it helps to clarify the inherent value judgements made in achieving the aim of the radiological protection system as underlined by the Commission in Publication 103. Although primarily addressed to the radiological protection community, this publication is also intended to address authorities, operators, workers, medical professionals, patients, the public, and its representatives (e.g. NGOs) acting in the interest of the protection of people and the environment. This publication provides the key steps concerning the scientific, ethical, and practical evolutions of the system of radiological protection since the first ICRP publication in 1928. It then describes the four core ethical values underpinning the present system: beneficence/ non-maleficence, prudence, justice, and dignity. It also discusses how these core ethical values relate to the principles of radiological protection, namely justification, optimisation, and limitation. The publication finally addresses key procedural values that are required for the practical implementation of the system, focusing on accountability, transparency, and inclusiveness. The Commission sees this publication as a founding document to be elaborated further in different situations and circumstances.

  16. 138th International School of Physics "Enrico Fermi" : Unfolding the Matter of Nuclei

    CERN Document Server

    Ricci, R A

    1998-01-01

    The nucleus and its constituents are a challenging problem. The lectures collected in this book present a broad and comprehensive review of the current knowledge about nuclei.They cover topics such as searching for signatures of the quarks in nuclei with electromagnetic probes and, at much higher energies, for signatures of the quark-gluon plasma in ultrarelativistic nuclear collisions. The attempts to obtain new nuclei in the laboratory are also discussed, as well as the central role played by nuclear physics in the development of weak interactions. Progress in all these areas rests on a deeper theoretical handling of the nuclear and nucleon’s structure. The latter can also be addressed by relying on numerical solutions of QCD on a discrete space-time lattice. The advancement of computational capabilities has spurred a growing interest in this approach. Finally, the book deals with different paths toward solving non-perturbative QCD.

  17. 138 Etude de la variabilité agromorphologique de quarante-cinq ...

    African Journals Online (AJOL)

    ITRAD

    collectés lors des séjours de contact avec les paysans en 1987, et mis en collection, à savoir Moudjo-kass,. Loubial al botoro ... agromorphologique des quarante-cinq cultivars de la collection de l'Institut Tchadien de Recherche. Agronomique pour le ... coloration (Coo) et la forme de l'œil (Fog). Quant aux gousses ce sont ...

  18. 78 FR 138 - Self-Regulatory Organizations; Chicago Board Options Exchange, Incorporated; Notice of Filing and...

    Science.gov (United States)

    2013-01-02

    ... allow for further analysis of the Program and a determination of how the Program should be structured in... that the rules of an exchange be designed to prevent fraudulent and manipulative acts and practices, to... national market system, and, in general, to protect investors and the public interest. Additionally, the...

  19. : tous les projets | Page 138 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: SOCIAL CONFLICTS, Governance, PEACE KEEPING, SAFETY, ETHNIC GROUPS, INTERETHNIC RELATIONS, POLICY MAKING. Région: Sri Lanka, Central Asia, Far East Asia, South Asia, Bangladesh, Nepal, Pakistan. Financement total : CA$ 25,200.00. Étude sur l'état de la démocratie et de la gouvernance au ...

  20. أثر العلماء في الحياة الرسمية والاجتماعية في عهد الإمارة الأموية (138 هـ-316 هـ (755 م-928م

    Directory of Open Access Journals (Sweden)

    شخوم سعدي

    2010-03-01

    Full Text Available بدأت تظهر أولى الملامح الاستقلالية عن المشرق من الناحية الثقافية والعلمية، بتأسيس الدولة الأموية بالأندلس، ويذهب بعض الباحثين إلى أنّ الروابط التي كانت تربط الأندلس بالخلافة الأموية كانت قد انقطعت قبل ذلك في عهد واليها الصميل بن حاتم (129 هـ-138هـ(746م-755م الذي كان له نفوذ كبير جعله يتحكم في عزل الولاة واختيارهم ولهذا لم يكن لسقوط الدولة الأموية أثر مباشر يذكر على الولاية واستقرار الحكم بها، وتتضح هذه الاستقلالية في الجانب الديني فقد بدأ الأندلسيون يتجهون شيئا فشيئا من الأوزاعية إلى المالكية رغم أنّ المذهب السائد بالمشرق هو الحنفي، وهكذا وبمرور الوقت أصبح المذهب المالكي هو المذهب الرسمي للدولة الأندلسية، فكان فقهاء الجماعة من أتباع الإمام مالك يدرؤون أية محاولة للانحياز عنه، وفي ميدان الأدب والشعر عرف هذا الجانب نشاطا واضحا. حيث بدأت الأندلس تعرف جيلا جديدا من الشعراء أكثر تفرعا للشعر من غيره، وقد تعرض ابن حيان لهؤلاء وامتلأ المقتبس بشعرهم ومواقفهم، وفي الميادين العلمية الأخرى بدأت الأندلس تعرف جيلا جديدا من العلماء أكثر طموحا وبذلا للجهد العلمي وبذلك بدأ يغلب الجانب العلمي والثقافي على الأندلس أكثر من أي فترة سابقة وبدأت تظهر خصائص جديدة للحياة العلمية في هذه الفترة.

  1. Synthesis and characterization of nanometer sized thermoelectric lead-antimony-silver-tellurium compounds and related materials; Synthese und Charakterisierung nanoskaliger Thermoelektrika der LAST (Lead-Antimony-Silver-Tellurium)-Familie und verwandter Verbindungen

    Energy Technology Data Exchange (ETDEWEB)

    Petri, Denis

    2012-09-10

    The present dissertation deals with different variants of synthesis and processing of nanocrystalline composites of various thermoelectric compounds based on lead telluride including LAST-m (AgPb{sub m}SbTe{sub m+2}), LASTT-m-x (AgPb{sub m-x}Sn{sub x}SbTe{sub m+2}), LABST-m-x (AgPb{sub m}Sb{sub 1-x}Bi{sub x}Te{sub m+2}), doped LAST-m and (PbTe){sub m}(M{sup 15}{sub 2}Te{sub 3}) and the characterization thereof. A new route of manufacturing nanocrystalline composites was developed. The so called co-ball milling-route includes the synthesis of bi- or multinary compounds by conventional solid state melting methods followed by combined milling of appropriate amounts in a planetary ball mill; a process related to the widely used mechanical alloying of elemental powders. The as produced powders were shortly annealed for one hour and a.erwards compacted either at room temperature followed by pressureless sintering or combined application of high pressure and elevated temperatures via spark-plasma-sintering or short-term-sintering. The ball milling yielded micron-sized agglomerates consisting of crystallites with diameters ranging from 10 to 50 nm. These crystallites exhibited complicated internal nanostructures severe crystal defects as a consequence of the high energy processing. During short-term annealing some grain coarsening occured and the crystal defects partly healed, which was confirmed by TEM and HRTEM investigations as well as profile analysis of XRD powder pattern. Local EDX-analysis showed different compositions at every point as a consequence of synthesis and decomposition of the compounds. Measurements of thermopower, electrical and thermal conductivity were carried out and the values of the figure of merit ZT and the powerfactor were calculated. In general the compounds exhibited larger thermopower than corresponding bulk materials, which might be attributed to energy filtering of charge carriers at partly oxidized grain boundaries. Due to enhanced phonon scattering at grain boundarys, nanoscopic precipitates and crystal defects the thermal conductivity was generally low. Similar to other reports the powder processing caused a deleterious effect on the electrical conductivity. The comparison between short term annealed and long term sintered polycrystalline bulk samples revealed that the annealing temperature caused partly connected particles for the LAST-derivates but well sintered compacts for the non-LAST-compounds. For both classes, long-term sintering caused a simultanious increase of both thermopower and electrical conductivity which shows that co-ball milling leads to a decoupling of those two properties. This could prove usefull in further investigations and the development of new thermoelectric materials and the processing thereof.

  2. Direct determination of tellurium in soil and plant samples by sector-field ICP-MS for the study of soil-plant transfer of radioactive tellurium subsequent to the Fukushima Daiichi Nuclear Power Plant accident

    International Nuclear Information System (INIS)

    Yang, Guosheng; Zheng, Jian; Tagami, Keiko; Uchida, Shigeo

    2013-01-01

    The Fukushima Daiichi Nuclear Power Plant (FDNPP) accident caused the release of large amounts of radioactive Te into the environment. Stable Te, as an analogue, is considered to be useful for the estimation of the soil-plant transfer of radioactive Te. It is necessary to estimate the radiation dose of Te that would result from food ingestion. However, due to the extremely low concentrations of Te in the environment, reported transfer factor values for Te are considerably limited. We report a sensitive analytical method for direct determination of trace Te in soil and plant samples using a sector-field inductively coupled plasma mass spectrometry (SF-ICP-MS). The developed analytical method is characterized by a very low detection limit at the sub-parts per billion (ng g"-"1) level in soil and plant samples, and it has been applied to the study of soil-plant transfer to collect transfer factor data in Japan. (author)

  3. Synthesis and structure of organoantimony(III) compounds containing antimony−selenium and −tellurium terminal bonds

    Czech Academy of Sciences Publication Activity Database

    Dostál, L.; Jambor, R.; Růžička, A.; Lyčka, A.; Brus, Jiří; de Proft, F.

    2008-01-01

    Roč. 27, č. 23 (2008), s. 6059-6062 ISSN 0276-7333 Grant - others:GA ČR(CZ) GP203/07/P094; GA MŠk(CZ) LC523 Program:LC Institutional research plan: CEZ:AV0Z40500505 Keywords : organometallic compounds Subject RIV: CA - Inorganic Chemistry Impact factor: 3.815, year: 2008

  4. Biogenic selenium and tellurium nanoparticles synthesized by environmental microbial isolates efficaciously inhibit bacterial planktonic cultures and biofilms

    Directory of Open Access Journals (Sweden)

    Emanuele eZonaro

    2015-06-01

    Full Text Available The present study deals with Se0- and Te0-based nanoparticles bio-synthesized by two selenite- and tellurite-reducing bacterial strains, namely Stenotrophomonas maltophilia SeITE02 and Ochrobactrum sp. MPV1, isolated from polluted sites. We discovered that, by regulating culture conditions and exposure time to the selenite and tellurite oxyanions, differently sized zero-valent Se and Te nanoparticles were produced. The results revealed that these Se0 and Te0 nanoparticles possess antimicrobial and biofilm eradication activity against E. coli JM109, P. aeruginosa PAO1, and S. aureus ATCC 25923. In particular, Se0 nanoparticles exhibited antimicrobial activity at quite low concentrations, below that of selenite. Toxic effects of both Se0 and Te0 nanoparticles can be related to the production of reactive oxygen species upon exposure of the bacterial cultures. Evidence so far achieved suggests that the antimicrobial activity seems to be strictly linked to the dimensions of the nanoparticles: indeed, the highest activity was shown by nanoparticles of smaller sizes. In particular, it is worth noting how the bacteria tested in biofilm mode responded to the treatment by Se0 and Te0 nanoparticles with a susceptibility similar to that observed in planktonic cultures. This suggests a possible exploitation of both Se0 and Te0 nanoparticles as efficacious antimicrobial agents with a remarkable biofilm eradication capacity.

  5. Isotopically labeled sulfur compounds and synthetic selenium and tellurium analogues to study sulfur metabolism in marine bacteria

    Directory of Open Access Journals (Sweden)

    Nelson L. Brock

    2013-05-01

    Full Text Available Members of the marine Roseobacter clade can degrade dimethylsulfoniopropionate (DMSP via competing pathways releasing either methanethiol (MeSH or dimethyl sulfide (DMS. Deuterium-labeled [2H6]DMSP and the synthetic DMSP analogue dimethyltelluriopropionate (DMTeP were used in feeding experiments with the Roseobacter clade members Phaeobacter gallaeciensis DSM 17395 and Ruegeria pomeroyi DSS-3, and their volatile metabolites were analyzed by closed-loop stripping and solid-phase microextraction coupled to GC–MS. Feeding experiments with [2H6]DMSP resulted in the incorporation of a deuterium label into MeSH and DMS. Knockout of relevant genes from the known DMSP demethylation pathway to MeSH showed in both species a residual production of [2H3]MeSH, suggesting that a second demethylation pathway is active. The role of DMSP degradation pathways for MeSH and DMS formation was further investigated by using the synthetic analogue DMTeP as a probe in feeding experiments with the wild-type strain and knockout mutants. Feeding of DMTeP to the R. pomeroyi knockout mutant resulted in a diminished, but not abolished production of demethylation pathway products. These results further corroborated the proposed second demethylation activity in R. pomeroyi. Isotopically labeled [2H3]methionine and 34SO42−, synthesized from elemental 34S8, were tested to identify alternative sulfur sources besides DMSP for the MeSH production in P. gallaeciensis. Methionine proved to be a viable sulfur source for the MeSH volatiles, whereas incorporation of labeling from sulfate was not observed. Moreover, the utilization of selenite and selenate salts by marine alphaproteobacteria for the production of methylated selenium volatiles was explored and resulted in the production of numerous methaneselenol-derived volatiles via reduction and methylation. The pathway of selenate/selenite reduction, however, proved to be strictly separated from sulfate reduction.

  6. Sequential determination of arsenic, selenium, antimony, and tellurium in foods via rapid hydride evolution and atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Fiorino, J.A.; Jones, J.W.; Capar, S.G.

    1976-01-01

    Analysis of acid digests of foods for As, Se, Sb, and Te was semiautomated. Hydrides generated by controlled addition of base stabilized NaBH 4 solution to acid digests are transported directly into a shielded, hydrogen (nitrogen diluted), entrained-air flame for atomic absorption spectrophotometric determination of the individual elements. The detection limits, based on 1 g of digested sample, are approximately 10 to 20 ng/g for all four elements. Measurement precision is 1 to 2 percent relative standard deviation for each element measured at 0.10 μg. A comparison is made of results of analysis of lyophilized fish tissues for As and Se by instrumental neutron activation (INAA), hydride generation with atomic absorption spectrometry, fluorometry, and spectrophotometry. NBS standard reference materials (orchard leaves and bovine liver) analyzed for As, Se, and Sb by this method show excellent agreement with certified values and with independent NAA values

  7. Aeration Controls the Reduction and Methylation of Tellurium by the Aerobic, Tellurite-Resistant Marine Yeast Rhodotorula mucilaginosa▿

    Science.gov (United States)

    Ollivier, Patrick R. L.; Bahrou, Andrew S.; Church, Thomas M.; Hanson, Thomas E.

    2011-01-01

    We previously described a marine, tellurite-resistant strain of the yeast Rhodotorula mucilaginosa that both precipitates intracellular Te(0) and volatilizes methylated Te compounds when grown in the presence of the oxyanion tellurite. The uses of microbes as a “green” route for the production of Te(0)-containing nanostructures and for the remediation of Te-oxyanion wastes have great potential, and so a more thorough understanding of this process is required. Here, Te precipitation and volatilization catalyzed by R. mucilaginosa were examined in continuously aerated and sealed (low oxygen concentration) batch cultures. Continuous aeration was found to strongly promote Te volatilization while inhibiting Te(0) precipitation. This differs from the results in sealed batch cultures, for which tellurite reduction to Te(0) was found to be very efficient. We show also that volatile Te species may be degraded rapidly in medium and converted to the particulate form by biological activity. Further experiments revealed that Te(0) precipitates produced by R. mucilaginosa can be further transformed to volatile and dissolved Te species. However, it was not clearly determined whether Te(0) is a required intermediate for Te volatilization. Based on these results, we conclude that low oxygen concentrations will be the most efficient for production of Te(0) nanoparticles while limiting the production of toxic volatile Te species, although the production of these compounds may never be completely eliminated. PMID:21602387

  8. Biosynthetic incorporation of telluromethionine into dihydrofolate reductase and crystallographic analysis of the distribution of tellurium atoms in the protein molecule

    Energy Technology Data Exchange (ETDEWEB)

    Kunkle, M.G.; Lewinski, K.; Boles, J.O.; Dunlap, R.B.; Odom, J.D.; Lebioda, L. [Univ. of South Carolina, Columbia, SC (United States)

    1994-12-01

    Recent successes in crystallographic studies of proteins with methionine (Met) residues replaced with SeMet, pioneered by Hendrickson and coworkers, inspired us to replace Met with TeMet in Escherichia coli dihydrofolate reductase (DHFR). E. coli DHFR, which catalyzes the NADPH-dependent reduction of dihydrofolate to tetrahydrofolate, consists of 159 residues, 5 of which are Met. TeMet was incorporated into DHFR using the Met auxotroph, E. coli DL41, carrying the expression vector pWT8 with an IPTG inducible promoter and ampicillin resistance gene. The enzyme was purified by successive chromatography on Q-Sepharose and PHenyl Sepharose resins, yielding milligram quantities of homogeneous enzyme with a specific activity of 40 units/mg. TeMet DHFR exhibits kinetic properties similar to those of wt DHFR. Amino acid analysis indicated 3 authentic Met residues in TeMet DHFR, whereas atomic absorption spectroscopy detected 2 Te per protein molecule. Amino acid sequence analysis results suggested that only authentic Met was present in the first three Met positions (1,16,and 20). Crystals of Te-DHFR were grown in the presence of methotrexate from PEG 4000 and were isomorphous with wt-DHFR crystals grown from ethanol. Difference Fourier maps and restrained least-squares refinement show very little, if any, Te in the first three Met positions: Met{sup 1}, Met{sup 16}, and Met{sup 20}, whereas the occupancy of Te in positions 42 and 92 is 0.64. Apparently, the process of folding, subsequent purification, and crystallization select DHFR molecules with Te in Met{sup 42} and Met{sup 92}. Replacing Met with TeMet provides an internal probe that should facilitate structural and mechanistic studies of proteins.

  9. Luminescent Photoelectrochemical Cells. 5. Multiple Emission from Tellurium-Doped Cadmium Sulfide Photoelectrodes and Implications Regarding Excited-State Communication.

    Science.gov (United States)

    1980-12-03

    essentially invariant. Similar effects were observed for n-type, ZnO -based PECs and ascribed to a deficiency in the electron concentration needed for...California 92152 Dr. J. J. Auborn Dr. C. E. Mueller Bell Laboratories The Electrochemistry Branch Murray Hill, New Jersey 07974 Materials Division

  10. A Better Understanding of Protein Structure and Function by the Synthesis and Incorporation of Selenium- and Tellurium Containing Tryptophan Analogs

    Energy Technology Data Exchange (ETDEWEB)

    Helmey, Sherif Samir [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Bioscience Division; Belmont Univ., Nashville, TN (United States). Dept. of Chemistry and Physics; Rice, Ambrose Eugene [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Bioscience Division; Belmont Univ., Nashville, TN (United States). Dept. of Chemistry and Physics; Hatch, Duane Michael [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Bioscience Division; Belmont Univ., Nashville, TN (United States). Dept. of Chemistry and Physics; Silks, Louis A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Bioscience Division; Marti-Arbona, Ricardo [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Bioscience Division

    2016-08-17

    Unnatural heavy metal-containing amino acid analogs have shown to be very important in the analysis of protein structure, using methods such as X-ray crystallography, mass spectroscopy, and NMR spectroscopy. Synthesis and incorporation of selenium-containing methionine analogs has already been shown in the literature however with some drawbacks due to toxicity to host organisms. Thus synthesis of heavy metal tryptophan analogs should prove to be more effective since the amino acid tryptophan is naturally less abundant in many proteins. For example, bioincorporation of β-seleno[3,2-b]pyrrolyl-L-alanine ([4,5]SeTrp) and β-selenolo[2,3-b]pyrrolyl-L-alanine ([6,7]SeTrp) has been shown in the following proteins without structural or catalytic perturbations: human annexin V, barstar, and dihydrofolate reductase. The reported synthesis of these Se-containing analogs is currently not efficient for commercial purposes. Thus a more efficient, concise, high-yield synthesis of selenotryptophan, as well as the corresponding, tellurotryptophan, will be necessary for wide spread use of these unnatural amino acid analogs. This research will highlight our progress towards a synthetic route of both [6,7]SeTrp and [6,7]TeTrp, which ultimately will be used to study the effect on the catalytic activity of Lignin Peroxidase (LiP).

  11. Effect of tellurium on machinability and mechanical property of CuAlMnZn shape memory alloy

    International Nuclear Information System (INIS)

    Liu Na; Li Zhou; Xu Genying; Feng Ze; Gong Shu; Zhu Lilong; Liang Shuquan

    2011-01-01

    Highlights: → A novel free-machining Cu-7.5Al-9.7Mn-3.4Zn-0.3Te (wt.%) shape memory alloy has been developed. → The size of dispersed particles with richer Te is 2-5 μm. → The CuAlMnZnTe alloy has good machinability which approached that of BZn15-24-1.5 due to the addition of Te. → Its shape memory property keeps the same as that of CuAlMnZn alloy with free Te. → The CuAlMnZn shape memory alloy with and without Te both have good ductile as annealed at 700 deg. C for 15 min. - Abstract: The microstructure transition, shape memory effect, machinability and mechanical property of the CuAlMnZn alloy with and without Te have been studied using X-ray diffraction analysis, chips observation and scanning electron microscopy (SEM), tensile strength test and differential scanning calorimeter (DSC), and semi-quantitative shape memory effect (SME) test. The particles with richer Te dispersedly distributed in grain interior and boundary with size of 2-5 μm. After the addition of Te, the CuAlMnZnTe alloy machinability has been effectively increased to approach that of BZn15-24-1.5 and its shape memory property remains the same as the one of CuAlMnZn alloy. The CuAlMnZn shape memory alloys with and without Te both have good ductility as annealed at 700 deg. C for 15 min.

  12. Determination of tellurium in lead and lead alloy using flow injection-hydride generation atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Mesko, Marcia F.; Pozebon, Dirce; Flores, Erico M.M.; Dressler, Valderi L.

    2004-01-01

    A method based on flow injection-hydride generation atomic absorption spectrometry (FI-HG AAS) for the determination of trace amount of Te in lead and lead alloy is described. A flow injection system (FI) and related analytical parameters as well as Te determination and interference caused by Pb, Bi and Ag on Te were investigated. The Pb interference could be overcome by using a small sample volume, while the Bi interference could be overcome by thiourea. However, it was not possible to minimise the interference caused by Ag on Te. The optimised conditions for Te determination in the analysed samples were: 6 mol l -1 HCl as sample carrier solution, 0.75% (m/v) sodium tetrahydroborate as Te reductant, 40 μl of sample solution, and 200 ml min -1 Ar flow rate as carrier gas. The limit of quantification (LOQ) was 1.0 μg g -1 Te (using 250 mg of sample in 50 ml final solution), the limit of detection (LOD) was 2.5 μg l -1 and the relative standard deviation (RSD) was 6% for five consecutive measurements of sample solution. The standard addition calibration method was used. Relatively high sample throughput (ca. 45 sample runs can be performed in a working hour), reduced sample manipulation since matrix separation is not necessary, and minor waste generation are the main advantages of the proposed method for Te determination by FI-HG AAS

  13. Production and characterization Te-peptide by induced autolysis of Saccharomyces cerevisiae.

    Science.gov (United States)

    Morya, V K; Dong, Shin Jae; Kim, Eun-ki

    2014-04-01

    Recently, the interest in mimicking functions of chalcogen-based catalytic antioxidants like selenoenzymes, has been increased. Various attempts had been done with selenium, but very few attempts were carried out with tellurium. Bio-complex formation and characterization of tellurium was not tried earlier by using any organism. The present study was focused on tellurium peptide production, characterization, and bioactivity assessment especially Mimetic to glutathione peroxidase (GPx). The production was achieved by the autolysis of total proteins obtained from Saccharomyces cerevisiae ATCC 7752 grown with inorganic tellurium. The GPx-like activity of the hydrolyzed tellurium peptide was increased when prepared by autolysis, but decreased when prepared by acid hydrolysis. Tellurium peptide produced by autolysis of the yeast cell showed increased GPx-like activity as well as tellurium content. Tellurium peptide showed little toxicity, compared to highly toxic inorganic tellurium. The results showed the potential of tellurium peptide as an antioxidant that can be produced by simple autolysis of yeast cells.

  14. 76 FR 19744 - Final Tropic to Hatch 138 kV Transmission Line Project Environmental Impact Statement and...

    Science.gov (United States)

    2011-04-08

    ... area currently designated as Primitive Zone in the Monument Management Plan, and (b) changing the... information--may be made publicly available at any time. While you can ask us in your protest to withhold your...

  15. 76 FR 56791 - Notice of Availability of Record of Decision for the Tropic To Hatch (Garkane) 138 kV...

    Science.gov (United States)

    2011-09-14

    ... zoning decision in the MMP from Primitive Zone to a 300-foot-wide Passage Zone to accommodate an existing... the time your appeal is being reviewed by the Interior Board of Appeals, the petition for a stay must...

  16. Association between gender inequality index and child mortality rates: a cross-national study of 138 countries

    OpenAIRE

    Brinda, Ethel Mary; Rajkumar, Anto P; Enemark, Ulrika

    2015-01-01

    BACKGROUND: Gender inequality weakens maternal health and harms children through many direct and indirect pathways. Allied biological disadvantage and psychosocial adversities challenge the survival of children of both genders. United Nations Development Programme (UNDP) has recently developed a Gender Inequality Index to measure the multidimensional nature of gender inequality. The global impact of Gender Inequality Index on the child mortality rates remains uncertain.METHODS: We employed an...

  17. TAN/LOFT 13.8 KV, 2.4 KV, and 480 V relay and circuit breaker coordination study

    International Nuclear Information System (INIS)

    Burnett, J.E.

    1977-01-01

    Present overcurrent relay settings are presented and evaluated for adequacy in terms of the updated short circuit analysis. Recommendations are made for new relay and trip device settings to improve coordination. Switchgear ratings are examined against available short circuit currents, and recommendations are made where applicable. Vital MCC-A and B are examined in detail to provide maximum continuity of service for every fault contingency. A recommendation is made to improve the reliability of these buses

  18. Assessment of the Jabiluka Project - Report of the Supervising Scientist to the World heritage Committee. Supervising Scientist report 138

    International Nuclear Information System (INIS)

    Johnston, A.; Prendergast, J.B.

    1999-01-01

    This report has been prepared in response to the request of the World Heritage Committee that the Supervising Scientist conduct a full review of scientific issues raised by the Committee's Mission to Kakadu National Park in October-November 1998. Perceived scientific uncertainty with respect to these issues had led to the Mission's conclusion that the natural values of Kakadu are threatened by the Jabiluka project. This detailed review has demonstrated that there were a number of weaknesses in the hydrological modelling presented by ERA in the EIS and the PER. Accordingly, a number of recommendations have been made which should be implemented by ERA in completing the detailed design of the Jabiluka project. On the other hand, the review has demonstrated quite clearly that, if the design of the water management system proposed by ERA in the PER had been implemented, the risk to the wetlands of Kakadu National Park, and the risk of radiation exposure to people of the region would have been extremely low. This conclusion is valid even in extreme circumstances leading to the complete failure of the structure of the water retention pond at Jabiluka. Copyright (2000) Commonwealth of Australia

  19. 40 CFR 49.138 - Rule for the registration of air pollution sources and the reporting of emissions.

    Science.gov (United States)

    2010-07-01

    ... equipment; (11) Agricultural activities and forestry and silvicultural activities, including agricultural... to the Regional Administrator must be verifiable using currently accepted engineering criteria. The... factors that are applicable to the source; (iv) Other engineering calculations; or (v) Other procedures to...

  20. Physician satisfaction with clinical laboratory services: a College of American Pathologists Q-probes study of 138 institutions.

    Science.gov (United States)

    Jones, Bruce A; Bekeris, Leonas G; Nakhleh, Raouf E; Walsh, Molly K; Valenstein, Paul N

    2009-01-01

    Monitoring customer satisfaction is a valuable component of a laboratory quality improvement program. To survey the level of physician satisfaction with hospital clinical laboratory services. Participating institutions provided demographic and practice information and survey results of physician satisfaction with defined aspects of clinical laboratory services, rated on a scale of 1 (poor) to 5 (excellent). One hundred thirty-eight institutions participated in this study and submitted a total of 4329 physician surveys. The overall satisfaction score for all institutions ranged from 2.9 to 5.0. The median overall score for all participants was 4.1 (10th percentile, 3.6; 90th percentile, 4.5). Physicians were most satisfied with the quality/reliability of results and staff courtesy, with median values of excellent or good ratings of 89.9%. Of the 5 service categories that received the lowest percentage values of excellent/good ratings (combined scores of 4 and 5), 4 were related to turnaround time for inpatient stat, outpatient stat, routine, and esoteric tests. Surveys from half of the participating laboratories reported that 96% to 100% of physicians would recommend the laboratory to other physicians. The category most frequently selected as the most important category of laboratory services was quality/reliability of results (31.7%). There continues to be a high level of physician satisfaction and loyalty with clinical laboratory services. Test turnaround times are persistent categories of dissatisfaction and present opportunities for improvement.