WorldWideScience

Sample records for tellurium 123

  1. Tellurium

    Science.gov (United States)

    Goldfarb, Richard J.; Berger, Byron R.; George, Micheal W.; Seal, Robert R.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.

    2017-12-19

    Tellurium (Te) is a very rare element that averages only 3 parts per billion in Earth’s upper crust. It shows a close association with gold and may be present in orebodies of most gold deposit types at levels of tens to hundreds of parts per million. In large-tonnage mineral deposits, such as porphyry copper and seafloor volcanogenic massive sulfide deposits, sulfide minerals may contain hundreds of parts per million tellurium, although the orebodies likely have overall concentrations of 0.1 to 1.0 parts per million tellurium. Tellurium is presently recovered as a primary ore from only two districts in the world; these are the gold-tellurium epithermal vein deposits located adjacent to one another at Dashuigou and Majiagou (Sichuan Province) in southwestern China, and the epithermal-like mineralization at the Kankberg deposit in the Skellefteå VMS district of Västerbotten County, Sweden. Combined, these two groups of deposits account for about 15 percent (about 70 metric tons) of the annual global production of between 450 and 470 metric tons of tellurium. Most of the world’s tellurium, however, is produced as a byproduct of the mining of porphyry copper deposits. These deposits typically yield concentrations of 1 to 4 percent tellurium in the anode slimes recovered during copper refining. Present production of tellurium from the United States is solely from the anode slimes at ASARCO LLC’s copper refinery in Amarillo, Texas, and may total about 50 metric tons per year. The main uses of tellurium are in photovoltaic solar cells and as an additive to copper, lead, and steel alloys in various types of machinery. The environmental data available regarding the mining of tellurium are limited; most concerns to date have focused on the more-abundant metals present in the large-tonnage deposits from which tellurium is recovered as a byproduct. Global reserves of tellurium are estimated to be 24,000 metric tons, based on the amount of tellurium likely contained in

  2. On the study of proton-irradiated Tellurium targets relevant for production of medical radioisotopes 123I and 124I

    International Nuclear Information System (INIS)

    Imam Kambali; Hari Suryanto; Daya Agung Sarwono; Cahyana Amiruddin

    2014-01-01

    The energy loss distribution and range of energetic proton beams in tellurium (Te) target have been simulated using the Stopping and Range of Ion in Matter (SRIM 2013) codes. The calculated data of the proton's range were then used to determine the optimum thickness of Te targets for future production of 123 I and 124 I from 123 Te(p,n) 123 I, 124 Te(p,n) 124 I and 124 Te(p,2n) 123 I nuclear reactions using the BATAN's Cs-30 cyclotron. It was found that for an incidence angle of 0° with respect to the target normal, the optimum thickness of 123 Te and 124 Te targets for 123 I production should be 644 µm and 1.8 mm respectively, whereas a 649 µm thick 124 Te target would be Required for 124 I production. In addition, the thickness should be decreased with increasing incidence angle. The EOB yield could theoretically reach up to 13.62 Ci of 123 I at proton energy of 22 Me V and beam current of 30 µA if the 124 Te is irradiated over a period of 3 hours. The theoretical EOB yield is comparable to the experimental data with accuracy within 10%. (author)

  3. Tellurium-123m-labeled isosteres of palmitoleic and oleic acids show high myocardial uptake

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Ambrose, K.R.; Callahan, A.P.; Grigsby, R.A.; Irgolic, K.J.

    1979-01-01

    These studies were directed at determining if the telluro fatty acids prepared by the isosteric replacement of the Δ 9 -double bonds of oleic and palmitoleic acids with /sup 123m/Te would show heart uptake in rats. The isostere of palmitoleic acid, 9-tellurapentadecanoic acid(II), was prepared by basic hydrolysis of the product formed by the coupling of /sup 123m/Te-sodium hexyl tellurol with methyl-8-bromooctadecanoate. Similarly, the isostere of oleic acid, 9-telluraheptadecanoic acid(IV), was prepared by the same route beginning with the reaction of /sup 123m/Te-sodium octyl tellurol with methyl-8-bromooctadecanoate. Both /sup 123m/Te-(II) and /sup 123m/Te-(IV) showed remarkably high heart uptake in rats (2 to 3% dose/gm) ten minutes after intravenous administration, and the heart/blood ratios were high (20-30/1). Finally, the hearts of rats injected with /sup 123m/Te-(IV) have been clearly imaged with a rectilinear scanner

  4. Selenium and tellurium as carbon substitutes

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.

    1980-01-01

    This review has summarized structure-activity studies with 75 Se- and /sup 123m/Te-labeled radiopharmaceuticals in which the selenium or tellurium heteroatom has been inserted between carbon-carbon bonds. The agents that have been investigated in most detail include steroids for adrenal imaging and long-chain fatty acids, and a variety of other unique agents have also been studied. Because of the great versatility of the organic chemistry of selenium and tellurium, there is continuing interest in the preparation of radiopharmaceuticals labeled with 75 Se, 73 Se, and /sup 123m/Te. There are two important factors which will determine the extent of future interest in such agents. These include the necessity of a decrease in the cost of highly enriched 122 Te to make the reactor production of /sup 123m/Te cost effective. In addition, the potential preparation of large amounts of 73 Se should stimulate the development of 73 Se-labeled radiopharmaceuticals

  5. Simple and effective method for nuclear tellurium isomers separation from antimony cyclotron targets

    International Nuclear Information System (INIS)

    Bondarevskij, S.I.; Eremin, V.V.

    1999-01-01

    Simple and effective method of generation of tellurium nuclear isomers from irradiated on cyclotron metallic antimony is suggested. Basically this method consists in consideration of the big difference in volatilities of metallic forms of antimony, tin and tellurium. Heating of the tin-antimony alloy at 1200 K permits to separate about 90 % of produced quantity of 121m Te and 123m Te (in this case impurity of antimony radionuclides is not more than 1 % on activity) [ru

  6. Extractive separation of tellurium(4)

    International Nuclear Information System (INIS)

    Gawali, S.B.; Shinde, V.M.

    1977-01-01

    A method is described for the extraction of tellurium (4) from hydrobromic acid media using 4-methyl-2-pentanol as an extractant. The method affords the determination of tellurium after its separation from Se, Au, Cu, Pb, Fe, Os, V and Al. (author)

  7. Thermodynamic behaviour of tellurium at high temperatures

    International Nuclear Information System (INIS)

    Garisto, F.

    1992-09-01

    Thermodynamic calculations are used to determine the chemical speciation of tellurium in the primary heat transport system under postulated reactor accident conditions. The speciation of tellurium is determined for various values of the temperature, oxygen partial pressure, tellurium concentration and Cs/Te ratio. The effects of the Zircaloy cladding and/or cesium on tellurium speciation and volatility are of particular interest in this report. (Author) (37 refs., 14 figs., 4 tabs.)

  8. Selenium and tellurium nanomaterials

    Science.gov (United States)

    Piacenza, Elena; Presentato, Alessandro; Zonaro, Emanuele; Lampis, Silvia; Vallini, Giovanni; Turner, Raymond J.

    2018-04-01

    Over the last 40 years, the rapid and exponential growth of nanotechnology led to the development of various synthesis methodologies to generate nanomaterials different in size, shape and composition to be applied in various fields. In particular, nanostructures composed of Selenium (Se) or Tellurium (Te) have attracted increasing interest, due to their intermediate nature between metallic and non-metallic elements, being defined as metalloids. Indeed, this key shared feature of Se and Te allows us the use of their compounds in a variety of applications fields, such as for manufacturing photocells, photographic exposure meters, piezoelectric devices, and thermoelectric materials, to name a few. Considering also that the chemical-physical properties of elements result to be much more emphasized when they are assembled at the nanoscale range, huge efforts have been made to develop highly effective synthesis methods to generate Se- or Te-nanomaterials. In this context, the present book chapter will explore the most used chemical and/or physical methods exploited to generate different morphologies of metalloid-nanostructures, focusing also the attention on the major advantages, drawbacks as well as the safety related to these synthetic procedures.

  9. Reaction of tellurium with Zircaloy-4

    International Nuclear Information System (INIS)

    Boer, R. de; Cordfunke, E.H.P.

    1994-09-01

    Interaction of tellurium vapour with Zircaloy during the initial stage of an accident will lead to retention of tellurium in the core. For reliable estimation of the release behaviour of tellurium, it is necessary to know which zirconium tellurides are formed during this interaction. In this work the reaction of tellurium with Zircaloy-4 has been studied, using various reaction temperatures and tellurium vapour pressures. The compound ZrTe 2-x is formed on the surface of the Zircaloy in a broad range of reaction temperatures and vapour pressures. It is found that the formation of the more zirconium-rich compound Zr 5 Te 4 is favoured at high reaction temperatures is combination with low tellurium vapour pressures. (orig.)

  10. On the resistivity of metal-tellurium alloys for low concentrations of tellurium

    International Nuclear Information System (INIS)

    Gorecki, J.

    1982-04-01

    The resistivity and thermoelectric power of metal-tellurium liquid alloys have been discussed for the case of small tellurium concentration. Nearly free electron model of conduction band has been used. The rapid increase of resistivity in transition metal-tellurium alloys has been predicted. (author)

  11. Sulfur, selenium, tellurium and polonium

    International Nuclear Information System (INIS)

    Berry, F.J.

    1987-01-01

    This chapter on the coordination compounds of sulfur, selenium, tellurium and polonium starts with an introduction to the bonding, valence and geometry of the elements. Complexes of the group VIB elements are discussed with particular reference to the halo and pseudohalide complexes, oxo acid complexes, oxygen and nitrogen donor complexes and sulfur and selenium donor complexes. There is a section on the biological properties of the complexes discussed. (UK)

  12. Electrowinning Of Tellurium From Acidic Solutions

    Directory of Open Access Journals (Sweden)

    Kowalik R.

    2015-06-01

    Full Text Available The process of electrochemical deposition of tellurium was studied. Preliminary researches embrace the voltammetry and microgravimetric measurements. According to the results the electrolysis of tellurium was conducted under potentiostatic conditions. There was no deposition of tellurium above potential −0.1 vs. Ag/AgCl electrode in 25°C. The process of deposition is observed in the range of potentials −0.1 to −0.3 V vs. Ag/AgCl. The presence of tellurium was confirmed by XRF and XRD. The obtained deposits were homogenous and compact. Below potential −0.3 V vs. Ag/AgCl the Faradaic efficiency of the tellurium deposition decreased due to reduction of Te to H2Te and hydrogen evolution.

  13. New radiohalogenated alkenyl tellurium fatty acids

    International Nuclear Information System (INIS)

    Srivastava, P.C.; Knapp, F.F. Jr.; Kabalka, G.W.

    1987-01-01

    Radiolabeled long-chain fatty acids have diagnostic value as radiopharmaceutical tools in myocardial imaging. Some applications of these fatty acids are limited due to their natural metabolic degradation in vivo with subsequent washout of the radioactivity from the myocardium. The identification of structural features that will increase the myocardial residence time without decreasing the heart uptake of long-chain fatty acids is of interest. Fatty acids containing the tellurium heteroatom were the first modified fatty acids developed that show unique prolonged myocardial retention and low blood levels. Our detailed studies with radioiodinated vinyliodide substituted tellurium fatty acids demonstrate that heart uptake is a function of the tellurium position. New techniques of tellurium and organoborane chemistry have been developed for the synthesis of a variety of radioiodinated iodoalkenyl tellurium fatty acids. 9 refs., 3 figs., 2 tabs

  14. Tellurium self-diffusion and point defects in lead telluride

    International Nuclear Information System (INIS)

    Simirskij, Yu.N.; Firsova, L.P.

    1982-01-01

    Method of radioactive indicators was used to determine factors of tellurium self-diffusion in lead telluride with different deviation of the composition from stoichiometric in the range of enrichment by tellurium. It was found that at 973 K factors of tellurium self-diffusion in lead telluride depend slightly on the vapor pressure of tellurium equilibrium with solid phase

  15. Tellurium: providing a bright future for solar energy

    Science.gov (United States)

    Goldfarb, Richard J.

    2015-01-01

    Tellurium is one of the least common elements on Earth. Most rocks contain an average of about 3 parts per billion tellurium, making it rarer than the rare earth elements and eight times less abundant than gold. Grains of native tellurium appear in rocks as a brittle, silvery-white material, but tellurium more commonly occurs in telluride minerals that include varied quantities of gold, silver, or platinum. Tellurium is a metalloid, meaning it possesses the properties of both metals and nonmetals.

  16. Tellurium in active volcanic environments: Preliminary results

    Science.gov (United States)

    Milazzo, Silvia; Calabrese, Sergio; D'Alessandro, Walter; Brusca, Lorenzo; Bellomo, Sergio; Parello, Francesco

    2014-05-01

    Tellurium is a toxic metalloid and, according to the Goldschmidt classification, a chalcophile element. In the last years its commercial importance has considerably increased because of its wide use in solar cells, thermoelectric and electronic devices of the last generation. Despite such large use, scientific knowledge about volcanogenic tellurium is very poor. Few previous authors report result of tellurium concentrations in volcanic plume, among with other trace metals. They recognize this element as volatile, concluding that volcanic gases and sulfur deposits are usually enriched with tellurium. Here, we present some results on tellurium concentrations in volcanic emissions (plume, fumaroles, ash leachates) and in environmental matrices (soils and plants) affected by volcanic emissions and/or deposition. Samples were collected at Etna and Vulcano (Italy), Turrialba (Costa Rica), Miyakejima, Aso, Asama (Japan), Mutnovsky (Kamchatka) at the crater rims by using common filtration techniques for aerosols (polytetrafluoroethylene filters). Filters were both eluted with Millipore water and acid microwave digested, and analyzed by inductively coupled plasma mass spectrometry (ICP-MS). Volcanic ashes emitted during explosive events on Etna and Copahue (Argentina) were analyzed for tellurium bulk composition and after leaching experiments to evaluate the soluble fraction of tellurium. Soils and leaves of vegetation were also sampled close to active volcanic vents (Etna, Vulcano, Nisyros, Nyiragongo, Turrialba, Gorely and Masaya) and investigated for tellurium contents. Preliminary results showed very high enrichments of tellurium in volcanic emissions comparing with other volatile elements like mercury, arsenic, thallium and bismuth. This suggests a primary transport in the volatile phase, probably in gaseous form (as also suggested by recent studies) and/or as soluble salts (halides and/or sulfates) adsorbed on the surface of particulate particles and ashes. First

  17. Selenium and tellurium reagents in organic synthesis

    International Nuclear Information System (INIS)

    Comasseto, J.V.

    1984-01-01

    A review of the contribution of the University of Sao Paulo (SP, Brazil) to the organic synthesis of selenium and tellurium reagents is made. Major reactions amoung selenium compounds and insaturated substrates, phosphorus, ester enolates as well as the use of phase transference catalysed reactions to produce arylselenolate are described. For tellurium, interactions of its compounds with organic substrates and reactive intermediates (e.g. benzino diazomethane) are reported. (C.L.B.) [pt

  18. Tellurium chemistry, tellurium release and deposition during the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Sallach, R.A.; Osetek, D.J.; Hobbins, R.R.; Akers, D.W.

    1985-08-01

    This report presents the chemistry and estimated behavior of tellurium during and after the accident at Three Mile Island Unit-2. The discussion of tellurium behavior is based on all available measurement data for /sup 129 m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te, and 130 Te), and best estimate calculations of tellurium release and transport. Results from Oak Ridge National Laboratory (ORNL) tests, Power Burst Facility (PBF) Severe Fuel Damage Tests at Idaho National Engineering Laboratory (INEL) and SASCHA tests from Karlsruhe, W. Germany are compared with calculated release fractions and samples taken from TMI Unit-2. It is concluded that very little tellurium was released and transported from the TMI-2 core, probably as a result of holdup by zircaloy cladding and other structural materials. 39 refs., 24 figs., 17 tabs

  19. Tellurium chemistry, tellurium release and deposition during the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Sallach, R.A.; Osetek, D.J.; Hobbins, R.R.; Akers, D.W.

    1985-01-01

    This paper presents the chemistry and estimated behavior of tellurium during and after the accident at Three Mile Island Unit-2. The discussion of tellurium behavior is based on all available measurement data for /sup 129m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te, and 130 Te), and best estimate calculations of tellurium release and transport. Results from Oak Ridge National Laboratory (ORNL) tests, Power Burst Facility (PBF) Severe Fuel Damage Tests at Idaho National Engineering Laboratory (INEL) and SASCHA tests from Karlsruhe, W. Germany are compared with calculated release fractions and samples taken from TMI Unit-2. It is concluded that very little tellurium was released and transported from the TMI-2 core, probably as a result of holdup by zircaloy cladding and other structural materials. 37 refs., 12 figs., 4 tabs

  20. Iodine-123 program at the TRIUMF laboratory

    International Nuclear Information System (INIS)

    Vincent, J.S.

    1985-01-01

    A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

  1. Selenium Se and tellurium Te

    International Nuclear Information System (INIS)

    Busev, A.I.; Tiptsova, V.G.; Ivanov, V.M.

    1978-01-01

    The basic methods for determining selenium and tellurium in various objects are presented. The bichromatometric determination of Te in cadmium, zinc and mercury tellurides is based on oxidation of Te(4) to (6) in H 2 SO 4 with potassium bichromate. In steels, Te is determined photometrically with the aid of KI. The determination is hindered by Fe(3), Cu(2), Bi(3) and Se(4) ions, which must be separated. The extraction-photometric determination of Te in native sulfur is carried out with the aid of 5-mercapto-3-(naphthyl-2)-1,3,4-thiadiazolthione-2 (pH=4.8-5.0). The dyed complex is readily extracted with chloroform and benzene. The spectrophotometric determination of Te in selenium is performed with the aid of 3,5-diphenylpyrazoline-1-dithiocarbamate of sodium. Te is determined in commercial indium, arsenic and their semiconductor compounds photometrically with the aid of copper diethyldithiocarbamate. The method permits determining 5x10 -5 % Te in a weighed amount of 0.5 g. The chloride complex of Te(4) with diantipyriodolpropylmethane is quantitatively extracted with dichloroethane from hydrochloric acid solutions. Thus, any amounts of Te can be separated from Se and determined photometrically. The extraction-photometric determination of Te in commercial lead and bismuth is carried out with the aid of pyrazolone derivatives, in commercial copper with the aid of diantipyridolpropylmethane, and in ores (more than 0.01% Te) with the aid of bismuthol 2. Also described is the extraction-polarographic determination of Te in sulfide ores

  2. Facile electrochemical synthesis of tellurium nanorods and their photoconductive properties

    Energy Technology Data Exchange (ETDEWEB)

    Li, H.H. [Center for Photon Manufacturing Science and Technology, School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); Zhang, P. [Dongguan University of Technology, Dongguan-523808 (China); School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou - 510275 (China); Liang, C.L. [Instrumental Analysis and Research Center, SunYat-sen University, Guangzhou - 510275 (China); Yang, J. [School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); Zhou, M. [Center for Photon Manufacturing Science and Technology, School of Materials Science and Engineering, Jiangsu University, Zhenjiang - 212013 (China); The State Key Laboratory of Tribology, Tsinghua University, Beijing - 10084 (China); Lu, X.H. [School of Chemistry and Chemical Engineering, Sun Yat-sen University, Guangzhou - 510275 (China); Hope, G.A. [School of Biomolecular and Physical Sciences, Griffith University, Nathan - Qld 4111 (Australia)

    2012-10-15

    Tellurium nanorods have been successfully fabricated by template and surfactant-free electrochemical technique from an aqueous solution at room temperature. The as-prepared tellurium nanorods were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), Raman spectrometry, UV-vis spectroscopy and photoluminescence spectroscopy. Films based on tellurium nanorods were constructed to study the photoresponse and I-V curves. These photoresponse measurements demonstrate that tellurium nanorods exhibited enhanced conductivity under illumination compared to in the dark measurement. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  3. The mineralogical characterization of tellurium in copper anodes

    Science.gov (United States)

    Chen, T. T.; Dutrizac, J. E.

    1993-12-01

    A mineralogical study of a «normal» commercial copper anode and six tellurium-rich copper anodes from the CCR Refinery of the Noranda Copper Smelting and Refining Company was carried out to identify the tellurium carriers and their relative abundances. In all the anodes, the major tellurium carrier is the Cu2Se-Cu2Te phase which occurs as a constituent of complex inclusions at the copper grain boundaries. In tellurium-rich anodes, the molar tellurium content of the Cu2Se-Cu2Te phase can exceed that of selenium. Although >85 pct of the tellurium occurs as the Cu2Se-Cu2Te phase, minor amounts are present in Cu-Pb-As-Bi-Sb oxide, Cu-Bi-As oxide, and Cu-Te-As oxide phases which form part of the grain-boundary inclusions. About 1 pct of the tellurium content of silver-rich anodes occurs in various silver alloys, but gold tellurides were never detected. Surprising is the fact that 2 to 8 pct of the total tellurium content of the anodes occurs in solid solution in the copper-metal matrix, and presumably, this form of tellurium dissolves at the anode interface during electrorefining.

  4. Comparison between selenium and tellurium clusters

    International Nuclear Information System (INIS)

    Benamar, A.; Rayane, D.; Tribollet, B.; Broyer, M.; Melinon, P.

    1991-01-01

    Selenium and tellurium clusters are produced by the inert gas condensation technique. The mass spectra of both species are completely different and reveal different properties. In selenium, a periodicity of 6-7 is observed and may be interpreted by the binding energy between small cyclic molecules. Moreover, it was very difficult to obtained large clusters probably because the binding energy between these molecules is very small. In tellurium, these periodic structures do not exist and large clusters are easily obtained in nucleation conditions where only small selenium clusters are present. These results are discussed and a simple nucleation model is used to illustrate this different behavior. Finally these clusters properties are correlated to the bulk structure of both materials. (orig.)

  5. Neutron activation analysis of high purity tellurium

    International Nuclear Information System (INIS)

    Gil'bert, Eh.N.; Verevkin, G.V.; Obrazovskij, E.G.; Shatskaya, S.S.

    1980-01-01

    A scheme of neutron activation analysis of high purity tellurium is developed. Weighed amount of Te (0.5 g) is irradiated for 20-40 hr in the flux of 2x10 13 neutron/(cm 2 xs). After decomposition of the sample impurities of gold and palladium are determined by the extraction with organic sulphides. Tellurium separation from the remaining impurities is carried out by the extraction with monothiobenzoic acid from weakly acidic HCl solutions in the presence of iodide-ions, suppressing silver extraction. Remaining impurity elements in the refined product are determined γ-spectrometrically. The method allows to determine 34 impurities with determination limits 10 -6 -10 -11 g

  6. Interaction of tellurium and tellurium-containing semiconductor compounds with solutions of HI-HNO3-H2O system

    International Nuclear Information System (INIS)

    Tomashik, V.N.; Sava, A.A.; Tomashik, Z.F.

    1994-01-01

    As a result of experimental investigations and physical-chemical simulation are established regularities of solution of semiconducting tellurium-containing compounds in HI-HNO 3 -H 2 O systems. In HNO 3 -HI system solutions enriched by HNO 3 are not used for CdTe treatment but HI enriched solution are similar in composition with I 2 -HI solutions. Solution of the given tellurium-containing materials proceeds by a chemical mechanism and is determined by tellurium oxidation with iodine

  7. Copper Tellurium Oxides - A Playground for Magnetism.

    Energy Technology Data Exchange (ETDEWEB)

    Norman, M. R.

    2018-04-15

    A variety of copper tellurium oxide minerals are known, and many of them exhibit either unusual forms of magnetism, or potentially novel spin liquid behavior. Here, I review a number of the more interesting materials with a focus on their crystalline symmetry and, if known, the nature of their magnetism. Many of these exist (so far) in mineral form only, and most have yet to have their magnetic properties studied. This means a largely unexplored space of materials awaits our exploration.

  8. Tellurium labeled analogues of the fatty acid hexadecenoic acid for imaging of myocardial tissue

    International Nuclear Information System (INIS)

    Mills, S.L.

    1980-01-01

    Non-invasive nuclear diagnostic procedures for the evaluation of acute myocardial infarction and ischemia are currently limited by problems associated with the availablity of radiopharmaceuticals, development of imaging equipment, and inherent characteristics of radionuclides. Myocardial tissue requires high levels of substrates which provide energy for the continuous functioning of this vital organ. Of the major sources of energy, the most utilized source is fatty acids. Tellurium-123m, with excellent gamma imaging characteristics was chosen as the radionuclide. A 16 carbon fatty acid, hexadecenoic acid, was chosen as the carrier molecule. The tellurium-123m fatty acid radiopharmaceuticals were formulated either in a solution of 20 percent ethanol, two percent polysorbate 80, and brought to volume with normal saline or in 12.5 percent human serum ablumin and brought to volume with normal saline. Biodistribution was performed in three animal species: Sprague-Dawley rats (three rats per time frame), Australian white rabbits (three rabbits per time frame), and mongrel dogs (one dog per time frame). Dosimetry calculations were performed to assess the radiation dose

  9. Tellurium release and deposition during the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Osetek, D.J.; Hobbins, R.R.; Jessup, J.S.

    1984-09-01

    The estimated behavior of tellurium during and after the accident at the Three Mile Island Unit-2 is presented. The behavior is based on all available measurement data for /sup 129m/Te, 132 Te, stable tellurium ( 126 Te, 128 Te and 130 Te), and best estimate calculations of tellurium release and transport. The predicted release was calculated using current techniques that relate release rate to fuel temperature and holdup of tellurium in zircaloy until significant oxidation occurs. The calculated release fraction was low, approx. 7%, but the total measured release for samples analyzed to date is about 5.8%. Of the measured tellurium about 2.4, 1.8, 0.88, 0.42, 0.17 and 0.086% of core inventory were in the containment sump water, upper plenum assembly surfaces, containment solids in the sump water, makeup and purification demineralizer, containment inside surface, and the reactor primary coolant, respectively. A significant fraction (54%) of the tellurium calculated to be retained on the upper plenum surfaces (4.61% of the core inventory) was deposited during the high pressure injection of coolant at about 200 min after the reactor scram. Comparison of tellurium behavior with in-pile and out-of-pile tests strongly suggests that zircaloy holds tellurium until significant cladding oxidation occurs

  10. Tellurium behavior during and after the TMI-2 accident

    International Nuclear Information System (INIS)

    Vinjamuri, K.; Osetek, D.J.; Hobbins, R.R.

    1984-01-01

    The estimated behavior of tellurium during and after the accident at the Three Mile Island Unit-2 is presented. The behavior is based on all available measurement data for /sup 129m/Te, 132 Te and stable tellurium ( 126 Te, 128 Te and 130 Te), and best estimate calculations of tellurium release and transport. The predicted release was calculated using current techniques that relate release rate to fuel temperature and holdup of tellurium in zircaloy until significant oxidation occurs. The calculated release fraction was low, approximately 7%, but the total measured release for samples analyzed to date is about 4.0%. Of the measured tellurium about 2.4, 0.88, 0.42, 0.17 and 0.086% of core inventory were in the containment sump water, containment solids in water, makeup and purification demineralizer, containment inside surface, and the reactor primary coolant, respectively. A significant fraction (54%) of the calculated tellurium retained on the upper plenum surfaces (4.61% of the core inventory) was deposited during the high pressure injection of coolant at about 200 minutes after the reactor scram. Comparison of tellurium behavior with inpile and out-of-pile tests strongly suggests that zircaloy holds tellurium until significant cladding oxidation occurs

  11. Rapid radiochemical ion-exchange separation of iodine from tellurium: a novel radioiodine-132 generator

    Energy Technology Data Exchange (ETDEWEB)

    Abrao, A

    1975-01-01

    Tellurium ions form a soluble cationic complex with thiourea in acid medium. The cationic tellurium-thiourea species is strongly absorbed on a cationic ion exchanger. The retention of tellurium on the resin enables many interesting separation schemes for tellurium from various ions. With special interest, the separation of iodine from tellurium was studied. An efficient and convenient iodine-132 generator is described, in which the radio-iodine is eluted with water or 9 g/1 NaCl, when desired.

  12. A rapid radiochemical ion-exchange separation of iodine from tellurium: a novel radioiodine-132 generator

    International Nuclear Information System (INIS)

    Abrao, A.

    1975-01-01

    Tellurium ions form a soluble cationic complex with thiourea in acid medium. The cationic tellurium-thiourea species is strongly absorbed on a cationic ion exchanger. The retention of tellurium on the resin enables many interesting separation schemes for tellurium from various ions. With special interest, the separation of iodine from tellurium was studied. An efficient and convenient iodine-132 generator is described, in which the radio-iodine is eluted with water or 9 g/1 NaCL, when desired

  13. Analysis of tellurium thin films electrodeposition from acidic citric bath

    Energy Technology Data Exchange (ETDEWEB)

    Kowalik, Remigiusz; Kutyła, Dawid [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, al. A. Mickiewicza 30, 30-059 Krakow (Poland); Mech, Krzysztof [AGH University of Science and Technology, Academic Centre for Materials and Nanotechnology, al. A. Mickiewicza 30, Krakow (Poland); Żabiński, Piotr, E-mail: rkowalik@agh.edu.pl [AGH University of Science and Technology, Faculty of Non-Ferrous Metals, al. A. Mickiewicza 30, 30-059 Krakow (Poland)

    2016-12-01

    This work presents the description of the electrochemical process of formation thin tellurium layers from citrate acidic solution. The suggested methodology consists in the preparation of stable acidic baths with high content of tellurium, and with the addition of citrate acid. In order to analyse the mechanism of the process of tellurium deposition, the electroanalytical tests were conducted. The tests of cyclic voltammetry and hydrodynamic ones were performed with the use of polycrystalline gold disk electrode. The range of potentials in which deposition of tellurium in direct four-electron process is possible was determined as well as the reduction of deposited Te° to Te{sup 2−} and its re-deposition as a result of the comproportionation reaction. On the basis of the obtained results, the deposition of tellurium was conducted by the potentiostatic method. The influence of a deposition potential and a concentration of TeO{sub 2} in the solution on the rate of tellurium coatings deposition was examined. The presence of tellurium was confirmed by X-ray spectrofluorometry and electron probe microanalysis. In order to determine the phase composition and the morphology, the obtained coatings were analysed with the use of x-ray diffraction and scanning electron microscopy.

  14. Double beta decay of tellurium-130

    International Nuclear Information System (INIS)

    Richardson, J.F.; Manuel, O.K.; Sinha, B.; Thorpe, R.I.

    1986-01-01

    The isotopic composition of xenon is reported in four, neutron-irradiated tellurium minerals - tellurobismuthite from Boliden, Sweden, native tellurium from the Good Hope Mine of Gunnison County, Colorado, altaite from the Kirkland Lake area, Ontario, and altaite from the Mattagami Lake area, Quebec. From the amount of radiogenic 130 Xe and pile-produced 131 Xe in these samples, it is concluded that the half-life of 130 Te for ββ-decay is 21 y based on measured values of (1.0+-0.3) . 10 21 y and higher. Our results demonstrate that there has been no significant partial leakage of radiogenic 130 Xe from these minerals over geologic time. Larger values of Tsub(1/2), as indicated from some of the analysis reported here and in other studies, are attributed to recrystallization of the soft telluride minerals and complete resetting of the Te-Xe system after mineralization. The value obtained here for the half-life of 130 Te is substantiated by recent measurements on xenon in tellurides from Kalgoorlie, Western Australia. (orig.)

  15. Inclusion free cadmium zinc tellurium and cadmium tellurium crystals and associated growth method

    Science.gov (United States)

    Bolotnikov, Aleskey E [South Setauket, NY; James, Ralph B [Ridge, NY

    2010-07-20

    The present disclosure provides systems and methods for crystal growth of cadmium zinc tellurium (CZT) and cadmium tellurium (CdTe) crystals with an inverted growth reactor chamber. The inverted growth reactor chamber enables growth of single, large, high purity CZT and CdTe crystals that can be used, for example, in X-ray and gamma detection, substrates for infrared detectors, or the like. The inverted growth reactor chamber enables reductions in the presence of Te inclusions, which are recognized as an important limiting factor in using CZT or CdTe as radiation detectors. The inverted growth reactor chamber can be utilized with existing crystal growth techniques such as the Bridgman crystal growth mechanism and the like. In an exemplary embodiment, the inverted growth reactor chamber is a U-shaped ampoule.

  16. Peroxide coordination of tellurium in aqueous solutions

    Energy Technology Data Exchange (ETDEWEB)

    Mikhaylov, Alexey A.; Medvedev, Alexander G. [Kurnakov Institute of General and Inorganic Chemistry, Russian Academy of Sciences, Moscow (Russian Federation); The Casali Center of Applied Chemistry, The Institute of Chemistry, The Hebrew University of Jerusalem (Israel); Churakov, Andrei V.; Grishanov, Dmitry A.; Prikhodchenko, Petr V. [Kurnakov Institute of General and Inorganic Chemistry, Russian Academy of Sciences, Moscow (Russian Federation); Lev, Ovadia [The Casali Center of Applied Chemistry, The Institute of Chemistry, The Hebrew University of Jerusalem (Israel)

    2016-02-15

    Tellurium-peroxo complexes in aqueous solutions have never been reported. In this work, ammonium peroxotellurates (NH{sub 4}){sub 4}Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 4}(OH){sub 2} (1) and (NH{sub 4}){sub 5}Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 5}(OH).1.28 H{sub 2}O.0.72 H{sub 2}O{sub 2} (2) were isolated from 5 % hydrogen peroxide aqueous solutions of ammonium tellurate and characterized by single-crystal and powder X-ray diffraction analysis, by Raman spectroscopy and thermal analysis. The crystal structure of 1 comprises ammonium cations and a symmetric binuclear peroxotellurate anion [Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 4}(OH){sub 2}]{sup 4-}. The structure of 2 consists of an unsymmetrical [Te{sub 2}(μ-OO){sub 2}(μ-O)O{sub 5}(OH)]{sup 5-} anion, ammonium cations, hydrogen peroxide, and water. Peroxotellurate anions in both 1 and 2 contain a binuclear Te{sub 2}(μ-OO){sub 2}(μ-O) fragment with one μ-oxo- and two μ-peroxo bridging groups. {sup 125}Te NMR spectroscopic analysis shows that the peroxo bridged bitellurate anions are the dominant species in solution, with 3-40 %wt H{sub 2}O{sub 2} and for pH values above 9. DFT calculations of the peroxotellurate anion confirm its higher thermodynamic stability compared with those of the oxotellurate analogues. This is the first direct evidence for tellurium-peroxide coordination in any aqueous system and the first report of inorganic tellurium-peroxo complexes. General features common to all reported p-block element peroxides could be discerned by the characterization of aqueous and crystalline peroxotellurates. (copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  17. Structure and activity of tellurium-cerium oxide acrylonitrile catalysts

    International Nuclear Information System (INIS)

    Bart, J.C.J.; Giordano, N.

    1982-01-01

    Ammoxidation of propylene to acrylonitrile (ACN) was investigated over various silica-supported (Te,Ce)O catalysts at 360 and 440 0 C. The binary oxide system used consists of a single nonstoichiometric fluorite-type phase α-(Ce,Te)O 2 up to about 80 mole% TeO 2 and a tellurium-saturated solid solution β-(Ce,Te)O 2 at higher tellurium concentrations. The ACN yield varies almost linearly with the tellurium content of (Ce,Te)O 2 . The β-(Ce,Te)O 2 phase is the most active component of the system (propylene conversion and ACN selectivity at 440 C of 76.7 and 74%, respectively) and is slightly more selective to ACN than α-Te0 2 . Tellurium reduces the overoxidation properties of cerium and selective oxidation occurs through Te(IV)-bonded oxygen

  18. Selenium- or tellurium- containing bile acids and derivatives thereof

    International Nuclear Information System (INIS)

    Monks, R.; Riley, A.L.M.

    1981-01-01

    This invention relates to the preparation of selenium and tellurium derivatives, particularly γ-emitting radioactive derivatives of bile acids and bile salts. Such compounds are valuable in the examination of body function, especially small bowel function. (author)

  19. Study of distribution coefficients of admixtures in tellurium

    International Nuclear Information System (INIS)

    Kuchar, L.; Drapala, J.; Kuchar, L. jr.

    1986-01-01

    Limit areas of tellurium-admixture binary systems were studied and the values determined of steady-state distribution coefficients of admixtures. A second order polynomial was used to express equations of solidus and liquidus curves for Te-Se, Te-S, Te-Hg systems; the curves are graphically represented. The most effective method for preparing high-purity tellurium is zonal melting with material removal. (M.D.). 4 figs., 4 tabs., 16 refs

  20. Thermal neutron capture cross sections of tellurium isotopes

    International Nuclear Information System (INIS)

    Tomandl, I.; Honzatko, J.; Egidy, T. von; Wirth, H.-F.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Zs.; Molnar, G.L.; Firestone, R.B.; Bondarenko, V.

    2003-01-01

    New values for thermal neutron capture cross sections of the tellurium isotopes 122 Te, 124 Te, 125 Te, 126 Te, 128 Te, and 130 Te are reported. These values are based on a combination of newly determined partial γ-ray cross sections obtained from experiments on targets contained natural Te and γ intensities per capture of individual Te isotopes. Isomeric ratios for the thermal neutron capture on the even tellurium isotopes are also given

  1. Thermal neutron capture cross sections of tellurium isotopes

    International Nuclear Information System (INIS)

    Tomandl, I.; Honzatko, J.; Egidy, T. von; Wirth, H.-F.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Zs.; Molnar, G.L.; Firestone, R.B.; Bondarenko, V.

    2004-01-01

    New values for thermal neutron capture cross sections of the tellurium isotopes 122Te, 124Te, 125Te, 126Te, 128Te, and 130Te are reported. These values are based on a combination of newly determined partial g-ray cross sections obtained from experiments on targets contained natural Te and gamma intensities per capture of individual Te isotopes. Isomeric ratios for the thermal neutron capture on the even tellurium isotopes are also given

  2. Thermal neutron capture cross sections of tellurium isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Tomandl, I.; Honzatko, J.; von Egidy, T.; Wirth, H.-F.; Belgya, T.; Lakatos, M.; Szentmiklosi, L.; Revay, Zs.; Molnar, G.L.; Firestone, R.B.; Bondarenko, V.

    2004-03-01

    New values for thermal neutron capture cross sections of the tellurium isotopes 122Te, 124Te, 125Te, 126Te, 128Te, and 130Te are reported. These values are based on a combination of newly determined partial g-ray cross sections obtained from experiments on targets contained natural Te and gamma intensities per capture of individual Te isotopes. Isomeric ratios for the thermal neutron capture on the even tellurium isotopes are also given.

  3. Tellurium quantum dots: Preparation and optical properties

    Science.gov (United States)

    Lu, Chaoyu; Li, Xueming; Tang, Libin; Lai, Sin Ki; Rogée, Lukas; Teng, Kar Seng; Qian, Fuli; Zhou, Liangliang; Lau, Shu Ping

    2017-08-01

    Herein, we report an effective and simple method for producing Tellurium Quantum dots (TeQDs), zero-dimensional nanomaterials with great prospects for biomedical applications. Their preparation is based on the ultrasonic exfoliation of Te powder dispersed in 1-methyl-2-pyrrolidone. Sonication causes the van der Waals forces between the structural hexagons of Te to break so that the relatively coarse powder breaks down into nanoscale particles. The TeQDs have an average size of about 4 nm. UV-Vis absorption spectra of the TeQDs showed an absorption peak at 288 nm. Photoluminescence excitation (PLE) and photoluminescence (PL) are used to study the optical properties of TeQDs. Both the PLE and PL peaks revealed a linear relationship against the emission and excitation energies, respectively. TeQDs have important potential applications in biological imaging and catalysis as well as optoelectronics.

  4. Quantitative analysis of tellurium in simple substance sulfur

    International Nuclear Information System (INIS)

    Arikawa, Yoshiko

    1976-01-01

    The MIBK extraction-bismuthiol-2 absorptiometric method for the quantitative analysis of tellurium was studied. The method and its limitation were compared with the atomic absorption method. The period of time required to boil the solution in order to decompose excess hydrogen peroxide and to reduce tellurium from 6 valance to 4 valance was examined. As a result of experiment, the decomposition was fast in the alkaline solution. It takes 30 minutes with alkaline solution and 40 minutes with acid solution to indicate constant absorption. A method of analyzing the sample containing tellurium less than 5 ppm was studied. The experiment revealed that the sample containing a very small amount of tellurium can be analyzed when concentration by extraction is carried out for the sample solutions which are divided into one gram each because it is difficult to treat several grams of the sample at one time. This method also is suitable for the quantitative analysis of selenium. This method showed good addition effect and reproducibility within the relative error of 5%. The comparison between the calibration curve of the standard solution of tellurium 4 subjected to the reaction with bismuthiol-2 and the calibration curve obtained from the extraction of tellurium 4 with MIBK indicated that the extraction is perfect. The result by bismuthiol-2 method and that by atom absorption method coincided quite well on the same sample. (Iwakiri, K.)

  5. METHODS OF SYNTHESIS EIGHT-TELLURIUM-CONTAINING HETEROCYCLES WITH MORE HETEROATOMS

    Directory of Open Access Journals (Sweden)

    G. M. Abakarov

    2013-01-01

    Full Text Available In this article systematized and summarized data on the synthesis of neweight-embered tellurium-containing heterocycles and new preparative methods described above produce heterocyclic tellurium.

  6. Investigation of γ-irradiation influence on the DLTS spectra in silicon diluted by tellurium

    International Nuclear Information System (INIS)

    Sultanov, N.A.; Tadzhibaev, M.; Mirzabadalov, Zh

    1997-01-01

    The influence of gamma-radiation on deep level transient spectroscopy(DLTS) spectra for silicon crystals doped with tellurium was studied. The DLTS spectra have shown that tellurium in silicon formed two deep levels with fixed ionization energy. It was shown that the presence of tellurium prevents the formation of radiation defects

  7. Fission product tellurium chemistry from fuel to containment

    International Nuclear Information System (INIS)

    McFarlane, J.

    1996-01-01

    Chemical equilibrium calculations were performed on the speciation of tellurium in-core and inside the primary heat transport system (PHTS) under loss-of-coolant accident conditions. Data from recent Knudsen-cell experiments on the volatilization of Cs 2 Te were incorporated into the calculation. These data were used to recalculate thermodynamic quantities for Cs 2 Te(g), including Δ f G o (298 K)= -118±9 kJ.mol -1 . The description of the condensed high-temperature cesium-tellurium phase was expanded to include Cs 2 Te 3 (c) in addition to Cs 2 Te(c). These modifications were incorporated into the database used in the equilibrium calculations; the net effect was to stabilize the condensed cesium-tellurium phase and reduce the vapour pressure of Cs 2 Te(g) between 1200 and 1600 K. The impact of tellurium speciation in containment, after release from the PHTS, is discussed along with the possible effect of tellurium on iodine chemistry. (author) 10 figs., 5 tabs., 21 refs

  8. Fission product tellurium chemistry from fuel to containment

    Energy Technology Data Exchange (ETDEWEB)

    McFarlane, J [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Labs.

    1996-12-01

    Chemical equilibrium calculations were performed on the speciation of tellurium in-core and inside the primary heat transport system (PHTS) under loss-of-coolant accident conditions. Data from recent Knudsen-cell experiments on the volatilization of Cs{sub 2}Te were incorporated into the calculation. These data were used to recalculate thermodynamic quantities for Cs{sub 2}Te(g), including {Delta}{sub f}G{sup o}(298 K)= -118{+-}9 kJ.mol{sup -1}. The description of the condensed high-temperature cesium-tellurium phase was expanded to include Cs{sub 2}Te{sub 3}(c) in addition to Cs{sub 2}Te(c). These modifications were incorporated into the database used in the equilibrium calculations; the net effect was to stabilize the condensed cesium-tellurium phase and reduce the vapour pressure of Cs{sub 2}Te(g) between 1200 and 1600 K. The impact of tellurium speciation in containment, after release from the PHTS, is discussed along with the possible effect of tellurium on iodine chemistry. (author) 10 figs., 5 tabs., 21 refs.

  9. A recycling model of the biokinetics of systemic tellurium.

    Science.gov (United States)

    Giussani, Augusto

    2014-11-01

    To develop a compartmental model of the systemic biokinetics of tellurium required for calculating the internal dose and interpreting bioassay measurements after incorporation of radioactive tellurium. The compartmental model for tellurium was developed with the software SAAM II v. 2.0 (©The Epsilon Group, Charlottesville, Virginia, USA). Model parameters were determined on the basis of published retention and excretion data in humans and animals. The model consists of two blood compartments, one compartment each for liver, kidneys, thyroid, four compartments for bone tissues and a generic compartment for the soft tissues. The model predicts a rapid urinary excretion of systemic tellurium: 45% in the first 24 h and 84% after 50 d. Faecal excretion amounts to 0.4% after 3 d and 9% after 50 d. Whole body retention is 55% after one day, and 2.8% after 100 d. These values as well as the retained fractions in the single organs are reasonably consistent with the available human and animal data (studies with swine and guinea pigs). The proposed model gives a realistic description of the available biokinetic data for tellurium and will be adopted by the International Commission on Radiological Protection for applications in internal dosimetry.

  10. Tracing Tellurium and Its Nanostructures in Biology.

    Science.gov (United States)

    Zare, Bijan; Nami, Mohammad; Shahverdi, Ahmad-Reza

    2017-12-01

    Tellurium (Te) is a semimetal rare element in nature. Together with oxygen, sulfur (S), and selenium (Se), Te is considered a member of chalcogen group. Over recent decades, Te applications continued to emerge in different fields including metallurgy, glass industry, electronics, and applied chemical industries. Along these lines, Te has recently attracted research attention in various fields. Though Te exists in biologic organisms such as microbes, yeast, and human body, its importance and role and some of its potential implications have long been ignored. Some promising applications of Te using its inorganic and organic derivatives including novel Te nanostructures are being introduced. Before discovery and straightforward availability of antibiotics, Te had considered and had been used as an antibacterial element. Antilishmaniasis, antiinflammatory, antiatherosclerotic, and immuno-modulating properties of Te have been described for many years, while the innovative applications of Te have started to emerge along with nanotechnological advances over the recent years. Te quantum dots (QDs) and related nanostructures have proposed novel applications in the biological detection systems such as biosensors. In addition, Te nanostructures are used in labeling, imaging, and targeted drug delivery systems and are tested for antibacterial or antifungal properties. In addition, Te nanoparticles show novel lipid-lowering, antioxidant, and free radical scavenging properties. This review presents an overview on the novel forms of Te, their potential applications, as well as related toxicity profiles.

  11. Tellurium Enrichment in Jurassic Coal, Brora, Scotland

    Directory of Open Access Journals (Sweden)

    Liam Bullock

    2017-11-01

    Full Text Available Mid-Jurassic pyritic coals exposed at the village of Brora, northern Scotland, UK, contain a marked enrichment of tellurium (Te relative to crustal mean, average world coal compositions and British Isles Carboniferous coals. The Te content of Brora coal pyrite is more than one order of magnitude higher than in sampled pyrite of Carboniferous coals. The Te enrichment coincides with selenium (Se and mercury (Hg enrichment in the rims of pyrite, and Se/Te is much lower than in pyrites of Carboniferous coals. Initial pyrite formation is attributed to early burial (syn-diagenesis, with incorporation of Te, Se, Hg and lead (Pb during later pyrite formation. The source of Te may have been a local hydrothermal system which was responsible for alluvial gold (Au in the region, with some Au in Brora headwaters occurring as tellurides. Anomalous Te is not ubiquitous in coal, but may occur locally, and is detectable by laser ablation inductively coupled plasma-mass spectrometry (LA-ICP-MS.

  12. Electrophilic addition of selenium and tellurium halides to methyldiethynylsilane

    International Nuclear Information System (INIS)

    Amosova, S.V.; Penzik, M.V.; Martynov, A.V.; Zhilitskaya, L.V.; Voronkov, M.G.

    2009-01-01

    Reaction of TeCl 4 with methyldiethynylsilane (MDES) proceeds with the predominant formation of E-isomer 1,1,3,6-tetrachlorine-1-methyl-1-(methyldiethynylsiloxy)-1,4-tellurium(IV) silafulvic due to the interaction of intermediate E-isomer 4-methyl-1,1,3,6-tetrachlorine-1,4-tellurium(IV)silafulvic with MDES. TeCl 4 Reacts with MDES without reduction of Te(IV) in Te(II). Tetracoordination of tellurium atom in heterocycle was established by NMR 125 Te. Mass spectrum of heterocycle shows the presence of fragmentary ions [M-Cl 2 ] + . According elemental analysis Te:Cl=1:4 ratio proves composition of heterocycle

  13. Analysis of tellurium-silicon alloys. Part 1. Determination of tellurium by the reduction from perchloric acid solution

    International Nuclear Information System (INIS)

    Teperek, J.

    1977-01-01

    When 100-150 mg of tellurium is dissolved in the solution containing 20 cm 3 72 wt.% of perchloric acid, the reduction of tellurium to elementary form is possible only after adding 60-100 milimoles of HCl. The reduction is performed by adding 1 cm 3 of saturated sodium pyrosulphite solution (Na 2 S 2 O 5 ) and 10 cm 3 of 10 wt.% hydrazine hydrochloride solution (N 2 H 4 .2HCl) to 80-90 cm 3 of cold solution of Te in HClO 4 -HCl mixture. The reduction is completed after 3-5 min. of boiling. When 150-200 mg sample of Te-Si alloy is dissolved in 20 cm 3 of hot 72% per chloric acid, the separation of components is reached. Tellurium can be determinated in filtrate by proposed procedure with high accuracy and precision. (author)

  14. METALCOMPLEXES OF TELLURIUM-CONTAINING AMINES AND AZOMETINES

    Directory of Open Access Journals (Sweden)

    G. M. Abakarov

    2014-01-01

    Full Text Available In this article methods of synthesis and reactionary ability of metalcomplexes of tellurium-containing amines, azometines, of a problem of competitive coordination with use of the principle of "soft" and "rigid" acids and the bases (R. Pearson.

  15. Properties of low-alloy steel with tellurium

    International Nuclear Information System (INIS)

    Popova, L.V.; Lebedev, D.V.; Litvinenko, D.A.; Nasibov, A.G.

    1983-01-01

    The results of investigations into 09G2 and 09G2F steels alloyed with tellurium after controlled rolling are presented. 0.002-0.011% tellurium additions did not change strength and plastic properties of the steels after controlled rolling. Tellurium additions results in 40-50% increase of the steel impact strength on samples With circular and sharp cuts in brittle-viscous region. 0.002-0.003% of tellurium is considered to be the optimum content from the view point of increa=. sing steel strength. Increase of impact strength takes place at the expense of growth of both work function of crack formation and work function of crack propagation but in different temperature ranges: at the expense of firstone at 80-40 deg C, at the expense of second one at 20-40 deg C. 0.002-0.011% teilurium additions mainly at the expense of sulphide globularization bring about decrease of anisotropy of steet properties by impact strength reducing anisotropy factor from 2 to 1.5

  16. Production of 123I

    International Nuclear Information System (INIS)

    Britto, J.L.Q. de; Silva, A.G. da; Teixeira, F.C.M.; Costa e Silva, A.; Souza, A.S.F. de

    1981-01-01

    The 12 I is prepared by 122 Te( 3 He, 2n) 123 Xe sup(β+) → 123 I reaction. The remotization of the Xe diffusion and capture system and the retired of the 123 I produced by the 123 Xe precursory decaying. (E.G.) [pt

  17. Tellurium Stable Isotopes as a Paleoredox Proxy

    Science.gov (United States)

    Wasserman, N.; Johnson, T. M.

    2017-12-01

    Despite arguments for variably-oxygenated shallow waters and anoxic deep marine waters, which delayed animal development until the Neoproterozoic Oxidation Event, the magnitude of atmospheric oxygen during the Proterozoic is still uncertain [1]. The evidence for low pO2 (<0.1-1% PAL) is based on geochemical and isotopic proxies, which track the mobilization of Fe and Mn on the continents. For example, large chromium isotope shifts occur at the Neoproterozoic Oxidation Event due to the initiation of Cr redox cycling, but this proxy is insensitive to fluctuations in the lower-pO2 conditions at other times during the Proterozoic. Tellurium, a metalloid with a lower threshold to oxidation, may be sensitive to pO2 shifts in a lower range. In the reduced forms, Te(-II) and Te(0), the element is insoluble and immobile. However, in the more oxidized phases, Te(IV) and Te(VI), Te can form soluble oxyanions (though it tends to adsorb to Fe-oxyhydroxides and clays) [2]. Te stable isotopes have been shown to fractionate during abiotic or biologic reduction of Te(VI) or Te(IV) to elemental Te(0) [3, 4]. Utilizing hydride generation MC-ICP-MS, we are able to obtain high precision (2σ 0.04‰) measurements of δ128Te/125Te for natural samples containing < 10 ng of Te. A suite of Phanerozoic and Proterozoic ironstones show significant variation in δ128Te/125Te (<0.5‰), suggesting that the Te redox cycle was active during the Proterozoic. Future directions will include Te isotope measurements of Precambrian paleosols to determine natural isotope variation before the Great Oxidation Event and experiments to determine fractionation during adsorption to Fe-oxyhydroxides. [1] Planavsky et al. (2014) Science 346 (6209), pp. 635-638 [2] Qin et al. (2017) Environmental Science and Technology 51 (11), pp 6027-6035 [3] Baesman et al. (2007) Applied Environmental Microbiology 73 (7), pp 2135-2143 [4] Smithers and Krause (1968) Canadian Journal of Chemistry 46(4): pp 583-591

  18. Enrichment mechanisms of tellurium in ferromanganese crusts

    Science.gov (United States)

    Sakaguchi, A.; Sugiyama, T.; Usui, A.; Takahashi, Y.

    2012-04-01

    Marine ferromanganese crusts (FMCs) consist of iron (Fe) hydroxides and manganese (Mn) oxides with various minor and trace elements. Especially for tellurium (Te), which is recognized as one of the rare metals, it has been reported that this element is concentrated about 105 times in FMCs compared with earth's crust, and the host phase might be Fe (oxy)hydroxide (Hein et al., 2003). Actually, in our previous study, the high concentration of Te in very surface layers of FMCs was found from the top to halfway down of a seamount in the Pacific Ocean. However, the concentration of Te in surface layers through the seamount showed good correlation with that of Mn instead of Fe. In this study, we attempted to clarify the enrichment mechanism of Te in FMCs with some methods including X-ray absorption fine structure (XAFS) technique for synthesised /natural samples. Seventeen FMC samples were collected from the Takuyo-Daigo seamount, from 950 m (summit) to 3000 m in water depth, with hyper-dolphin (remotely operated vehicle) equipped with live video camera and manipulators. The growth rates of all FMC samples were estimated to be about 3 mm/Ma. Very surface layer (less than 1 mm) of all FMC was analyzed with XRD and XAFS to confirm the mineral composition and speciation of Te. Furthermore, to serve as an aid to clarify the adsorption mechanism of Te on FMCs, distribution coefficients (Kd) and oxidation states were determined through the adsorption experiments of Te(IV) and Te(VI) on ferrihydrite and δ-MnO2. In all the experiments, pH and ionic strength were adjusted to pH 7.5 and 0.7 M, respectively. The oxidation state of Te in water phase was determined with HPLC-ICP-MS. As for the analysis of oxidation and adsorption states on the solid phase, XAFS was employed. The major mineral composition of Fe and Mn had no significant variation through the water depth of Takuyo-Daigo seamount. The oxidation state of Te in all samples showed hexavalent, and there was no significant

  19. Atomic absorption determination of ultratrace tellurium in rocks utilizing high sensitivity sampling systems

    International Nuclear Information System (INIS)

    Beaty, R.D.

    1973-01-01

    The sampling boat and the graphite furnace were shown to possess the required sensitivity to detect tellurium at ultratrace levels, in a variety of sample types, by atomic absorption. In the sampling boat approach, tellurium in sample solutions is chemically separated and concentrated by extraction into methyl isobutyl ketone before measurement. For samples exhibiting extraction interferences or excessively high background absorption, a preliminary separation of tellurium by coprecipitation with selenium is described. Using this technique, tellurium can be quantitatively detected down to 5 nanograms and linear response is observed to 100 nanograms. Relative standard deviations of better than 7 percent are achieved for 50 nanograms of tellurium. For samples that have a tellurium content below the detection limits of the sampling boat, the graphite furnace is used for atomization. By this method, as little as 0.07 nanograms of tellurium can be detected, and a precision of 1 percent relative standard deviation is achievable at the 5 nanogram level. A routinely applicable procedure was developed for determining tellurium in rocks, using the graphite furnace, after a hydrofluoric acid decomposition of the sample. Using this procedure, tellurium data were obtained on 20 different rocks, and the significance of this new information is discussed. (Diss. Abstr. Int., B)

  20. Effects of tellurium concentration on the structure of melt-grown ZnSe crystals

    International Nuclear Information System (INIS)

    Atroshchenko, Lyubov V.; Galkin, Sergey N.; Rybalka, Irina A.; Voronkin, Evgeniy F.; Lalayants, Alexandr I.; Ryzhikov, Vladimir D.; Fedorov, Alexandr G.

    2005-01-01

    It has been shown that isovalent doping by tellurium positively affects the structural perfection of ZnSe crystals related to the completeness of the wurtzite-sphalerite phase transition. The optimum concentration range of tellurium in ZnSe crystals is 0.3-0.6 mass %. X-ray diffraction studies have shown that in ZnSe 1-x Te x crystals at tellurium concentrations below 0.3 mass % twinning and packing defects occur, while tellurium concentrations above 0.6 mass % lead to formation of tetragonal crystal lattice

  1. Determining arsenic in elemental antimony containing selenium and tellurium

    International Nuclear Information System (INIS)

    Mogileva, M.G.; Kozlova, E.L.

    1986-01-01

    The authors have developed a method of determining arsenic in metallic antimony containing selenium, tellurium, and mercury, in which they isolated it in elementary form for separation from the antimony and the associated elements (silicon and phosphorus), followed by colorimetric determination of the arsenic from arsenic-molbdenum blue. The reducing agents to reduce the arsenic were sodium hypophosphite and tin(II) chloride, which do not reduce antimony and which do not interfere with the determination. This method of determining arsenic in metallic antimony without preliminary separation of the selenium and tellurium is in no way inferior in accuracy to the method given in All-Union State Standard (GOST) 1367.4-83

  2. RILIS-ionized mercury and tellurium beams at ISOLDE CERN

    Energy Technology Data Exchange (ETDEWEB)

    Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN (Switzerland); Billowes, J. [The University of Manchester, School of Physics and Astronomy (United Kingdom); Chrysalidis, K. [CERN (Switzerland); Fedorov, D. V. [Petersburg Nuclear Physics Institute (Russian Federation); Fedosseev, V. N.; Marsh, B. A. [CERN (Switzerland); Molkanov, P. L. [Petersburg Nuclear Physics Institute (Russian Federation); Rossel, R. E.; Rothe, S.; Seiffert, C. [CERN (Switzerland); Wendt, K. D. A. [Johannes Gutenberg Universität, Institut für Physik (Germany)

    2017-11-15

    This paper presents the results of ionization scheme development for application at the ISOLDE Resonance Ionization Laser Ion Source (RILIS). Two new ionization schemes for mercury are presented: a three-step three-resonance ionization scheme, ionizing via an excitation to a Rydberg level and a three-step two-resonance ionization scheme, with a non-resonant final step to the ionization continuum that corresponded to a factor of four higher ionization efficiency. The efficiency of the optimal mercury ionization scheme was measured, together with the efficiency of a new three-step three resonance ionization scheme for tellurium. The efficiencies of the mercury and tellurium ionization schemes were determined to be 6 % and >18 % respectively.

  3. ELECTROCHEMICAL STUDY OF RHENIUM-TELLURIUM-COPPER SYSTEM

    OpenAIRE

    E.A.Salakhova*1, D.B.Tagiyev2, P.E.Kalantarova3 and A.M.Askerova4

    2017-01-01

    The formation of the triple alloys Re-Te-Cu on the platinum electrode at volt amperemetric cycling has been studied. The investigation was carried out from chloride acidic solution containing tellurium acid, potassium perrhenate, chloride copper. The kinetics of the processes was controlled using the measurements by the method of cyclic volt-amperometry on the device İVİUMSTAT. For the analysis of composition and structure the methods of XRD (X-ray diffraction analysis) were used, and the inv...

  4. Starting material radiation source for Moessbauer investigations of tellurium compounds

    International Nuclear Information System (INIS)

    Alexandrov, A.J.; Grushko, J.S.; Makarov, E.F.; Mishin, K.Y.; Baltrunas, D.A.J.

    1977-01-01

    A method is described of preparing a radiation source for Mossbauer investigations of tellurium compounds manufactured on the basis of 5 MgO . Te 124 O 3 . 5 MgO . Te 124 O 3 is irradiated in a reactor by means of thermal neutrons, followed by annealing at a temperature ranging from 600 0 to 1,100 0 C for a period of from 5 to 10 hours

  5. Flotation concentration for tellurium determination in industrial sewage

    International Nuclear Information System (INIS)

    Skripchuk, V.G.; Bormotova, L.V.; Lukoyanova, L.P.; Tret'yakova, M.I.

    1983-01-01

    Combination of the flotation of tellurium (4) precipitate with papaverine toluene and extraction-photometric determination of Te with butylrhodamine C allows one to determine 0.002-0.1 mg Te/l without its preliminary precipitation. Accompanying elements found in non-ferrous metallurgy sewage have no effect upon it. The duration of analysis of 10 samples is 1 to 1.5 h. Relative error is 12%. The method is introduced at the ''Uralelektromed'' plant

  6. Investigation of biomethylation of arsenic and tellurium during composting

    International Nuclear Information System (INIS)

    Diaz-Bone, Roland A.; Raabe, Maren; Awissus, Simone; Keuter, Bianca; Menzel, Bernd; Kueppers, Klaus; Widmann, Renatus; Hirner, Alfred V.

    2011-01-01

    Though the process of composting features a high microbiological activity, its potential to methylate metals and metalloids has been little investigated so far in spite of the high impact of this process on metal(loid) toxicity and mobility. Here, we studied the biotransformation of arsenic, tellurium, antimony, tin and germanium during composting. Time resolved investigation revealed a highly dynamic process during self-heated composting with markedly differing time patterns for arsenic and tellurium species. Extraordinary high concentrations of up to 150 mg kg -1 methylated arsenic species as well as conversion rates up to 50% for arsenic and 5% for tellurium were observed. In contrast, little to no conversion was observed for antimony, tin and germanium. In addition to experiments with metal(loid) salts, composting of arsenic hyperaccumulating ferns Pteris vittata and P. cretica grown on As-amended soils was studied. Arsenic accumulated in the fronds was efficiently methylated resulting in up to 8 mg kg -1 methylated arsenic species. Overall, these studies indicate that metal(loid)s can undergo intensive biomethylation during composting. Due to the high mobility of methylated species this process needs to be considered in organic waste treatment of metal(loid) contaminated waste materials.

  7. Rutherford backscatter measurements on tellurium and cadmium implanted gallium arsenide

    International Nuclear Information System (INIS)

    Bell, E.C.

    1979-10-01

    The primary aim of the work described in this thesis was to examine implanted layers of the dopant impurities cadmium and tellurium in gallium arsenide and to experimentally assess their potential for producing electrically active layers. 1.5 MeV Rutherford backscattering measurements of lattice disorder and atom site location have been used to assess post implantation thermal annealing and elevated temperature implantations to site the dopant impurities on either gallium or arsenic lattice positions in an otherwise undisordered lattice. Pyrolitically deposited silicon dioxide was used as an encapsulant to prevent thermal dissociation of the gallium arsenide during annealing. It has been shown that high doses of cadmium and tellurium can be implanted without forming amorphous lattice disorder by heating the gallium arsenide during implantation to relatively low temperatures. Atom site location measurements have shown that a large fraction of a tellurium dose implanted at 180 0 C is located on or near lattice sites. Channeled backscatter measurements have shown that there is residual disorder or lattice strain in gallium arsenide implanted at elevated temperatures. The extent of this disorder has been shown to depend on the implanted dose and implantation temperature. The channeling effect has been used to measure annealing of the disorder. (author)

  8. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis

    Directory of Open Access Journals (Sweden)

    Yang F

    2014-10-01

    Full Text Available Fang Yang,1 Ka-Hing Wong,2 Yufeng Yang,3 Xiaoling Li,1 Jie Jiang,1 Wenjie Zheng,1 Hualian Wu,1 Tianfeng Chen1 1Department of Chemistry, Jinan University, Guangzhou, People’s Republic of China; 2Department of Applied Biology and Chemical Technology, The Hong Kong Polytechnic University, Hong Kong, People’s Republic of China; 3Institute of Hydrobiology, College of Life Science and Technology, Jinan University, Guangzhou, People’s Republic of China Abstract: Tellurium-containing phycocyanin (Te-PC and allophycocyanin (Te-APC, two organic tellurium (Te species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 µg g-1 protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropanedihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress. Keywords: tellurium, phycocyanin, allophycocyanin, purification, antioxidant activity

  9. Purification and in vitro antioxidant activities of tellurium-containing phycobiliproteins from tellurium-enriched Spirulina platensis.

    Science.gov (United States)

    Yang, Fang; Wong, Ka-Hing; Yang, Yufeng; Li, Xiaoling; Jiang, Jie; Zheng, Wenjie; Wu, Hualian; Chen, Tianfeng

    2014-01-01

    Tellurium-containing phycocyanin (Te-PC) and allophycocyanin (Te-APC), two organic tellurium (Te) species, were purified from tellurium-enriched Spirulina platensis by a fast protein liquid chromatographic method. It was found that the incorporation of Te into the peptides enhanced the antioxidant activities of both phycobiliproteins. With fractionation by ammonium sulfate precipitation and hydroxylapatite chromatography, Te-PC and Te-APC could be effectively separated with high purity, and Te concentrations were 611.1 and 625.3 μg g(-1) protein in Te-PC and Te-APC, respectively. The subunits in the proteins were identified by using MALDI-TOF-TOF mass spectrometry. Te incorporation enhanced the antioxidant activities of both phycobiliproteins, as examined by 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid assay. Moreover, Te-PC and Te-APC showed dose-dependent protection on erythrocytes against the water-soluble free radical initiator 2,2'-azo(2-asmidinopropane)dihydrochloride-induced hemolysis. In the hepatoprotective model, apoptotic cell death and nuclear condensation induced by tert-butyl hydroperoxide in HepG2 cells was significantly attenuated by Te-PC and Te-APC. Taken together, these results suggest that Te-PC and Te-APC are promising Te-containing proteins with application potential for treatment of diseases related to oxidative stress.

  10. Electrodeposition of antimony, tellurium and their alloys from molten acetamide mixtures

    NARCIS (Netherlands)

    Nguyen, H.P.; Peng, X.; Murugan, G.; Vullers, R.J.M.; Vereecken, P.M.; Fransaer, J.

    2013-01-01

    We examine the electrodeposition of antimony (Sb), tellurium (Te) and their alloys from molten mixtures of acetamide - antimony chloride and tellurium chloride. The binary mixtures of acetamide with SbCl3 and TeCl 4 exhibit eutectic formation with large depressions of freezing points to below room

  11. Biosynthesis and recovery of rod-shaped tellurium nanoparticles and their bactericidal activities

    Energy Technology Data Exchange (ETDEWEB)

    Zare, Bijan; Faramarzi, Mohammad Ali; Sepehrizadeh, Zargham [Department of Pharmaceutical Biotechnology and Biotechnology Research Center, Faculty of Pharmacy, Tehran University of Medical Sciences, P.O. Box 14155-6451 Tehran (Iran, Islamic Republic of); Shakibaie, Mojtaba [Department of Pharmacognosy and Biotechnology, School of Pharmacy, Pharmaceutics Research Center, Kerman University of Medical Sciences, P.O. Box 76175-493 Kerman (Iran, Islamic Republic of); Rezaie, Sassan [Department of Medical Biotechnology, School of Advanced Medical Technologies, Tehran University of Medical Sciences, Tehran (Iran, Islamic Republic of); Shahverdi, Ahmad Reza, E-mail: shahverd@sina.tums.ac.ir [Department of Pharmaceutical Biotechnology and Biotechnology Research Center, Faculty of Pharmacy, Tehran University of Medical Sciences, P.O. Box 14155-6451 Tehran (Iran, Islamic Republic of)

    2012-11-15

    Highlights: ► Biosynthesis of rod shape tellurium nanoparticles with a hexagonal crystal structure. ► Extraction procedure for isolation of tellurium nanoparticles from Bacillus sp. BZ. ► Extracted tellurium nanoparticles have good bactericidal activity against some bacteria. -- Abstract: In this study, a tellurium-transforming Bacillus sp. BZ was isolated from the Caspian Sea in northern Iran. The isolate was identified by various tests and 16S rDNA analysis, and then used to prepare elemental tellurium nanoparticles. The isolate was subsequently used for the intracellular biosynthesis of elemental tellurium nanoparticles. The biogenic nanoparticles were released by liquid nitrogen and purified by an n-octyl alcohol water extraction system. The shape, size, and composition of the extracted nanoparticles were characterized. The transmission electron micrograph showed rod-shaped nanoparticles with dimensions of about 20 nm × 180 nm. The energy dispersive X-ray and X-ray diffraction spectra respectively demonstrated that the extracted nanoparticles consisted of only tellurium and have a hexagonal crystal structure. This is the first study to demonstrate a biological method for synthesizing rod-shaped elemental tellurium by a Bacillus sp., its extraction and its antibacterial activity against different clinical isolates.

  12. Biosynthesis and recovery of rod-shaped tellurium nanoparticles and their bactericidal activities

    International Nuclear Information System (INIS)

    Zare, Bijan; Faramarzi, Mohammad Ali; Sepehrizadeh, Zargham; Shakibaie, Mojtaba; Rezaie, Sassan; Shahverdi, Ahmad Reza

    2012-01-01

    Highlights: ► Biosynthesis of rod shape tellurium nanoparticles with a hexagonal crystal structure. ► Extraction procedure for isolation of tellurium nanoparticles from Bacillus sp. BZ. ► Extracted tellurium nanoparticles have good bactericidal activity against some bacteria. -- Abstract: In this study, a tellurium-transforming Bacillus sp. BZ was isolated from the Caspian Sea in northern Iran. The isolate was identified by various tests and 16S rDNA analysis, and then used to prepare elemental tellurium nanoparticles. The isolate was subsequently used for the intracellular biosynthesis of elemental tellurium nanoparticles. The biogenic nanoparticles were released by liquid nitrogen and purified by an n-octyl alcohol water extraction system. The shape, size, and composition of the extracted nanoparticles were characterized. The transmission electron micrograph showed rod-shaped nanoparticles with dimensions of about 20 nm × 180 nm. The energy dispersive X-ray and X-ray diffraction spectra respectively demonstrated that the extracted nanoparticles consisted of only tellurium and have a hexagonal crystal structure. This is the first study to demonstrate a biological method for synthesizing rod-shaped elemental tellurium by a Bacillus sp., its extraction and its antibacterial activity against different clinical isolates.

  13. Polarographic determination of selenium and tellurium in silver-gold alloys

    International Nuclear Information System (INIS)

    Gornostaeva, T.D.; Shmargun, S.V.

    1986-01-01

    The determination of selenium and tellurium is of importance in monitoring the composition of silver-gold alloys (SGA) since these elements are harmful impurities in the pure metals. Tellurium is determined in silver alloys by atomic absorption and atomic emmission methods; selenium determination is made by atomic absorption methods. This paper examines the polarographic determination of silver and tellurium in SGA containing platinum metals and copper. Copper and the bulk of the platinum and palladium were removed by precipitating selenium and tellurium with potassium hypophosphite in the elementary state from 6 M HC1. The results of an analysis of samples of SGA according to the proposed method were compared with the results obtained by the atomic absorption method. the relative deviation in the determination of 0.02-1.0% by weight selenium and tellurium does not exceed 0.12 (n = 5)

  14. Synthesis and structure of aromatic and heterocyclic compounds of tellurium

    International Nuclear Information System (INIS)

    Sadekov, I.D.; Maksimenko, A.A.; Rivkin, B.B.

    1983-01-01

    A new universal method of preparing assymmetric and symmetric diaryl-tellurium chlorides and-dibromides, based on the interaction of diarylditellurides with cations of aryl-diazonium in the presence of copper (2) halogenides is developed. High yields of diaryltellium dihalogenices (60-90 de %), the possibility of the a wide variation of the nature of substituents in both components make this reaction one of the most general methods of preparing assymmetric diaryltellurium dihalogenides. It is advisable to use aryldiazonium boron fluorides instead of halogenides in this reaction

  15. Characterization of tellurium-based films for NO2 detection

    International Nuclear Information System (INIS)

    Tsiulyanu, D.; Tsiulyanu, A.; Liess, H.-D.; Eisele, I.

    2005-01-01

    Sensing characteristics of tellurium-based thin films for NO 2 monitoring was studied systematically. The influence of contact materials, thermal treatment, temperature and thickness of the samples on the electrical conductivity and sensitivity to NO 2 with respect to scanning electron microscopy analyses is given. The possibility is shown to optimize the properties of the films for the development of a simple and stable NO 2 sensor device with rapid response/recovery time and low operating temperature. The sensing mechanism is discussed for the direct interaction of gaseous species with lone-pair electrons of chalcogen atoms

  16. Van der Waals epitaxy and photoresponse of hexagonal tellurium nanoplates on flexible mica sheets.

    Science.gov (United States)

    Wang, Qisheng; Safdar, Muhammad; Xu, Kai; Mirza, Misbah; Wang, Zhenxing; He, Jun

    2014-07-22

    Van der Waals epitaxy (vdWE) is of great interest due to its extensive applications in the synthesis of ultrathin two-dimensional (2D) layered materials. However, vdWE of nonlayered functional materials is still not very well documented. Here, although tellurium has a strong tendency to grow into one-dimensional nanoarchitecture due to its chain-like structure, we successfully realize 2D hexagonal tellurium nanoplates on flexible mica sheets via vdWE. Chemically inert mica surface is found to be crucial for the lateral growth of hexagonal tellurium nanoplates since it (1) facilitates the migration of tellurium adatoms along mica surface and (2) allows a large lattice mismatch. Furthermore, 2D tellurium hexagonal nanoplates-based photodetectors are in situ fabricated on flexible mica sheets. Efficient photoresponse is obtained even after bending the device for 100 times, indicating 2D tellurium hexagonal nanoplates-based photodetectors on mica sheets have a great application potential in flexible and wearable optoelectronic devices. We believe the fundamental understanding of vdWE effect on the growth of 2D tellurium hexagonal nanoplate can pave the way toward leveraging vdWE as a useful channel to realize the 2D geometry of other nonlayered materials.

  17. Release of tellurium and cesium from UO2 in LWR fuel rods during irradiation

    International Nuclear Information System (INIS)

    Malen, K.A.

    1983-01-01

    In this paper the release of tellurium (Te-132) and cesium (Cs-134 and Cs-137) from UO 2 -fuel is analyzed. The basis for the analysis is the experimental results from the S176 series of experiments performed at Studsvik. It seems that the model developed earlier for release of iodine applies also to tellurium and cesium. This model assumes sweeping up of the species in question by moving grain boundaries and subsequent release through grain boundary porosity. An interesting extra feature is deposition of tellurium at temperatures in the range 1500-2000 K believed to be due to condensation. (author)

  18. Review of tellurium release rates from LWR fuel elements under accident conditions

    International Nuclear Information System (INIS)

    Lorenz, R.A.; Beahm, E.C.; Wichner, R.P.

    1983-01-01

    Although fission product tellurium presents a potentially significant radiohazard, its release and transport in source-term experiments is frequently overlooked because it does not possess a readily measurable, gamma emission; moreover, a recent study emphasized noble gas, iodine and cesium release from LWR fuel elements because of the large data base that exists for these materials. Some new tests show that in some cases tellurium may be held up in core material to a greater degree than previously assumed - an observation that prompts a careful reappraisal of the existing tellurium-release data and its chemical foundation

  19. Liquid-liquid extraction of arsenic, antimony, selenium and tellurium by zinc diethyldithiocarbamate

    International Nuclear Information System (INIS)

    Bajo, S.; Wyttenbach, A.

    1978-03-01

    The authors report the solvent extraction, oxidation, reduction, extraction in the presence of iron, and reextraction of arsenic, antimony, selenium and tellurium. These processes were studied using radioactive tracers. (G.T.H.)

  20. A Magnetic Resonance Force Microscopy Quantum Computer with Tellurium Donors in Silicon

    OpenAIRE

    Berman, G. P.; Doolen, G. D.; Tsifrinovich, V. I.

    2000-01-01

    We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines the well-developed silicon technology with expected advances in MRFM.

  1. Flame and flameless atomic-absorption determination of tellurium in geological materials

    Science.gov (United States)

    Chao, T.T.; Sanzolone, R.F.; Hubert, A.E.

    1978-01-01

    The sample is digested with a solution of hydrobromic acid and bromine and the excess of bromine is expelled. After dilution of the solution to approximately 3 M in hydrobromic acid, ascorbic acid is added to reduce iron(III) before extraction of tellurium into methyl isobutyl ketone (MIBK). An oxidizing air-acetylene flame is used to determine tellurium in the 0.1-20 ppm range. For samples containing 4-200 ppb of tellurium, a carbon-rod atomizer is used after the MIBK extract has been washed with 0.5 M hydrobromic acid to remove the residual iron. The flame procedure is useful for rapid preliminary monitoring, and the flameless procedure can determine tellurium at very low concentrations. ?? 1978.

  2. DETECTION OF THE SECOND r-PROCESS PEAK ELEMENT TELLURIUM IN METAL-POOR STARS ,

    International Nuclear Information System (INIS)

    Roederer, Ian U.; Lawler, James E.; Cowan, John J.; Beers, Timothy C.; Frebel, Anna; Ivans, Inese I.; Schatz, Hendrik; Sobeck, Jennifer S.; Sneden, Christopher

    2012-01-01

    Using near-ultraviolet spectra obtained with the Space Telescope Imaging Spectrograph on board the Hubble Space Telescope, we detect neutral tellurium in three metal-poor stars enriched by products of r-process nucleosynthesis, BD +17 3248, HD 108317, and HD 128279. Tellurium (Te, Z = 52) is found at the second r-process peak (A ≈ 130) associated with the N = 82 neutron shell closure, and it has not been detected previously in Galactic halo stars. The derived tellurium abundances match the scaled solar system r-process distribution within the uncertainties, confirming the predicted second peak r-process residuals. These results suggest that tellurium is predominantly produced in the main component of the r-process, along with the rare earth elements.

  3. Nano-Structured Crystalline Te Films by Laser Gas-Phase Pyrolysis of Dimethyl Tellurium

    Czech Academy of Sciences Publication Activity Database

    Pola, Josef; Pokorná, Veronika; Boháček, Jaroslav; Bastl, Zdeněk; Ouchi, A.

    2004-01-01

    Roč. 71, č. 2 (2004), s. 739-746 ISSN 0165-2370 R&D Projects: GA AV ČR IAA4072107; GA MŠk OC 523.60 Institutional research plan: CEZ:AV0Z4072921; CEZ:AV0Z4032918; CEZ:AV0Z4040901 Keywords : dimethyl tellurium * tellurium films * laser Subject RIV: CA - Inorganic Chemistry Impact factor: 1.352, year: 2004

  4. Kinetics and mechanism of oxidation of tellurium (IV) by periodate in alkaline medium

    International Nuclear Information System (INIS)

    Srinivas, K.; Vani, P.; Dikshitulu, L.S.A.

    1995-01-01

    Detailed kinetic study of the oxidation of tellurium (IV) by periodate in alkaline medium has been carried out to compare the mechanisms of oxidation in the acid and alkaline media. It is interesting to note that the rate step involves a two-electron transfer from tellurium (IV) to periodate in alkaline medium although the kinetic pattern is somewhat different from that in the acid medium. 7 refs., 1 tab

  5. Methods of selenium and tellurium determination in geological and enviromental materials

    International Nuclear Information System (INIS)

    Nazarenko, I.I.; Kislova, I.V.

    1988-01-01

    Atomic-absorption and atomic-emission methods of tellurium determination in ores and products of their processing are described. Flame variant with extractional concentration permits to determine tellurium with the concentration up to 6x10 -6 %, the use of graphite cuvette after preliminary concentration-up to 1x10 -6 %. Atomic-emissional method permits to determine 3x10 -4 % Te from sample of 0.5 g

  6. Formation of defects in tellurium at various levels of gravitation

    International Nuclear Information System (INIS)

    Parfen'ev, R.V.; Farbshtejn, I.I.; Shul'pina, I.L.; Yakimov, S.V.; Shalimov, V.P.; Turchaninov, A.M.

    2002-01-01

    One investigated into effect of gravitation conditions during tellurium crystallization (ranging from microgravitation up to increased gravitation - 5g 0 ) on concentration of neutral (N D ) and electrically active (N AD ) acceptor structure defects in specimens grown both under complete remelting of parent ingot and under directed recrystallization of ingot with inoculation. N AD and N D concentrations and their distribution along the specimen depth were determined on the basis of analysis of electrical characteristics (conductivity and the Hall effect) measured along ingots within 1.6-300 K temperature range. The results were compared with characteristics of specimens grown following the similar program under normal conditions. At complete remelting under microgravitation one detected attributes of strong supercooling and spontaneous crystallization, as well as, of specimen resistance oscillation by its depth caused by N D modulation [ru

  7. Facile Hydrothermal Synthesis of Tellurium Nanostructures for Solar Cells

    Directory of Open Access Journals (Sweden)

    M. Panahi-Kalamuei

    2014-10-01

    Full Text Available Tellurium (Te nanostructures have been successfully synthesized via a simple hydrothermal methodfrom the reaction of a TeCl4 aqueous solution with thioglycolic acid (TGA as a reductant. TGA can be easily oxidized to the corresponding disulfide [SCH2CO2H]2, which in turn can reduce TeCl4 to Te. The obtained Te was characterized by XRD, SEM, EDS, and DRS. The effect of reducing agent on morphology and size of the products were also studied. Additionally, Te thin film was deposited on the FTO-TiO2 by Dr- blading then employed to solar cell application and measured open circuit voltage (Voc, short circuit current (Isc, and fill factor (FF were determined as well. The studies showed that particle morphology and sizes play crucial role on solar cell efficiencies.

  8. Tellurium adsorption on tungsten and molybdenum field emitters

    International Nuclear Information System (INIS)

    Collins, R.A.; Kiwanga, C.A.

    1977-01-01

    Studies of the adsorption of tellurium onto tungsten and molybdenum field emitters are described and the results obtained are compared with those obtained in previous work on the adsorption of silicon and selenium. The adsorption of Te onto W was found to be much more uniform than in the case of Se. Although Te is metallic in many of its properties its adsorptive behavior on field emitters is found to be similar to that of selenium and these adsorptive properties are basically common to all semiconductors. The most evident property of these adsorbates is that the work function and emission current decrease simultaneously at coverages of less than half a monolayer and the work function subsequently increases. (B.D.)

  9. Strong nonlinear photonic responses from microbiologically synthesized tellurium nanocomposites

    Science.gov (United States)

    Liao, K.-S.; Wang, Jingyuan; Dias, S.; Dewald, J.; Alley, N.J.; Baesman, S.M.; Oremland, R.S.; Blau, W.J.; Curran, S.A.

    2010-01-01

    A new class of nanomaterials, namely microbiologically-formed nanorods composed of elemental tellurium [Te(0)] that forms unusual nanocomposites when combined with poly(m-phenylenevinylene-co-2,5-dioctoxy-phenylenevinylene) (PmPV) is described. These bio-nanocomposites exhibit excellent broadband optical limiting at 532 and 1064 nm. Nonlinear scattering, originating from the laser induced solvent bubbles and microplasmas, is responsible for this nonlinear behavior. The use of bacterially-formed Te(0) when combined with an organic chemical host (e.g., PmPV) is a new green method of nanoparticle syntheses. This opens the possibilities of using unique, biologically synthesized materials to advance future nanoelectronic and nanophotonic applications. ?? 2009 Elsevier B.V. All rights reserved.

  10. Study On Analytical Methods Of Tellurium Content In Natriiodide (Na131I) Radiopharmaceutical Solution Produced In The Dalat Nuclear Reactor

    International Nuclear Information System (INIS)

    Vo Thi Cam Hoa; Duong Van Dong; Nguyen Thi Thu; Chu Van Khoa

    2007-01-01

    This report describes the practical methods for analyzing of Tellurium content in Na 131 I solution produced at the Dalat Nuclear Research Institute. We studied analytical methods to control Tellurium content in final Na 131 I solution product used in medical purposes by three methods such as: spot test, gamma spectrometric and spectrophotometric methods. These investigation results are shown that the spot test method is suitable for controlling Tellurium trace in the final product. This spot test can be determinate Tellurium trace less than 10 ppm and are used to quality control of Na 131 I solution using in medical application. (author)

  11. Near threshold electron impact ionization cross section for tellurium atoms

    International Nuclear Information System (INIS)

    Chipev, F.F.; Chernyshova, I.V.; Kontros, J.E.; Shpenik, O.B.

    2004-01-01

    Full text: Up today electron-impact ionization is one of the most intensively investigated processes in atomic and molecular physics [1]. These experiments however, are associated with difficulties: high temperatures and densities are required to produce atomic beams and monochromatic intensive electron beams. A crossed electron and atomic beams scattering geometry was employed to measure the ionization efficiency curve for tellurium atoms. Our electron spectrometer comprises two serially mounted hypocycloidal electron energy analyzers [2], the first being the monochromator and the second - the scattered electron analyzer. The whole spectrometer is immersed into the homogenous magnetic field. Great care was taken in selecting the value of the extracting potential at the electrode, mounted normally to the atomic beam direction. By careful choosing this potential as low as possible (∼1.4 V), its influence on the motion of the monochromatized electrons in the collision region was minimized and the full collection of the formed ions was reached. The atom beam was produced using a compact effusion source made of the stainless steel with a microchannel exit to minimise the angular divergency of the beam. The temperature of the microchannel plate was taken about 50 K higher than that of the metal vapour in the heated reservoir. This atomic beam source enabled to produce an atomic beam with the concentration of two orders of magnitude higher than that in the case of a standard effusion source. A typical value of the electron energy spread was 0.15 eV (FWHM) in the 0.1-15 eV energy range. The primary electron beam current was equal to 10 -7 A. Such values of electron energy spread and beam current for the primary electron beam passing through the collision chamber were chosen to provide identical conditions for carrying out all the measurements. The energy scale was calibrated with the accuracy of ± 0.05 eV. The measured ionization cross-section normalized to the results

  12. Optimization of scintillator loading with the tellurium-130 isotope for long-term stability

    Science.gov (United States)

    Duhamel, Lauren; Song, Xiaoya; Goutnik, Michael; Kaptanoglu, Tanner; Klein, Joshua; SNO+ Collaboration

    2017-09-01

    Tellurium-130 was selected as the isotope for the SNO + neutrinoless double beta decay search, as 130Te decays to 130Xe via double beta decay. Linear alkyl benzene(LAB) is the liquid scintillator for the SNO + experiment. To load tellurium into scintillator, it is combined with 1,2-butanediol to form an organometallic complex, commonly called tellurium butanediol (TeBD). This study focuses on maximizing the percentage of tellurium loaded into scintillator and evaluates the complex's long-term stability. Studies on the effect of nucleation due to imperfections in the detector's surface and external particulates were employed by filtration and induced nucleation. The impact of water on the stability of TeBD complex was evaluated by liquid-nitrogen sparging, variability in pH and induced humidity. Alternative loading methods were evaluated, including the addition of stability-inducing organic compounds. Samples of tellurium-loaded scintillator were synthesized, treated, and consistently monitored in a controlled environment. It was found that the hydronium ions cause precipitation in the loaded scintillator, demonstrating that water has a detrimental effect on long-term stability. Optimization of loaded scintillator stability can contribute to the SNO + double beta decay search.

  13. Chemical Process for Treatment of Tellurium and Chromium Liquid Waste from I-131 Radioisotope Production

    International Nuclear Information System (INIS)

    Zainus-Salimin; Gunandjar; Dedy-Harsono; Hendro; Sugeng-Purnomo; Mohammad-Faruq; Zulfakhri

    2000-01-01

    The I-131 radioisotope is used in nuclear medicine for diagnosis and therapy. The I-131 radioisotope is produced by wet distillation at Bandung Nuclear Research Center and generated about 4,875 Itr of liquid waste containing 2,532.8 ppm of tellurium and 1,451.8 ppm chromium at pH 1. Considering its negative impact to the environment caused by toxic behaviour of tellurium and chromium, it is necessary to treat chemically that's liquid waste. The research of chemical treatment of tellurium and chromium liquid waste from I-131 radioisotope production has been done. The steps of process are involved of neutralisation with NaOH, coagulation-flocculation process for step I using Ca(OH) 2 coagulant for precipitation of sulphate, sulphite, oxalic, chrome Cr 3+ , and coagulation-flocculation process for step II using BaCI 2 coagulant for precipitation of chrome Cr 6+ and tellurium from the supernatant of coagulation in step I. The best result of experiment was achieved at 0.0161 ppm of chromium concentration on the supernatant from coagulation-flocculation of step I using 3.5 g Ca(OH) 2 for 100 ml of liquid waste, and 0.95 ppm of tellurium concentration on the final supernatant from coagulation-flocculation by of step II using 0.7 g BaCI 2 for supernatant from coagulation of step I. (author)

  14. Gamma Radiation Dosimetry Using Tellurium Dioxide Thin Film Structures

    Directory of Open Access Journals (Sweden)

    Olga Korostynska

    2002-08-01

    Full Text Available Thin films of Tellurium dioxide (TeO2 were investigated for γ-radiation dosimetry purposes. Samples were fabricated using thin film vapour deposition technique. Thin films of TeO2 were exposed to a 60Co γ-radiation source at a dose rate of 6 Gy/min at room temperature. Absorption spectra for TeO2 films were recorded and the values of the optical band gap and energies of the localized states for as-deposited and γ-irradiated samples were calculated. It was found that the optical band gap values were decreased as the radiation dose was increased. Samples with electrical contacts having a planar structure showed a linear increase in current values with the increase in radiation dose up to a certain dose level. The observed changes in both the optical and the electrical properties suggest that TeO2 thin film may be considered as an effective material for room temperature real time γ-radiation dosimetry.

  15. Enhancement of Au-Ag-Te contents in tellurium-bearing ore minerals via bioleaching

    Science.gov (United States)

    Choi, Nag-Choul; Cho, Kang Hee; Kim, Bong Ju; Lee, Soonjae; Park, Cheon Young

    2018-03-01

    The purpose of this study was to enhance the content of valuable metals, such as Au, Ag, and Te, in tellurium-bearing minerals via bioleaching. The ore samples composed of invisible Au and Au paragenesis minerals (such as pyrite, chalcopyrite, sphalerite and galena) in combination with tellurium-bearing minerals (hessite, sylvanite and Tellurobismuthite) were studied. Indigenous microbes from mine drainage were isolated and identified as Acidithiobacillus ferrooxidans, which were used in bioleaching after adaption to copper. The effect of the microbial adaption on the bioleaching performance was then compared with the results produced by the non-adaptive process. The microbial adaption enhanced the Au-Ag-Te contents in biological leaching of tellurium-bearing ore minerals. This suggests that bioleaching with adapted microbes can be used both as a pretreatment and in the main recovery processes of valuable metals.

  16. Status of tellurium--hastelloy N studies in molten fluoride salts

    International Nuclear Information System (INIS)

    Keiser, J.R.

    1977-10-01

    Tellurium, which is a fission product in nuclear reactor fuels, can embrittle the surface grain boundaries of nickel-base structural materials. This report summarizes results of an experimental investigation conducted to understand the mechanism and to develop a means of controlling this embrittlement in the alloy Hastelloy N. The addition of a chromium telluride to salt can be used to provide small partial pressures of tellurium simulating a reactor environment where tellurium appears as a fission product. The intergranular embrittlement produced in Hastelloy N when exposed to this chromium telluride-salt mixture can be reduced by adding niobium to the Hastelloy N or by controlling the oxidation potential of the salt in the reducing range

  17. Selective floatation-spectrophotometric determination of tellurium (4) with papaverine and butyl rhodamine B

    International Nuclear Information System (INIS)

    Skripchuk, V.G.

    1981-01-01

    It is shown, that papaverine reacts with a bromide complex of tellurium (4) to form a compound readily floated by toluene. The floatation is carried out from an aqueous solution, 5.2 M in H 2 SO 4 , 0.2 M in KBr and 5.4x10 -3 M in papaverine. The absorbance is a function of tellurium (4) concentration over a range of 5-100 μg Te/5 ml. Such a highly sensitive reagent as butylrhodamine B can be effectively substituted for papaverine. The floatation results in better selectivity. The method makes it possible to determine tellurium in blister, anodic and cathodic copper without matrix preseparation [ru

  18. The defects produced by electron irradiation in tellurium-doped germanium

    International Nuclear Information System (INIS)

    Fukuoka, Noboru; Saito, Haruo

    1989-01-01

    The nature of the irradiation induced defects in a germanium single crystal doped with tellurium was studied by DLTS and electrical measurements. The E c -0.21 eV level produced by irradiation with 1.5 MeV electrons was studied using the DLTS technique. It was found that the defect associated with this level is a divacancy. The E-center like defect (group V impurity-vacancy pair) introduces the E c -0.20 eV level in samples doped with a group V impurity. The level introduced by a tellurium (group VI impurity)-vacancy pair is deeper. The E c -0.16 eV level was generated by annealing at 430 K. A tellurium-vacancies complex is proposed as the defect associated with this level. (author)

  19. Determination of half life of tellurium isotopes: a proposal for the teaching of nuclear physics

    International Nuclear Information System (INIS)

    Ruivo, Julio C.; Zamboni, Cibele B.; Batista, Wagner F.

    2013-01-01

    This work aimed at the development of courseware for teaching nuclear physics, using experimental data of half-life measurement (T1/2) of Tellurium isotopes (A=127 and 131). The choice of Tellurium was established for providing nuclear data, which are fundamental in related investigations of nuclear structure and its use in various areas such as geochemistry, chemical and pharmaceutical industries, astrophysics etc. For evaluation of the proposal performance, the material was made available, bringing a lot of information about nuclear safety, production and storage of radioactive material and concepts of radioactive decay, subatomic particles, emission of gamma radiation, half-life, etc.

  20. Determination of half life of tellurium isotopes: a proposal for the teaching of nuclear physics

    Energy Technology Data Exchange (ETDEWEB)

    Ruivo, Julio C.; Zamboni, Cibele B.; Batista, Wagner F., E-mail: julio.ruivo.costa@usp.br, E-mail: czamboni@ipen.br, E-mail: fisicawagner@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    This work aimed at the development of courseware for teaching nuclear physics, using experimental data of half-life measurement (T1/2) of Tellurium isotopes (A=127 and 131). The choice of Tellurium was established for providing nuclear data, which are fundamental in related investigations of nuclear structure and its use in various areas such as geochemistry, chemical and pharmaceutical industries, astrophysics etc. For evaluation of the proposal performance, the material was made available, bringing a lot of information about nuclear safety, production and storage of radioactive material and concepts of radioactive decay, subatomic particles, emission of gamma radiation, half-life, etc.

  1. Electrochemical and antimicrobial activity of tellurium oxide nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Gupta, Pramod K. [Department of Applied Sciences and Humanities, Jamia Millia Islamia, New Delhi 110067 (India); Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India); Sharma, Prem Prakash; Sharma, Anshu [Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India); Khan, Zishan H., E-mail: zishan_hk@yahoo.co.in [Department of Applied Sciences and Humanities, Jamia Millia Islamia, New Delhi 110067 (India); Solanki, Pratima R., E-mail: pratimarsolanki@gmail.com [Special Centre for Nanosciences, Jawaharlal Nehru University, New Delhi 110067 (India)

    2016-09-15

    Highlights: • TeO{sub 2} NPs synthesized without using any catalyst by chemical vapour deposition method. • The growth temperature was 410 °C with continuous flow of O{sub 2.} • TeO{sub 2} NPs have anti-bacterial activity against E. coli, K. pneumoniae and S. aureus while enhances the growth of S. pyogenes. • TeO{sub 2} shows maximum redox current at pH 7 for phosphate buffer solution. - Abstract: Thin film of tellurium oxide (TeO{sub 2}) has been synthesized by chemical vapour deposition method onto indium tin oxide (ITO) coated glass substrate without using any catalyst. XRD pattern of TeO{sub 2} thin film suggests that the structure of TeO{sub 2} changes from amorphous to crystalline (paratellurite) on dispersing into deionized water. Zeta potential measurement reveals a positive surface potential of 28.8 mV. TEM images shows spherical shaped TeO{sub 2} nanoparticles having average particle size of 65 nm. Electrochemical studies of TeO{sub 2}/ITO electrode exhibit improved electron transfer owing to its inherent electron transfer property at pH 7.0 of phosphate buffer. Antimicrobial activity of TeO{sub 2} has been studied for gram-positive (Staphylococcus aureus and Streptococcus pyogenes) and gram negative (Escherichia coli and Klebsiella pneumoniae) bacterial and fungal strains (Aspergillus nizer and Candida albicans). These studies suggest that the TeO{sub 2} NPs inhibit the growth of E. coli, K. pneumoniae and S. aureus bacteria, whereas the same particles enhance the growth of S. pyogenes bacteria.

  2. Mechanism of tellurium isomers excitation in (γ, n) reactions

    International Nuclear Information System (INIS)

    Mazur, V.M.; Symochko, D.M.; Bigan, Z.M.; Poltorzhytska, T.V.; Derechkey, P.S.

    2012-01-01

    Isomeric yield ratios for the 119 Te, 121 Te, 123 Te, 127 Te, 129 Te nuclei were obtained in (γ, n) reactions with bremsstrahlung end point energies ranging 10 - 22 MeV with δE = 0.5 MeV step. Experimental isomeric ratios were used to calculate the cross-sections of (γ, n) m reactions, that were further compared with TALYS-1.4 calculations

  3. Magnetic resonance force microscopy quantum computer with tellurium donors in silicon.

    Science.gov (United States)

    Berman, G P; Doolen, G D; Hammel, P C; Tsifrinovich, V I

    2001-03-26

    We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines well-developed silicon technology and expected advances in MRFM. Our proposal does not use electrostatic gates to realize quantum logic operations.

  4. Magnetic Resonance Force Microscopy Quantum Computer with Tellurium Donors in Silicon

    International Nuclear Information System (INIS)

    Berman, G. P.; Doolen, G. D.; Hammel, P. C.; Tsifrinovich, V. I.

    2001-01-01

    We propose a magnetic resonance force microscopy (MRFM)-based nuclear spin quantum computer using tellurium impurities in silicon. This approach to quantum computing combines well-developed silicon technology and expected advances in MRFM. Our proposal does not use electrostatic gates to realize quantum logic operations

  5. Electric field fluctuations in liquid tellurium alloys a hint to bond character

    NARCIS (Netherlands)

    Paulick, C.A.; Brinkmann, R.; Elwenspoek, Michael Curt; von Hartrott, M.; Kiehl, M.; Maxim, P.; Quitmann, D.

    1985-01-01

    Atomic scale electric field fluctuations in liquid tellurium alloys are detected as they induce nuclear spin relaxation rate RQ in noble gas impurity atoms, via quadrupolar interaction. Results for Xe in liquid Ag, Ga, In, Tl, Ge, Sn---Te alloys are discussed, assuming that bonding in these alloys

  6. Subnanosecond pulse measurements of 10.6 μm radiation with tellurium

    NARCIS (Netherlands)

    Haselhoff, E.H.; Bonnie, R.J.M.; Ernst, G.J.; Witteman, W.J.

    1988-01-01

    Subnanosecond infrared pulses have been measured by noncollinear secondharmonic generation in tellurium. The method is very practical because due to the high refractive index the fine tuning of the phase matching is easily obtained by rotating the crystal around the optic axis.

  7. Dismantling and chemical characterization of spent Peltier thermoelectric devices for antimony, bismuth and tellurium recovery.

    Science.gov (United States)

    Balva, Maxime; Legeai, Sophie; Garoux, Laetitia; Leclerc, Nathalie; Meux, Eric

    2017-04-01

    Major uses of thermoelectricity concern refrigeration purposes, using Peltier devices, mainly composed of antimony, bismuth and tellurium. Antimony was identified as a critical raw material by EU and resources of bismuth and tellurium are not inexhaustible, so it is necessary to imagine the recycling of thermoelectric devices. That for, a complete characterization is needed, which is the aim of this work. Peltier devices were manually dismantled in three parts: the thermoelectric legs, the alumina plates on which remain the electrical contacts and the silicone paste used to connect the plates. The characterization was performed using five Peltier devices. It includes mass balances of the components, X-ray diffraction analysis of the thermoelectric legs and elemental analysis of each part of the device. It appears that alumina represents 45% of a Peltier device in weight. The electrical contacts are mainly composed of copper and tin, and the thermoelectric legs of bismuth, tellurium and antimony. Thermoelectric legs appear to be Se-doped Bi 2 Te 3 and (Bi 0,5 Sb 1,5 )Te 3 for n type and p type semiconductors, respectively. This work shows that Peltier devices can be considered as a copper ore and that thermoelectric legs contain high amounts of bismuth, tellurium and antimony compared to their traditional resources.

  8. Thermoelectric properties of electrodeposited tellurium films and the sodium lignosulfonate effect

    International Nuclear Information System (INIS)

    Abad, Begoña; Rull-Bravo, Marta; Hodson, Stephen L.; Xu, Xianfan; Martin-Gonzalez, Marisol

    2015-01-01

    The effect of the addition of a surfactant, sodium lignosulfonate (SLS), on the thermoelectric properties of tellurium films prepared by electrochemical deposition is studied. The growth mechanism is found to have an important role in the thermoelectric properties since the grain size of the films is sharply reduced when the surfactant is added to the solution. For this reason, the electrical resistivity of the tellurium films when the surfactant is not added is 229 μΩ·m, which is lower than 798 μΩ·m with SLS. The Seebeck coefficient values are not influenced, with values in the vicinity of 285 μV/K for both solutions. The power factor resulted higher values than previous works, reaching values of 280 μW/m·K 2 (without SLS) and 82 μW/m·K 2 (with SLS) at room temperature. Finally, the thermal conductivity was measured by means of the Photoacoustic technique, which showed values of the order of 1 W/m·K for both solutions, which is a factor of 3 less than the bulk value of tellurium. A notable observation is that the power factor and the thermal conductivity of electrodeposited tellurium films have the same order of magnitude of bismuth telluride films grown by electrodeposition. The figure of merit is estimated to be approximately one order of magnitude higher than the bulk value, 0.09 without SLS and 0.03 with SLS, both at room temperature

  9. Determination of spins and radioactive widths of tellurium nuclear levels with capturre gamma rays

    International Nuclear Information System (INIS)

    Bianchini, F.G.

    1973-01-01

    Spins and levels widths of the tellurium, mainly 128 Te and 130 Te, were determinated by gamma spectroscopy. Measurements of inelastic and elastic scattering, angular distribution and scattering temperature dependence, were still made. Energy levels of this isotopes, were also determinated [pt

  10. Simultaneous determination of selenium and tellurium in native sulfur by atomic absorption spectrophotometry

    International Nuclear Information System (INIS)

    Arikawa, Yoshiko; Hirai, Shoji; Ozawa, Takejiro.

    1979-01-01

    A method for the determination of selenium and tellurium in native sulfur has been investigated by means of atomic absorption spectrophotometry. Native sulfur collected from around fumarole or volcanic crater is ground down into powder, a portion of which weighing 1 g is subjected to analysis. A 2.6% (w/v) sodium hydroxide solution is added by 10 ml to the sample in a teflon beaker, and the mixture is then heated on a hot plate. Sulfur is decomposed and dissolved in the form of disulfide and thiosulfate. A 30% hydrogenperoxide solution is added by 10 ml to oxidize them to sulfate. At the same time selenium and tellurium contained in the sulfur sample are also thought to be oxidized to Se(VI) and Te(VI) states. The solution is neutralized with hydrochloric acid and diluted with distilled water to 100 ml. The sample solution thus prepared is sprayed into the air-acetylene flame of the atomic absorption spectrophotometer. The absorbance is measured at 195.9 nm for selenium and 214.2 nm for tellurium. Calibration curve is prepared by measuring the absorbances of the solutions prepared as follows. One gram portions of pure sulfur (99.9999%) are decomposed as for the samples. After neutralization, standard solutions containing each same amount of selenium and tellurium (0 -- 1000 μg) are added to the sulfur solution and then diluted with water to 100 ml. The standard deviations were estimated to be 50.4 ppm for selenium at 756 ppm and 16.6 ppm for tellurium at 587 ppm. For the check of the reliability of the method, results were compared with those obtained by neutron activation analysis. Results obtained by both methods showed good agreement. (author)

  11. Technical meeting of project counterparts on 'Cyclotron production of Iodine-123'. Report

    International Nuclear Information System (INIS)

    2002-01-01

    Several cyclotron laboratory facilities are very much interested in the production of Iodine-123 for medical applications in view of its optimal physical and chemical properties. Some of these countries have in the past used the solid target technology based on utilization of enriched Tellurium targets and are currently involved in the development of enriched Xenon-124 gas targets to improved radionuclidic purity as required by the needs of modern nuclear medicine. With the purpose of discussing the advances in the later route of production and to foster mutual co-operation among the developing countries interested in this technology, a meeting was convened with the participation of scientists from Argentina, Brazil, Iran, Korea and Syria. A scientist from the United States was also invited as an expert to provide advise on particular aspects of the technology. This publication contains as an annex technical reports from the participating institutions. All of these reports have been separately indexed and provided with abstracts

  12. Large-scale synthesis of Tellurium nanostructures via galvanic displacement of metals

    Science.gov (United States)

    Kok, Kuan-Ying; Choo, Thye-Foo; Ubaidah Saidin, Nur; Rahman, Che Zuraini Che Ab

    2018-01-01

    Tellurium (Te) is an attractive semiconductor material for a wide range of applications in various functional devices including, radiation dosimeters, optical storage materials, thermoelectric or piezoelectric generators. In this work, large scale synthesis of tellurium (Te) nanostructures have been successfully carried out in different concentrations of aqueous solutions containing TeO2 and NaOH, by galvanic displacements of Zn and Al which served as the sacrificial materials. Galvanic displacement process is cost-effective and it requires no template or surfactant for the synthesis of nanostructures. By varying the concentrations of TeO2 and NaOH, etching temperatures and etching times, Te nanostructures of various forms of nanostructures were successfully obtained, ranging from one-dimensional needles and rod-like structures to more complex hierarchical structures. Microscopy examinations on the nanostructures obtained have shown that both the diameters and lengths of the Te nanostructures increased with increasing etching temperature and etching time.

  13. Equilibrium state of delta-phase with tellurium in the Sb-Bi-Te system

    International Nuclear Information System (INIS)

    Gajgukova, V.S.; Dudkin, L.D.; Erofeev, R.S.; Musaelyan, V.V.; Nadzhip, A.Eh.; Sokolov, O.B.

    1978-01-01

    A research has been carried out with a view to establish the equilibrium state of delta-phase of the composition (Sbsub(1-x)Bisub(x)) 2 Te 3 with tellurium, depending on x and temperature. The Hall effect, the thermoelectromotive force, and the electric conductivity of the samples of Sb-Bi-Te alloys have been measured, the samples being annealed at various temperatures (550 to 250 deg C). The measurement results have shown that as the Bi 2 Te 3 content in the solid solutions increases and temperature decreases, the delta-phase-Te boundary monotonously approaches the stoichiometric composition. Using the research carrid out as the basis, the general character of the equilibrium delta-phase with tellurium boundary has been rendered more precise in Sb-Bi-Te system, depending on the temperature and Bi content (up to 25 at.%)

  14. GALVANIC MAGNETIC PROPERTIES OF BISMUTH THIN FILMS DOPED WITH TELLURIUM MADE BY THERMAL VACUUM EVAPORATION

    Directory of Open Access Journals (Sweden)

    V. A. Komarov

    2013-01-01

    Full Text Available The influence of n-type impurity of tellurium (concentration range from 0.005 atomic % Te to 0.15 atomic % Te on galvanic magnetic properties (resistivity, magnetic resistance and Hall constant of Bi thin films with various thicknesses was studied. The properties were measured in temperature range from 77 to 300 K. It was established that the classical size effect in the films is significant and decreases with higher concentration of Te impurity. The analysis of experimental results was carried out in approximation of the law of Jones-Schoenberg dispersion for Bi films doped with tellurium. Calculation of concentration and mobility of charge carriers in the studied films was made.

  15. The dependence of the texture of tellurium thin films on vacuum deposition angle

    International Nuclear Information System (INIS)

    Cocks, F.H.; Peterson, M.J.; Jones, P.L.

    1980-01-01

    Vacuum-deposited tellurium thin films can show substantially different surface morphologies depending on the angle with which the vapor stream impinges on the substrate surface. These tellurium thin films have a tendency to grow as acicular crystallites but as the deposition angle is increased so that the vapor stream becomes tangential to the substrate surface the spacing between crystallites increases and approaches, at stream angles of approximately 80 0 from the normal, dimensions roughly once or twice the average wavelength of visible light. Such films may have application in solar energy collector systems because of the high absorptivity of sunlight shown by such films. Mechanisms which describe the tendency for crystallite spacing to increase with increasing angle are discussed. (Auth.)

  16. Acousto-optic measurements of ultrasound attenuation in tellurium dioxide crystal

    International Nuclear Information System (INIS)

    Voloshinov, V. B.; Lemyaskina, E. A.

    1996-01-01

    The paper is devoted to experimental investigation of ultrasound propagation in tellurium dioxide monocrystal. In particular, attenuation of slow shear acoustic modes in the crystal was measured. The measurements were performed by acousto-optic methods using probing of acoustic column by a laser beam. The paper describes measurements of acoustic attenuation coefficient for slow shear ultrasonic waves propagating at an angle =4.5 O with respect to the (110) direction in the (110) plane. The investigation was made at acoustic frequency f = 100 MHz with pulsed acoustic waves and with an optical beam of a He-Ne laser. It is found that the attenuation coefficient is α = 0.57 cm -1 ± 15 %. The attenuation at acoustic frequencies f ≥ 100 MHz influences performance characteristics of acousto-optical devices based on tellurium dioxide. As proved, spectral resolution of a quasicollinear acoustooptic filter decreases by a factor of 2 compared to a case of the attenuation absence. (authors)

  17. Evaluated phase diagrams of binary metal-tellurium systems of the D-block transition elements

    International Nuclear Information System (INIS)

    Chattopadhyay, G.; Bharadwaj, S.R.

    1989-01-01

    The binary phase diagrams of metal-tellurium systems for twenty seven d-block transition elements have been critically evaluated. Complete phase diagrams are presented for the elements, chromium, manganese, iron, cobalt, nickel, copper, molybdenum, palladium, silver, lanthanum, platinum and gold, whereas, for scandium, titanium, vanadium, yttrium, zirconium, niobium, technitium, ruthenium, rhodium, hafnium, tantalum, tungsten , rhenium, osmium and iridium, the phase diagrams are incomplete and tentative. (author). 20 refs., 27 tabs., 27 figs

  18. Exploring molecular and spin interactions of Tellurium adatom in reduced graphene oxide

    Energy Technology Data Exchange (ETDEWEB)

    Alegaonkar, Ashwini [Department of Chemistry, Savitribai Phule Pune University (Formerly University of Pune), Ganeshkhind, Pune, 411 007, MS (India); Alegaonkar, Prashant [Department of Applied Physics, Defence Institute of Advance Technology, Girinagar, Pune, 411 025, MS (India); Pardeshi, Satish, E-mail: skpar@chem.unipune.ac.in [Department of Chemistry, Savitribai Phule Pune University (Formerly University of Pune), Ganeshkhind, Pune, 411 007, MS (India)

    2017-07-01

    The transport of spin information fundamentally requires favourable molecular architecture and tunable spin moments to make the medium pertinent for spintronic. We report on achieving coherent molecular-spin parameters for rGO due to Tellurium (Te) adatom. Initially, GO prepared using graphite, was modified into rGO by in situ incorporation of 1 (w/w)% of Te. Both the systems were subjected to ESCA, FTIR, Raman dispersion, ESR spectroscopy, and electron microscopy. Analysis revealed that, Te substantially reacted with epoxides, carbonyl, and carboxylate groups that improved C-to-O ratio by twice. However, the spin splitting character, between Te and C, seems to be quenched. Moreover, Te altered the dynamical force constant between C-C and C=C that generated the mechanical stress within rGO network. The layer conjugation, nature of folding, symmetry, and electronic states of the edges were also affected by precipitation and entrapment of Te. The calculated dynamic molecular Raman and ESR spin parameters indicated that, Te acted as a bridging element for long range spin transport. This is particularly due to, the p-orbital moments of Te contributing, vectorially, to spin relaxation process operative at broken inversion symmetry sites. Our study suggests that, facile addition of Te in rGO is useful to achieve favourable spintronic properties. - Highlights: • Spin interactions and molecular dynamics modification due to Tellurium adatom in rGO. • Molecular level manipulation of Tellurium adatom for favourable spintronic properties. • Bychocov-Rashaba coupling are the operative channels in rGO. • Extrinsic coupling component get added vectorially by Tellurium. • Te-rGO is a viable medium for molecular spintronics.

  19. The effect of hydrostatic pressure on the anomalous sign reversal of the Hall coefficient in tellurium

    International Nuclear Information System (INIS)

    Balynas, V.; Dobrovolskis, Z.; Krotkus, A.; Hoerstel, W.

    1981-01-01

    In order to obtain information about the pressure behaviour of the higher lying second conduction band the dependences of the Hall coefficient of single crystalline tellurium on temperature (300 to 500 K) have been measured at atmospheric pressure and hydrostatic pressures of 500 and 800 MPa. The separation between the two conduction bands in Te decreases with increasing pressure. The anomalous sign reversal of the Hall coefficient can be well explained by a double-conduction band model

  20. Electrochemical characterization of the underpotential deposition of tellurium on Au electrode

    International Nuclear Information System (INIS)

    Zhu, W.; Yang, J.Y.; Zhou, D.X.; Bao, S.Q.; Fan, X.A.; Duan, X.K.

    2007-01-01

    Electrochemical characterization of the underpotential deposition (UPD) of tellurium on Au substrate has been performed in this paper. The mechanism of Te deposition and its voltammetry dependence on the Te ion concentration were studied, and it suggests that variations in the metal ion concentration may affect the UPD process kinetics. The effect of tellurium adsorbates on UPD behavior of Te has also been investigated. The results show that the tellurium adsorbates could be irreversibly adsorbed upon the Au substrate surface under the open-circuit conditions. Subsequent removal of the Te adsorbates was also proved to be very difficult within the Au double-layer region, and a standard electrochemical cleaning procedure is necessary to remove the Te adsorbates completely. When the potential was cycled into the Au oxidation region, a substantial loss of Te adsobates was observed, which occurs simultaneously with the Au oxidation features. Scan rate dependent cyclic voltammetry experiments reveal that the peak current in the Te UPD peak is not a linear function of the scan rate, ν, but of a 2/3 power of the scan rate, ν 2/3 . It is in good consistent with a two-dimension nucleation and growth mechanism

  1. Iodine-129 in thyroids and tellurium isotopes in meteorites by neutron activation analysis

    International Nuclear Information System (INIS)

    Ballad, R.V.

    1978-06-01

    A combination of neutron activation and mass spectrometry has been used to determine the concentration of fissiogenic 129 I and the value of the 129 I/ 127 I ratio in thyroids of man, cow, and deer from Missouri. Deer thyroids show an average value of 129 I/ 127 I = 1.8 x 10 -8 and an average concentration of 3 x 10 -3 pCi 129 I per gram of thyroid (wet weight). Thyroids of cows and humans show successively lower values for the 129 I/ 127 I ratio and the 129 I content because their diets dilute fission-produced 129 I in the natural iodine cycle with mineral iodine. The results of analyses on a few thyroids from other geographic areas are also reported. The isotopic compositions of tellurium, krypton, and xenon were determined in acid-resistant residues of the Allende meteorite. Neutron activation and γ-counting were used to determine the relative abundances of six tellurium isotopes, and mass spectrometry was used to determine the isotopic compositions of krypton and xenon in aliquots of the same residues. Nucleogenetic anomalies were observed in the isotopic compositions of these three elements. The presence of isotopically distinct components of tellurium, krypton, and xenon in these residues provides strong support for the suggestion that our solar system formed directly from the debris of a supernova

  2. Hydrogen-assisted post-growth substitution of tellurium into molybdenum disulfide monolayers with tunable compositions

    Science.gov (United States)

    Yin, Guoli; Zhu, Dancheng; Lv, Danhui; Hashemi, Arsalan; Fei, Zhen; Lin, Fang; Krasheninnikov, Arkady V.; Zhang, Ze; Komsa, Hannu-Pekka; Jin, Chuanhong

    2018-04-01

    Herein we report the successful doping of tellurium (Te) into molybdenum disulfide (MoS2) monolayers to form MoS2x Te2(1-x) alloy with variable compositions via a hydrogen-assisted post-growth chemical vapor deposition process. It is confirmed that H2 plays an indispensable role in the Te substitution into as-grown MoS2 monolayers. Atomic-resolution transmission electron microscopy allows us to determine the lattice sites and the concentration of introduced Te atoms. At a relatively low concentration, tellurium is only substituted in the sulfur sublattice to form monolayer MoS2(1-x)Te2x alloy, while with increasing Te concentration (up to ˜27.6% achieved in this study), local regions with enriched tellurium, large structural distortions, and obvious sulfur deficiency are observed. Statistical analysis of the Te distribution indicates the random substitution. Density functional theory calculations are used to investigate the stability of the alloy structures and their electronic properties. Comparison with experimental results indicate that the samples are unstrained and the Te atoms are predominantly substituted in the top S sublattice. Importantly, such ultimately thin Janus structure of MoS2(1-x)Te2x exhibits properties that are distinct from their constituents. We believe our results will inspire further exploration of the versatile properties of asymmetric 2D TMD alloys.

  3. The characterisation of vapour-phase alkali metal-tellurium-oxygen species

    International Nuclear Information System (INIS)

    Gomme, R.A.; Ogden, J.S.; Bowsher, B.R.

    1986-10-01

    Detailed assessments of hypothetical severe accidents in light water reactors require the identification of the chemical forms of the radionuclides in order to determine their transport characteristics. Caesium and tellurium are important volatile fission products in accident scenarios. This report describes detailed studies to characterise the chemical species that vaporise from heated mixtures of various alkali metal-tellurium-oxygen systems. The molecular species were characterised by a combination of quadrupole mass spectrometry and matrix isolation-infrared spectroscopy undertaken in conjunction with experiments involving oxygen-18 substitution. The resulting spectra were interpreted in terms of a vapour-phase molecule with the stoichiometry M 2 TeO 3 (M = K,Rb,Cs) for M/Te molecular ratios of ∼ 2, and polymeric species for ratios < 2. This work has demonstrated the stability of caesium tellurite. The formation of this relatively low-volatility, water-soluble species could significantly modify the transport and release of caesium and tellurium. The data presented in this report should allow more comprehensive thermodynamic calculations to be undertaken that assist in the quantification of fission product behaviour during severe reactor accidents. (author)

  4. Influence of ion beam irradiation induced defects on the structural, optical and electrical properties of tellurium nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Narinder [Department of Physics, Chaudhary Devi Lal University, Sirsa, 125055 (India); Department of Physics, Haryana College of Technology & Management, Kaithal, 136027 (India); Kumar, Rajesh [Department of Physics, RN College of Engineering & Technology, Madlauda, 132104 (India); Kumar, Sushil, E-mail: sushil_phys@rediffmail.com [Department of Physics, Chaudhary Devi Lal University, Sirsa, 125055 (India); Chakarvarti, S.K. [Research and Development, Manav Rachana International University, Faridabad, 121001 (India)

    2016-11-01

    In this study, tellurium nanowires were electrodeposited into the polymer membranes from aqueous acidic bath containing HTeO{sub 2}{sup +} ions. The field emission scanning electron microscopy (FESEM) images confirmed the formation of uniform and straight nanowires. The influence of 110 MeV Ni{sup 8+} ion irradiation induced defects on the structural, optical and electrical properties of as–deposited tellurium nanowires were examined using X-ray diffraction (XRD), UV–visible absorption spectroscopy and current–voltage (I–V) measurements. The XRD data depicted the hexagonal phase of tellurium nanowires and further revealed a variation in the intensity of diffraction peaks of ion irradiated nanowires. Williamson–Hall (WH) analysis is used for convoluting the size and microstrain contributions to the width of diffraction peaks. Tellurium nanowires exhibited a distinct absorbance band in the visible region at 686 nm, while this was absent in bulk tellurium. Electrical properties of nanowires are explored on the basis of I–V curves, which revealed a significant increase in the electrical conductivity of irradiated nanowires. A possible mechanism for the enhanced electrical conductivity is the increase in carrier concentration due to thermally excited defects. The defects produced by ion irradiation play a vital role in modifying the properties of semiconducting nanowires. - Highlights: • 110 MeV Ni{sup 8+} ion beam induced changes in tellurium nanowires have been examined. • Nanowires were prepared using template electrodeposition method. • Irradiation improved the electrical conductivity of tellurium nanowires. • Mechanism for enhanced electrical conductivity of irradiated nanowires was discussed.

  5. First example of a high-level correlated calculation of the indirect spin-spin coupling constants involving tellurium

    DEFF Research Database (Denmark)

    Rusakov, Yury Yu; Krivdin, Leonid B.; Østerstrøm, Freja From

    2013-01-01

    This paper documents a very first example of a high-level correlated calculation of spin-spin coupling constants involving tellurium taking into account relativistic effects, vibrational corrections and solvent effects for the medium sized organotellurium molecules. The 125Te-1H spin-spin coupling...... constants of tellurophene and divinyl telluride were calculated at the SOPPA and DFT levels in a good agreement with experiment. A new full-electron basis set av3z-J for tellurium derived from the "relativistic" Dyall's basis set, dyall.av3z, and specifically optimized for the correlated calculations...... of spin-spin coupling constants involving tellurium, was developed. The SOPPA methods show much better performance as compared to 15 those of DFT, if relativistic effects calculated within the ZORA scheme are taken into account. Vibrational and solvent corrections are next to negligible, while...

  6. Site-specific nucleation and controlled growth of a vertical tellurium nanowire array for high performance field emitters

    International Nuclear Information System (INIS)

    Safdar, Muhammad; Zhan Xueying; Mirza, Misbah; Wang Zhenxing; Sun Lianfeng; He Jun; Niu Mutong; Zhang Jinping; Zhao Qing

    2013-01-01

    We report the controlled growth of highly ordered and well aligned one-dimensional tellurium nanostructure arrays via a one-step catalyst-free physical vapor deposition method. The density, size and fine structures of tellurium nanowires are systematically studied and optimized. Field emission measurement was performed to display notable dependence on nanostructure morphologies. The ordered nanowire array based field emitter has a turn-on field as low as 3.27 V μm −1 and a higher field enhancement factor of 3270. Our finding offers the possibility of controlling the growth of tellurium nanowire arrays and opens up new means for their potential applications in electronic devices and displays. (paper)

  7. Neutron capture in 122,123,124Te: A critical test for s-process studies

    International Nuclear Information System (INIS)

    Wisshak, K.; Voss, F.; Kaeppeler, F.; Reffo, G.

    1991-11-01

    The neutron capture cross sections of 122,123,124,125,126 Te were measured in the energy range from 10 to 200 keV at the Karlsruhe Van de Graaff accelerator using gold as a standard. Neutrons were produced via the 7 Li(p,n) 7 Be reaction by bombarding metallic Li targets with a pulsed proton beam. Capture events were registered with the Karlsruhe 4π Barium Fluoride Detector. Several runs have been performed under different experimental conditions to study the systematic uncertainties in detail. The cross section ratios were determined with an overall uncertainty of ∝ 1%. This is an improvement by about a factor of five compared to the existing data. Maxwellian averaged neutron capture cross sections were calculated for thermal energies between kT=10 and 100 keV by normalizing the cross section shape up to 600 keV neutron energy reported in literature to the present data. These stellar cross sections were used in an s-process analysis. With the classical approach the abundances of the three s-only isotopes 122,123,124 Te could be reproduced within the experimental uncertainties of ∝ 1%. The accuracy of the present data allowed also to derive constraints for the existing stellar models with respect to the effective neutron density. Furthermore, the p-process abundances for the tellurium isotopes are discussed. (orig.) [de

  8. Intergranular tellurium cracking of nickel-based alloys in molten Li, Be, Th, U/F salt mixture

    Science.gov (United States)

    Ignatiev, Victor; Surenkov, Alexander; Gnidoy, Ivan; Kulakov, Alexander; Uglov, Vadim; Vasiliev, Alexander; Presniakov, Mikhail

    2013-09-01

    In Russia, R&D on Molten Salt Reactor (MSR) are concentrated now on fast/intermediate spectrum concepts which were recognized as long term alternative to solid fueled fast reactors due to their attractive features: strong negative feedback coefficients, easy in-service inspection, and simplified fuel cycle. For high-temperature MSR corrosion of the metallic container alloy in primary circuit is the primary concern. Key problem receiving current attention include surface fissures in Ni-based alloys probably arising from fission product tellurium attack. This paper summarizes results of corrosion tests conducted recently to study effect of oxidation state in selected fuel salt on tellurium attack and to develop means of controlling tellurium cracking in the special Ni-based alloys recently developed for molten salt actinide recycler and tranforming (MOSART) system. Tellurium corrosion of Ni-based alloys was tested at temperatures up to 750 °C in stressed and unloaded conditions in molten LiF-BeF2 salt mixture fueled by about 20 mol% of ThF4 and 2 mol% of UF4 at different [U(IV)]/[U(III)] ratios: 0.7, 4, 20, 100 and 500. Following Ni-based alloys (in mass%): HN80М-VI (Mo—12, Cr—7.6, Nb—1.5), HN80МТY (Mo—13, Cr—6.8, Al—1.1, Ti—0.9), HN80МТW (Mo—9.4, Cr—7.0, Ti—1.7, W—5.5) and ЕМ-721 (W—25.2, Cr—5.7, Ti—0.17) were used for the study in the corrosion facility. If the redox state the fuel salt is characterized by uranium ratio [U(IV)]/[U(III)] uranium intermetallic compounds and alloys with nickel and molybdenum. This leads to spontaneous behavior of alloy formation processes on the specimens' surface and further diffusion of uranium deep into the metallic phase. As consequence of this films of intermetallic compounds and alloys of nickel, molybdenum, tungsten with uranium are formed on the alloys specimens' surface, and intergranular corrosion does not take place. In the fuel salt with [U(IV)]/[U(III)] = 4-20 the potentials of uranium

  9. Continuous removal and recovery of tellurium in an upflow anaerobic granular sludge bed reactor

    Energy Technology Data Exchange (ETDEWEB)

    Mal, Joyabrata, E-mail: joyabrata2006@gmail.com [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Nancharaiah, Yarlagadda V. [Biofouling and Biofilm Processes Section, Water and Steam Chemistry Division, Bhabha Atomic Research Centre, Kalpakkam, 603102, Tamil Nadu (India); Homi Bhabha National Institute, Anushakti Nagar Complex, Mumbai 400094 (India); Maheshwari, Neeraj [CNRS UMR 7338, BMBI University de Technologie Compiegne, 60200 Compiegne (France); Hullebusch, Eric D. van [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Université Paris-Est, Laboratoire Géomatériaux et Environnement (LGE), EA 4508, UPEM, 77454, Marne-la-Vallée (France); Lens, Piet N.L. [UNESCO-IHE, Westvest 7, 2611 AX Delft (Netherlands); Department of Chemistry and Bioengineering, Tampere University of Technology, P.O-Box 541, Tampere (Finland)

    2017-04-05

    Highlights: • Tellurite bioreduction coupled to recovery of biogenic Te(0) nanocrystals. • First report on continuous tellurite removal in a UASB reactor. • Biogenic Te(0) was mainly associated with loosely-bound EPS of granular sludge. • Repeated exposure to tellurite caused compositional changes in the EPS matrix. - Abstract: Continuous removal of tellurite (TeO{sub 3}{sup 2−}) from synthetic wastewater and subsequent recovery in the form of elemental tellurium was studied in an upflow anaerobic granular sludge bed (UASB) reactor operated at 30 °C. The UASB reactor was inoculated with anaerobic granular sludge and fed with lactate as carbon source and electron donor at an organic loading rate of 0.6 g COD L{sup −1} d{sup −1}. After establishing efficient and stable COD removal, the reactor was fed with 10 mg TeO{sub 3}{sup 2−} L{sup −1} for 42 d before increasing the influent concentration to 20 mg TeO{sub 3}{sup 2−} L{sup −1}. Tellurite removal (98 and 92%, respectively, from 10 and 20 mg Te L{sup −1}) was primarily mediated through bioreduction and most of the removed Te was retained in the bioreactor. Characterization using XRD, Raman spectroscopy, SEM-EDX and TEM confirmed association of tellurium with the granular sludge, typically in the form of elemental Te(0) deposits. Furthermore, application of an extracellular polymeric substances (EPS) extraction method to the tellurite reducing sludge recovered up to 78% of the tellurium retained in the granular sludge. This study demonstrates for the first time the application of a UASB reactor for continuous tellurite removal from tellurite-containing wastewater coupled to elemental Te(0) recovery.

  10. Continuous reduction of tellurite to recoverable tellurium nanoparticles using an upflow anaerobic sludge bed (UASB) reactor.

    Science.gov (United States)

    Ramos-Ruiz, Adriana; Sesma-Martin, Juan; Sierra-Alvarez, Reyes; Field, Jim A

    2017-01-01

    According to the U.S. Department of Energy and the European Union, tellurium is a critical element needed for energy and defense technology. Thus methods are needed to recover tellurium from waste streams. The objectives of this study was to determine the feasibility of utilizing upflow anaerobic sludge bed (UASB) reactors to convert toxic tellurite (Te IV ) oxyanions to non-toxic insoluble elemental tellurium (Te 0 ) nanoparticles (NP) that are amendable to separation from aqueous effluents. The reactors were supplied with ethanol as the electron donating substrate to promote the biological reduction of Te IV . One reactor was additionally amended with the redox mediating flavonoid compound, riboflavin (RF), with the goal of enhancing the bioreduction of Te IV . Its performance was compared to a control reactor lacking RF. The continuous formation of Te 0 NPs using the UASB reactors was found to be feasible and remarkably improved by the addition of RF. The presence of this flavonoid was previously shown to enhance the conversion rate of Te IV by approximately 11-fold. In this study, we demonstrated that this was associated with the added benefit of reducing the toxic impact of Te IV towards the methanogenic consortium in the UASB and thus enabled a 4.7-fold higher conversion rate of the chemical oxygen demand. Taken as a whole, this work demonstrates the potential of a methanogenic granular sludge to be applied as a bioreactor technology producing recoverable Te 0 NPs in a continuous fashion. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Continuous removal and recovery of tellurium in an upflow anaerobic granular sludge bed reactor

    International Nuclear Information System (INIS)

    Mal, Joyabrata; Nancharaiah, Yarlagadda V.; Maheshwari, Neeraj; Hullebusch, Eric D. van; Lens, Piet N.L.

    2017-01-01

    Highlights: • Tellurite bioreduction coupled to recovery of biogenic Te(0) nanocrystals. • First report on continuous tellurite removal in a UASB reactor. • Biogenic Te(0) was mainly associated with loosely-bound EPS of granular sludge. • Repeated exposure to tellurite caused compositional changes in the EPS matrix. - Abstract: Continuous removal of tellurite (TeO 3 2− ) from synthetic wastewater and subsequent recovery in the form of elemental tellurium was studied in an upflow anaerobic granular sludge bed (UASB) reactor operated at 30 °C. The UASB reactor was inoculated with anaerobic granular sludge and fed with lactate as carbon source and electron donor at an organic loading rate of 0.6 g COD L −1 d −1 . After establishing efficient and stable COD removal, the reactor was fed with 10 mg TeO 3 2− L −1 for 42 d before increasing the influent concentration to 20 mg TeO 3 2− L −1 . Tellurite removal (98 and 92%, respectively, from 10 and 20 mg Te L −1 ) was primarily mediated through bioreduction and most of the removed Te was retained in the bioreactor. Characterization using XRD, Raman spectroscopy, SEM-EDX and TEM confirmed association of tellurium with the granular sludge, typically in the form of elemental Te(0) deposits. Furthermore, application of an extracellular polymeric substances (EPS) extraction method to the tellurite reducing sludge recovered up to 78% of the tellurium retained in the granular sludge. This study demonstrates for the first time the application of a UASB reactor for continuous tellurite removal from tellurite-containing wastewater coupled to elemental Te(0) recovery.

  12. A new tellurium-containing amphiphilic molecule induces apoptosis in HCT116 colon cancer cells.

    Science.gov (United States)

    Du, Peng; Saidu, Nathaniel Edward Bennett; Intemann, Johanna; Jacob, Claus; Montenarh, Mathias

    2014-06-01

    Chalcogen-based redox modulators over the years have attracted considerable attention as anti-cancer agents. New selenium- and tellurium-containing compounds with a polar head group and aryl-groups of various lengths have recently been reported as biologically active in several organisms. In the present study, we used the most active of the tellurium compound DP41, and its selenium counterpart DP31 to investigate their effects on the human cancer cell line HCT116. Cells were treated with DP41 or DP31 and the formation of superoxide radicals was determined using dihydroethidium. Cell cycle analysis and apoptosis was determined by cytofluorimetry. Proteins involved in ER signaling and apoptosis were determined by Western blot analysis and fluorescence microscopy. With 50μM of DP41, we observed an increase in O2(-) formation. There was, however, no such increase in O2(-) after treatment with the corresponding selenium compound under the same conditions. In the case of DP41, the production of O2(-) radicals was followed by an up-regulation of Nrf2, HO-1, phospho-eIF2α and ATF4. CHOP was also induced and cells entered apoptosis. Unlike the cancer cells, normal retinal epithelial ARPE-19 cells did not produce elevated levels of O2(-) radicals nor did they induce the ER signaling pathway or apoptosis. The tellurium-containing compound DP41, in contrast to the corresponding selenium compound, induces O2(-) radical formation and oxidative and ER stress responses, including CHOP activation and finally apoptosis. These results indicate that DP41 is a redox modulating agent with promising anti-cancer potentials. Copyright © 2014 Elsevier B.V. All rights reserved.

  13. Simultaneous analysis of arsenic, antimony, selenium and tellurium in environmental samples using hydride generation ICPMS

    International Nuclear Information System (INIS)

    Jankowski, L.M.; Breidenbach, R.; Bakker, I.J.I.; Epema, O.J.

    2009-01-01

    Full text: A quantitative method for simultaneous analysis of arsenic, antimony, selenium and tellurium in environmental samples is being developed using hydride generation ICPMS. These elements must be first transformed into hydride-forming oxidation states. This is particularly challenging for selenium and antimony because selenium is susceptible to reduction to the non-hydride-forming elemental state and antimony requires strong reducing conditions. The effectiveness of three reducing agents (KI, thiourea, cysteine) is studied. A comparison is made between addition of reducing agent to the sample and addition of KI to the NaBH 4 solution. Best results were obtained with the latter approach. (author)

  14. Effect of tellurium on viscosity and liquid structure of GaSb melts

    Energy Technology Data Exchange (ETDEWEB)

    Ji Leilei [School of Material Science and Engineering, Jinan University, Jinan 250022 (China); Geng Haoran [School of Material Science and Engineering, Jinan University, Jinan 250022 (China)], E-mail: mse_genghr@ujn.edu.cn; Sun Chunjing [Key Laboratory of Liquid Structure and Heredity of Materials, Ministry of Education, Shandong University, Jinan 250061 (China); Teng Xinying; Liu Yamei [School of Material Science and Engineering, Jinan University, Jinan 250022 (China)

    2008-04-03

    The behavior of GaSb melt with tellurium addition was investigated using viscometer and differential scanning calorimetry (DSC). Normally, the viscosity of all melts measured decreased with the increasing temperature. However, anomalous transition points were observed in the temperature dependence of viscosity for Ga-Sb-Te system. Corresponded with the abnormal points on the viscosity-temperature curves, there were thermal effect peaks on the DSC curves. Furthermore, viscous activation energy and flow units of these melts and their structural features were discussed in this paper.

  15. Light-Induced Tellurium Enrichment on CdZnTe Crystal Surfaces Detected by Raman Spectroscopy

    International Nuclear Information System (INIS)

    Hawkins, Samantha A.; Villa-Aleman, Eliel; Duff, Martine C.; Hunter, Doug B.; Burger, Arnold; Groza, Michael; Buliga, Vladimir; Black, David R.

    2008-01-01

    CdZnTe (CZT) crystals can be grown under controlled conditions to produce high-quality crystals to be used as room-temperature radiation detectors. Even the best crystal growth methods result in defects, such as tellurium secondary phases, that affect the crystal's performance. In this study, CZT crystals were analyzed by micro-Raman spectroscopy. The growth of Te rich areas on the surface was induced by low-power lasers. The growth was observed versus time with low-power Raman scattering and was observed immediately under higher-power conditions. The detector response was also measured after induced Te enrichment.

  16. LIGHT INDUCED TELLURIUM ENRICHMENT ON CDZNTE CRYSTAL SURFACES DETECTED BY RAMAN SPECTROSCOPY

    International Nuclear Information System (INIS)

    Hawkins, S; Eliel Villa-Aleman, E; Martine Duff, M; Douglas Hunter, D

    2007-01-01

    Synthetic CdZnTe or 'CZT' crystals can be grown under controlled conditions to produce high quality crystals to be used as room temperature radiation detectors. Even the best crystal growth methods result in defects, such as tellurium secondary phases, that affect the crystal's performance. In this study, CZT crystals were analyzed by micro Raman spectroscopy. The growth of Te rich areas on the surface was induced by low powered lasers. The growth was observed versus time with low power Raman scattering and was observed immediately under higher power conditions. The detector response was also measured after induced Te enrichment

  17. Vaporization studies on elemental tellurium and selenium by Knudsen effusion mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Viswanathan, R., E-mail: rvis1953@gmail.com; Balasubramanian, R., E-mail: rbs@igcar.gov.in; Darwin Albert Raj, D., E-mail: darwinalbertraj1953@gmail.com; Sai Baba, M., E-mail: msb@igcar.gov.in; Lakshmi Narasimhan, T.S., E-mail: tslak@igcar.gov.in

    2014-08-01

    Highlights: • A detailed KEMS study of vaporization of elemental tellurium and selenium systems. • Clusters Te{sub i}(g) (i = 2 to 7) and Se{sub i}(g) (i = 2 to 9) identified over Te(s) and Se(s). • p–T relations for Te{sub i}(g) (590 to 690 K) and Se{sub i}(g) (380 to 480 K). • Vapor phase of Te dominated by Te{sub 2}(g) (∼95%) while that of Se by Se{sub 6}(g) (∼50%) and Se{sub 5}(g) (∼25%). • Sublimation and atomization enthalpies deduced for Te{sub i}(g) and Se{sub i}(g). - Abstract: Vaporization studies on elemental tellurium and selenium were conducted by Knudsen effusion mass spectrometry in the temperature range of 590–690 K and 380–480 K, respectively. The ionic species Te{sub i}{sup +} (i = 1–7) and Se{sub i}{sup +}(g) (i = 1–9) were detected in the mass spectra over these two condensed phases. Measurement of ion intensities were performed as a function of electron impact energy and as a function of temperature (at different electron impact energies) for identifying the gaseous precursor species as well as for determining the partial pressure–temperature relations and sublimation enthalpies for these species. While the major species over elemental tellurium was confirmed to be Te{sub 2}(g) (with all other gaseous species Te{sub 3}–Te{sub 7} put together constituting less than 5%), the major species over elemental selenium was found to be Se{sub 6}(g), closely followed by Se{sub 5}(g) (with other gaseous species Se{sub 2}–Se{sub 4} and Se{sub 7}–Se{sub 9} put together also moderately constituting ∼25%). From the partial pressures, the thermodynamic data for the sublimation reactions i Te(s) = Te{sub i}(g) and i Se(s) = Se{sub i}(g) were deduced by second- and third-law methods. The atomization enthalpies of tellurium and selenium clusters were also deduced by using the recommended enthalpies of formation of monomeric species. Comparison of the findings obtained in the present study with those in previous studies revealed

  18. Characterization of tellurium-based films for NO{sub 2} detection

    Energy Technology Data Exchange (ETDEWEB)

    Tsiulyanu, D. [Technical University, Department of Physics, bul. Dacia 41, MD-2060 Kishinau (Moldova, Republic of)]. E-mail: tsiu@cni.md; Tsiulyanu, A. [Technical University, Department of Physics, bul. Dacia 41, MD-2060 Kishinau (Moldova, Republic of); Liess, H.-D. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany); Eisele, I. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany)

    2005-08-01

    Sensing characteristics of tellurium-based thin films for NO{sub 2} monitoring was studied systematically. The influence of contact materials, thermal treatment, temperature and thickness of the samples on the electrical conductivity and sensitivity to NO{sub 2} with respect to scanning electron microscopy analyses is given. The possibility is shown to optimize the properties of the films for the development of a simple and stable NO{sub 2} sensor device with rapid response/recovery time and low operating temperature. The sensing mechanism is discussed for the direct interaction of gaseous species with lone-pair electrons of chalcogen atoms.

  19. Influence of the hydrolysis conditions on the properties of tellurium coatings obtained from hydrochloric acid baths

    International Nuclear Information System (INIS)

    Bigelis, V.M.; Kim, G.N.; Navalikhin, L.V.; Kalanov, M.; Abrarov, O.A.

    1982-01-01

    The structure of tellurium coatings has been studied using the methods of activational analysis on fast neutrons, roentgenography using DRON-2. The study is carried out in electrolyte 1N TeO 2 +6NHCl+2NH 2 SO 4 at the temperatures 25 and 95 deg C in the range of current densities 10-150 mA/cm 2 with and without mixing. Atomic content of chlorine and oxygen in deposite depending on the electrolyte work is determined. Nicrohardness, density, specific resistance of the coatings investigated are determined

  20. Test of irradiation of tellurium oxide for obtaining iodine-131 by dry distillation

    International Nuclear Information System (INIS)

    Alanis M, J.

    2003-07-01

    With the purpose of optimizing to the maximum independently the work of the reactor of those mathematical calculations of irradiation that are already optimized, now it corresponds to carry out irradiation tests in the different positions with their respective neutron fluxes that it counts the reactor for samples irradiation. Then, it is necessary to carry out the irradiation of the tellurium dioxide through cycles, with the purpose of observing the activity that it goes accumulating in each cycle and this way to obtain an activity of the Iodine-131 obtained when finishing the last cycle. (Author)

  1. Speciation analysis of tellurium by solid-phase extraction in the presence of ammonium pyrrolidine dithiocarbamate and inductively coupled plasma mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Chunhai; Cai, Qiantao; Guo, Zhong-Xian; Yang, Zhaoguang [Centre for Advanced Water Technology, Innovation Centre (NTU), Singapore (Singapore); Khoo, Soo Beng [Department of Chemistry, National University of Singapore (Singapore)

    2003-05-01

    Under acidic conditions tellurium(IV) formed a complex with ammonium pyrrolidine dithiocarbamate (APDC). The tellurium(IV) complex was completely retained on a non-polar Isolute silica-based octadecyl (C{sub 18}) sorbent-containing solid-phase extraction (SPE) cartridge, while the uncomplexed Te(VI) passed through the cartridge and remained as a free species in the solution. Only partial Te(IV) was retained on the SPE cartridge for samples without addition of APDC. On the basis of different retention behaviours of the complexed Te(IV) and uncomplexed Te(VI), a simple and highly sensitive method is proposed for the determination of total tellurium and Te(VI) by SPE separation and inductively coupled plasma mass spectrometry (ICP-MS) detection. The Te(IV) concentration was calculated as the difference between total tellurium and Te(VI) concentrations. The detection limit (3{sigma}) is 3 ng L{sup -1} tellurium. Factors affecting the separation and detection of tellurium species were investigated. Coexisting ions did not show significant interferences with the Te(IV)-APDC complex retention and the subsequent ICP-MS detection of Te. The method has been successfully applied to the tellurium speciation analysis in waters with spiked recoveries for Te(IV) and Te(VI) of 86.0-108% and 87.1-97.4%, respectively. (orig.)

  2. Resource recovery from urban stock, the example of cadmium and tellurium from thin film module recycling

    Energy Technology Data Exchange (ETDEWEB)

    Simon, F.-G., E-mail: franz-georg.simon@bam.de [BAM Federal Institute for Materials Research and Testing, Division 4.3 Contaminant Transfer and Environmental Technologies, Unter den Eichen 87, 12205 Berlin (Germany); Holm, O.; Berger, W. [BAM Federal Institute for Materials Research and Testing, Division 4.3 Contaminant Transfer and Environmental Technologies, Unter den Eichen 87, 12205 Berlin (Germany)

    2013-04-15

    Highlights: ► The semiconductor layer on thin-film photovoltaic modules can be removed from the glass-plate by vacuum blast cleaning. ► The separation of blasting agent and semiconductor can be performed using flotation with a valuable yield of 55%. ► PV modules are a promising source for the recovery of tellurium in the future. - Abstract: Raw material supply is essential for all industrial activities. The use of secondary raw material gains more importance since ore grade in primary production is decreasing. Meanwhile urban stock contains considerable amounts of various elements. Photovoltaic (PV) generating systems are part of the urban stock and recycling technologies for PV thin film modules with CdTe as semiconductor are needed because cadmium could cause hazardous environmental impact and tellurium is a scarce element where future supply might be constrained. The paper describes a sequence of mechanical processing techniques for end-of-life PV thin film modules consisting of sandblasting and flotation. Separation of the semiconductor material from the glass surface was possible, however, enrichment and yield of valuables in the flotation step were non-satisfying. Nevertheless, recovery of valuable metals from urban stock is a viable method for the extension of the availability of limited natural resources.

  3. Ecological aspects of selenium and tellurium in human and animal health

    Energy Technology Data Exchange (ETDEWEB)

    Frost, D V; Ingvoldstad, D

    1975-01-01

    Animal and human studies indicate that selenium inadequacy, in part, underlies various chronic diseases. Epidemiologic evidence suggests that cancer and heart disease are most common where ambient Se availability is low. Plant Se uptake and Se blood levels are inverse to human cancer mortality. As the active group in glutathione peroxidase, Se/sup -2/ inhibits aberrant oxidations which lead to chronic diseases. It binds heavy metals, and with tocopherol maintains tissue integrity. Sulfur dioxide fallout from the atmosphere, resulting from fossil fuel burning, may diminish the nutritional availability of selenium by diminishing plant uptake. Intensive ruminant grazing returns unavailable Se/sup 0/ to soils. Trimethyl selenium ion, as excreted by animals, also appears to be unavailable to plants. Modern fertilization practices and the effect of buildup of sulfates in the soil, due to acid rains, both appear to lessen the availability of Se to plants. SeO/sub 2/ added to the atmosphere from combustion and volcanic activity react with SO/sub 2/ to yield Se/sup 0/. This is presumed to fall out as particles from the air. How traces of Se are otherwise carried in air, explaining its enrichment in some areas, is unknown. The New Zealand experience with Se inadequacy in animals and man may be repeated in other parts of the world. Se inadequacy is far more of a human health problem than Se toxicity. There are no known adverse health effects from tellurium, other than tellurium breath. 164 references, 5 figures, 3 tables.

  4. Catalytic activity of oxide cerium-molybdenum-tellurium catalysts in oxidation ammonolysis

    International Nuclear Information System (INIS)

    Dzhordano, N.; Bart, D.; Madzhori, R.

    1984-01-01

    A commercial catalyst containing a mixture of Ce-, Mo-, Te oxides deposited on SiO 2 is shown to manifest a high efficiency in oxidative ammonolysis of propylene (C 3 - ) to acrylonitrile (AN). The dependence of the catalytic properties on the catalyst composition and reaction conditions is studied. It is established that three-component mixtures are more active and selective than the systems with a lesser number of components. Using the catalyst with the optimum ratio of constituent oxides in a microreactor at 440 deg enabled one to achieve initial selectivity in terms of AN equal to 82.5% at 97% conversion of C 3 - . Acrolein, acetonitrile, HCN and nitrogen oxides are the reaction by-products. A supposition is made that the reaction proceeds via the formation of π-compleXes on the centres of Te(4). Setective oxidation occurs on oxygen atoms bonded with the Mo(6) ions. Tellurium enhances the molybdenum reducibleness due to delocalization of electrons, whereas the cerium addition to the mixture of tellurium- and molybdenum oxides increases the rate of molybdenum reoxidation and thus enhances the catalytic system stability

  5. Determination of tellurium by hydride generation with in situ trapping flame atomic absorption spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Matusiewicz, H.; Krawczyk, M. [Politechn Poznanska, Poznan (Poland)

    2007-03-15

    The analytical performance of coupled hydride generation - integrated atom trap (HG-IAT) atomizer flame atomic absorption spectrometry (FAAS) system was evaluated for determination of Te in reference material (GBW 07302 Stream Sediment), coal fly ash and garlic. Tellurium, using formation of H{sub 2}Te vapors, is atomized in air-acetylene flame-heated IAT. A new design HG-IAT-FAAS hyphenated technique that would exceed the operational capabilities of existing arrangernents (a water-cooled single silica tube, double-slotted quartz tube or an 'integrated trap') was investigated. An improvement in detection limit was achieved compared with using either of the above atom trapping techniques separately. The concentration detection limit, defined as 3 times the blank standard deviation (3{sigma}), was 0.9 ng mL{sup -1} for Te. For a 2 min in situ preconcentration time (sample volume of 2 mL), sensitivity enhancement compared to flame AAS, was 222 fold, using the hydride generation atom trapping technique. The sensitivity can be further improved by increasing the collection time. The precision, expressed as RSD, was 7.0% (n = 6) for Te. The accuracy of the method was verified using a certified reference material (GBW 07302 Stream Sediment) by aqueous standard calibration curves. The measured Te contents of the reference material was in agreement with the information value. The method was successfully applied to the determination of tellurium in coal fly ash and garlic.

  6. High performance supercapacitor and non-enzymatic hydrogen peroxide sensor based on tellurium nanoparticles

    Directory of Open Access Journals (Sweden)

    M. Manikandan

    2017-04-01

    Full Text Available Tellurium nanoparticles (Te Nps were synthesized by wet chemical method and characterized by XRD, Raman, FESEM, TEM, XPS, UV–Vis and FL. The Nps were coated on graphite foil and Glassy carbon electrode to prepare the electrodes for supercapacitor and biosensor applications. The supercapacitor performance is evaluated in 2 M KOH electrolyte by both Cyclic Voltammetry (CV and galvanostatic charge-discharge method. From charge-discharge method, Te Nps show a specific capacitance of 586 F/g at 2 mA/cm2 and 100 F/g at 30 mA/cm2 as well as an excellent cycle life (100% after 1000 cycles. In addition, the H2O2 sensor performance of Te Nps modified glassy carbon electrode is checked by CV and Chronoamperometry (CA in phosphate buffer solution (PBS. In the linear range of 0.67 to 8.04 μM of hydrogen peroxide (H2O2, Te NPs show a high sensitivity of 0.83 mA mM−1 cm−2 with a correlation coefficient of 0.995. The detection limit is 0.3 μM with a response time less than 5 s. Keywords: Tellurium nanoparticles, Supercapacitor, Biosensor, Hydrogen peroxide

  7. Equilibrium evaporation test of lead-bismuth eutectic and of tellurium in lead-bismuth

    International Nuclear Information System (INIS)

    Ohno, Shuji; Nishimura, Masahiro; Hamada, Hirotsugu; Miyahara, Shinya; Sasa, Toshinobu; Kurata, Yuji

    2005-01-01

    A series of equilibrium evaporation experiment was performed to acquire the essential and the fundamental knowledge about the transfer behavior of lead-bismuth eutectic (LBE) and impurity tellurium in LBE from liquid to gas phase. The experiments were conducted using the transpiration method in which saturated vapor in an isothermal evaporation pot was transported by inert carrier gas and collected outside of the pot. The size of the used evaporation pot is 8 cm inner diameter and 15 cm length. The weight of the LBE pool in the pot is about 500 g. The investigated temperature range was 450degC to 750degC. From this experiment and discussion using the data in literature, we have obtained several instructive and useful data on the LBE evaporation behavior such as saturated vapor pressure of LBE, vapor concentration of Pb, Bi and Bi 2 in LBE saturated gas phase, and activity coefficient of Pb in the LBE. The LBE vapor pressure equation is represented as the sum of Pb, Bi and Bi 2 vapor in the temperature range between 550degC and 750degC as logP[Pa]=10.2-10100/T[k]. The gas-liquid equilibrium partition coefficient of tellurium in LBE is in the range of 10 to 100, with no remarkable temperature dependency between 450degC and 750degC. This research was founded by the Ministry of Education, Culture, Sports, Science and Technology (MEXT). (author)

  8. Improvement of physical properties of ZnO thin films by tellurium doping

    Energy Technology Data Exchange (ETDEWEB)

    Sönmezoğlu, Savaş, E-mail: svssonmezoglu@kmu.edu.tr; Akman, Erdi

    2014-11-01

    Highlights: • We report the synthesis of tellurium-doped zinc oxide (Te–ZnO) thin films using sol–gel method. • Highly c-axis oriented Te-doped ZnO thin films were grown on FTO glasses as substrate. • 1.5% Te-doping ratio could improve the physical properties of ZnO thin films. - Abstract: This investigation addressed the structural, optical and morphological properties of tellurium incorporated zinc oxide (Te–ZnO) thin films. The obtained results indicated that Te-doped ZnO thin films exhibit an enhancement of band gap energy and crystallinity compared with non-doped films. The optical transmission spectra revealed a shift in the absorption edge toward lower wavelengths. X-ray diffraction measurement demonstrated that the film was crystallized in the hexagonal (wurtzite) phase and presented a preferential orientation along the c-axis. The XRD obtained patterns indicate that the crystallite size of the thin films, ranging from 23.9 to 49.1 nm, changed with the Te doping level. The scanning electron microscopy and atomic force microscopy results demonstrated that the grain size and surface roughness of the thin films increased as the Te concentration increased. Most significantly, we demonstrate that it is possible to control the structural, optical and morphological properties of ZnO thin films with the isoelectronic Te-incorporation level.

  9. Microbial-assisted synthesis and evaluation the cytotoxic effect of tellurium nanorods

    Energy Technology Data Exchange (ETDEWEB)

    Forootanfar, Hamid [Herbal and Traditional Medicines Research Center, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Amirpour-Rostami, Sahar; Jafari, Mandana [Pharmaceutics Research Center, Institute of Neuropharmacology, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Forootanfar, Amir [Department of Pharmacology and Toxicology, Faculty of Pharmacy, Mashhad University of Medical Sciences, Mashhad (Iran, Islamic Republic of); Yousefizadeh, Zahra [The Student Research Committee, Faculty of Pharmacy, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of); Shakibaie, Mojtaba, E-mail: shakiba@kmu.ac.ir [Pharmaceutics Research Center, Institute of Neuropharmacology, Kerman University of Medical Sciences, Kerman (Iran, Islamic Republic of)

    2015-04-01

    The present study was designed to isolate bacterial strain capable of tellurium nanorods' (Te NRs) production followed by purification and evaluation of the cytotoxic effect of Te NRs. Among 25 environmental samples collected for screening of Te NR-producer bacterial strains one bacterial colony (isolated from hot spring and identified as Pseudomonas pseudoalcaligenes strain Te) was selected and applied for biosynthesis of Te NRs. Thereafter, an organic–aqueous partitioning system was applied for the purification of the biogenic Te NRs and the purified Te NRs were characterized using transmission electron microscopy (TEM), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), X-ray diffraction spectroscopy (XRD), UV–visible spectroscopy, and Fourier transform infrared spectroscopy (FTIR) techniques. The cytotoxic effect of biologically synthesized Te NRs and potassium tellurite on four cell lines of MCF-7, HT1080, HepG2 and A549 was then determined using the MTT assay method. The obtained results revealed lower toxicity for the rod-shaped biogenic tellurium nanostructures (~ 22 nm diameter by 185 nm length) compared to K{sub 2}TeO{sub 3}. - Highlights: • Te NR producing bacterial strain were isolated from hot springs. • Organic–aqueous partitioning system was applied for purification of Te nanorods. • The rod-shaped biogenic Te NPs showed lower cytotoxicity compared to K{sub 2}TeO{sub 3}.

  10. Microbial-assisted synthesis and evaluation the cytotoxic effect of tellurium nanorods

    International Nuclear Information System (INIS)

    Forootanfar, Hamid; Amirpour-Rostami, Sahar; Jafari, Mandana; Forootanfar, Amir; Yousefizadeh, Zahra; Shakibaie, Mojtaba

    2015-01-01

    The present study was designed to isolate bacterial strain capable of tellurium nanorods' (Te NRs) production followed by purification and evaluation of the cytotoxic effect of Te NRs. Among 25 environmental samples collected for screening of Te NR-producer bacterial strains one bacterial colony (isolated from hot spring and identified as Pseudomonas pseudoalcaligenes strain Te) was selected and applied for biosynthesis of Te NRs. Thereafter, an organic–aqueous partitioning system was applied for the purification of the biogenic Te NRs and the purified Te NRs were characterized using transmission electron microscopy (TEM), scanning electron microscopy (SEM), energy dispersive X-ray (EDX), X-ray diffraction spectroscopy (XRD), UV–visible spectroscopy, and Fourier transform infrared spectroscopy (FTIR) techniques. The cytotoxic effect of biologically synthesized Te NRs and potassium tellurite on four cell lines of MCF-7, HT1080, HepG2 and A549 was then determined using the MTT assay method. The obtained results revealed lower toxicity for the rod-shaped biogenic tellurium nanostructures (~ 22 nm diameter by 185 nm length) compared to K 2 TeO 3 . - Highlights: • Te NR producing bacterial strain were isolated from hot springs. • Organic–aqueous partitioning system was applied for purification of Te nanorods. • The rod-shaped biogenic Te NPs showed lower cytotoxicity compared to K 2 TeO 3

  11. Resource recovery from urban stock, the example of cadmium and tellurium from thin film module recycling

    International Nuclear Information System (INIS)

    Simon, F.-G.; Holm, O.; Berger, W.

    2013-01-01

    Highlights: ► The semiconductor layer on thin-film photovoltaic modules can be removed from the glass-plate by vacuum blast cleaning. ► The separation of blasting agent and semiconductor can be performed using flotation with a valuable yield of 55%. ► PV modules are a promising source for the recovery of tellurium in the future. - Abstract: Raw material supply is essential for all industrial activities. The use of secondary raw material gains more importance since ore grade in primary production is decreasing. Meanwhile urban stock contains considerable amounts of various elements. Photovoltaic (PV) generating systems are part of the urban stock and recycling technologies for PV thin film modules with CdTe as semiconductor are needed because cadmium could cause hazardous environmental impact and tellurium is a scarce element where future supply might be constrained. The paper describes a sequence of mechanical processing techniques for end-of-life PV thin film modules consisting of sandblasting and flotation. Separation of the semiconductor material from the glass surface was possible, however, enrichment and yield of valuables in the flotation step were non-satisfying. Nevertheless, recovery of valuable metals from urban stock is a viable method for the extension of the availability of limited natural resources

  12. Iodine-123 in Western Europe

    International Nuclear Information System (INIS)

    Qaim, S.M.; Stoecklin, G.; Weinreich, R.

    1976-08-01

    The major object of this panel was to obtain information on the state of art of Iodine-123 production in Western Europe. Technical, medical and organizational problems were discussed extensively during the one-day meeting and a stimulating exchange of information between the various 123 I-producers and users has been initiated. Some specific examples of medical application were also included in order to get a feeling of the degree of acceptance by the medical community and the demand for this isotope. The meeting clearly demonstrated the great demand for this isotope but it also showed that the present rate of production is well below the demand. In order to fill this gap, not only further technical development is needed but also the organizational question of distribution has to be solved, perhaps within a network of collaborating cyclotrons, a task which is considerably more difficult in Western Europe than in the USA. (orig./HP) [de

  13. 29 CFR 570.123 - Agriculture.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is so...

  14. 40 CFR 123.61 - Approval process.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Approval process. 123.61 Section 123... REQUIREMENTS Program Approval, Revision, and Withdrawal § 123.61 Approval process. (a) After determining that a...; and (6) Briefly outline the fundamental aspects of the State's proposed program, and the process for...

  15. 7 CFR 1260.123 - Research.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1260.123 Section 1260.123 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Definitions § 1260.123 Research. Research means studies relative to the...

  16. Industrial system for producing iodine-123

    International Nuclear Information System (INIS)

    Brantley, J.C.

    1985-01-01

    An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments

  17. 7 CFR 1280.123 - State.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false State. 1280.123 Section 1280.123 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Definitions § 1280.123 State. State means each of the 50 States and the District of Columbia. ...

  18. 10 CFR 71.123 - Test control.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Test control. 71.123 Section 71.123 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) PACKAGING AND TRANSPORTATION OF RADIOACTIVE MATERIAL Quality Assurance § 71.123 Test control. The licensee, certificate holder, and applicant for a CoC shall establish a test...

  19. 32 CFR 701.123 - PA fees.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false PA fees. 701.123 Section 701.123 National... OFFICIAL RECORDS AVAILABILITY OF DEPARTMENT OF THE NAVY RECORDS AND PUBLICATION OF DEPARTMENT OF THE NAVY DOCUMENTS AFFECTING THE PUBLIC DON Privacy Program § 701.123 PA fees. The PA fee schedule is only applicable...

  20. The influence of composition of fluoride electrolytes and conditions of the electrodeposition on some properties of tellurium

    International Nuclear Information System (INIS)

    Bugelis, V.M.; Kum, G.N.; Abrarov, O.A.; Madumarov, A.; Navalikhin, L.V.; Ajnakulov, Eh.B.

    1981-01-01

    Effect of electrolytic bath content, cathode current density, illumination and temperature on specific resistance, photosensitivity, structure and chemical purity of plated tellurium coatings is studied. Deposition is realized from moderately acid fluoride electrolytes at the constant temperature with a platinum working electrode. X-ray studies of precipitates obtained are carried out

  1. Exploratory studies of element substitutions in synthetic tetrahedrite. Part II. Selenium and tellurium as anions in Zn-Fe tetrahedrites

    DEFF Research Database (Denmark)

    Karup-Møller, Sven; Makovicky, E.

    1999-01-01

    -free) compositons do not materialize. The substituted Se tetrahedrite coexists with Cu3SbSe3, (iron-bearing) Cu2-xSe, Cu3SbSe4 plus/minus low Zn-sulfide melt. Selenium does not adopt the role of cation and tellurium that of anion in the tetrahedrite structure. The explanation of the severely restricted composition...

  2. The enhancing of Au-Ag-Te content in tellurium-bearing ore mineral by bio-oxidation-leaching

    Science.gov (United States)

    Kim, PyeongMan; Kim, HyunSoo; Myung, EunJi; Kim, YoonJung; Lee, YongBum; Park*, CheonYoung

    2015-04-01

    The purpose of this study is to enhance the content of valuable metals such as Au-Ag-Te in tellurium-bearing minerals by bio-oxidation-leaching. It was confirmed that pyrite, chalcopyrite, sphalerite and galena were produced together with tellurium-bearing minerals including hessite, sylvanite and tellurobismuthite from ore minerals and concentrates through microscopic observation and SEM/EDS analysis. In a bio-oxidation-leaching experiment, with regard to Au, Ag, Te, Cu and Fe, the changes in the amount of leaching and the content of leaching residues were compared and analyzed with each other depending on the adaptation of an indigenous microbe identified as Acidithiobacillus ferrooxidans. As a result of the experiment, the Au-Ag-Te content in tellurium-bearing ore mineral was enhanced in the order of physical oxidation leaching, physical/non-adaptive bio-oxidation-leaching and physical/adaptive biological leaching. It suggests that the bio-oxidation-leaching using microbes adapted in tellurium-bearing ore mineral can be used as a pre-treatment and a main process in a recovery process of valuable metals. "This research was supported by Basic Science Research Program through the National Research Foundation of Korea(NRF) funded by the Ministry of Education(NRF-2013R1A1A2004898)"

  3. Phenylethynyl-butyltellurium inhibits the sulfhydryl enzyme Na+, K+ -ATPase: an effect dependent on the tellurium atom.

    Science.gov (United States)

    Quines, Caroline B; Rosa, Suzan G; Neto, José S S; Zeni, Gilson; Nogueira, Cristina W

    2013-11-01

    Organotellurium compounds are known for their toxicological effects. These effects may be associated with the chemical structure of these compounds and the oxidation state of the tellurium atom. In this context, 2-phenylethynyl-butyltellurium (PEBT) inhibits the activity of the sulfhydryl enzyme, δ-aminolevulinate dehydratase. The present study investigated on the importance of the tellurium atom in the PEBT ability to oxidize mono- and dithiols of low molecular weight and sulfhydryl enzymes in vitro. PEBT, at high micromolar concentrations, oxidized dithiothreitol (DTT) and inhibited cerebral Na(+), K(+)-ATPase activity, but did not alter the lactate dehydrogenase activity. The inhibition of cerebral Na(+), K(+)-ATPase activity was completely restored by DTT. By contrast, 2-phenylethynyl-butyl, a molecule without the tellurium atom, neither oxidized DTT nor altered the Na(+), K(+)-ATPase activity. In conclusion, the tellurium atom of PEBT is crucial for the catalytic oxidation of sulfhydryl groups from thiols of low molecular weight and from Na(+), K(+)-ATPase.

  4. Extraction-spectrophotometric method for silicon determination in high-purity substances. 1. Silicon determination in tellurium

    Energy Technology Data Exchange (ETDEWEB)

    Shaburova, V P; Yudelevich, I G [AN SSSR, Novosibirsk (USSR). Inst. Neorganicheskoj Khimii

    1989-01-01

    The extraction-spectrophotometric method for silicon determination in tellurium based on extraction isolation of the base by tributyl phosphate from hydrochloride solutions and with addition of HNO/sub 3/ and spectrophotometric silicon determination using malachite green is developed. The method permits to determine 2x10/sup -1/-3x10/sup -4/ % Si.

  5. Renovascular hypertension screening with iodine-123 orthoiodohippurate

    International Nuclear Information System (INIS)

    Oppenheim, B.E.; Appledorn, C.R.; Mock, B.H.; Yune, H.Y.; Grim, C.E.

    1985-01-01

    Screening of 123 hypertensive patients for renovascular disease was carried out through renal studies, performed with iodine-123 ortho-iodohippurate (OIH), consisting of 214 studies performed with high-purity 123 I-OIH and 10 studies performed with 123 I-OIH contaminated with 124 I. Standard dynamic renal images and renogram curves were supplemented by functional renal images generated by computer. For the same radiation dose to the bladder, the number of detected photons with contaminated 123 I-OIH is only about one-third of that for high-purity 123 I-OIH so that for comparable studies one must use at least twice the dose with the former agent as compared with the latter. The study was hampered by erratic delivery of 123 I-OIH, which demonstrated the need for a reliable source

  6. Renal function study using I-123-OIH

    International Nuclear Information System (INIS)

    Yamashita, Masato; Osaka, Yosio; Aikawa, Ichiro

    1989-01-01

    Twenty-eight renal function studies were performed in 24 patients with renal diseases with I-123 orthoiodohippurate (I-123 OIH). Neither side effects nor abnormal laboratory values were attributable to I-123 OIH. Imaging with Tc-99m diethylene triaminepentaacetic acid (DTPA) was also performed in 20 patients within one week after I-123 imaging. Findings with I-123 OIH and Tc-99m DTPA were similar in all except for two patients. The two patients had received cadaveric renal transplantation. One patient presented with acute tubular necrosis and the other with chronic renal rejection. In these patients, I-123 imaging showed vascular stricture and Tc-99m imaging showed a decreased glomerular function. Because I-123 OIH and Tc-99m DTPA had different pharmacodynamics, combined use of the two imaging agents may be useful in evaluating renal rejection or acute tubular necrosis. (N.K.)

  7. Determination of tellurium in coal samples by means of graphite furnace atomic absorption spectrometry after coprecipitation with iron(III) hydroxide

    Energy Technology Data Exchange (ETDEWEB)

    Oda, S.; Arikawa, Y. [Japan Womens University, Tokyo (Japan)

    2005-11-01

    A simple and accurate method for the determination of tellurium in coal samples was investigated by the combustion of samples under a high pressure of oxygen and coprecipitation with Fe(OH){sub 3}, followed by a measurement by graphite furnace atomic absorption spectrometry (GF-AAS). About 0.5 g of an accurately weighed ground coal sample and 0.5 g of starch were combusted in an oxygen combustion bomb filled with oxygen to 3 MPa and added with 3 ml of water as an absorbing solution. The formed tellurium trioxide TeOs dissolved in water as TeO{sub 4}{sup 2-}, which was in turn reduced to TeO{sub 3}{sup 2-} by heating. After diluting the above-mentioned solution up to about 50 ml with water, Fe(OH){sub 3} is formed upon adding Fe(NO{sub 3}){sub 3} and sodium hydroxide solutions at pH 8-9 and left standing overnight. After dissolving the precipitate by HCl, the solution was diluted to 10 ml with water and the concentration of tellurium was measured by GF-AAS at a wavelength of 214.3 nm. The standard addition method was employed for the determination of tellurium in real coal samples, because those processes for the formation of tellurium(VI) oxide and coprecipitation with Fe(OH)3 were interfered by matrices. For NIST SRM 1632c, the standard coal sample tellurium content of 0.057 {+-} 0.004 mg kg{sup -1} was in good agreement with the information value of 0.05 mg kg{sup -1} with 7% of RSD in five replicate analyses. The tellurium contents in 20 real coal samples given by Center for Coal Utilization, Japan were also determined. The tellurium contents in these samples were scattered over the narrow range between 0.032 and 0.100 mg kg{sup -1}.

  8. Intrinsic two-dimensional states on the pristine surface of tellurium

    Science.gov (United States)

    Li, Pengke; Appelbaum, Ian

    2018-05-01

    Atomic chains configured in a helical geometry have fascinating properties, including phases hosting localized bound states in their electronic structure. We show how the zero-dimensional state—bound to the edge of a single one-dimensional helical chain of tellurium atoms—evolves into two-dimensional bands on the c -axis surface of the three-dimensional trigonal bulk. We give an effective Hamiltonian description of its dispersion in k space by exploiting confinement to a virtual bilayer, and elaborate on the diminished role of spin-orbit coupling. These intrinsic gap-penetrating surface bands were neglected in the interpretation of seminal experiments, where two-dimensional transport was otherwise attributed to extrinsic accumulation layers.

  9. Calculations of energy levels and electromagnetic properties for tellurium pair isotopes, by unified method

    International Nuclear Information System (INIS)

    Teixeira, R.R.P.

    1988-01-01

    Calculations with the Unified Model (vibrator coupled to two particles), of the energy levels and the eletromagnetic properties have been performed and compared with the twelve pair isotopes from tellurium with A between 112 and 134. The results were analysed using as particles interaction: pairing and SDI (Surface Delta Interaction). The SDI and 3 fonons collective states were used in the fittings, and a syntematic comparison between the theoretical and experimental results was made. The dependence of the results with the model parameters was determined, through large variation sof them. Calculations using 4 fonons have been made, and the importance of the introduced variations in the results was discussed. Calculations have been made in the VAX Computer of the Pelletron at IFUSP. (author) [pt

  10. Studies on nickel (II and palladium (II complexes with some tetraazamacrocycles containing tellurium

    Directory of Open Access Journals (Sweden)

    Rathee Nitu

    2012-01-01

    Full Text Available The synthesis of 10-membered and 12-membered tellurium containing tetraazamacrocyclic complexes of divalent nickel and palladium by template condensation of diaryltellurium dichlorides, (aryl = p-hydroxyphenyl, 3-methyl-4-hydroxyphenyl, p-methoxyphenyl with 1,2-diaminoethane and 1,3-diaminopropane in the presence of metal dichloride is reported. The resulting complexes have been subjected to elemental analyses, magnetic measurements, electronic absorption, infra-red, and proton magnetic resonance spectral studies. The formation of proposed macrocyclic skeletons and their donor sites have been identified on the basis of spectral studies. Distorted octahedral structure for the nickel complexes in the solid state and squareplanar structure for the palladium complexes have been suggested.

  11. Effect of aging and temperature on alternating current conductivity of tellurium thin films

    Energy Technology Data Exchange (ETDEWEB)

    Tsiulyanu, D. [Technical University, Department of Physics, bul. Dacia 41, MD-2060, Chisinau (Moldova, Republic of)], E-mail: tsiu@cni.md; Marian, T.; Tiuleanu, A. [Technical University, Department of Physics, bul. Dacia 41, MD-2060, Chisinau (Moldova, Republic of); Liess, H.-D.; Eisele, I. [University of the Bundeswehr Munich, Faculty of Electrical Engineering and Information Technology, Institute of Physics, D-85577 Neubiberg (Germany)

    2009-02-27

    The impedance spectra of tellurium films with interdigital platinum electrodes were investigated in air at temperatures between 10 and 50 deg. C . Cole-Cole analysis made it possible to assess time constants, resistance, and capacitance of the film at characteristic frequencies and the dependence of these parameters on aging and temperature. Aging under normal conditions over 12 months led to a relative increase of only {approx} 5% in film impedance at the characteristic frequency. However, aging noticeably influences the electrical resistance of the film at high (> 500 kHz) frequencies, and capacitance diminished after 12 months by more than 50% throughout the spectrum. Scanning electron microscopy confirmed that the effect of aging is due to structural changes in the film. Temperature does not influence the capacitance of the film but uncommonly influences its resistance, which reaches a maximum at around 20 deg. C . This is ascribed to desorption of oxygen previously adsorbed from the environment.

  12. Effect of aging and temperature on alternating current conductivity of tellurium thin films

    International Nuclear Information System (INIS)

    Tsiulyanu, D.; Marian, T.; Tiuleanu, A.; Liess, H.-D.; Eisele, I.

    2009-01-01

    The impedance spectra of tellurium films with interdigital platinum electrodes were investigated in air at temperatures between 10 and 50 deg. C . Cole-Cole analysis made it possible to assess time constants, resistance, and capacitance of the film at characteristic frequencies and the dependence of these parameters on aging and temperature. Aging under normal conditions over 12 months led to a relative increase of only ∼ 5% in film impedance at the characteristic frequency. However, aging noticeably influences the electrical resistance of the film at high (> 500 kHz) frequencies, and capacitance diminished after 12 months by more than 50% throughout the spectrum. Scanning electron microscopy confirmed that the effect of aging is due to structural changes in the film. Temperature does not influence the capacitance of the film but uncommonly influences its resistance, which reaches a maximum at around 20 deg. C . This is ascribed to desorption of oxygen previously adsorbed from the environment

  13. Thermodynamic assessment of the palladium-tellurium (Pd-Te) system

    International Nuclear Information System (INIS)

    Gosse, S.; Gueneau, C.

    2011-01-01

    Among the fission products formed in nuclear fuels, the platinum-group metal palladium and the chalcogen element tellurium exhibit strong interaction. It is therefore of interest to be able to predict the chemical equilibria involving the Pd and Te fission products. A thermodynamic assessment is carried out using the Calphad (Calculation of Phase Diagram) method to investigate the behaviour of Pd-Te alloy system in nuclear fuels under irradiation and under waste disposal conditions. The Pd-Te binary description was optimized using experimental data found in literature including thermodynamic properties and phase diagram data. To validate the calculated phase diagram and thermodynamic properties, the results are compared with data from the literature. Both calculated and experimental phase diagrams and thermodynamic properties are in good agreement in the whole Pd-Te composition range. (authors)

  14. Melt-gas phase equilibria and state diagrams of the selenium-tellurium system

    Science.gov (United States)

    Volodin, V. N.; Trebukhov, S. A.; Burabaeva, N. M.; Nitsenko, A. V.

    2017-05-01

    The partial pressures of saturated vapor of the components in the Se-Te system are determined and presented in the form of temperature-concentration dependences from which the boundaries of the melt-gas phase transition are calculated at atmospheric pressure and vacuums of 2000 and 100 Pa. The existence of azeotropic mixtures is revealed. It is found that the points of inseparably boiling melts correspond to 7.5 at % of Se and 995°C at 101325 Pa, 10.9 at % at 673°C and 19.5 at % at 522°C in vacuums of 2000 and 100 Pa, respectively. A complete state diagram is constructed, including the fields of gas-liquid equilibria at atmospheric and low pressures, the boundaries of which allow us to assess the behavior of selenium and tellurium upon distillation fractionation.

  15. Level structure in 123Xe

    International Nuclear Information System (INIS)

    Luukko, A.; Hattula, J.; Helppi, H.; Knuuttila, O.

    1980-09-01

    The level structure of 123 Xe has been studied with 122 Te( 3 He,2n) and 123 Te( 3 He,3n) reactions using in-beam γ-ray spectroscopic methods. Band-like level structures based on the unique-parity hsub(11/2) neutron state and different low-j states are observed. The isomeric state proposed earlier is established at 185.4 keV with a half-life of 5.6+-0.3 μs, and a new spin assignment of 7/2 - is proposed for this level. A triaxial-rotor-model calculation has been performed to interprete the negative-parity level system. Because of the 7/2 - state, we do not obtain a consistent description of the negative-parity states with the triaxial rotor model, unlike the heavier odd-A Xe nuclei. On the other hand, the positive-parity level structures are interpreted in terms of the core-quasiparticle model supposing a vibrational core. This indicates different core shapes for the positive- and negative-parity level systems. (author)

  16. Modelling the chemical behaviour of tellurium species in the reactor pressure vessel and the reactor cooling system under severe accident conditions

    International Nuclear Information System (INIS)

    Alonso, A.; Gonzalez, C.

    1991-07-01

    This state of the art report contains information on the behaviour of tellurium and its compounds in the reactor pressure vessel and the reactor coolant system under light water reactor severe accident conditions. To characterise tellurium behaviour, it is necessary the previous knowledge of the species of tellurium released from the core, and simultaneity of its release with that of other materials which can alter the transport, for instance, control rod and structural materials. Release and transport experiments have been reviewed along with the models implemented in the codes which are used in the international community: TRAPMELT, RAFT, VICTORIA and SOPHIE. From the experiments, it can be concluded that other species different to Te 2 , such as tin telluride and cesium telluride, may be released from the fuel. That is why they must be considered in the transport phenomena. There is also experimental evidence of the strong interaction of Te 2 with Inconel 600 and stainless steel of the pipe walls and structures, however this strong interaction is in competition with the interaction of tellurium with aerosols, which under severe accident conditions may represent an area greater than that of the primary system. It is for the absence of significant tellurium species in the transport models, and also for the interaction of tellurium with aerosols, for which some codes show the greatest deficiencies

  17. Multicurie, transportable, integrally shielded 123Xe → 123I generator and processing system for high-purity iodine-123 production

    International Nuclear Information System (INIS)

    Lagunas-Solar, M.C.; Thibeau, H.L.; Goodart, C.E.; Little, F.E.; Navarro, N.J.; Hartnett, D.E.

    1985-01-01

    An integrally shielded 123 Xe → 123 I generator system has been designed and tested under production conditions for its suitability as a multicurie handling device from which to produce radiopharmaceutical-quality high-purity no-carrier-added (NCA) 123 I. The 123 Xe → 123 I generator system is expected to provide an alternative to current techniques and to increase the availability and reliability of high-purity 123 I made via the 127 I(p,5n) 123 Xe → 123 I nuclear reaction. The generator system is based on the Crocker Nuclear Laboratory's continuous-flow production system which has been operating since 1974 for the multicurie production of 123 I. The generator system, which consists of an integrally shielded xenon trap and separate loading and processing apparatuses, is simple and reliable to operate, can be adapted to computerized control, and provides a safe working environment for the repeated handling of multicurie amounts of Xe-I radioactivities

  18. In vitro and in vivo activity of an organic tellurium compound on Leishmania (Leishmania chagasi.

    Directory of Open Access Journals (Sweden)

    Isabella Aparecida Salerno Pimentel

    Full Text Available Tellurium compounds have shown several biological properties and recently the leishmanicidal effect of one organotellurane was demonstrated. These findings led us to test the effect of the organotellurium compound RF07 on Leishmania (Leishmania chagasi, the agent of visceral leishmaniasis in Latin America. In vitro assays were performed in L. (L. chagasi-infected bone marrow derived macrophages treated with different concentrations of RF07. In in vivo experiments Golden hamsters were infected with L. (L. chagasi and injected intraperitoneally with RF07 whereas control animals received either Glucantime or PBS. The effect of RF07 on cathepsin B activity of L. (L. chagasi amastigotes was assayed spectrofluorometrically using fluorogenic substrates. The main findings were: 1 RF07 showed significant leishmanicidal activity against intracellular parasites at submicromolar concentrations (IC50 of 529.7±26.5 nM, and the drug displayed 10-fold less toxicity to macrophages (CC50 of 5,426±272.8 nM; 2 kinetics assays showed an increasing leishmanicidal action of RF07 at longer periods of treatment; 3 one month after intraperitoneal injection of RF07 L. (L. chagasi-infected hamsters showed a reduction of 99.6% of parasite burden when compared to controls that received PBS; 4 RF07 inhibited the cathepsin B activity of L. (L. chagasi amastigotes. The present results demonstrated that the tellurium compound RF07 is able to destroy L. (L. chagasi in vitro and in vivo at concentrations that are non toxic to the host. We believe these findings support further study of the potential of RF07 as a possible alternative for the chemotherapy of visceral leishmaniasis.

  19. Revision and extension to the analysis of the third spectrum of tellurium: Te III

    International Nuclear Information System (INIS)

    Tauheed, A.; Naz, A.

    2011-01-01

    The spectrum of doubly ionized tellurium atom (Te III) has been investigated in the vacuum ultraviolet wavelength region. The ground configuration of Te III is 5s 2 5p 2 and the excited configurations are of the type 5s 2 5p nl. The core excitation leads to a 5s5p 3 configuration. Cowan's multi-configuration interaction code was utilized to predict the ion structure. The observed spectrum of tellurium was recorded on a 3-m normal incidence vacuum spectrograph of Antigonish Laboratory (Canada) in the wavelength region of 300 - 2000 A by using a triggered spark light source for the excitation of the spectrum. The 5s 2 5p 2 - [ 5s 2 5p (5d + 6d + 7d + 6s + 7s + 8s) + 5s5p 3 ] transition array has been analyzed. Previously reported levels by Joshi et al have been confirmed while the older analysis by Crooker and Joshi has been revised and extended to include the 5s 2 5p (5d, 6d, 7d, 6s,7s, 8s) and 5s5p 3 configurations. Least-squares- fitted parametric calculations were used to interpret the final results. One hundred and fifty spectral lines have been identified to establish 60 energy levels. Our wavelength accuracy for unblended and sharp lines is better than ±0.005 A. The ionization potential of Te III was found to be 224550 ± 300 cm -1 (27.841 ± 0.037eV).

  20. Reprint of “Extracellular production of tellurium nanoparticles by the photosynthetic bacterium Rhodobacter capsulatus”

    Energy Technology Data Exchange (ETDEWEB)

    Borghese, Roberto, E-mail: roberto.borghese@unibo.it [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy); Brucale, Marco [Institute for the Study of Nanostructured Materials (CNR-ISMN), Rome (Italy); Fortunato, Gianuario [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy); Lanzi, Massimiliano [Dept. of Industrial Chemistry “Toso Montanari”, University of Bologna (Italy); Mezzi, Alessio [Institute for the Study of Nanostructured Materials (CNR-ISMN), Rome (Italy); Valle, Francesco; Cavallini, Massimiliano [Institute for the Study of Nanostructured Materials (CNR-ISMN), Bologna (Italy); Zannoni, Davide [Dept. of Pharmacy and Biotechnology, University of Bologna (Italy)

    2017-02-15

    Highlights: • Tellurite is reduced by R. capsulatus as cytosolic tellurium nanoprecipitates TeNPs. • Lawsone allows R. capsulatus to produce extracellular TeNPs. • Extracellular TeNPs production depends on the carbon source used for cells growth. • Both lawsone concentration and the incubation time determine the TeNPs size. • Extracellular TeNPs are coated with extracellular polymeric substances (EPS). - Abstract: The toxic oxyanion tellurite (TeO{sub 3}{sup 2−}) is acquired by cells of Rhodobacter capsulatus grown anaerobically in the light, via acetate permease ActP2 and then reduced to Te{sup 0} in the cytoplasm as needle-like black precipitates. Interestingly, photosynthetic cultures of R. capsulatus can also generate Te{sup 0} nanoprecipitates (TeNPs) outside the cells upon addition of the redox mediator lawsone (2-hydroxy-1,4-naphtoquinone). TeNPs generation kinetics were monitored to define the optimal conditions to produce TeNPs as a function of various carbon sources and lawsone concentration. We report that growing cultures over a 10 days period with daily additions of 1 mM tellurite led to the accumulation in the growth medium of TeNPs with dimensions from 200 up to 600–700 nm in length as determined by atomic force microscopy (AFM). This result suggests that nucleation of TeNPs takes place over the entire cell growth period although the addition of new tellurium Te{sup 0} to pre-formed TeNPs is the main strategy used by R. capsulatus to generate TeNPs outside the cells. Finally, X-ray photoelectron spectroscopy (XPS) and Fourier transform infrared (FT-IR) analysis of TeNPs indicate they are coated with an organic material which keeps the particles in solution in aqueous solvents.

  1. Potential for improved extraction of tellurium as a byproduct of current copper mining processes

    Science.gov (United States)

    Hayes, S. M.; Spaleta, K. J.; Skidmore, A. E.

    2016-12-01

    Tellurium (Te) is classified as a critical element due to its increasing use in high technology applications, low average crustal abundance (3 μg kg-1), and primary source as a byproduct of copper extraction. Although Te can be readily recovered from copper processing, previous studies have estimated a 4 percent extraction efficiency, and few studies have addressed Te behavior during the entire copper extraction process. The goals of the present study are to perform a mass balance examining Te behavior during copper extraction and to connect these observations with mineralogy of Te-bearing phases which are essential first steps in devising ways to optimize Te recovery. Our preliminary mass balance results indicate that less than 3 percent of Te present in copper ore is recovered, with particularly high losses during initial concentration of copper ore minerals by flotation. Tellurium is present in the ore in telluride minerals (e.g., Bi-Te-S phases, altaite, and Ag-S-Se-Te phases identified using electron microprobe) with limited substitution into sulfide minerals (possibly 10 mg kg-1 Te in bulk pyrite and chalcopyrite). This work has also identified Te accumulation in solid-phase intermediate extraction products that could be further processed to recover Te, including smelter dusts (158 mg kg-1) and pressed anode slimes (2.7 percent by mass). In both the smelter dusts and anode slimes, X-ray absorption spectroscopy indicates that about two thirds of the Te is present as reduced tellurides. In anode slimes, electron microscopy shows that the remaining Te is present in an oxidized form in a complex Te-bearing oxidate phase also containing Pb, Cu, Ag, As, Sb, and S. These results clearly indicate that more efficient, increased recovery of Te may be possible, likely at minimal expense from operating copper processing operations, thereby providing more Te for manufacturing of products such as inexpensive high-efficiency solar panels.

  2. NMR spectroscopy of organic compounds of selenium and tellurium. Communication 8. Constants of spin-spin interaction of /sup 125/Te-/sup 1/o/sup 3/C in nmr spectra of unsaturated organtellurides

    Energy Technology Data Exchange (ETDEWEB)

    Kalabin, G.A.; Kushnarev, D.F.; Valeev, R.B. (Irkutskij Gosudarstvennyj Univ. (USSR))

    1981-06-01

    On the basis of /sup 13/C NMR spectra of a series of unsaturated and aromatic tellurium compounds the constants of spin-spin interaction (SSIC) (sup(1.2)J(Te, C)) are measured. A reliable linear relation between /sup 1/J(Te, C) and s-character of a carbon orbitale forming bond with tellurium is found. Correlation of straight SSIC of carbon with selenium and tellurium in isological compounds is established.

  3. Comparison of analytical possibilities of inversion voltammetry of tellurium with cathodic and anodic potential scanning taking layer-by-layer analysis of GaAs-Te films as example

    International Nuclear Information System (INIS)

    Kaplin, A.A.; Portnyagina, Eh.O.; Gridaev, V.F.

    1979-01-01

    Possibility of application in analytical purposes of the process of tellurium precipitation electrosolution from the surfaces of graphite and mercury-graphite electrodes at the cathode scanning of the potential is shown. As a result of comparison of direct and inversion scanning with cathodic and anodic scanning of the potential, variants of voltammetric method of tellurium determination in artificial solutions and, taking the developed method of layer-by-layer analysis of the GaAsTe films as an example, advantage of mercury-graphite electrode with cathodic scanning as compared to graphite electrode with cathode scanning of the potential is shown. Reproducibility of the GaAs film analysis results according to anodic and cathodic tellurium peaks is satisfactory. Maximum deviation from the results of analysis of oxidation peaks and tellurium peduction does not exceed 15 rel. %. Thus, for tellurium concentrations, exceeding 5x10 -6 g-ion/l, both anodic and cathodic scanning of the potential can be used, though error in tellurium determination according to cathodic peaks is 1.5-2.0 times higher. At tellurium amounts lower 5x10 -6 g-ion/l the determination should be carried out according to the peaks of tellurium anodic oxidation from the surface of graphite electrode or according to the peaks of tellurium cathodic reduction from the surface of mercury-graphite electrode

  4. Investigation of evaporation characteristics of polonium and its lighter homologues selenium and tellurium from liquid Pb-Bi-eutecticum

    CERN Document Server

    Neuhausen, J; Eichler, B

    2004-01-01

    The evaporation behaviour of polonium and its lighter homologues selenium and tellurium dissolved in liquid Pb-Bi-eutecticum (LBE) has been studied at various temperatures in the range from 482 K up to 1330 K under Ar/H2 and Ar/H2O-atmospheres using γ-ray spectroscopy. Polonium release in the temperature range of interest for technical applications is slow. Within short term (1h) experiments measurable amounts of polonium are evaporated only at temperatures above 973 K. Long term experiments reveal that a slow evaporation of polonium occurs at temperatures around 873 K resulting in a fractional polonium loss of the melt around 1% per day. Evaporation rates of selenium and tellurium are smaller than those of polonium. The presence of H2O does not enhance the evaporation within the error limits of our experiments. The thermodynamics and possible reaction pathways involved in polonium release from LBE are discussed.

  5. Synthesis of Novel E-2-Chlorovinyltellurium Compounds Based on the Stereospecific Anti-addition of Tellurium Tetrachloride to Acetylene

    Directory of Open Access Journals (Sweden)

    Svetlana V. Amosova

    2012-05-01

    Full Text Available The reaction of tellurium tetrachloride with acetylene proceeds in a stereospecific anti-addition manner to afford the novel products E-2-chlorovinyltellurium trichloride and E,E-bis(2-chlorovinyltellurium dichloride. Reaction conditions for the selective preparation of each of these products were found. The latter was obtained in 90% yield in CHCl3 under a pressure of acetylene of 10–15 atm, whereas the former product was formed in up to 72% yield in CCl4 under a pressure of acetylene of 1–3 atm. Synthesis of the previously unknown E,E-bis(2-chlorovinyl telluride, E,E-bis(2-chlorovinyl ditelluride, E-2-chlorovinyl 1,2,2-trichloroethyl telluride and E,E-bis(2-chlorovinyl-tellurium dibromide is described.

  6. Deposition of tellurium films by decomposition of electrochemically-generated H{sub 2}Te: application to radiative cooling devices

    Energy Technology Data Exchange (ETDEWEB)

    Engelhard, T.; Jones, E.D.; Viney, I. [Coventry Univ. (United Kingdom). Centre for Data Storage Mater.; Mastai, Y.; Hodes, G. [Department of Materials and Interfaces, Weizmann Institute of Science, 76100, Rehovot (Israel)

    2000-07-17

    The preparation of homogenous, large area thin layers of tellurium on thin polyethylene foils is described. The tellurium was formed by room temperature decomposition of electrochemically generated H{sub 2}Te. Pre-treatment of the polyethylene substrates with KMnO{sub 4} to give a Mn-oxide layer was found to improve the Te adhesion and homogeneity. Optical characterization of the layers was performed using UV/VIS/NIR spectroscopy. Such coatings have favorable characteristics for use as solar radiation shields in radiative cooling devices. The simplicity of generation of the very unstable H{sub 2}Te was also exploited to demonstrate formation of size-quantized CdTe nanocrystals. (orig.)

  7. The application of three-phase liquid-liquid extraction to the analysis of bismuth and tellurium in sulphide concentrates

    International Nuclear Information System (INIS)

    Nicholas, D.J.

    1976-01-01

    An extraction system consisting of one aqueous and two organic phases is described. Diantipyrylmethane (DAM) is used as the extractant for bismuth and tellurium, which are extracted into the smaller of the two organic phases from nitric acid and perchloric acid respectively. The extraction efficiency is in the range of 90 to 95 per cent, compensation for incomplete extraction being made by the technique of standard addition. Copper, lead, and zinc are not extracted in either procedure. When the solutions contain high concentrations of iron, thioglycolic acid is used as a masking agent for iron in the extraction of bismuth. Atomic-absorption spectrophotometry is used for the analysis of the third phase after it has been diluted with methanol. The precision for bismuth and tellurium is in the range of 3 to 4 per cent. The accuracy, as ascertained from comparative analyses of sulphide concentrates, is good

  8. Iodine-123 (123I) is promising radiopharmaceutical in the radionuclide diagnostics

    International Nuclear Information System (INIS)

    Tazhedinov, I.T.

    2003-01-01

    In the paper some advantages of the radiopharmaceuticals with 123 I against 99m Tc preparations are shown. It is noted that the 123 I is the most favourable among cyclotron radionuclides for radionuclide diagnostics by it nuclear-physical characteristics. With application of 123 I it is possible to attain a significant progress in the thyroid examination. 123 I labelled preparations should have a high bond strength providing the high information valuation of examinations

  9. Total β-decay energies and masses of tin, antimony and tellurium isotopes in the vicinity of 50132Sn82

    International Nuclear Information System (INIS)

    Lund, E.; Aleklett, K.; Rudstam, G.

    1977-01-01

    Experimental β-decay energies for short-lived isotopes of tin, antimony and tellurium are presented. Mass-separated sources were produced at the on-line isotope separator OSIRIS. By applying β-γ coincidence methods, total β-decay energies have been determined for the following nuclides: 127-131 Sn, 128 130 131 134 Sb and 134 135 Te. The atomic mass excess has been derived for these nuclei, and comparisons are made with mass formula predictions. (Auth.)

  10. Solvent Extraction of Tellurium from Chloride Solutions Using Tri-n-butyl Phosphate: Conditions and Thermodynamic Data

    Directory of Open Access Journals (Sweden)

    Dongchan Li

    2014-01-01

    Full Text Available The extractive separation of tellurium (IV from hydrochloric acid media with tri-n-butyl phosphate (TBP in kerosene was investigated. The dependence on the extraction of tellurium species, concentrations of tellurium and TBP, extraction time and stage, organic/aqueous ratio, and interferences from coexist metallic ions were examined and are discussed. Besides, the stripping agent and stripping time were also studied. It was found that the extraction reaction corresponds to the neutral complex formation mechanism and the extracted species is TeCl4·3TBP and that the extraction process is exothermic. The thermodynamic parameters of enthalpy ΔH, entropy ΔS, and free energy ΔG of the extraction process were evaluated at −26.2 kJ·mol−1, −65.6 J·mol−1·K−1, and −7.0 kJ·mol−1, respectively at 293 K.

  11. Synthesis of ultra-thin tellurium nanoflakes on textiles for high-performance flexible and wearable nanogenerators

    Energy Technology Data Exchange (ETDEWEB)

    He, Wen; Van Ngoc, Huynh; Qian, Yong Teng; Hwang, Jae Seok; Yan, Ya Ping [Department of Physics and Interdisciplinary Course of Physics and Chemistry, Sungkyunkwan University, 2066, Seobu-ro, Jangan-gu, Suwon 16419, Gyeoggi-do (Korea, Republic of); Choi, Hongsoo [Department of Robotics Engineering, Daegu Gyeongbuk Institute of Science and Technology (DGIST), 711-873, Daegu (Korea, Republic of); Kang, Dae Joon, E-mail: djkang@skku.edu [Department of Physics and Interdisciplinary Course of Physics and Chemistry, Sungkyunkwan University, 2066, Seobu-ro, Jangan-gu, Suwon 16419, Gyeoggi-do (Korea, Republic of)

    2017-01-15

    Highlights: • Ultra-thin tellurium (Te) nanoflakes were successfully grown on textile and used as an active piezoelectric material. • Te nanoflake nanogenerator device was systematically studied by bending and compressing test. • The ultra-high output power during compressing test can light up 10 LEDs without any external power source. • The device can offer a breakthrough in applying tellurium nanoflakes into high-performance flexible and wearable piezoelectric nanogenerator. - Abstract: We report that ultra-thin tellurium (Te) nanoflakes were successfully grown on a sample of a gold-coated textile, which then was used as an active piezoelectric material. An output voltage of 4 V and a current of 300 nA were obtained from the bending test under a driving frequency of 10 Hz. To test the practical applications, Te nanoflake nanogenerator (TFNG) device was attached to the subject’s arm, and mechanical energy was converted to electrical energy by means of periodic arm-bending motions. The optimized open-circuit voltage and short-circuit current density of approximately 125 V and 17 μA/cm{sup 2}, respectively, were observed when a TFNG device underwent a compression test with a compressive force of 8 N and driving frequency of 10 Hz. This high-power generation enabled the instantaneous powering of 10 green light-emitting diodes that shone without any assistance from an external power source.

  12. Effect of sample preparation methods on photometric determination of the tellurium and cobalt content in the samples of copper concentrates

    Directory of Open Access Journals (Sweden)

    Viktoriya Butenko

    2016-03-01

    Full Text Available Methods of determination of cobalt and nickel in copper concentrates currently used in factory laboratories are very labor intensive and time consuming. The limiting stage of the analysis is preliminary chemical sample preparation. Carrying out the decomposition process of industrial samples with concentrated mineral acids in open systems does not allow to improve the metrological characteristics of the methods, for this reason improvement the methods of sample preparation is quite relevant and has a practical interest. The work was dedicated to the determination of the optimal conditions of preliminary chemical preparation of copper concentrate samples for the subsequent determination of cobalt and tellurium in the obtained solution using tellurium-spectrophotometric method. Decomposition of the samples was carried out by acid dissolving in individual mineral acids and their mixtures by heating in an open system as well as by using ultrasonification and microwave radiation in a closed system. In order to select the optimal conditions for the decomposition of the samples in a closed system the phase contact time and ultrasonic generator’s power were varied. Intensification of the processes of decomposition of copper concentrates with nitric acid (1:1, ultrasound and microwave radiation allowed to transfer quantitatively cobalt and tellurium into solution spending 20 and 30 min respectively. This reduced the amount of reactants used and improved the accuracy of determination by running the process in strictly identical conditions.

  13. 21 CFR 123.7 - Corrective actions.

    Science.gov (United States)

    2010-04-01

    ... of their HACCP plans in accordance with § 123.6(c)(5), by which they predetermine the corrective... in accordance with § 123.10, to determine whether the HACCP plan needs to be modified to reduce the risk of recurrence of the deviation, and modify the HACCP plan as necessary. (d) All corrective actions...

  14. Imaging with 123I labelled fatty acids

    International Nuclear Information System (INIS)

    Dudczak, R.

    1985-01-01

    This report describes the clinical results obtained with radioiodinated aromatic and aliphatic fatty acids. The radiopharmaceuticals were 123 I labelled p-phenylpentadecanoic (p-IPPA) and 123 I labelled heptadecanoic acid (HDA). The possibility to evaluate the myocardial metabolic function in man noninvasively add a complementary diagnostic tool in the clinical follow-up of patients with heart disease. (Auth.)

  15. 49 CFR 38.123 - Restrooms.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Restrooms. 38.123 Section 38.123 Transportation Office of the Secretary of Transportation AMERICANS WITH DISABILITIES ACT (ADA) ACCESSIBILITY... measured to the top of the toilet seat. Seats shall not be sprung to return to a lifted position. (3) A...

  16. 27 CFR 31.123 - New corporation.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false New corporation. 31.123... Requiring Registration As A New Business § 31.123 New corporation. Where a new corporation is formed to take over and conduct the business of one or more corporations that have registered under this part, the new...

  17. 27 CFR 28.123 - Export marks.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Export marks. 28.123..., or Transportation to a Manufacturing Bonded Warehouse § 28.123 Export marks. (a) General. In addition... filled under the provisions of part 24 of this chapter, the proprietor shall mark the word “Export” on...

  18. N-isopropyl-p-[I[sup 123

    Energy Technology Data Exchange (ETDEWEB)

    Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko (Toho Univ., Tokyo (Japan). School of Medicine)

    1992-09-01

    We studied the clinical usefulness of I[sup 123]-IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I[sup 123]-IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p<0.01). In all groups except the migraine, we could find abnormal findings in more than 90% of the patients. Out of 28 patients without focal findings on the initial CT scanning. I[sup 123]-IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I[sup 123]-IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I[sup 123]-IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I[sup 123]-IMP SPECT showed larger abnormalities in CT scanning. By using I[sup 123]-IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I[sup 123]-IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I[sup 123]-IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I[sup 123]-IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author).

  19. Tellurium stable isotope fractionation in chondritic meteorites and some terrestrial samples

    Science.gov (United States)

    Fehr, Manuela A.; Hammond, Samantha J.; Parkinson, Ian J.

    2018-02-01

    New methodologies employing a 125Te-128Te double-spike were developed and applied to obtain high precision mass-dependent tellurium stable isotope data for chondritic meteorites and some terrestrial samples by multiple-collector inductively coupled plasma mass spectrometry. Analyses of standard solutions produce Te stable isotope data with a long-term reproducibility (2SD) of 0.064‰ for δ130/125Te. Carbonaceous and enstatite chondrites display a range in δ130/125Te of 0.9‰ (0.2‰ amu-1) in their Te stable isotope signature, whereas ordinary chondrites present larger Te stable isotope fractionation, in particular for unequilibrated ordinary chondrites, with an overall variation of 6.3‰ for δ130/125Te (1.3‰ amu-1). Tellurium stable isotope variations in ordinary chondrites display no correlation with Te contents or metamorphic grade. The large Te stable isotope fractionation in ordinary chondrites is likely caused by evaporation and condensation processes during metamorphism in the meteorite parent bodies, as has been suggested for other moderately and highly volatile elements displaying similar isotope fractionation. Alternatively, they might represent a nebular signature or could have been produced during chondrule formation. Enstatite chondrites display slightly more negative δ130/125Te compared to carbonaceous chondrites and equilibrated ordinary chondrites. Small differences in the Te stable isotope composition are also present within carbonaceous chondrites and increase in the order CV-CO-CM-CI. These Te isotope variations within carbonaceous chondrites may be due to mixing of components that have distinct Te isotope signatures reflecting Te stable isotope fractionation in the early solar system or on the parent bodies and potentially small so-far unresolvable nucleosynthetic isotope anomalies of up to 0.27‰. The Te stable isotope data of carbonaceous and enstatite chondrites displays a general correlation with the oxidation state and hence might

  20. Thermoelectric properties of bismuth antimony tellurium thin films through bilayer annealing prepared by ion beam sputtering deposition

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Zhuang-hao [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Fan, Ping, E-mail: fanping308@126.com [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Luo, Jing-ting [College of Physics Science and Technology, Shenzhen University, 518060 (China); Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China); Cai, Xing-min; Liang, Guang-xing; Zhang, Dong-ping [College of Physics Science and Technology, Shenzhen University, 518060 (China); Ye, Fan [Shenzhen Key Laboratory of Sensor Technology, Shenzhen 518060 (China)

    2014-07-01

    Bismuth antimony tellurium is one of the most important tellurium-based materials for high-efficient thermoelectric application. In this paper, ion beam sputtering was used to deposit Bi{sub 2}Te{sub 3} and Sb{sub 2}Te{sub 3} bilayer thin films on borosilicate substrates at room-temperature. Then the bismuth antimony tellurium thin films were synthesized via post thermal treatment of the Bi{sub 2}Te{sub 3} and Sb{sub 2}Te{sub 3} bilayer thin films. The effect of annealing temperature and compositions on the thermoelectric properties of the thin films was investigated. After the thin films were annealed from 150 °C to 350 °C for 1 h in the high vacuum condition, the Seebeck coefficient changed from a negative sign to a positive sign. The X-ray diffraction results showed that the synthesized tellurium-based thermoelectric thin film exhibited various alloys phases, which contributed different thermoelectricity conductivity to the synthesized thin film. The overall Seebeck coefficient of the synthesized thin film changed from negative sign to positive sign, which was due to the change of the primary phase of the tellurium-based materials at different annealing conditions. Similarly, the thermoelectric properties of the films were also associated with the grown phase. High-quality thin film with the Seebeck coefficient of 240 μV K{sup −1} and the power factor of 2.67 × 10{sup −3} Wm{sup −1} K{sup −2} showed a single Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} phase when the Sb/Te thin film sputtering time was 40 min. - Highlights: • Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} thermoelectric thin films synthesized via bilayer annealing • The film has single Bi{sub 0.5}Sb{sub 1.5}Te{sub 3} phase with best thermoelectric performance. • The film has high thermoelectric properties comparable with other best results.

  1. Validation of a new design of tellurium dioide-irradiated target

    Energy Technology Data Exchange (ETDEWEB)

    Fllaoui, Aziz; Ghamad, Younes; Zoubir, Brahim; Ayaz, Zinel Abidine; El Morabiti, Aissam; Amayoud, Hafid [Centre National de l' Energie des Sciences et des Techniques Nucleaires, Rabat (Morocco); Chakir, El Mahjoub [Nuclear Physics Department, University Ibn Toufail, Kenitra (Morocco)

    2016-10-15

    Production of iodine-131 by neutron activation of tellurium in tellurium dioxide (TeO{sub 2}) material requires a target that meets the safety requirements. In a radiopharmaceutical production unit, a new lid for a can was designed, which permits tight sealing of the target by using tungsten inert gas welding. The leakage rate of all prepared targets was assessed using a helium mass spectrometer. The accepted leakage rate is ≤ 10 - 4 mbr.L/s, according to the approved safety report related to iodine-131 production in the TRIGA Mark II research reactor (TRIGA: Training, Research, Isotopes, General Atomics). To confirm the resistance of the new design to the irradiation conditions in the TRIGA Mark II research reactor's central thimble, a study of heat effect on the sealed targets for 7 hours in an oven was conducted and the leakage rates were evaluated. The results show that the tightness of the targets is ensured up to 600 .deg. C with the appearance of deformations on lids beyond 450 .deg. C. The study of heat transfer through the target was conducted by adopting a one-dimensional approximation, under consideration of the three transfer modes-convection, conduction, and radiation. The quantities of heat generated by gamma and neutron heating were calculated by a validated computational model for the neutronic simulation of the TRIGA Mark II research reactor using the Monte Carlo N-Particle transport code. Using the heat transfer equations according to the three modes of heat transfer, the thermal study of I-131 production by irradiation of the target in the central thimble showed that the temperatures of materials do not exceed the corresponding melting points. To validate this new design, several targets have been irradiated in the central thimble according to a preplanned irradiation program, going from 4 hours of irradiation at a power level of 0.5 MW up to 35 hours (7 h/d for 5 days a week) at 1.5 MW. The results show that the irradiated targets are

  2. Validation of a New Design of Tellurium Dioxide-Irradiated Target

    Directory of Open Access Journals (Sweden)

    Aziz Fllaoui

    2016-10-01

    Full Text Available Production of iodine-131 by neutron activation of tellurium in tellurium dioxide (TeO2 material requires a target that meets the safety requirements. In a radiopharmaceutical production unit, a new lid for a can was designed, which permits tight sealing of the target by using tungsten inert gas welding. The leakage rate of all prepared targets was assessed using a helium mass spectrometer. The accepted leakage rate is ≤ 10−4 mbr.L/s, according to the approved safety report related to iodine-131 production in the TRIGA Mark II research reactor (TRIGA: Training, Research, Isotopes, General Atomics. To confirm the resistance of the new design to the irradiation conditions in the TRIGA Mark II research reactor's central thimble, a study of heat effect on the sealed targets for 7 hours in an oven was conducted and the leakage rates were evaluated. The results show that the tightness of the targets is ensured up to 600°C with the appearance of deformations on lids beyond 450°C. The study of heat transfer through the target was conducted by adopting a one-dimensional approximation, under consideration of the three transfer modes—convection, conduction, and radiation. The quantities of heat generated by gamma and neutron heating were calculated by a validated computational model for the neutronic simulation of the TRIGA Mark II research reactor using the Monte Carlo N-Particle transport code. Using the heat transfer equations according to the three modes of heat transfer, the thermal study of I-131 production by irradiation of the target in the central thimble showed that the temperatures of materials do not exceed the corresponding melting points. To validate this new design, several targets have been irradiated in the central thimble according to a preplanned irradiation program, going from 4 hours of irradiation at a power level of 0.5 MW up to 35 hours (7 h/d for 5 days a week at 1.5 MW. The results show that the irradiated targets are

  3. Cyclotron production of high-purity 123I for medical applications via the 127I(p,5n)123Xe → 123I nuclear reaction

    International Nuclear Information System (INIS)

    Lagunas-Solar, M.C.

    1985-01-01

    The use of iodine-123 in nuclear medicine procedures is well documented in the scientific literature. Also, several methods for its production based on accelerator techniques have been described. Indirectly made 123 I via the 127 I(p,5n) 123 Xe → 123 I reaction produces 123 I of > 99.9% radionuclidic purity, with only 125 I ( 123 I production were developed at the University of California at Davis, where since 1974 the 76-in. isochronous cyclotron of the Crocker Nuclear Laboratory has been used for routine biweekly production of high-purity no-carrier-added 123 I

  4. Equilibrium evaporation behavior of polonium and its homologue tellurium in liquid lead-bismuth eutectic

    International Nuclear Information System (INIS)

    Ohno, Shuji; Miyahara, Shinya; Kurata, Yuji; Katsura, Ryoei; Yoshida, Shigeru

    2006-01-01

    Experimental study using the transpiration method investigates equilibrium evaporation behavior of radionuclide polonium ( 210 Po) generated and accumulated in liquid lead-bismuth eutectic (LBE) cooled nuclear systems. The experiment consists of two series of tests: preliminary evaporation tests for homologue element tellurium (Te) in LBE, and evaporation tests for 210 Po-accumulated LBE in which test specimens are prepared by neutron irradiation. The evaporation tests of Te in LBE provide the suggestion that Te exists in a chemical form of PbTe as well as the information for confirming the validity of technique and conditions of Po test. From the evaporation tests of 210 Po in LBE, we obtain fundamental data and empirical equations such as 210 Po vapor concentration in the gas phase, 210 Po partial vapor pressure, thermodynamic activity coefficients, and gas-liquid equilibrium partition coefficient of 210 Po in LBE in the temperature range from 450 to 750degC. Additionally, radioactivity concentration of 210 Po and 210m Bi vapor in a cover gas region of a typical LBE-cooled nuclear system is specifically estimated based on the obtained experimental results, and the importance of 210 Po evaporation behavior is quantitatively demonstrated. (author)

  5. Raman and DSC studies of fragility in tellurium-zinc oxide glass formers

    International Nuclear Information System (INIS)

    Stavrou, Elissaios; Kripotou, Sotiria; Raptis, Constantine; Turrell, Sylvia; Syassen, Karl

    2011-01-01

    Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out in four mixed (TeO 2 ) 1-x (ZnO) x (x = 0.1, 0.2, 0.3, 0.4) glasses at high temperatures (Raman and DSC through the glass transition) and high pressures (Raman) with the aim of determining the fragility of these glass forming oxides. Four different criteria, corresponding to four parameters, were applied to assess the fragility of the glasses. From the DSC studies, we have obtained the fragility parameter m which corresponds to the slopes of Arrhenius (lnQ vs. 1/T g , were Q is the heating rate) plots, and the glass transition width ΔT g . Also, from the low-frequency Raman scattering, and in particular the boson peak intensity of the glasses at T g , we have estimated the fragility ratio r R (T g ) = I min /I max whose value serves as another (empirical) fragility criterion. Finally, from high pressure Raman measurements on the glasses, we have estimated the Grueneisen parameter γ T for each glass, which constitutes the fourth fragility parameter adopted in this work. Considering the four parameters ΔT g , m, r (T g ) and γ T and the generally accepted (empirical) fragility criteria, we conclude that the mixed tellurium-zinc oxides constitute strong-to-intermediate glass formers (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  6. Structural Modeling of Djenkolic Acid with Sulfur Replaced by Selenium and Tellurium

    Directory of Open Access Journals (Sweden)

    Petr Melnikov

    2014-04-01

    Full Text Available The comparative structural modeling of djenkolic acid and its derivatives containing selenium and tellurium in chalcogen sites (Ch = Se, Te has provided detailed information about the bond lengths and bond angles, filling the gap in what we know about the structural characteristics of these aminoacids. The investigation using the molecular mechanics technique with good approximation confirmed the available information on X-ray refinements for the related compounds methionine and selenomethionine, as well as for an estimate made earlier for telluromethionine. It was shown that the Ch-C(3 and Ch-C(4 bond lengths grow in parallel with the increasing anionic radii. Although the distances C-C, C-O, and C-N are very similar, the geometry of conformers is quite different owing to the possibility of rotation about four carbon atoms, hence the remarkable variability observed in dihedral angles. It was shown that the compounds contain a rigid block with two Ch atoms connected through a methylene group. The standard program Gaussian 03 with graphical interface Gaussview 4.1.2 has proved to be satisfactory tool for the structural description of less-common bioactive compositions when direct X-ray results are absent.

  7. Agglomeration during wet milling of LAST (lead-antimony-silver-tellurium) powders

    International Nuclear Information System (INIS)

    Hall, B.D.; Case, E.D.; Ren, F.; Johnson, J.R.; Timm, E.J.

    2009-01-01

    LAST (lead-antimony-silver-tellurium) compounds comprise a family of semiconducting materials with good thermoelectric properties. However, the as-cast form of LAST exhibits large grain size and hence low mechanical strength. Powder processing can produce a fine powder particle size that enhances fracture strength, however the powders tend to agglomerate if the individual powder diameters are less than a few microns across. Dry milling or wet milling (hexane additions of 0 cm 3 and 10 cm 3 ) produced hard agglomerates roughly 40 μm in diameter while wet milling with hexane additions of 25 cm 3 , 30 cm 3 or 50 cm 3 resulted in small, porous agglomerates roughly 20 μm in diameter. Thus, by adjusting the amount of milling liquid used while milling LAST powders, one can shift from hard to soft agglomerates, where the literature shows that soft agglomerates are less harmful to the final, sintered product. Also, in agreement with the results from the literature on other materials, wet milling of LAST powders produced smaller particle sizes but required longer times to reach the grindability limit

  8. From Selenium- to Tellurium-Based Glass Optical Fibers for Infrared Spectroscopies

    Directory of Open Access Journals (Sweden)

    Jacques Lucas

    2013-05-01

    Full Text Available Chalcogenide glasses are based on sulfur, selenium and tellurium elements, and have been studied for several decades regarding different applications. Among them, selenide glasses exhibit excellent infrared transmission in the 1 to 15 µm region. Due to their good thermo-mechanical properties, these glasses could be easily shaped into optical devices such as lenses and optical fibers. During the past decade of research, selenide glass fibers have been proved to be suitable for infrared sensing in an original spectroscopic method named Fiber Evanescent Wave Spectroscopy (FEWS. FEWS has provided very nice and promising results, for example for medical diagnosis. Then, some sophisticated fibers, also based on selenide glasses, were developed: rare-earth doped fibers and microstructured fibers. In parallel, the study of telluride glasses, which can have transmission up to 28 µm due to its atom heaviness, has been intensified thanks to the DARWIN mission led by the European Space Agency (ESA. The development of telluride glass fiber enables a successful observation of CO2 absorption band located around 15 µm. In this paper we review recent results obtained in the Glass and Ceramics Laboratory at Rennes on the development of selenide to telluride glass optical fibers, and their use for spectroscopy from the mid to the far infrared ranges.

  9. Dibromidochlorido{2-[(dimethylaminomethyl]phenyl-κ2N,C1}tellurium(IV

    Directory of Open Access Journals (Sweden)

    Prakul Rakesh

    2012-01-01

    Full Text Available The title compound, C9H13Br2ClNTe, was synthesized by reacting [2-(dimethylaminomethylphenyl]tellurium(II chloride with Br2. As a consequence, the Cl and Br atoms are not well ordered but distributed over the three possible positions such that the overall stiochiometry is two Br atoms and one Cl atom. The scrambling of the Br and Cl atoms indicates a small energy barrier for the exchange process between the apical and equatorial positions. Overall, the Te atom geometry is slightly distorted square pyramidal (τ = 0.052 for the major component. However, there is a weak secondary interaction between the Te atoms and the disordered Br/Cl atoms of a nearby molecule. The Te—Br and Te—Cl distances in both disorder components fall into two groups; a longer distance for the Br/Cl involved in this secondary interaction [2.6945 (17 Å for Br and 2.601 (9Å for Cl] and shorter bond distances to the remaining halogen atoms, indicating that this interaction has slightly weakened the Te—X bond, as is the case in the previously reported tribromido structure [Singh et al. (1990. J. Chem. Soc. Dalton Trans. pp. 907–913]. Otherwise, the metrical parameters in the two structures are not significantly different. An intermolecular C—H...Br interaction occurs.

  10. Size Controlled Synthesis of Tellurium Nanorices by Galvanic Displacement Reaction of Aluminum

    International Nuclear Information System (INIS)

    Wu, Tingjun; Myung, Lawrence Youngjae; Zhang, Miluo; Lee, Kyu-Hwan; Lee, Yeheun Laura; Lim, Hyo-Ryong; Kim, Bum Sung; Choa, Yong-Ho; Myung, Nosang V.

    2015-01-01

    ABSTRACT: Tellurium nanostructures were synthesized by galvanic displacement reaction (GDR) of aluminum in an alkaline solution containing TeO 3 2− ions. Due to negative redox potential of Al/AlO 2 − (i.e., −2.50 V vs. sat. Ag/AgCl), TeO 3 2− (+IV) can be reduced to Te 2 2− (-I) and Te 2− (-II), which resulted in the deposition of Te (0) nanostructures in the solution via chemical reaction between Te 2 2− or Te 2− and TeO 3 2− . The deposition mechanism led to the formation of unique “rice-like” nanostructures in the solution instead of branched structures on the substrate. The sharp tips of the “rice-like” nanostructures may be attributed to the high density of surface charges at the tips. The morphology, diameter and aspect ratio of Te “rice-like” nanostructures were altered by the TeO 3 2− concentration, solution pH, reaction time and the reaction temperature. Electrochemical analytical methods, including open circuit potential (OCP) and linear polarizations (LPs), were used to investigate the reaction mechanisms. The enhancement of piezoelectric constant (d 11 ) of nanorices at small diameter was probably due to a flexoelectric effect

  11. Determination of tellurium in gallium by alternating current stripping voltammetry with a mercury/graphite electrode

    International Nuclear Information System (INIS)

    Berengard, I.B.; Kaplan, B. Ya.

    1986-01-01

    The analytical signal in ac stripping coltammetry (ACSV) with mercury indicator electrodes depends on the weight of the electrolytically collected analyte at the electrode surface, the depth of the collection layer being equal to the effective diffusion-layer thickness. Replacement of the static mercury drop electrode (SMDE) by the mercury/graphite electrode (MGE) is of practical interest in that the analyte detection limit can be lowered by decreasing the colume of the telluriumcontaining polarographed solution; in addition, plant laboratories find it difficult to control the SDME uniformity. The work in this article was done on a PU-1 universal polarograph in a square-wave vol tage component mode using the three-electrode cell shown. The rotating mercury/graphite electrode is found by the authors to be superior to the static mercury drop electrode in that it can lower the detection limit for tellurium in gallium to 5.10 /SUP -7percent/ , due to the smaller volume of the polarographed solution

  12. Iron-tellurium-selenium mixed oxide catalysts for the selective oxidation of propylene to acrolein

    International Nuclear Information System (INIS)

    Patel, B.M.; Price, G.L.

    1990-01-01

    This paper reports on iron-tellurium-selenium mixed oxide catalysts prepared by coprecipitation from aqueous solution investigated for the propylene to acrolein reaction in the temperature range 543-773 K. Infrared spectroscopy, electron dispersive X-ray analysis, X-ray diffraction, and isotopic tracer techniques have also been employed to characterize this catalytic system. Properties of the Fe-Te-Se mixed oxide catalysts have been compared with Fe-Te mixed oxides in an effort to deduce the functionality of Se. The selenium in the Fe-Te-Se-O catalyst has been found to be the hydrocarbon activating site. The activation energies for the acrolein and carbon dioxide formation are 71 and 54 kJ/mol, respectively. Reactions carried out with 18 O 2 have shown lattice oxygen to be primarily responsible for the formation of both acrolein and carbon dioxide. The initial and rate-determining step for acrolein formation is hydrogen abstraction as determined by an isotope effect associated with the C 3 D 6 reaction. No isotope effect is observed for carbon dioxide formation from C 3 D 6 suggesting that CO 2 is formed by parallel, not consecutive, oxidation of propylene

  13. Study on concentration nonlinearity of interacting acoustic flows in cadmium sulfide and tellurium

    International Nuclear Information System (INIS)

    Ilisavskij, Yu.V.; Kulakova, L.A.; Yakhkind, Eh.Z.

    1976-01-01

    The ratio of an one-mode (self-action of an external monochromatic sound wave) and a many-mode (interaction of an external wave with crystal thermal phonons) concentration nonlinearity has been experimentally investigated on sound amplification in cadmium sulphide and tellurium. It has been shown that in a strong piezoelectric the main part in the nonlinear limitation of the sound amplification in a drift field is played by the wave interaction, i.e., the transfer of the sound wave energy into the crystal sound modes starts before the nonlinear self-action of a wave. In Te characterized by a large value of the electromechanical coupling constant value at the sound frequency of about 250 MHz the threshold of many-mode nonlinearity is achieved in fields much below the critical one, and corresponds to the sound intensity as low as 10 -7 W/cm 2 , as compared with 10 -2 W/cm 2 -the threshold of the one-mode nonlinearity

  14. Enhanced Flexural Strength of Tellurium Nanowires/epoxy Composites with the Reinforcement Effect of Nanowires

    Science.gov (United States)

    Balguri, Praveen Kumar; Harris Samuel, D. G.; Aditya, D. B.; Vijaya Bhaskar, S.; Thumu, Udayabhaskararao

    2018-02-01

    Investigating the mechanical properties of polymer nanocomposite materials has been greatly increased in the last decade. In particular, flexural strength plays a major role in resisting bending and shear loads of a composite material. Here, one dimensional (1D) tellurium nanowires (TeNWs) reinforced epoxy composites have been prepared and the flexural properties of resulted TeNWs/epoxy nanocomposites are studied. The diameter and length of the TeNWs used to make TeNWs/epoxy nanocomposites are 21±2.5 nm and 697±87 nm, respectively. Plain and TeNWs/epoxy nanocomposites are characterized by X-ray diffraction (XRD), thermogravimetric analysis (TGA), and differential thermal analysis (DTA). Furthermore, significant enhancement in the flexural strength of TeNWs/epoxy nanocomposite is observed in comparison to plain epoxy composite, i.e. flexural strength is increased by 65% with the addition of very little amount of TeNWs content (0.05 wt.%) to epoxy polymer. Structural details of plain and TeNWs/epoxy at micrometer scale were examined by scanning electron microscopy (SEM). We believe that our results provide a new type of semiconductor nanowires based high strength epoxy polymer nanocomposites.

  15. Antiparasitic activity of 1,3-dioxolanes containing tellurium in Trichomonas vaginalis.

    Science.gov (United States)

    Sena-Lopes, Ângela; das Neves, Raquel Nascimento; Bezerra, Francisco Silvestre Brilhante; de Oliveira Silva, Mara Thais; Nobre, Patrick C; Perin, Gelson; Alves, Diego; Savegnago, Lucielli; Begnini, Karine Rech; Seixas, Fabiana Kommling; Collares, Tiago; Borsuk, Sibele

    2017-05-01

    The increased prevalence of metronidazole-resistant infections has resulted in a search for alternative drugs for the treatment of trichomoniasis. In the present study, we report the preparation and in vitro activity of three 1,3-dioxolanes that contain tellurium (PTeDOX 01, PTeDOX 02, and PTeDOX 03) against Trichomonas vaginalis. Six concentrations of these compounds were analyzed for in vitro activity against ATCC 30236 isolate of T. vaginalis. PTeDOX 01 reported a cytotoxic effect against 100% of T. vaginalis trophozoites at a final concentration of 90μM with an IC 50 of 60μM. The kinetic growth curve of trophozoites indicated that PTeDOX 01 reduced the growth by 22% at a concentration of 90μM after an exposure of 12h, and induced complete parasite death at 24h. It induced cytotoxicity of 44% at 90μM concentration but and had no effect in lower concentrations in a culture of CHO-K1 cells. These results confirmed that PTeDOX 01 is an important drug for the treatment of T. vaginalis, and should be evaluated in other infectious agents as well. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  16. 21 CFR 163.123 - Sweet chocolate.

    Science.gov (United States)

    2010-04-01

    ... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.123 Sweet chocolate. (a... specified in paragraph (b)(3) of this section are used in the breakfast cocoa, the label shall bear an...

  17. I sup(123) target transfer system

    International Nuclear Information System (INIS)

    Almeida, G.L. de; Rautenberg, F.A.

    1986-01-01

    The construction of target transfer system using a robot into hot cell of IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. The system operation is described, and the advantages are shown. (M.C.K.)

  18. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    Energy Technology Data Exchange (ETDEWEB)

    Day Goodacre, T., E-mail: thomas.day.goodacre@cern.ch [CERN, CH-1211 Geneva 23 (Switzerland); School of Physics and Astronomy, The University of Manchester, Manchester M13 9PL (United Kingdom); Fedorov, D. [Petersburg Nuclear Physics Institute, 188350 Gatchina (Russian Federation); Fedosseev, V.N.; Forster, L.; Marsh, B.A. [CERN, CH-1211 Geneva 23 (Switzerland); Rossel, R.E. [CERN, CH-1211 Geneva 23 (Switzerland); Institut für Physik, Johannes Gutenberg Universität, D-55099 Mainz (Germany); Faculty of Design, Computer Science and Media, Hochschule RheinMain, Wiesbaden (Germany); Rothe, S.; Veinhard, M. [CERN, CH-1211 Geneva 23 (Switzerland)

    2016-09-11

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  19. Laser resonance ionization scheme development for tellurium and germanium at the dual Ti:Sa–Dye ISOLDE RILIS

    CERN Document Server

    Day Goodacre, T.; Fedosseev, V.N.; Forster, L.; Marsh, B.A.; Rossel, R.E.; Rothe, S.; Veinhard, M.

    2016-01-01

    The resonance ionization laser ion source (RILIS) is the principal ion source of the ISOLDE radioactive beam facility based at CERN. Using the method of in-source laser resonance ionization spectroscopy, a transition to a new autoionizing state of tellurium was discovered and applied as part of a three-step, three-resonance, photo-ionization scheme. In a second study, a three-step, two-resonance, photo-ionization scheme for germanium was developed and the ionization efficiency was measured at ISOLDE. This work increases the range of ISOLDE RILIS ionized beams to 31 elements. Details of the spectroscopy studies are described and the new ionization schemes are summarized.

  20. Reaction of 1-bromo-3-chloropropane with tellurium and dimethyl telluride in the system of hydrazine hydrate-alkali

    International Nuclear Information System (INIS)

    Russavskaya, N.V.; Levanova, E.P.; Sukhomazova, Eh.N.; Grabel'nykh, V.A.; Elaev, A.V.; Klyba, L.V.; Zhanchipova, E.R.; Albanov, A.I.; Korotaeva, I.M.; Toryashinova, D.S.D.; Korchevin, N.A.

    2006-01-01

    A synthesis of oligomeric substance of thiocol type, the poly(trimethyleneditelluride), from 1-bromo-3-chloropropane and elemental tellurium is performed using a hydrazine hydrate-alkali system. Reductive splitting of the tellurocol followed by alkylation with methyl iodide give rise to preparation of bis(methyltelluro)propane, which was synthesized also from dimethyl telluride and 1,3-dihalopropanes using the N 2 H 4 ·H 2 O/KOH system. The reaction products were characterized by elementary analysis, NMR, and IR spectra. Mass spectra of the synthesized low molecular weight organotellurium compounds are considered [ru

  1. Luminescent Tellurium-Doped Cadmium Sulfide Electrodes as Probes of Semiconductor Excited-State Deactivation Processes in Photoelectrochemical Cells.

    Science.gov (United States)

    1980-08-12

    photocurrent and emission intensity. Whereas CdS:Te electrochemistry consisted of oxidation of an electrolyte 2+ reductant, ZnO underwent photoanodic...employed n- and 1 3 2,3 3 3,4p-type GaPl’ n-type ZnO , n-type CdS , and n- and p-type GaAs. We have focussed our attention recently on n-type, tellurium...should point out that our treatment of Or and 0x is not without precedent. Both GaP- and ZnO -based PECs have been examined in this regard.l12 The

  2. Labeling of indocyanine green with carrier-free iodine-123

    International Nuclear Information System (INIS)

    Ansari, A.N.; Lambrecht, R.M.; Redvanly, C.S.; Wolf, A.P.

    1976-01-01

    The method is described for labeling indocyanine green (ICG) with carrier-free iodine-123 by condensing xenon-123 on crystals of ICG followed by permitting decay of the 123 Xe a sufficient length of time to produce 123 I-electronically excited ions and atoms which subsequently label ICG. 4 claims, no drawings

  3. Quantitative SPECT reconstruction of iodine-123 data

    International Nuclear Information System (INIS)

    Gilland, D.R.; Jaszczak, R.J.; Greer, K.L.; Coleman, R.E.

    1991-01-01

    Many clinical and research studies in nuclear medicine require quantitation of iodine-123 ( 123 I) distribution for the determination of kinetics or localization. The objective of this study was to implement several reconstruction methods designed for single-photon emission computed tomography (SPECT) using 123 I and to evaluate their performance in terms of quantitative accuracy, image artifacts, and noise. The methods consisted of four attenuation and scatter compensation schemes incorporated into both the filtered backprojection/Chang (FBP) and maximum likelihood-expectation maximization (ML-EM) reconstruction algorithms. The methods were evaluated on data acquired of a phantom containing a hot sphere of 123 I activity in a lower level background 123 I distribution and nonuniform density media. For both reconstruction algorithms, nonuniform attenuation compensation combined with either scatter subtraction or Metz filtering produced images that were quantitatively accurate to within 15% of the true value. The ML-EM algorithm demonstrated quantitative accuracy comparable to FBP and smaller relative noise magnitude for all compensation schemes

  4. Hot seeding using large Y-123 seeds

    International Nuclear Information System (INIS)

    Scruggs, S J; Putman, P T; Zhou, Y X; Fang, H; Salama, K

    2006-01-01

    There are several motivations for increasing the diameter of melt textured single domain discs. The maximum magnetic field produced by a trapped field magnet is proportional to the radius of the sample. Furthermore, the availability of trapped field magnets with large diameter could enable their use in applications that have traditionally been considered to require wound electromagnets, such as beam bending magnets for particle accelerators and electric propulsion. We have investigated the possibility of using large area epitaxial growth instead of the conventional point nucleation growth mechanism. This process involves the use of large Y123 seeds for the purpose of increasing the maximum achievable Y123 single domain size. The hot seeding technique using large Y-123 seeds was employed to seed Y-123 samples. Trapped field measurements indicate that single domain samples were indeed grown by this technique. Microstructural evaluation indicates that growth can be characterized by a rapid nucleation followed by the usual peritectic grain growth which occurs when large seeds are used. Critical temperature measurements show that no local T c suppression occurs in the vicinity of the seed. This work supports the suggestion of using an iterative method for increasing the size of Y-123 single domains that can be grown

  5. 123I research and production at Brookhaven

    International Nuclear Information System (INIS)

    Mausner, L.F.; Srivastava, S.C.; Mirzadeh, S.; Meinken, G.E.; Prach, T.

    1985-01-01

    The procedures for preparing high purity 123 I at the BLIP using the 127 I(p,5n) 123 Xe reaction on an NaI target are described. The activity is supplied in a glass ampoule with anhydrous 123 I deposited on the interior walls, allowing maximum flexibility in subsequent iodinations. Preliminary experience with a continuous flow target is also described. The results of a series of measurements of specific activity by neutron activation, x-ray fluorescence, uv absorption, and wet chemistry generally showed no detectable carrier. HPLC methods to analyse the chemical form of radioiodine and to characterize various iodinated radiopharmaceuticals have been developed. These methods provide higher sensitivity, speed and resolution than commonly used techniques. 19 refs., 6 figs., 2 tabs

  6. Evaluation of the Content of Antimony, Arsenic, Bismuth, Selenium, Tellurium and Their Inorganic Forms in Commercially Baby Foods.

    Science.gov (United States)

    Ruiz-de-Cenzano, M; Rochina-Marco, A; Cervera, M L; de la Guardia, M

    2017-12-01

    Baby foods, from the Spanish market and prepared from meat, fish, vegetables, cereals, legumes, and fruits, were analyzed to obtain the concentration of antimony (Sb), arsenic (As), bismuth (Bi), and tellurium (Te) as toxic elements and selenium (Se) as essential element. An analytical procedure was employed based on atomic fluorescence spectroscopy which allowed to obtain accurate data at low levels of concentration. Values of 14 commercial samples, expressed in nanograms per gram fresh weight, ranged for Sb 0.66-6.9, As 4.5-242, Te 1.35-2.94, Bi 2.18-4.79, and Se 5.4-109. Additionally, speciation studies were performed based on data from a non-chromatographic screening method. It was concluded that tellurium and bismuth were mainly present as inorganic forms and selenium as organic form, and antimony and arsenic species depend on the ingredients of each baby food. Risk assessment considerations were made by comparing dietary intake of the aforementioned elements through the consumption of one baby food portion a day and recommended or tolerable guideline values.

  7. Tellurium rings as electron pair donors in cluster compounds and coordination polymers; Tellurringe als Elektronenpaardonoren in Clusterverbindungen und Koordinationspolymeren

    Energy Technology Data Exchange (ETDEWEB)

    Guenther, Anja

    2011-11-08

    In this dissertation novel and already known molecular tellurium rings are presented in cluster compounds and quasi-one-dimensional coordination polymers. The cyclic, homonuclear units are always stabilized by coordination to electron-rich transition metal atoms, with the coordinating tellurium atoms acting as two-electron donors. As a synthesis route, the solid-state reaction in quartz glass vials was used uniformly. In addition to structural determination, the focus was on the characterization of the resulting compounds. For this purpose, resistance measurements were carried out on selected compounds, the magnetic behavior and the thermal degradation reactions were investigated and accompanying quantum chemical calculations were carried out. [German] In dieser Dissertation werden neuartige sowie bereits bekannte molekulare Tellurringe in Clusterverbindungen und quasi-eindimensionalen Koordinationspolymeren vorgestellt. Die Stabilisierung der zyklischen, homonuklearen Einheiten erfolgt dabei stets durch die Koordination an elektronenreiche Uebergangsmetallatome, wobei die koordinierenden Telluratome gegenueber diesen als Zwei-Elektronendonoren fungieren. Als Syntheseroute wurde dabei einheitlich auf die Festkoerperreaktion in Quarzglasampullen zurueckgegriffen. Neben der Strukturaufklaerung stand die Charakterisierung der erhaltenden Verbindungen im Fokus der Arbeit. Dazu wurden an ausgewaehlten Verbindungen Widerstandsmessungen durchgefuehrt, das magnetische Verhalten sowie die thermischen Abbaureaktionen untersucht und begleitende quantenchemische Rechnungen durchgefuehrt.

  8. Surface studies on graphite furnace platforms covered with Pd, Rh and Ir as modifiers in graphite furnace atomic absorption spectrometry of tellurium

    Energy Technology Data Exchange (ETDEWEB)

    Pedro, Juana [Area de Química Analítica, Departamento de Química, Facultad de Ingeniería Química, Universidad Nacional del Litoral, Santiago del Estero 2829 (S3000GL.N), Santa Fe (Argentina); Stripekis, Jorge [Laboratorio de Análisis de Trazas, Departamento de Química Inorgánica, Analítica y Química Física, INQUIMAE, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria (1428), Buenos Aires (Argentina); Departamento de Ingeniería Química, Instituto Tecnológico de Buenos Aires, Av. Eduardo Madero 399 (1106), Buenos Aires (Argentina); Bonivardi, Adrian [Area de Química Analítica, Departamento de Química, Facultad de Ingeniería Química, Universidad Nacional del Litoral, Santiago del Estero 2829 (S3000GL.N), Santa Fe (Argentina); Tudino, Mabel, E-mail: tudino@qi.fcen.uba.ar [Laboratorio de Análisis de Trazas, Departamento de Química Inorgánica, Analítica y Química Física, INQUIMAE, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Ciudad Universitaria (1428), Buenos Aires (Argentina)

    2015-05-01

    The main objective of this work is the study of correlations between the efficiency of the distribution of the permanent platinum group modifiers Pd, Rh and Ir over the graphite surface with the aim of improving analytical signal of tellurium. Modifier solution was deposited onto the platform and pyrolysed after drying. In the case of Pd, the physical vaporization/deposition technique was also tested. In order to analyze the differences amongst coverings (morphology, topology and distribution), the graphite surfaces were studied with scanning electron microscopy and energy dispersive X-ray microscopy. Micrographs for physical vaporization and pyrolytic deposition of Pd were also analyzed in order to explain the lack of signal obtained for tellurium with the first alternative. Similar micrographs were obtained for pyrolytic deposition of Ir and Rh and then, compared to those of Pd. Ir showed the most homogeneous distribution on the graphite surface and the tallest and sharpest transient. With the aim of improving the analytical signal of tellurium, the correlation between the surface studies and the tellurium transient signal (height, area and shape) is discussed. - Highlights: • Distribution of Rh, Pd and Ir onto graphite furnaces is evaluated by SEM and EDX • Micrographs and spectra showed that surface distribution could influence Te signal. • Ir showed the best signal together with the most homogeneous surface distribution. • Pd-PVD micrographs revealed the absence of graphite and no signal for Te.

  9. Synthesis of 123I-16 iodo estradiol

    International Nuclear Information System (INIS)

    Therain, F.; Gros, J.; Souchu, A.

    1982-01-01

    16α iodo estradiol has been demonstrated to have as good an affinity as estradiol for estrogen-receptors and, labeled with iodine 123, may provide a good scanning agent fot visualisation of tissues containing estrogen-repectors, especially mammary tumors. 123 I-16α iodo estradiol has been synthesized by an halogen exchange of 16ν bromo estradiol according to the procedure described by Hochberg for 125 I-16α iodo estradiol labeling. Radiochemical yields are much lower than with iodine 125 (1 to 30%) and extremely variable. Specific activity range from 1,000 to 2,000 Ci/mmole [fr

  10. Chemical processes for the extreme enrichment of tellurium into marine ferromanganese oxides

    Science.gov (United States)

    Kashiwabara, Teruhiko; Oishi, Yasuko; Sakaguchi, Aya; Sugiyama, Toshiki; Usui, Akira; Takahashi, Yoshio

    2014-04-01

    Tellurium, an element of growing economic importance, is extremely enriched in marine ferromanganese oxides. We investigated the mechanism of this enrichment using a combination of spectroscopic analysis and adsorption/coprecipitation experiments. X-ray Absorption Near-Edge Structure (XANES) analysis showed that in adsorption/coprecipitation systems, Te(IV) was oxidized on δ-MnO2 and not oxidized on ferrihydrite. Extended X-ray Absorption Fine Structure (EXAFS) analysis showed that both Te(IV) and Te(VI) were adsorbed on the surface of δ-MnO2 and ferrihydrite via formation of inner-sphere complexes. In addition, Te(VI) can be structurally incorporated into the linkage of Fe octahedra through a coprecipitation process because of its molecular geometry that is similar to the Fe octahedron. The largest distribution coefficient obtained in the adsorption/coprecipitation experiments was for the Te(VI)/ferrihydrite coprecipitation system, and it was comparable to those calculated from the distribution between natural ferromanganese oxides and seawater. Our XAFS and micro-focused X-ray fluorescence (μ-XRF) mapping of natural ferromanganese oxides showed that Te was structurally incorporated as Te(VI) in Fe (oxyhydr)oxide phases. We conclude that the main process for the enrichment of Te in ferromanganese oxides is structural incorporation of Te(VI) into Fe (oxyhydr)oxide phases through coprecipitation. This mechanism can explain the unique degree of enrichment of Te compared with other oxyanions, which are mainly enriched via adsorption on the surface of the solid structures. In particular, the great contrast in the distributions of Te and Se is caused by their oxidized species: (i) the similar geometry of the Te(VI) molecule to Fe octahedron, and (ii) quite soluble nature of Se(VI). Coexisting Mn oxide phases may promote structural incorporation of Te(VI) by oxidation of Te(IV), although the surface oxidation itself may not work as the critical enrichment process as

  11. Metabolism of 123I-FP-CIT in humans

    International Nuclear Information System (INIS)

    Tanaka, Akihiro; Okano, Kyoko; Tamagami, Hiroshi

    1999-01-01

    The metabolism of N-(3-fluoropropyl)-2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-FP-CIT) in healthy humans was studied. Plasma and urine samples, obtained after i.v. administration of 123 I-FP-CIT, were analyzed using the two-dimensional thin-layer chromatography technique. Eleven radiochemical components were detected in both plasma and urine, and four of them were the parent 123 I-FP-CIT and its metabolites, N-(3-fluoropropyl)-2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-acid), 2β-carboxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-acid) and 2β-carbomethoxy-3β-(4-iodophenyl)nortropane ( 123 I) ( 123 I-nor-CIT). These four identified radiochemical components occupied about 80% or more in ratio of the radiochemical components in the plasma and urine. In the metabolites of 123 I-FP-CIT, the high polar metabolites- 123 I-acid and 123 I-nor-acid-were found to be the major components, while lipophilic 123 I-nor-CIT was a minor component. Free iodide ( 123 I - ) was not found in the plasma or urine. Thus, the main metabolic reactions which 123 I-FP-CIT undergoes in humans seem to be hydrolysis of the ester bond and N-dealkylation. In vivo deiodination of 123 I-FP-CIT was found to be minimum. Current results suggest that the metabolites of 123 I-FP-CIT hardly influence evaluation of the dopamine transporter in the human brain. (author)

  12. V123 Beam Synchronous Encoder Module

    International Nuclear Information System (INIS)

    Kerner, T.; Conkling, C. R.; Oerter, B.

    1999-01-01

    The V123 Synchronous Encoder Module transmits events to distributed trigger modules and embedded decoders around the RHIC rings where they are used to provide beam instrumentation triggers [1,2,3]. The RHIC beam synchronous event link hardware is mainly comprised of three VMEbus board designs, the central input modules (V201), and encoder modules (V123), and the distributed trigger modules (V124). Two beam synchronous links, one for each ring, are distributed via fiberoptic and fanned out via twisted wire pair cables. The V123 synchronizes with the RF system clock derived from the beam bucket frequency and a revolution fiducial pulse. The RF system clock is used to create the beam synchronous event link carrier and events are synchronized with the rotation fiducial. A low jitter RF clock is later recovered from this carrier by phase lock loops in the trigger modules. Prioritized hardware and software triggers fill up to 15 beam event code transmission slots per revolution while tracking the ramping RF acceleration frequency and storage frequency. The revolution fiducial event is always the first event transmitted which is used to synchronize the firing of the abort kicker and to locate the first bucket for decoders distributed about the ring

  13. 21 CFR 123.10 - Training.

    Science.gov (United States)

    2010-04-01

    ... HACCP principles to fish and fishery product processing at least equivalent to that received under... standardized curriculum. (a) Developing a HACCP plan, which could include adapting a model or generic-type HACCP plan, that is appropriate for a specific processor, in order to meet the requirements of § 123.6(b...

  14. 14 CFR 1264.123 - Protective order.

    Science.gov (United States)

    2010-01-01

    ... PENALTIES ACT OF 1986 § 1264.123 Protective order. (a) A party or a prospective witness or deponent may file a motion for a protective order with respect to discovery sought by an opposing party or with... the following: (1) That the discovery not be had; (2) That the discovery may be had only on specified...

  15. I-123 IMP SPECT in Parkinson's disease

    International Nuclear Information System (INIS)

    Kawabata, Keita; Tachibana, Kyudai; Sugita, Minoru

    1990-01-01

    To examine semiquantitatively regional cerebral blood flow, SPECT with N-isopropyl-p-[I-123]iodoamphetamine (I-123 IMP) was undertaken in 17 patients with Parkinson's disease. Seven patients with Alzheimer's disease and 9 senile control subjects were also imaged for comparison. Both the Parkinson's disease group and the Alzheimer's disease group had a decreased uptake of I-123 IMP in the frontal lobe, in comparison with the control group. A remarkably decreased uptake was seen in the lateral and parietal lobes in the group of Parkinson's disease associated with dementia, as well as in the Alzheimer's disease group. A significantly decreased uptake was observed in the frontal lobe, lateral lobe, thalamus, and basal ganglia in the Parkinson's disease group, irrespective of the presence or absence of dementia. For Parkinson's disease associated with dementia, there was much more significant decrease in I-123 IMP uptake. The pattern of regional cerebral blood flow in the Alzheimer's disease group was analogous to that in the Parkinson's disease group associated with dementia. This supports the hypothesis that Alzheimer's disease may be somewhat involved in the occurrence of dementia for Parkinson's disease. (N.K.)

  16. 13 CFR 123.500 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Reservist Economic Injury Disaster Loans § 123.500 Definitions. The following terms have the same meaning wherever they are used in this subpart: (a) Essential employee is an individual (whether or not an owner of... economic injury means an economic harm to the small business such that it cannot: (1) Meet its obligations...

  17. Hippuran-123 I: labelling and quality control

    International Nuclear Information System (INIS)

    Barboza, M.F. de; Colturato, M.T.; Herrerias, R.; Muramoto, E.

    1992-01-01

    The o-iodo hippuric acid labelling with radioiodine is a radiopharmaceutical used with more frequently for evaluation the kidney function. Several reactive kits for labelling with 123 I are prepared. Controls of radiochemical purity and biological distribution are made. The reactive kit of hippuran is kept at 4 C during 2 years. (C.G.C.)

  18. Dosimetry of iodine-123 for newborn and infant

    International Nuclear Information System (INIS)

    Guilhem, M.T.; Therain, F.

    1987-01-01

    Iodine-123 ( 123 I) is a radionuclide of choice of neonatal hypothyroidism diagnosis. It is important to know infant main organs adsorbed doses during a thyroid scan with 123 I. Absorbed doses are already available for adults: for infants, they must be transformed taking account of organs sizes and inter-organs distances. Calculations are done for commercially available 123 I(p,2n) and 123 I(p,5n). Important contamination of 124 I in 123 I(p,2n) increases considerably the absorbed-dose during thyroid scan of a newborn (the ratio 124 I/ 123 I doubles every 15h). For routinely used activities, thyroid absorbed dose, 24 h after end of production, is fifteen times higher with 123 I(p,5n) than with 99m Tc: for one month old child; total body absorbed dose is of the same order of magnitude [fr

  19. Production of 123I for medical use with small accelerators

    International Nuclear Information System (INIS)

    Beyer, G.J.; Pimentel, G.; Solin, O.; Heselius, S.J.; Taka, T.

    1988-01-01

    The possibilities of 123 I production with small accelerators are discussed. Among the possible nuclear reactions the 122 Te(d,n) 123 I and the 123 Te(p,n) 123 I reaction are of particular interest for those institutions, who do not run a cyclotron with particle energies for protons above 18-20 MeV. The use of TeO 2 as target material is advantaged over Te. The 123 I preparations contain resonable amounts of 130 I and 124 I. The most 'dangerous' impurity is 130 I due to its high energy gamma radiation. Nevertheless, high quality imagings may be obtained using medium or high energy collimators loosing some of the advantages of 123 I. The proposed approach is the only way to make 123 I available for a number of institutions or countries running small cyclotrons and for which commercial 123 I is difficult or impossible to obtain for economical or geographical reasons. (author)

  20. Leaching of cadmium and tellurium from cadmium telluride (CdTe) thin-film solar panels under simulated landfill conditions

    Science.gov (United States)

    Ramos-Ruiz, Adriana; Wilkening, Jean V.; Field, James A.; Sierra-Alvarez, Reyes

    2017-01-01

    A crushed non-encapsulated CdTe thin-film solar cell was subjected to two standardized batch leaching tests (i.e., Toxicity Characteristic Leaching Procedure (TCLP) and California Waste Extraction Test (WET)) and to a continuous-flow column test to assess cadmium (Cd) and tellurium (Te) dissolution under conditions simulating the acidic- and the methanogenic phases of municipal solid waste landfills. Low levels of Cd and Te were solubilized in both batch leaching tests (leaching behavior of CdTe in the columns is related to different aqueous pH and redox conditions promoted by the microbial communities in the columns, and is in agreement with thermodynamic predictions. PMID:28472709

  1. Development of tellurium oxide and lead-bismuth oxide glasses for mid-wave infra-red transmission optics

    Science.gov (United States)

    Zhou, Beiming; Rapp, Charles F.; Driver, John K.; Myers, Michael J.; Myers, John D.; Goldstein, Jonathan; Utano, Rich; Gupta, Shantanu

    2013-03-01

    Heavy metal oxide glasses exhibiting high transmission in the Mid-Wave Infra-Red (MWIR) spectrum are often difficult to manufacture in large sizes with optimized physical and optical properties. In this work, we researched and developed improved tellurium-zinc-barium and lead-bismuth-gallium heavy metal oxide glasses for use in the manufacture of fiber optics, optical components and laser gain materials. Two glass families were investigated, one based upon tellurium and another based on lead-bismuth. Glass compositions were optimized for stability and high transmission in the MWIR. Targeted glass specifications included low hydroxyl concentration, extended MWIR transmission window, and high resistance against devitrification upon heating. Work included the processing of high purity raw materials, melting under controlled dry Redox balanced atmosphere, finning, casting and annealing. Batch melts as large as 4 kilograms were sprue cast into aluminum and stainless steel molds or temperature controlled bronze tube with mechanical bait. Small (100g) test melts were typically processed in-situ in a 5%Au°/95%Pt° crucible. Our group manufactured and evaluated over 100 different experimental heavy metal glass compositions during a two year period. A wide range of glass melting, fining, casting techniques and experimental protocols were employed. MWIR glass applications include remote sensing, directional infrared counter measures, detection of explosives and chemical warfare agents, laser detection tracking and ranging, range gated imaging and spectroscopy. Enhanced long range mid-infrared sensor performance is optimized when operating in the atmospheric windows from ~ 2.0 to 2.4μm, ~ 3.5 to 4.3μm and ~ 4.5 to 5.0μm.

  2. Flavoprotein-mediated tellurite reduction: structural basis and applications to the synthesis of tellurium-containing nanostructures

    Directory of Open Access Journals (Sweden)

    Mauricio Arenas-Salinas

    2016-07-01

    Full Text Available The tellurium oxyanion tellurite (TeO32- is extremely harmful for most organisms. It has been suggested that a potential bacterial tellurite resistance mechanism would consist of an enzymatic, NAD(PH-dependent, reduction to the less toxic form elemental tellurium (Te0. To date, a number of enzymes such as catalase, type II NADH dehydrogenase and terminal oxidases from the electron transport chain, nitrate reductases, and dihydrolipoamide dehydrogenase (E3, among others, have been shown to display tellurite-reducing activity. This activity is generically referred to as tellurite reductase (TR. Bioinformatic data resting on some of the abovementioned enzymes enabled the identification of common structures involved in tellurite reduction including vicinal catalytic cysteine residues and the FAD/NAD(P+-binding domain, which is characteristic of some flavoproteins. Along this line, thioredoxin reductase (TrxB, alkyl hydroperoxide reductase (AhpF, glutathione reductase (GorA, mercuric reductase (MerA, NADH: flavorubredoxin reductase (NorW, dihydrolipoamide dehydrogenase, and the putative oxidoreductase YkgC from Escherichia coli or environmental bacteria were purified and assessed for TR activity. All of them displayed in vitro TR activity at the expense of NADH or NADPH oxidation. In general, optimal reducing conditions occurred around pH 9-10 and 37 °C.Enzymes exhibiting strong TR activity produced Te-containing nanostructures (TeNS. While GorA and AhpF generated TeNS of 75 nm average diameter, E3 and YkgC produced larger structures (> 100 nm. Electron-dense structures were observed in cells over-expressing genes encoding TrxB, GorA and YkgC.

  3. Coulomb excitation of {sup 123}Cd

    Energy Technology Data Exchange (ETDEWEB)

    Hartig, Anna-Lena; Kroell, Thorsten; Ilieva, Stoyanka; Boenig, Sabine; Thuerauf, Michael [IKP, TU Darmstadt (Germany); Simpson, Gary; Drouet, Floriane; Ramdhane, Mourad [LPSC, Grenoble (France); Georgiev, Georgi [CSNSM, Orsay (France); Kesteloot, Nele; Wrzosek-Lipska, Kasia [KU, Leuven (Belgium); Jungclaus, Andrea; Illana Sison, Andres [CSIC, Madrid (Spain); Balabanski, Dimiter [INRNE-BAS, Sofia (Bulgaria); Warr, Nigel [Koeln Univ. (Germany). IKP; Voulot, Didier; Wenander, Fredrik; Marsh, Bruce [CERN, Geneva (Switzerland)

    2013-07-01

    On the neutron-rich side of the valley of stability in the vicinity of the double magic nucleus {sup 132}Sn one can find the {sup 123}Cd isotope. Surprisingly the neutron-rich even-A Cd isotopes in this region are showing signs of collectivity beyond that calculated by modern shell-model predictions. In order to gain a deeper insight in this phenomenon we started to extend these studies to odd-A Cd isotopes. As first isotope the exotic nucleus {sup 123}Cd was produced for safe Coulomb excitation by the ISOLDE facility at CERN and post-accelerated by REX-ISOLDE. The γ-decay from excited states was detected with the MINIBALL array. A report on the status of the ongoing analysis is given.

  4. 19 CFR 123.31 - Merchandise in transit.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.31 Section 123.31... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through the United States § 123.31 Merchandise in transit. (a) From one contiguous country to another. Merchandise may be transported in transit...

  5. 19 CFR 123.21 - Merchandise in transit.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Merchandise in transit. 123.21 Section 123.21... TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.21 Merchandise in transit. (a) Status. Merchandise may be transported from one port to another in the United...

  6. 10 CFR 1040.123 - Consolidated or joint hearings.

    Science.gov (United States)

    2010-01-01

    ... ACTIVITIES Enforcement Opportunity for Hearing § 1040.123 Consolidated or joint hearings. In cases in which... 10 Energy 4 2010-01-01 2010-01-01 false Consolidated or joint hearings. 1040.123 Section 1040.123... departments or agencies, where applicable, provide for the conduct of consolidated or joint hearings and for...

  7. 12 CFR 225.123 - Activities closely related to banking.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Activities closely related to banking. 225.123 Section 225.123 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... Holding Companies Interpretations § 225.123 Activities closely related to banking. (a) Effective June 15...

  8. 18 CFR 284.123 - Rates and charges.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Rates and charges. 284.123 Section 284.123 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... AUTHORITIES Certain Transportation by Intrastate Pipelines § 284.123 Rates and charges. (a) General rule...

  9. 40 CFR 123.3 - Coordination with other programs.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Coordination with other programs. 123.3 Section 123.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS STATE PROGRAM REQUIREMENTS General § 123.3 Coordination with other programs. Issuance of State permits...

  10. 29 CFR 780.123 - Raising of bees.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Raising of bees. 780.123 Section 780.123 Labor Regulations... Raising of Livestock, Bees, Fur-Bearing Animals, Or Poultry § 780.123 Raising of bees. The term “raising of * * * bees” refers to all of those activities customarily performed in connection with the...

  11. Clinical experience with iodine-123-iodophenylpentadecanoic acid.

    Science.gov (United States)

    Corbett, J

    1994-04-01

    Initial research in dogs and later research in normal volunteers and patients with coronary artery disease indicated that 123I-iodophenylpentadecanoic acid (IPPA) can provide valuable diagnostic information. This agent compared favorably to 201Tl in detecting stenosed coronary arteries and identified reversible lesions with greater frequency. Testing with both 201Tl and IPPA before and after percutaneous transluminal coronary angioplasty produced similar results, supporting the notion that IPPA deserves inclusion among the diagnostic tools used to evaluate coronary heart disease.

  12. Melt processing of Yb-123 tapes

    International Nuclear Information System (INIS)

    Athur, S. P.; Balachandran, U.; Salama, K.

    2000-01-01

    The innovation of a simple, scalable process for manufacturing long-length conductors of HTS is essential to potential commercial applications such as power cables, magnets, and transformers. In this paper the authors demonstrate that melt processing of Yb-123 tapes made by the PIT route is an alternative to the coated conductor and Bi-2223 PIT tape fabrication techniques. Ag-clad Yb-123 tapes were fabricated by groove rolling and subsequently, melt processed in different oxygen partial pressures in a zone-melting furnace with a gradient of 140 C/cm. The transition temperatures measured were found to be around 81 K undermost processing conditions. EPMA of the tapes processed under different conditions show the 123 phase to be Ba deficient and Cu and Yb rich. Critical current was measured at various temperatures from 77 K to 4.2 K. The J c increased with decrease in pO 2 . The highest I c obtained was 52 A at 4.2 K

  13. Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

    Energy Technology Data Exchange (ETDEWEB)

    Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro [Kagoshima Univ. (Japan). Faculty of Medicine

    1999-12-01

    Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method ({mu}=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

  14. Production and application of 123I-labeled M-iodobenzylguanidine (123I-MIBG)

    International Nuclear Information System (INIS)

    Washburn, L.C.; Khosla, R.C.; Williams, C.C.; Gelfand, M.J.; Maxon, H.R.

    1993-01-01

    For the past two years the authors have been producing 123 I-MIBG for diagnosis and evaluation of neural crest tumors in both pediatric and adult patients. The method of Mock and Weiner (Appl. Radiat. Isot. 39:939-942, 1988) was used. Out of 89 attempted runs, 87 were successful in meeting the 90% radiochemical purity required for patient administration; both failures occurred during the first six months of the project. The 87 runs provided 144 pediatric doses and 48 adult doses. The radiochemical yield, not corrected for decay, was 67.7 ± 10.3% (mean ± S.D.). The radiochemical purity of the successful runs was 99.3 ± 1.3%, with 71 of the 87 runs giving a radiochemical purity of >99%. The radionuclidic purity of the I-123, obtained as sodium [ 123 I]iodide from Nordion International, was 99.985 ± 0.008%. Bacterial endotoxins, determined by the Limulus amebocyte lysate technique, were below the detectable level of 0.31 EU/mL for all batches of 123 I-MIBG. Sterility tests using both trypticase soy broth and fluid thioglycollate medium were negative for all batches except two, which showed growth of nonpathogenic microorganisms probably introduced during inoculation of the culture medium. 123 I-MIBG has thus been reliably prepared in high yield and excellent purity, and it has proved to be a valuable agent for diagnosis and evaluation of neural crest tumors in both children and adults

  15. Iodine-123 iodobenzofuran (I-123 IBF) SPECT in patients with parkinsonism

    International Nuclear Information System (INIS)

    Nakabeppu, Yoshiaki; Nakajo, Masayuki; Mitsuda, Mitsuru; Tsuchimochi, Shinsaku; Tani, Atsushi; Osame, Mitsuhiro

    1999-01-01

    Iodine-123 benzofuran (I-123 IBF) is a dopaminergic antagonist which is suitable for SPECT imaging of D2 receptors. The purpose of this study is to evaluate the potential usefulness of semi-quantitative parameters obtained from brain SPECT data of I-123 IBF for differential diagnosis in patients with parkinsonism (PN). Subjects were 10 patients with PN: 2 patients with striato-nigral degeneration (SND), 5 patients with Parkinson's disease (PD), 2 patients with progressive supranuclear palsy (PSP) and one patient with olivo-ponto-cerebellar atrophy (OPCA). The data were acquired with a triple-head gamma camera at 2 hours after intravenous injection of 167 MBq of I-123 IBF. Transverse images were reconstructed by means of filtered backprojection, and attenuation correction was performed by Chang's method (μ=0.08). The basal ganglia-to-frontal cortex ratio (GFR) and the basal ganglia-to-occipital cortex ratio (GOR) on slices of 5 different thicknesses were calculated. The GFR and GOR were lower in the SND group than in the other disease groups in all slices with different thicknesses (7.2 mm, 14.4 mm, 21.6 mm, 28.8 mm and 43.2 mm). The semiquantitative parameters (GFR and GOR) obtained from brain SPECT data at 2 hours after intravenous injection of I-123 IBF may be useful for differential diagnosis in patients with PN. (author)

  16. Determination of gold, indium, tellurium and thallium in the same sample digest of geological materials by atomic-absorption spectroscopy and two-step solvent extraction

    Science.gov (United States)

    Hubert, A.E.; Chao, T.T.

    1985-01-01

    A rock, soil, or stream-sediment sample is decomposed with hydrofluoric acid, aqua regia, and hydrobromic acid-bromine solution. Gold, thallium, indium and tellurium are separated and concentrated from the sample digest by a two-step MIBK extraction at two concentrations of hydrobromic add. Gold and thallium are first extracted from 0.1M hydrobromic acid medium, then indium and tellurium are extracted from 3M hydrobromic acid in the presence of ascorbic acid to eliminate iron interference. The elements are then determined by flame atomic-absorption spectrophotometry. The two-step solvent extraction can also be used in conjunction with electrothermal atomic-absorption methods to lower the detection limits for all four metals in geological materials. ?? 1985.

  17. 15-(para-[123I]iodophenyl) pentadecanoic acid obtained using mercuration and subsequent [123I] radioiodination

    International Nuclear Information System (INIS)

    Dougan, H.; Vincent, J.S.; Lyster, D.M.

    1989-01-01

    The present work explores the basic reactions necessary for the preparation of [ 123 I] 15-(paraiodophenyl)-pentadecanoic acid (IPPA) from organo mercury compounds. It was found that the essential reactions occur readily and with good yield. The steps were as follows: phenyl pentadecanoic acid or its ethyl ester may be mercurated using Hg(TFA) 2 in TFA solvent, and the para-chloromercury compounds may be recovered. [ 123 I] radioiodination may be carried out in a variety of solvents in the presence of chloramine T. When radioiodination was conducted at room temperature the isomeric purity of the ester or fatty acid was found to be 99.9% para. The results indicate that poor solubility of certain mercurated pentadecanoic acid compounds will limit the development of a kit for [ 123 I]IPPA. (author) 16 refs.; 2 tabs

  18. Use of Iodine-131 to Tellurium-132 Ratios for Assessing the Relationships between Human Inhaled Radioactivity and Environmental Monitoring after the Accident in Fukushima

    Directory of Open Access Journals (Sweden)

    Koji Uchiyama

    2018-03-01

    Full Text Available Significant differences in findings were seen between the intake amounts of iodine-131 that were derived from direct measurements and the estimated intake from environmental monitoring data at the Fukushima accident. To clarify these discrepancies, we have investigated the iodine-131 and tellurium-132 body burdens of five human subjects, who after being exposed to a radioactive plume, underwent 21.5 h whole body counter measurements at Fukui Prefectural Hospital, so clear intake scenario and thyroid counter measurement data were available. To determine the iodine-131 and tellurium-132 body burdens, we introduced a new method of whole body counter calibration composed of a self-consistent approach with the time-dependent correction efficiency factors concept. The ratios of iodine-131 to tellurium-132, ranging from 0.96 ± 0.05 to 2.29 ± 0.38, were consistent with results of the environmental measurements. The 24 h iodine uptake values ranging from 12.1–16.0% were within euthyroid range in Japanese people. These results suggest, even if the relatively low thyroid iodine uptake in the Japanese population was taken into consideration, that there is no doubt about the consistency between direct measurements and environmental monitoring data. Adequate intake scenario is suggested to be principally important to estimate the inhaled radioactivity in areas in or around nuclear accidents.

  19. Radioiodinated Rhodamine-123: a potential cationic hepatobiliary imaging agent

    International Nuclear Information System (INIS)

    Moonen, P.; Gorree, G.C.M.; Hoekstra, A.

    1987-01-01

    The labelling of the cationic dye Rhodamine-123 with 125 I is described. The biodistribution of the iodinated Rhodamine-123 has been determined at different time intervals after intravenous injection into fasted rats. It turned out that the dye is predominantly cleared by the liver and discharged into the bile. The bile acid taurocholate did not enhance the rate of excretion of 125 I-Rhodamine-123. (author)

  20. Labeling and quality control of 123I-MIBG

    International Nuclear Information System (INIS)

    Figols de Barboza, Marycel Rosa

    2002-01-01

    This report describes a method to facilitate routine production of 123 I-MIBG in Radiopharmacy Centre of IPEN-CNEN/SP. Iodine-123 radioisotope is produced in the form of sodium iodide in Cyclone-30 (IBA) at IPEN-CNEN/SP through proton irradiation of gaseous 124 Xe target. The labelling procedure uses MIBG-sulphate and leads to 123 I-MIBG with radiochemical purity at least 98% and specific activity of 300-380 MBq/mg

  1. Recent developments in the field of 123I-radiopharmaceuticals

    International Nuclear Information System (INIS)

    Machulla, H.J.; Knust, E.J.

    1984-01-01

    Due to its advantageous nuclear physical properties iodine-123 is an excellent label for radiopharmaceuticals very well suited for measurements by γ-cameras and single-photon emission tomography. The development of 123 I-radiopharmaceuticals should be based on a clear biochemical concept, reliable labelling procedures and careful pharmacokinetic studies in order to evaluate the physiological behaviour of the radioiodinated compounds being analogues of metabolic substrates. The development of 123 I-labelled fatty acids and biogenic amines clearly proved the successful use of 123 I for labelling compounds applied in medical diagnosis. (orig.) [de

  2. Raman scattering boson peak and differential scanning calorimetry studies of the glass transition in tellurium-zinc oxide glasses.

    Science.gov (United States)

    Stavrou, E; Tsiantos, C; Tsopouridou, R D; Kripotou, S; Kontos, A G; Raptis, C; Capoen, B; Bouazaoui, M; Turrell, S; Khatir, S

    2010-05-19

    Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out on four mixed tellurium-zinc oxide (TeO(2))(1 - x)(ZnO)(x) (x = 0.1, 0.2, 0.3, 0.4) glasses under variable temperature, with particular attention being given to the respective glass transition region. From the DSC measurements, the glass transition temperature T(g) has been determined for each glass, showing a monotonous decrease of T(g) with increasing ZnO content. The Raman study is focused on the low-frequency band of the glasses, the so-called boson peak (BP), whose frequency undergoes an abrupt decrease at a temperature T(d) very close to the respective T(g) values obtained by DSC. These results show that the BP is highly sensitive to dynamical effects over the glass transition and provides a means for an equally reliable (to DSC) determination of T(g) in tellurite glasses and other network glasses. The discontinuous temperature dependence of the BP frequency at the glass transition, along with the absence of such a behaviour by the high-frequency Raman bands (due to local atomic vibrations), indicates that marked changes of the medium range order (MRO) occur at T(g) and confirms the correlation between the BP and the MRO of glasses.

  3. Raman scattering boson peak and differential scanning calorimetry studies of the glass transition in tellurium-zinc oxide glasses

    International Nuclear Information System (INIS)

    Stavrou, E; Tsiantos, C; Tsopouridou, R D; Kripotou, S; Kontos, A G; Raptis, C; Capoen, B; Bouazaoui, M; Turrell, S; Khatir, S

    2010-01-01

    Raman scattering and differential scanning calorimetry (DSC) measurements have been carried out on four mixed tellurium-zinc oxide (TeO 2 ) 1-x (ZnO) x (x = 0.1, 0.2, 0.3, 0.4) glasses under variable temperature, with particular attention being given to the respective glass transition region. From the DSC measurements, the glass transition temperature T g has been determined for each glass, showing a monotonous decrease of T g with increasing ZnO content. The Raman study is focused on the low-frequency band of the glasses, the so-called boson peak (BP), whose frequency undergoes an abrupt decrease at a temperature T d very close to the respective T g values obtained by DSC. These results show that the BP is highly sensitive to dynamical effects over the glass transition and provides a means for an equally reliable (to DSC) determination of T g in tellurite glasses and other network glasses. The discontinuous temperature dependence of the BP frequency at the glass transition, along with the absence of such a behaviour by the high-frequency Raman bands (due to local atomic vibrations), indicates that marked changes of the medium range order (MRO) occur at T g and confirms the correlation between the BP and the MRO of glasses.

  4. Enhancement of Thermoelectric Properties of PEDOT:PSS and Tellurium-PEDOT:PSS Hybrid Composites by Simple Chemical Treatment

    Science.gov (United States)

    Jin Bae, Eun; Hun Kang, Young; Jang, Kwang-Suk; Yun Cho, Song

    2016-01-01

    The thermoelectric properties of poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS) and tellurium-PEDOT:PSS (Te-PEDOT:PSS) hybrid composites were enhanced via simple chemical treatment. The performance of thermoelectric materials is determined by their electrical conductivity, thermal conductivity, and Seebeck coefficient. Significant enhancement of the electrical conductivity of PEDOT:PSS and Te-PEDOT:PSS hybrid composites from 787.99 and 11.01 to 4839.92 and 334.68 S cm-1, respectively was achieved by simple chemical treatment with H2SO4. The power factor of the developed materials could be effectively tuned over a very wide range depending on the concentration of the H2SO4 solution used in the chemical treatment. The power factors of the developed thermoelectric materials were optimized to 51.85 and 284 μW m-1 K-2, respectively, which represent an increase of four orders of magnitude relative to the corresponding parameters of the untreated thermoelectric materials. Using the Te-PEDOT:PSS hybrid composites, a flexible thermoelectric generator that could be embedded in textiles was fabricated by a printing process. This thermoelectric array generates a thermoelectric voltage of 2 mV using human body heat.

  5. Acousto-optic control of internal acoustic reflection in tellurium dioxide crystal in case of strong elastic energy walkoff [Invited].

    Science.gov (United States)

    Voloshinov, Vitaly; Polikarpova, Nataliya; Ivanova, Polina; Khorkin, Vladimir

    2018-04-01

    Peculiar cases of acoustic wave propagation and reflection may be observed in strongly anisotropic acousto-optical crystals. A tellurium dioxide crystal serves as a prime example of such media, since it possesses record indexes of acoustic anisotropy. We studied one of the unusual scenarios of acoustic incidence and reflection from a free crystal-vacuum boundary in paratellurite. The directions of the acoustic waves in the (001) plane of the crystal were determined, and their basic characteristics were calculated. The carried-out acousto-optic experiment at the wavelength of light 532 nm and the acoustic frequency 73 MHz confirmed the theoretical predictions. The effects examined in the paper include the acoustic wave propagation with the record walkoff angle 74°. We also observed the incidence of the wave on the boundary at the angle exceeding 90°. Finally, we registered the close-to-back reflection of acoustic energy following the incidence. One of the stunning aspects is the distribution of energy between the incident and the back-reflected wave. The unusual features of the acoustic wave reflections pointed out in the paper are valuable for their possible applications in acousto-optic devices.

  6. Resonant ionization by laser beams: application to ions sources and to study the nuclear structure of radioactive tellurium isotopes

    International Nuclear Information System (INIS)

    Sifi, R.

    2007-07-01

    The radioactive ion beams that are produced through current isotope separators are well separated according to the A mass but not according to the Z parameter. The resonant ionization through laser beams applied to ion sources allows the production of radioactive ion beam in a very selective and efficient way by eliminating the isobaric contamination. The first chapter is dedicated to the resonant ionization by laser beams, we describe the principle, the experimental setting, the lasers used, the ionization schemes and the domain of application. The second chapter deals with the application of resonant ionization to laser ion sources for the production of radioactive ion beams. We present experimental tests performed for getting copper ion beams. Resonant ionization through laser is also used in the spectroscopy experiments performed at the Isolde (isotope separation on-line device) installation in CERN where more than 20 elements are ionized very efficiently. The technique is based on a frequency scanning around the excitation transition of the atoms in order to probe the hyperfine structure. Laser spectroscopy allows the determination of the hyperfine structure as well as the isotopic shift of atoms. In the third chapter the method is applied to the spectroscopy of tellurium atoms. First, we define the 2 parameters on which the extraction is based: charge radius and nuclear moments, then we present several theoretical models that we have used to assess our experimental results. (A.C.)

  7. Comparative Analysis of Supply Risk-Mitigation Strategies for Critical Byproduct Minerals: A Case Study of Tellurium.

    Science.gov (United States)

    Bustamante, Michele L; Gaustad, Gabrielle; Alonso, Elisa

    2018-01-02

    Materials criticality assessment is a screening framework increasingly applied to identify materials of importance that face scarcity risks. Although these assessments highlight materials for the implicit purpose of informing future action, the aggregated nature of their findings make them difficult to use for guidance in developing nuanced mitigation strategy and policy response. As a first step in the selection of mitigation strategies, the present work proposes a modeling framework and accompanying set of metrics to directly compare strategies by measuring effectiveness of risk reduction as a function of the features of projected supply demand balance over time. The work focuses on byproduct materials, whose criticality is particularly important to understand because their supplies are inherently less responsive to market balancing forces, i.e., price feedbacks. Tellurium, a byproduct of copper refining, which is critical to solar photovoltaics, is chosen as a case study, and three commonly discussed byproduct-relevant strategies are selected: dematerialization of end-use product, byproduct yield improvement, and end-of-life recycling rate improvement. Results suggest that dematerialization will be nearly twice as effective at reducing supply risk as the next best option, yield improvement. Finally, due to its infrequent use at present and its dependence upon long product lifespans, recycling end-of-life products is expected to be the least effective option despite potentially offering other benefits (e.g., cost savings and environmental impact reduction).

  8. Leaching of cadmium and tellurium from cadmium telluride (CdTe) thin-film solar panels under simulated landfill conditions.

    Science.gov (United States)

    Ramos-Ruiz, Adriana; Wilkening, Jean V; Field, James A; Sierra-Alvarez, Reyes

    2017-08-15

    A crushed non-encapsulated CdTe thin-film solar cell was subjected to two standardized batch leaching tests (i.e., Toxicity Characteristic Leaching Procedure (TCLP) and California Waste Extraction Test (WET)) and to a continuous-flow column test to assess cadmium (Cd) and tellurium (Te) dissolution under conditions simulating the acidic- and the methanogenic phases of municipal solid waste landfills. Low levels of Cd and Te were solubilized in both batch leaching tests (<8.2% and <3.6% of added Cd and Te, respectively). On the other hand, over the course of 30days, 73% of the Cd and 21% of the Te were released to the synthetic leachate of a continuous-flow column simulating the acidic landfill phase. The dissolved Cd concentration was 3.24-fold higher than the TCLP limit (1mgL -1 ), and 650-fold higher than the maximum contaminant level established by the US-EPA for this metal in drinking water (0.005mgL -1 ). In contrast, the release of Cd and Te to the effluent of the continuous-flow column simulating the methanogenic phase of a landfill was negligible. The remarkable difference in the leaching behavior of CdTe in the columns is related to different aqueous pH and redox conditions promoted by the microbial communities in the columns, and is in agreement with thermodynamic predictions. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. The use of masking agents in the determination, by hydride generation and atomic-absorption spectrophotometry, of arsenic, antimony, selenium, tellurium, and bismuth in the presence of noble metals

    International Nuclear Information System (INIS)

    Kellerman, S.P.

    1982-01-01

    The effectiveness of thiosemicarbazide, tellurium, and potassium iodide as masking agents to eliminate interferences was assessed. Thiosemicarbazide was found to be effective in eliminating or reducing the interferences on arsenic, antimony, and bismuth, and tellurium reduced the interferences on selenium. The interferences on tellurium could not be eliminated. Arsenic, antimony, selenium, and bismuth were determined in metal sulphide concentrates that were spiked with the noble metals (defined here as gold plus all the platinum-group metals except osmium). The relative standard deviations for arsenic, antimony, bismuth, and selenium were 0,061, 0,017, 0,029, and 0,145 respectively. The values obtained for all the analytes agreed favourably with the preferred values for two in-house reference samples. The laboratory method is detailed in an appendix

  10. 16 CFR 1.23 - Quantity limit rules.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Quantity limit rules. 1.23 Section 1.23 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL... Robinson-Patman Act. These rules have the force and effect of law. [32 FR 8444, June 13, 1967. Redesignated...

  11. 50 CFR 14.123 - Care in transit.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Care in transit. 14.123 Section 14.123 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF THE INTERIOR TAKING... transit. (a) A primate shall be observed for signs of distress and given food and water according to the...

  12. 21 CFR 123.5 - Current good manufacturing practice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 123.5 Section...) FOOD FOR HUMAN CONSUMPTION FISH AND FISHERY PRODUCTS General Provisions § 123.5 Current good manufacturing practice. (a) Part 110 of this chapter applies in determining whether the facilities, methods...

  13. 7 CFR 1955.123 - Sale procedures (chattel).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 14 2010-01-01 2009-01-01 true Sale procedures (chattel). 1955.123 Section 1955.123 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS... be notified of the opportunity to appeal in accordance with subpart B of part 1900 of this chapter...

  14. 40 CFR 123.46 - Individual control strategies.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Individual control strategies. 123.46... PROGRAM REQUIREMENTS Transfer of Information and Permit Review § 123.46 Individual control strategies. (a..., approval, and implementation an individual control strategy for each point source identified by the State...

  15. 40 CFR 123.23 - Attorney General's statement.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Attorney General's statement. 123.23... PROGRAM REQUIREMENTS State Program Submissions § 123.23 Attorney General's statement. (a) Any State that seeks to administer a program under this part shall submit a statement from the State Attorney General...

  16. 21 CFR 123.11 - Sanitation control procedures.

    Science.gov (United States)

    2010-04-01

    ... records are subject to the requirements of § 123.9. (d) Relationship to HACCP plan. Sanitation controls may be included in the HACCP plan, required by § 123.6(b). However, to the extent that they are monitored in accordance with paragraph (b) of this section they need not be included in the HACCP plan, and...

  17. 47 CFR 80.123 - Service to stations on land.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Service to stations on land. 80.123 Section 80... STATIONS IN THE MARITIME SERVICES Operating Requirements and Procedures Special Procedures-Public Coast Stations § 80.123 Service to stations on land. Marine VHF public coast stations, including AMTS coast...

  18. 23 CFR 771.123 - Draft environmental impact statements.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Draft environmental impact statements. 771.123 Section... ENVIRONMENT ENVIRONMENTAL IMPACT AND RELATED PROCEDURES § 771.123 Draft environmental impact statements. (a) A... significant impacts on the environment. When the applicant, after consultation with any project sponsor that...

  19. 14 CFR 415.123 - Computing systems and software.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 415.123... Launch Vehicle From a Non-Federal Launch Site § 415.123 Computing systems and software. (a) An applicant's safety review document must describe all computing systems and software that perform a safety...

  20. 27 CFR 22.123 - Losses on premises.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses on premises. 22.123... OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Losses § 22.123 Losses on premises. (a) Recording of losses. A permittee shall determine and record, in the records prescribed by subpart...

  1. 19 CFR 123.41 - Truck shipments transiting Canada.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Truck shipments transiting Canada. 123.41 Section... OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO United States and Canada In-Transit Truck Procedures § 123.41 Truck shipments transiting Canada. (a) Manifest required. Trucks with merchandise...

  2. 9 CFR 113.123 - Salmonella Dublin Bacterin.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...

  3. 7 CFR 457.123 - Almond crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Almond crop insurance provisions. 457.123 Section 457... CORPORATION, DEPARTMENT OF AGRICULTURE COMMON CROP INSURANCE REGULATIONS § 457.123 Almond crop insurance provisions. The Almond Crop Insurance Provisions for the 2008 and succeeding crop years are as follows: FCIC...

  4. 49 CFR 37.123 - ADA paratransit eligibility: Standards.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false ADA paratransit eligibility: Standards. 37.123... INDIVIDUALS WITH DISABILITIES (ADA) Paratransit as a Complement to Fixed Route Service § 37.123 ADA... complementary paratransit service shall provide the service to the ADA paratransit eligible individuals...

  5. 40 CFR 96.123 - CAIR permit contents and term.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 96.123 Section 96.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... necessary to facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal...

  6. 40 CFR 97.123 - CAIR permit contents and term.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false CAIR permit contents and term. 97.123 Section 97.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... facilitate coordination of the renewal of the CAIR permit with issuance, revision, or renewal of the CAIR NOX...

  7. 5 CFR 610.123 - Travel on official time.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel on official time. 610.123 Section... DUTY Weekly and Daily Scheduling of Work Work Schedules § 610.123 Travel on official time. Insofar as practicable travel during nonduty hours shall not be required of an employee. When it is essential that this...

  8. 17 CFR 12.3 - Business address; hours.

    Science.gov (United States)

    2010-04-01

    ... REPARATIONS General Information and Preliminary Consideration of Pleadings § 12.3 Business address; hours. The... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Business address; hours. 12.3..., DC 20581. It is open each day, except Saturdays, Sundays, and legal public holidays, from 8:15 a.m...

  9. Medical necessity for shorter lived radionuclides, specifically pure Iodine-123

    International Nuclear Information System (INIS)

    DeNardo, G.L.; DeNardo, S.J.; Hines, H.H.; Lagunas-Solar, M.C.; Jungerman, J.A.

    1985-01-01

    Iodine-123 has physical and radiochemical characteristics ideal for most tracer procedures performed in patients. Its use is generally preferable to the use of 131 I for diagnosis. The potential for 123 I can be realized only if a radiopharmaceutical of lesser radionuclide contamination is generally and economically available. Iodine-123 produced by direct methods has significant disadvantages relative to quality of procedure and radiation dosimetry. Our experience with 123 I(p,5n) during the past 12 years causes us to vigorously encourage general availability of an 123 I radiopharmaceutical of this quality. Using this product, the authors have prepared radiopharmaceuticals for use in the study of cancer, coagulation, and renal and thyroid diseases

  10. Clinical uses of I-123 produced by 127I(p, 5n)123Xe to 123I reaction in NIRS

    International Nuclear Information System (INIS)

    Saegusa, Kenji; Arimizu, Noboru; Uchiyama, Guio; Tateno, Yukio; Rikitake, Tomoyuki.

    1978-01-01

    123 I capsules produced by NIRS which are believed to be uncontaminated by radioactive impurities other than 125 I were compared with commercial 123 I capsules regarding gamma-ray spectra, thyroid phantoms and clinical scintigrams. Absorbed radiation doses of 123 I contaminated with nuclides other than 123 I to thyroid and whole body were also estimated. Regarding gamma-ray spectra, any nuclides other than 125 I(0.53%) did not contaminate in 123 I produced by NIRS, and it was superior to commercial capsules. Regarding phantoms and clinical scintigrams, background counts around the thyroid gland seemed to be slightly higher in commercial capsules than that produced by NIRS because of contamination with other nuclides. Exposed doses in thyroid and whole body were counted. Ratios in thyroid and whole body were increased by 30% and 9%, respectively in 123 I produced by NIRS because of contamination with 0.53% of 125 I in the event that the intake ratio of thyroid was determined as 25%. In commercial capsules the doses in thyroid and whole body were increased by 500% and 150%, respectively. Doses of commercial capsules and NIRS capsules were 7.87 rad and 1.72 rad, respectively per 100 μCi in thyroid. The ratio of NIRS capsules to commercial capsules in thyroid was 1/4.6, and that in the whole body was less than 1/2. (Ichikawa, K.)

  11. Challenges in assessment of clean energy supply-chains based on byproduct minerals: A case study of tellurium use in thin film photovoltaics

    International Nuclear Information System (INIS)

    Bustamante, Michele L.; Gaustad, Gabrielle

    2014-01-01

    Highlights: • Byproduct mining presents unique challenges to quantifying energy security issues. • This case study shows Te scarcity is closely tied to Cu demand and production. • Material intensity changes over time have a significant impact on projections. • Recycling as a mitigation strategy is shown to have poor short-term results. - Abstract: Transitioning to a sustainable energy supply will be critical to meeting future economic and environmental goals. This transition will require optimizing and commercializing a portfolio of new clean energy technologies. However, many promising clean energy technologies are based on materials with inherent risks in their supply; these risks include scarcity, price volatility, criticality, and other potential supply-chain disruptions. Using tellurium use in CdTe photovoltaics as a case study, this paper presents analysis of some of the key challenges associated with modeling byproduct systems (a supply-chain where a key material is actually a byproduct of extraction of another material, copper in the case of tellurium). This work presents a novel modeling approach; the results of the case study are used to identify potential supply risks facing this clean technology, with a unique focus on sensitivity to changes in the preliminary lifecycle stages. Supply-chain sensitivities are connected with direct environmental impacts to frame the implications in a broader sustainability context and to emphasize the future role of recycling. Ultimately, it was shown that if historical supply and demand trends continue, supply gap conditions will emerge before the end of the current decade. However, improvements in byproduct yield, end-use recycling rate, and end-use material intensity exhibit significant leverage to minimize risk in the energy-critical tellurium supply-chain

  12. Determination of tellurium at ultra-trace levels in drinking water by on-line solid phase extraction coupled to graphite furnace atomic absorption spectrometer

    International Nuclear Information System (INIS)

    Pedro, Juana; Stripekis, Jorge; Bonivardi, Adrian; Tudino, Mabel

    2008-01-01

    In this paper, two time-based flow injection (FI) separation pre-concentration systems coupled to graphite furnace atomic absorption spectrometry (GFAAS) for tellurium determination are studied and compared. The first alternative involves the pre-concentration of the analyte onto Dowex 1X8 employed as packaging material of a micro-column inserted in the flow system. The second set-up is based on the co-precipitation of tellurium with La(OH) 3 followed by retention onto XAD resins. Both systems are compared in terms of limit of detection, linear range, RSD%, sample throughput, micro-columns lifetime and aptitude for fully automatic operation. The features of the Dowex system are: 37% efficiency of retention and an enhancement factor of 42 for a pre-concentration time of 180 seconds (sample flow rate = 3 ml min -1 ) with acetic acid elution volumes of 80 μl. The detection limit (3 s) is 7 ng l -1 and the relative standard deviation (n = 7200 ng l -1 ) is 5.8%. The analytical performance of the XAD system is: 72% efficiency of retention and an enhancement factor of 25 for a pre-concentration time of 180 s (sample flow rate = 3 ml min -1 ) with nitric acid elution volumes of 300 μl. The detection limit is 66 ng l -1 and the relative standard deviation (n = 7200 ng l -1 ) is 8.3%. Applications to the determination of tellurium in tap water and the validation of the analytical methodology employing SRM 1643e as certified reference material are shown

  13. Test of irradiation of tellurium oxide for obtaining iodine-131 by dry distillation; Prueba de irradiacion de dioxido de telurio para obtener yodo-131 por destilacion seca

    Energy Technology Data Exchange (ETDEWEB)

    Alanis M, J. [ININ, Departamento de Materiales Radiactivos, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2003-07-15

    With the purpose of optimizing to the maximum independently the work of the reactor of those mathematical calculations of irradiation that are already optimized, now it corresponds to carry out irradiation tests in the different positions with their respective neutron fluxes that it counts the reactor for samples irradiation. Then, it is necessary to carry out the irradiation of the tellurium dioxide through cycles, with the purpose of observing the activity that it goes accumulating in each cycle and this way to obtain an activity of the Iodine-131 obtained when finishing the last cycle. (Author)

  14. Striatal uptake of I-123-β-CIT and I-123-IBZM in patients with extrapyramidal symptoms

    International Nuclear Information System (INIS)

    Bettin, S.; Kaempfer, I.; Seese, A.; Schaefer, A.; Reuter, M.; Loessner, J.; Dietrich, J.; Wagner, A.; Knapp, W.H.

    1997-01-01

    Aim: This pilot study deals with the question whether characteristic changes in local cerebral dopamine transporter function and D 2 -receptor binding capacity can be shown with SPET, in idiopathic Parkinson syndrome (IPS) and secondary Parkinson syndrome (SPS). Methods: In 16 patients (6 with IPS, 6 with SPS except Wilsons's disease, and 4 with Wilson's disease) SPET studies were performed using I-123-β-CIT and I-123-IBZM and a dual-head gamma camera. Images were obtained 20-24 h and 2 h post injection, respectively. For semiquantitative analysis count density ratios of basal ganglia (BG) and cerebellum (CER) were determined for I-123-β-CIT and ratios between BG and medial frontal cortex (MFC) for I-123-IBZM. Results: The BG/CER ratio in the I-123-β-CIT studies averaged 3.04±0.83 in IPS and 7.73±3.28 in SPS (p [de

  15. Formation of tellurium nanocrystals during anaerobic growth of bacteria that use Te oxyanions as respiratory electron acceptors

    Science.gov (United States)

    Baesman, S.M.; Bullen, T.D.; Dewald, J.; Zhang, Dongxiao; Curran, S.; Islam, F.S.; Beveridge, T.J.; Oremland, R.S.

    2007-01-01

    Certain toxic elements support the metabolism of diverse prokaryotes by serving as respiratory electron acceptors for growth. Here, we demonstrate that two anaerobes previously shown to be capable of respiring oxyanions of selenium also achieve growth by reduction of either tellurate [Te(VI)] or tellurite [Te(IV)] to elemental tellurium [Te(0)]. This reduction achieves a sizeable stable-Te-isotopic fractionation (isotopic enrichment factor [??] = -0.4 to -1.0 per ml per atomic mass unit) and results in the formation of unique crystalline Te(0) nanoarchitectures as end products. The Te(0) crystals occur internally within but mainly externally from the cells, and each microorganism forms a distinctly different structure. Those formed by Bacillus selenitireducens initially are nanorods (???10-nm diameter by 200-nm length), which cluster together, forming larger (???1,000-nm) rosettes composed of numerous individual shards (???100-nm width by 1,000-nm length). In contrast, Sulfurospirillium barnesii forms extremely small, irregularly shaped nanospheres (diameter < 50 nm) that coalesce into larger composite aggregates. Energy-dispersive X-ray spectroscopy and selected area electron diffraction indicate that both biominerals are composed entirely of Te and are crystalline, while Raman spectroscopy confirms that they are in the elemental state. These Te biominerals have specific spectral signatures (UV-visible light, Raman) that also provide clues to their internal structures. The use of microorganisms to generate Te nanomaterials may be an alternative for bench-scale syntheses. Additionally, they may also generate products with unique properties unattainable by conventional physical/chemical methods. Copyright ?? 2007, American Society for Microbiology. All Rights Reserved.

  16. Characterization of SGN-CD123A, A Potent CD123-Directed Antibody-Drug Conjugate for Acute Myeloid Leukemia.

    Science.gov (United States)

    Li, Fu; Sutherland, May Kung; Yu, Changpu; Walter, Roland B; Westendorf, Lori; Valliere-Douglass, John; Pan, Lucy; Cronkite, Ashley; Sussman, Django; Klussman, Kerry; Ulrich, Michelle; Anderson, Martha E; Stone, Ivan J; Zeng, Weiping; Jonas, Mechthild; Lewis, Timothy S; Goswami, Maitrayee; Wang, Sa A; Senter, Peter D; Law, Che-Leung; Feldman, Eric J; Benjamin, Dennis R

    2018-02-01

    Treatment choices for acute myelogenous leukemia (AML) patients resistant to conventional chemotherapies are limited and novel therapeutic agents are needed. IL3 receptor alpha (IL3Rα, or CD123) is expressed on the majority of AML blasts, and there is evidence that its expression is increased on leukemic relative to normal hematopoietic stem cells, which makes it an attractive target for antibody-based therapy. Here, we report the generation and preclinical characterization of SGN-CD123A, an antibody-drug conjugate using the pyrrolobenzodiazepine dimer (PBD) linker and a humanized CD123 antibody with engineered cysteines for site-specific conjugation. Mechanistically, SGN-CD123A induces activation of DNA damage response pathways, cell-cycle changes, and apoptosis in AML cells. In vitro , SGN-CD123A-mediated potent cytotoxicity of 11/12 CD123 + AML cell lines and 20/23 primary samples from AML patients, including those with unfavorable cytogenetic profiles or FLT3 mutations. In vivo , SGN-CD123A treatment led to AML eradication in a disseminated disease model, remission in a subcutaneous xenograft model, and significant growth delay in a multidrug resistance xenograft model. Moreover, SGN-CD123A also resulted in durable complete remission of a patient-derived xenograft AML model. When combined with a FLT3 inhibitor quizartinib, SGN-CD123A enhanced the activity of quizartinib against two FLT3-mutated xenograft models. Overall, these data demonstrate that SGN-CD123A is a potent antileukemic agent, supporting an ongoing trial to evaluate its safety and efficacy in AML patients (NCT02848248). Mol Cancer Ther; 17(2); 554-64. ©2017 AACR . ©2017 American Association for Cancer Research.

  17. N-isopropyl-p-[I123] iodoamphetamine single photon emission computed tomography (I123-IMP SPECT) and child neurology

    International Nuclear Information System (INIS)

    Tada, Hiroshi; Morooka, Keiichi; Arimoto, Kiyoshi; Matsuo, Takiko; Takagi, Kazue; Yanagawa, Etsuko

    1992-01-01

    We studied the clinical usefulness of I 123 -IMP SPECT in 50 pediatric patients with CNS disorders, which were categorized into the convulsive disorder group (n=20), the cerebrovascular disorder group (n=10), the acute encephalopathy or CNS infection group (n=10), the metabolic or degenerative disorder group (n=6), the congenital abnormality group (n=2) and the migraine group (n=2). The findings obtained were compared with those of cranial CT. I 123 -IMP SPECT revealed abnormal findings in 45 out of the 50 patients (90%), although cranial CT showed abnormal findings in only 24 patients (48%). This difference was statistically significant (p 123 -IMP SPECT showed focal abnormalities in 26 patients (93%). Moreover in many patients with focal neurological abnormalities, we found focal abnormalities of I 123 -IMP SPECT related with neurological abnormalities of the patients. From these findings, we think I 123 -IMP SPECT might be superior to CT scanning in examining a localized lesion. It was found that in many patients with focal abnormalities in CT scanning, I 123 -IMP SPECT showed larger abnormalities in CT scanning. By using I 123 -IMP SPECT we might be able to study the blood perfusional state surrounding the abnormal area shown by CT. In 3 patients with acute cerebrovascular disorders, I 123 -IMP SPECT revealed abnormal findings 3 to 11 days earlier than cranial CT. I 123 -IMP SPECT might be useful for early recognition of the pathological state. From these experiences, we concluded that I 123 -IMP SPECT was useful for studying the pathophysiology of CNS disorders in children. (author)

  18. Production of 123 I for medical diagnosis application

    International Nuclear Information System (INIS)

    Britto, J.L.Q. de.

    1982-01-01

    A method for production of carrier free 123 I with high radionuclidic purity in which the processing is done remotely was developed at Instituto de Engenharia Nuclear in Rio de Janeiro. The 123 I is produced in the decay of 123 Xe which is obtained through the reaction 122 Te ( 3 He, 2 n) 123 Xe with 30 MeV 3 He beams of IEN's variable energy cyclotron. The irradiated natural Te O 2 target is heated in a furnace at 675 0 C and the diffused out 123 Xe is adsorbed in a copper trap maintained at -196 0 C. The 123 Xe is allowed to decay during 6.3 hours and the 123 I produced washed out of the trap with a 0.1 N solution of NaOH. All the process is remotely controlled by using electric and pneumatic systems as well as manipulators and tongs. The quality control was achieved by atomic absorption and gamma-ray spectroscopy. (author)

  19. Localization of mitochondria in living cells with rhodamine 123.

    Science.gov (United States)

    Johnson, L V; Walsh, M L; Chen, L B

    1980-01-01

    The laser dye rhodamine 123 is shown to be a specific probe for the localization of mitochondria in living cells. By virtue of its selectivity for mitochondria and its fluorescent properties, the detectability of mitochondria stained with rhodamine 123 is significantly improved over that provided by conventional light microscopic techniques. With the use of rhodamine 123, it is possible to detect alterations in mitochondrial distribution following transformation by Rous sarcoma virus and changes in the shape and organization of mitochondria induced by colchicine treatment. Images PMID:6965798

  20. Dicty_cDB: SFC123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

  1. Stability studies of arsenic, selenium, antimony and tellurium species in water, urine, fish and soil extracts using HPLC/ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Lindemann, T.; Prange, A.; Neidhart, B. [GKSS Research Centre, Geesthacht (Germany). Inst. of Physical and Chemical Analysis; Dannecker, W. [Hamburg Univ. (Germany). Inst. fuer Anorganische und Angewandte Chemie

    2000-10-01

    The stability of arsenic, selenium, antimony and tellurium species in water and urine (NIST SRM 2670n) as well as in extracts of fish and soil certified reference materials (DORM-2 and NIST SRM 2710) has been investigated. Stability studies were carried out with As(III), As(V), arsenobetaine, monomethylarsonic acid (MMA), dimethylarsinic acid (DMA), phenylarsonic acid (PAA), Se(IV), Se(VI), selenomethionine, Sb(III), Sb(V) and Te(VI). Speciation analysis was performed by on-line coupling of anion exchange high-performance liquid chromatography (HPLC) with inductively coupled plasma mass spectrometry (ICP-MS). Best storage of aqueous mixtures of the examined species was achieved at 3 C whereas at -20 C species transformation especially of selenomethionine and Sb(V) took place and a new selenium species appeared within a period of 30 days. Losses and species transformations during extraction processes were investigated. Extraction of the spiked fish material with methanol/water led to partial conversion of Sb(III), Sb(V) and selenomethionine to two new antimony and one new selenium species. The other arsenic, selenium and tellurium species were almost quantitatively extracted. For soil spiked with MMA, PAA, Se(IV) and Sb(III), recoveries after extraction with water and sulfuric acid (0.01 mol/L) were below 20%. (orig.)

  2. Evaluation of myocardial distribution of iodine-123 labeled metaiodobenzylguanidine (123I-MIBG) in normal subjects

    International Nuclear Information System (INIS)

    Tsuchimochi, Shinsaku; Tamaki, Nagara; Shirakawa, Seishi; Fujita, Toru; Yonekura, Yoshiharu; Konishi, Junji; Nohara, Ryuji; Sasayama, Shigetake; Nishioka, Kenya

    1994-01-01

    The normal pattern of the myocardial sympathetic innervation was studied in 15 subjects using gamma camera scintigraphy with iodine-123 labeled metaiodobenzylguanidine ( 123 I-MIBG). Seven younger subjects (mean age 24.6±3.6) and eight older patients (mean age 60.9±8.4) with normal cardiac function were studied. Planar imaging was obtained at 15 minutes and 3 hours, and SPECT was also performed 3 hours after injection of 111 MBq (3 mCi) of MIBG. The younger subjects showed higher the heart to mediastinum count ratio (2.91±0.25 vs. 2.67±0.34; p<0.05) and higher inferior to anterior count ratio (1.19±0.15 vs. 0.97±0.13; p<0.05) on the late scan. The bull's-eye polar map also differences in counts in the mid-inferior (p<0.005), basal-inferior (p<0.005) and mid-lateral sectors (p<0.01). But there was no significant difference in MIBG washout rate from myocardium between two groups. These data suggest that there is a difference of the cardiac sympathetic innervation, with older subjects having fewer sympathetic nerve terminals, especially in inferior than younger subjects. We conclude that the age difference in sympathetic nerve function should be considered in the interpretation of MIBG scan. (author)

  3. Myocardial kinetics of 123I-labeled-16-hexadecanoic acid

    International Nuclear Information System (INIS)

    Okada, R.D.; Elmaleh, D.; Werre, G.S.; Strauss, H.W.; Massachusetts General Hospital, Boston

    1983-01-01

    To determine if the myocardial clearance of omega 123 I-16-hexadecanoic acid ( 123 I-HDA) is affected by decreased coronary blodood flow, six anesthetized dogs had partial occlusion of the left anterior descending coronary artery. One hour later, 113 Sn-microspheres were injected into the left atrium, followed immediately by the IV administration of 123 I-HDA. Following injection, regional myocardial 123 I activities were monitored continuously with miniature cadmium telluride radiation detectors placed against the endocardium in both ischemic and nonischemic zones. After 3 h continuous monitoring, 46 Sc-microspheres were injected into the left atrium and the dogs were killed. Ischemic and nonischemic areas of myocardium were sectioned and counted in a well counter. (orig./WL)

  4. 19 CFR 123.72 - Written agreement requirement.

    Science.gov (United States)

    2010-04-01

    ... THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Land Border Carrier Initiative Program § 123.72... lading of illegal drugs while the conveyance is en route to the United States; (c) To conduct, to the...

  5. Investigation of 123I production using electron accelerator

    International Nuclear Information System (INIS)

    Avetisyan, Albert; Avagyan, Robert; Dallakyan, Ruben; Avdalyan, Gohar; Dobrovolsky, Nikolay; Gavalyan, Vasak; Kerobyan, Ivetta; Harutyunyan, Gevorg

    2017-01-01

    The possibility of 123 I isotope production with the help of the high-intensity bremsstrahlung photons produced by the electron beam of the LUE50 linear electron accelerator at the A.I. Alikhanyan National Science Laboratory (Yerevan Physics Institute [YerPhI]) is considered. The production method has been established and shown to be successful. The 124 Xe(γ,n) 123 Xe → 123 I nuclear reaction has been investigated and the cross-section was calculated by nuclear codes TALYS 1.6 and EMPIRE 3.2. The optimum parameter of the thickness of the target was determined by GEANT4 code. For the normalized yield of 123 I, the value of 143 Bq/(mg·μA·h) has been achieved.

  6. Ion chemistry of 1H-1,2,3-triazole.

    Science.gov (United States)

    Ichino, Takatoshi; Andrews, Django H; Rathbone, G Jeffery; Misaizu, Fuminori; Calvi, Ryan M D; Wren, Scott W; Kato, Shuji; Bierbaum, Veronica M; Lineberger, W Carl

    2008-01-17

    A combination of experimental methods, photoelectron-imaging spectroscopy, flowing afterglow-photoelectron spectroscopy and the flowing afterglow-selected ion flow tube technique, and electronic structure calculations at the B3LYP/6-311++G(d,p) level of density functional theory (DFT) have been employed to study the mechanism of the reaction of the hydroxide ion (HO-) with 1H-1,2,3-triazole. Four different product ion species have been identified experimentally, and the DFT calculations suggest that deprotonation by HO- at all sites of the triazole takes place to yield these products. Deprotonation of 1H-1,2,3-triazole at the N1-H site gives the major product ion, the 1,2,3-triazolide ion. The 335 nm photoelectron-imaging spectrum of the ion has been measured. The electron affinity (EA) of the 1,2,3-triazolyl radical has been determined to be 3.447 +/- 0.004 eV. This EA and the gas-phase acidity of 2H-1,2,3-triazole are combined in a negative ion thermochemical cycle to determine the N-H bond dissociation energy of 2H-1,2,3-triazole to be 112.2 +/- 0.6 kcal mol-1. The 363.8 nm photoelectron spectroscopic measurements have identified the other three product ions. Deprotonation of 1H-1,2,3-triazole at the C5 position initiates fragmentation of the ring structure to yield a minor product, the ketenimine anion. Another minor product, the iminodiazomethyl anion, is generated by deprotonation of 1H-1,2,3-triazole at the C4 position, followed by N1-N2 bond fission. Formation of the other minor product, the 2H-1,2,3-triazol-4-ide ion, can be rationalized by initial deprotonation of 1H-1,2,3-triazole at the N1-H site and subsequent proton exchanges within the ion-molecule complex. The EA of the 2H-1,2,3-triazol-4-yl radical is 1.865 +/- 0.004 eV.

  7. [11 C]Rhodamine-123: Synthesis and biodistribution in rodents

    International Nuclear Information System (INIS)

    Bao Xiaofeng; Lu Shuiyu; Liow, Jeih-San; Morse, Cheryl L.; Anderson, Kacey B.; Zoghbi, Sami S.; Innis, Robert B.; Pike, Victor W.

    2012-01-01

    Introduction: Rhodamine-123 is a known substrate for the efflux transporter, P-glycoprotein (P-gp). We wished to assess whether rhodamine-123 might serve as a useful substrate for developing probes for imaging efflux transporters in vivo with positron emission tomography (PET). For this purpose, we aimed to label rhodamine-123 with carbon-11 (t 1/2 = 20.4 min) and to study its biodistribution in rodents. Methods: [ 11 C]Rhodamine-123 was prepared by treating rhodamine-110 (desmethyl-rhodamine-123) with [ 11 C]methyl iodide. The biodistribution of this radiotracer was studied with PET in wild-type mice and rats, in efflux transporter knockout mice, in wild-type rats pretreated with DCPQ (an inhibitor of P-gp) or with cimetidine (an inhibitor of organic cation transporters; OCT), and in P-gp knockout mice pretreated with cimetidine. Unchanged radiotracer in forebrain, plasma and peripheral tissues was also measured ex vivo at 30 min after radiotracer administration to wild-type and efflux transporter knockout rodents. Results: [ 11 C]Rhodamine-123 was obtained in 4.4% decay-corrected radiochemical yield from cyclotron-produced [ 11 C]carbon dioxide. After intravenous administration of [ 11 C]rhodamine-123 to wild-type rodents, PET and ex vivo measurements showed radioactivity uptake was very low in brain, but relatively high in some other organs such as heart, and especially liver and kidney. Inhibition of P-gp increased uptake in brain, heart, kidney and liver, but only by up to twofold. Secretion of radioactivity from kidney was markedly reduced by OCT knockout or pretreatment with cimetidine. Conclusions: [ 11 C]Rhodamine-123 was unpromising as a PET probe for P-gp function and appears to be a strong substrate of OCT in kidney. Cimetidine appears effective for blocking OCT in kidney in vivo.

  8. Apparatus of hot cell for iodine-123 production

    International Nuclear Information System (INIS)

    Almeida, G.L. de; Rautenberg, F.A.; Souza, A.S.F. de.

    1986-01-01

    The hot cell installation at IEN cyclotron (Brazilian-CNEN) for sup(123)I production is presented. Several devices, such as, tube furnace coupling system, tube furnace driving system, sup(123)I target transfer system, product extraction system, furnace control system, and effluent systems, were constructed and modified for implanting process engineering. The requirements of safety engineering for operation process were based on ALARA concept. (M.C.K.)

  9. A modified method for preparation of 123I-HDA

    International Nuclear Information System (INIS)

    Chen Fang; Decristoforo, C.; Staeger, A.; Fridrich, L.

    1994-01-01

    A modified method for preparation of 123 I-Heptadecanoic acid ( 123 I-HDA) is described. The labelling yield is 92.8%(n = 32, 85%-97%)by heating time of 15 minutes. The overall recovery is about 70%. The time for the whole preparation is about 90 min. The method described is reliable, and convenient. A carrier free and precursor free product of high purity can be prepared in a reasonable short time

  10. Myocardial scintigraphy with I-123 labeled fatty acids

    International Nuclear Information System (INIS)

    Dudczak, R.

    1983-01-01

    This study presents experimental and clinical data in the use of I-123 labeled aromatic and aliphatic fatty acids. I-123 p-phenylpentadecanoic acid (p-IPPA) and I-123 heptadecanoic acid (HDA) were applied for myocardial scintigraphy. The feasibility of p-IPPA and HDA for myocardial scintigraphy was substantiated in animal experiments. Clinical studies were performed in patients with coronary artery disease (CAD) and cardiomyopathy (CMP). In CAD the results of fatty acid studies were compared with those of Tl-201. I-123 labeled fatty acids proved to be a useful tool for myocardial scintigraphy. The possibility to evaluate non invasively the myocardial metabolic function in man may add a complementary diagnostic tool in the clinical follow up of patients with heart disease. In CAD studies with I-123 p-IPPA and I-123 HDA might provide a means to assess the degree of myocardial viability and to identify a subgroup of patients who are at increased risk for irreversible myocardial damage. In patients with CMP it is probable that these studies may be used as a means of separating groups of patients with this disease. (Author)

  11. Ginkgo biloba extract alters the binding of the sodium [123I] iodide (Na123I) on blood constituents

    International Nuclear Information System (INIS)

    Aleixo, Luiz Cláudio Martins; Moreno, Silvana Ramos Farias; Freitas, Rosimeire de Souza; Thomaz, Hélio; Santos-Filho, Sebastião David

    2012-01-01

    We evaluated the in vitro effect of an aqueous extract of Ginkgo biloba (EGb) on the distribution in blood cells (BC) and plasma (P) and on the binding of Na 123 I to the blood constituents using precipitation with trichloroacetic acid. The radioactivity percentages insoluble (SF) and insoluble fraction (IF) of blood constituents were determined. The EGb interfered (p 123 I in the P (from 69.64 to 86.13) and BC (from 30.36 to 13.87) and altered the fixation of the Na 123 I in IF-P and in IF-BC. - Highlights: ► Interaction between the Ginkgo biloba and blood constituents radiolabeled. ► Modification of the binding of sodium iodide (Na 123 I) to the blood constituents. ► This alteration should have influence in a diagnosis of nuclear medicine.

  12. Clinical utility of N-isopropyl-p-[123I] iodoamphetamine (123I-IMP) for SPECT in epileptic children

    International Nuclear Information System (INIS)

    Taki, Kuniyasu; Seto, Hikaru; Futatsuya, Ryusuke; Kakishita, Masao; Seki, Hiroyasu.

    1989-01-01

    A regional cerebral perfusion study was performed in epileptic children using single photon emission computed tomography (SPECT) and N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP). A total of 22 patients with epilepsy underwent both a 123 I-IMP brain perfusion study and X-ray CT. Eighteen had positive and four had negative perfusion study results. Of the eighteen patients with positive perfusion study results, two were positive on X-ray CT. In these two patients, the areas of perfusion defects were larger than those of low density on X-ray CT. In only four patients did the areas of perfusion defects correspond to the sites of abnormal EEG. In conclusion, 123 I-IMP perfusion study is of great clinical value in pediatric epileptic cases. (author)

  13. Ten Good Reasons for the Use of the Tellurium-Centered Anderson-Evans Polyoxotungstate in Protein Crystallography.

    Science.gov (United States)

    Bijelic, Aleksandar; Rompel, Annette

    2017-06-20

    Protein crystallography represents at present the most productive and most widely used method to obtain structural information on target proteins and protein-ligand complexes within the atomic resolution range. The knowledge obtained in this way is essential for understanding the biology, chemistry, and biochemistry of proteins and their functions but also for the development of compounds of high pharmacological and medicinal interest. Here, we address the very central problem in protein crystallography: the unpredictability of the crystallization process. Obtaining protein crystals that diffract to high resolutions represents the essential step to perform any structural study by X-ray crystallography; however, this method still depends basically on trial and error making it a very time- and resource-consuming process. The use of additives is an established process to enable or improve the crystallization of proteins in order to obtain high quality crystals. Therefore, a more universal additive addressing a wider range of proteins is desirable as it would represent a huge advance in protein crystallography and at the same time drastically impact multiple research fields. This in turn could add an overall benefit for the entire society as it profits from the faster development of novel or improved drugs and from a deeper understanding of biological, biochemical, and pharmacological phenomena. With this aim in view, we have tested several compounds belonging to the emerging class of polyoxometalates (POMs) for their suitability as crystallization additives and revealed that the tellurium-centered Anderson-Evans polyoxotungstate [TeW 6 O 24 ] 6- (TEW) was the most suitable POM-archetype. After its first successful application as a crystallization additive, we repeatedly reported on TEW's positive effects on the crystallization behavior of proteins with a particular focus on the protein-TEW interactions. As electrostatic interactions are the main force for TEW binding

  14. [A Phase 1 study of beta-methyl-p-(123I)-iodophenyl-pentadecanoic acid (123I-BMIPP)].

    Science.gov (United States)

    Torizuka, K; Yonekura, Y; Nishimura, T; Tamaki, N; Uehara, T; Ikekubo, K; Hino, M

    1991-07-01

    Phase 1 study of beta-methyl-p-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), a new radiopharmaceutical developed for the evaluation of myocardial fatty acid metabolism, was performed in six normal volunteers to evaluate its biodistribution and safety. After intravenous injection of 111 MBq of 123I-BMIPP, the agent accumulated to the myocardium rapidly (5.4 +/- 0.6% at 1.5 hr after injection) and was washed-out slowly (5.1 +/- 0.4% at 3.0hr). 123I-BMIPP demonstrated no significant accumulation to any specific organs other than myocardium, liver and muscle. Myocardium was clearly visualized in the planar and SPECT images obtained 30 min and 3 hrs after injection. The absorption doses from 123I-BMIPP estimated by MIRD method were lower than those from 201Tl in all organs. Neither adverse reactions nor abnormal clinical laboratory findings were found in the safety evaluation. These results suggest 123I-BMIPP is a promising agent for evaluating myocardial fatty acid metabolism.

  15. Iodine-123-labelled serum amyloid P component scintigraphy in amyloidosis

    International Nuclear Information System (INIS)

    Saile, R.; Deveaux, M.; Marchandise, X.; Duquesnoy, B.

    1993-01-01

    This study describes the results of scintigraphy with iodine-123-labelled serum amyloid P component (SAP) as a means of establishing the distribution of organ involvement in amyloidosis. The significance of 123 I-SAP scans obtained in 15 patients with biopsy-proven AA or AL amyloidosis is discussed. Biopsy-proven amyloidosis was typically confirmed by scintigraphy, though such confirmation was not obtained in the kidneys in six patients with histological proof of extensive renal amyloid deposition. This lack of uptake may have been due to the accumulation of a major part of the 123 I-SAP in the spleen and/or liver. Twenty-four hour whole-body retention of 123 I-SAP was higher in patients with amyloidosis than in controls. Twenty-four hour tracer accumulation of the radioactivity in the extravascular compartment was notably greater in patients than in controls and appeared to be a good diagnostic criterion. We conclude that 123 I-SAP scintigraphy may be helpful for the evaluation of organ involvement not only in patients with biopsy-proven amyloidosis but also when a biopsy cannot be performed or when a strong suspicion of amyloidosis exists in spite of repeated negative biopsises. (orig.)

  16. [sup 123]I-iodobenzoylglucosamines: glucose analogues for heart imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lutz, T [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences; Dougan, H [TRIUMF, Vancouver, BC (Canada); Rihela, T; Vo, C V [Vancouver General Hospital (Canada). Div. of Nuclear Medicine; Lyster, D M [British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences Vancouver General Hospital (Canada). Div. of Nuclear Medicine

    1993-01-01

    The ortho-, meta- and para-[[sup 123]I]-2-deoxy-2-N-(iodobenzoyl)-D-glucosamine (BGA) derivatives were investigated to determine the effect of iodine position and lipophilicity on tissue distribution. There was no correlation between tissue uptake and lipophilicity. Maximum uptake was observed for o-BGA displaying a heart:blood ratio of 36.0 at 18 hours post injection. Yeast hexokinase phosphorylation studies in vitro and an in vivo insulin experiment were carried out on o-BGA. No phosphorylation was detected, but the insulin study indicated that o-BGA uses the glucose transporter. o-BGA showed maximum tissue uptake in mice at an optimal specific activity of 0.004mg/[mu]Ci. Mouse biodistribution studies of o-[[sup 123]I]-iodobenzamide(o-[sup 123]IBA) indicated that the glucose moiety of o-BGA may be involved in the heart accumulation process in mice. Heart tissue extraction studies showed unmetabolized o-[[sup 123]I]BGA was the predominant species. A rabbit image of o-[[sup 123]I]BGA, recorded at 14 hours post injection, showed significant heart uptake. (author).

  17. Foliar contamination of plants with aerosols of 137Cs, 85Sr, 133Ba and 123mTe: influence of rain

    International Nuclear Information System (INIS)

    Madoz-Escande, C.; Bonhomme, T.; Poncet-Bonnard, D.

    2004-01-01

    Different types of plants (lettuce, radish and grass sward) were contaminated by dry deposition of radioactive aerosols ( 137 Cs, 85 Sr, 133 Ba and 123m Te). Due to the rain efficiency in decreasing radiological contamination of crops, a range of rain scenarios was applied on these three types of plants. These experiments aimed at improving the prediction of the consequences on agricultural products of a nuclear accident occurring on a PWR, and also at improving the understanding of the different processes occurring between the contamination and the first harvest. For a plant species at a given stage of its growth cycle, interception of the four radionuclides was identical and varied from 68% for radish to 84% for grass. The interception of aerosols by lettuce was intermediary with 75% (at the middle of ripeness stage) or 78%(at the mature plant stage). By the use of a conceptual model, the predominance between the two processes: washing-off the leaves and absorption through the leaves cuticles that allows the translocation, was evidenced. For Cs, Sr and Ba,, for the lettuce and the radish the washing-off process on the foliar cover of lettuce and radish was the most significant during the first rain. The absorption process inside the plant became dominant only from the third rain event. Tellurium had a particular behaviour: it was non-mobile and stayed put on the leaves. The values of the washing-off and absorption coefficients were estimated. For the grass, during the washing-off, radionuclides had a tendency to accumulate in the basal parts of plant first and the root matt later. Moreover, grass cuts came in between the rains. The global transfer factor values were dependant on both the radionuclides and the plant species, nevertheless the higher value was obtained for the cesium, whatever the plant and the rain (from 0,06 m 2 .kg fresh -1 for radish to 0,1 m 2 .kg fresh -1 for whole lettuce). (author)

  18. Abnormal I-123 HIPDM images in various disease entities

    International Nuclear Information System (INIS)

    Shih, W.J.; Magoun, S.; Coupal, J.J.; Clark, D.B.; Dekosky, S.T.; Kung, H.F.; Beihn, R.; Ryo, U.Y.

    1987-01-01

    Eighty patients who were referred from neurology service for evaluation of stroke, Alzheimer disease (AD), and/or other neurologic diseases underwent the study. Four views of planar images were obtained following the intravenous injection of 3-5 mCi of I-123 HIPDM. SPECT images were then obtained using a camera interfaced to a PDP-11 computer. Forty of the 80 patients had scintigraphic findings of stroke, which correlated well with head CT/cerebral angiogram. Sixteen patients with AD had good correlation between the degree of temporoparietal abnormality in the images. Severe AD and severe stroke patients almost always had a positive planar image. Normal I-123 HIPDM localization in the brain requires intact cerebral flow and cerebral neuronal function. A focal area of decreased I-123 HIPDM localization may represent either interruption of blood flow or neurochemical dysfunction

  19. I-123 IMP brain scintigraphies in asphyxiated newborns

    International Nuclear Information System (INIS)

    Maeda, Hisatoshi; Konishi, Yukuo; Kuriyama, Masanori; Ishii, Yasushi; Sudo, Masakatsu

    1987-01-01

    Brain scintigraphies with N-Isopropyl (I-123) p-Iodoamphetamine (I-123 IMP) were conducted in eight patients who had asphyxia at the time of birth. Two patients, 15 and 26 year-old, had local defects and diffuse low cerebral uptakes. Two children, 70 day and 2 year-old, had no cerebral uptake. Brain scintigraphies were carried out twice in three among four newborns. Only slight I-123 IMP brain uptakes were observed in the first 10 days. The lateral views of the brain scintigraphies showed increased uptake in the middle region of the brain between 10 to 30 days and reached almost equally distributed in frontal, middle and posterior regions after 30 days. These results were thought to represent rather developmental changes of the cerebral blood flow after ischemic attacks at birth. (author)

  20. [(123)I]FP-CIT ENC-DAT normal database

    DEFF Research Database (Denmark)

    Tossici-Bolt, Livia; Dickson, John C; Sera, Terez

    2017-01-01

    BACKGROUND: [(123)I]FP-CIT is a well-established radiotracer for the diagnosis of dopaminergic degenerative disorders. The European Normal Control Database of DaTSCAN (ENC-DAT) of healthy controls has provided age and gender-specific reference values for the [(123)I]FP-CIT specific binding ratio...... quantifications methods, BRASS and Southampton, and explores the performance of the striatal phantom calibration in their harmonisation. RESULTS: BRASS and Southampton databases comprising 123 ENC-DAT subjects, from gamma cameras with parallel collimators, were reconstructed using filtered back projection (FBP......) and iterative reconstruction OSEM without corrections (IRNC) and compared against the recommended OSEM with corrections for attenuation and scatter and septal penetration (ACSC), before and after applying phantom calibration. Differences between databases were quantified using the percentage difference...

  1. Myocardial imaging with 9-[Te-123m]tellurapheptadecanoic acid

    International Nuclear Information System (INIS)

    Elmaleh, D.R.; Knapp, F.F.; Yasuda, T.; Coffey, J.L.; Kopiwoda, S.; Okada, R.; Strauss, W.H.

    1981-01-01

    The distribution of radioactivity in the myocardium of rats and dogs infarcted by ligation of the left anterior coronary artery has been determined after intravenous injection of 9-[Te-123m]telluraheptadecanoic acid (Te-123m HDA). In rats the normal myocardium concentrated radioactivity (3.7% +/- 0.28 injected dose/g) to nearly three times that in the zones of infarction (1.12% +/- 0.18 dose/g). The focal defects detected in the gamma-camera images of rats and dogs correspond well with areas of infarction identified in the excised hearts by staining with triphenyltetrazolium chloride. The distribution of radioactivity from Te-123m HDA in dog hearts sectioned at autopsy showed a linear correlation (r = 0.94) with blood flow as determined with scandium-46-labeled microspheres

  2. Direct determination of tellurium and its redox speciation at the low nanogram level in natural waters by catalytic cathodic stripping voltammetry.

    Science.gov (United States)

    Biver, Marc; Quentel, François; Filella, Montserrat

    2015-11-01

    Tellurium is one of the elements recently identified as technologically critical and is becoming a new emergent contaminant. No reliable method exists for its determination in environmental samples such as natural waters. This gap is filled by the method described here; it allows the rapid detection of trace concentrations of Te(IV) and Te(VI) in surface waters by differential pulse cathodic stripping voltammetry. It is based on the proton reduction catalysed by the absorption of Te(IV) on the mercury electrode. Under our conditions (0.1 mol L(-1) HCl) a detection limit of about 5 ng L(-1) for a deposition time of 300 s is achieved. Organic matter does not represent a problem at low concentrations; higher concentrations are eliminated by adsorptive purification. Tellurium occurs primarily as Te(IV) and Te(VI) in natural waters. Thus, determining total Te requires the reduction of Te(VI) that it is not electroactive. A number of reduction procedures have been carefully evaluated and a method based on the addition of TiCl3 to the acidified samples has been proven to reduce Te(VI) at the trace level to Te(IV) reliably and quantitatively. Therefore, the procedure described allows the direct determination of total Te and its redox speciation. It is flexible, reliable and cost effective compared to any possible alternative method based on the common preconcentration-ICPMS approach. It is readily implementable as a routine method and can be deployed in the field with relative ease. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Optical properties of tellurium-doped InxGa1-xAsySb1-y epitaxial layers studied by photoluminescence spectroscopy

    International Nuclear Information System (INIS)

    Diaz-Reyes, J; Cardona-Bedoya, J A; Gomez-Herrera, M L; Herrera-Perez, J L; Riech, I; Mendoza-Alvarez, J G

    2003-01-01

    Controlled doping of quaternary alloys of In x Ga 1-x As y Sb 1-y with tellurium is fundamental to obtain the n-type layers needed for the development of optoelectronic devices based on p-n heterojunctions. InGaAsSb epitaxial layers were grown by liquid phase epitaxy and Te doping was obtained by incorporating small Sb 3 Te 2 pellets in the growth melt. The tellurium doping levels were in the range 10 16 -10 17 cm -3 . We have used low-temperature photoluminescence (PL) spectroscopy to study the influence of the Te donor levels on the radiative transitions shown in the PL spectra. The PL measurements were done by exciting the samples with the 448 nm line of an Ar ion laser with varying excitation powers in the range from 10 to 200 mW. For the low-doped sample the PL spectrum showed a narrow exciton-related peak centred at around 610 meV with a full width at half maximum (FWHM) of about 7 meV which is evidence of the good crystalline quality of the layers. For higher Te doping, the PL spectra show the presence of band-to-band and donor-to-acceptor transitions which overlap as the Te concentration increases. The peak of the PL band shifts to higher energies as Te doping increases due to a band-filling effect as the Fermi level enters into the conduction band. From the peak energy of the PL spectra, and using a model that includes the band-filling and band-shrinkage effects due to the carriers, we have estimated the effective carrier concentration due to doping with Te in the epilayers

  4. I-123-insulin: A new marker for hepatoma

    International Nuclear Information System (INIS)

    Sodoyez, J.C.; Goffaux, F.S.; Fallais, C.; Bourgeois, P.

    1984-01-01

    Previous studies have demonstrated that carrier-free I-123-Tyr Al4 insulin was taken up by the liver (by a saturable mechanism) and by the kidneys (by a non saturable mechanism). Autoradiographs of rat liver after injection of I-125-insulin showed that binding specifically occurred at the plasma membrane of the hepatocytes. I-123-Insulin binding to the hepatocyte plasma membrane appeared mediated by specific receptors. Indeed it was blocked by antibodies to the insulin receptors and by an excess of native insulin. Futhermore insulin derivatives with low biological potency (proinsulin and desoctapeptide insulin) did not inhibit I-123-insulin binding to the hepatocytes. I-123-Insulin (1.3 mCi) was I.V. injected into a patient in whom the right liver lobe was normal (normal uptake of Tc-99m-colloid sulfur) but the left liver lobe was occupied by a voluminous hepatoma (no uptake of Tc-99m-colloid sulfur). Liver blood supply was also studied by Tc-99m-pyrophosphate-labeled red cells. Computer analysis of the data revealed that compared to the normal liver lobe, binding of I-123-insulin to the hepatoma was more precocious (vascularization through the hepatic artery and not the portal vein), more intense and more prolonged (half-lives were 6 min in the normal liver and 14 min in the hepatoma). These results are consistent with characteristics of hepatoma cells in culture in which high insulin binding capacity contrasts with a markedly decreased insulin degrading activity. It is concluded that I-123-insulin may be used as a specific marker of hepatoma in man

  5. THE SYMMETRY BREAKING PHENOMENON IN 1,2,3-TRIOXOLENE AND C2Y3Z2 (Z= O, S, Se, Te, Z= H, F COMPOUNDS: A PSEUDO JAHN-TELLER ORIGIN STUDY

    Directory of Open Access Journals (Sweden)

    Ali Reza Ilkhani

    Full Text Available 1,2,3-Trioxolene (C2O3H2 is an intermediate in the acetylene ozonolysis reaction which is called primary ozonide intermediate. The symmetry breaking phenomenon were studied in C2O3H2 and six its derivatives then oxygen atoms of the molecule are substituted by sulphur, selenium, tellurium (C2Y3H2 and hydrogen ligands are replaced with fluorine atoms (C2Y3F2. Based on calculation results, all seven C2Y3Z2 considered in the series were puckered from unstable planar configuration with C2v symmetry to a Cs symmetry stable geometry. The vibronic coupling interaction between the 1A1 ground state and the first excited state 1B1 via the (1A1+1B1 ⊗b1 pseudo Jahn-Teller effect problem is the reason of the breaking symmetry phenomenon and un-planarity of the C2Y3 ring in the C2Y3Z2 series.

  6. The detection of ovarian cancer using 123I monoclonal antibody

    International Nuclear Information System (INIS)

    Granowska, M.; Britton, K.E.; Shepherd, J.

    1984-01-01

    The technique of the production of monoclonal antibodies is described. Antibodies show reactivity with epithelial surfaces of cancer of breast, colon and ovary. The iodogen reaction is used for labelling monoclonal antibodies with 123 I. Description of labelling technique and quality control. After intravenous injection of 74 MBq 123 I-labelled monoclonal antibody (0.5 mg) static camera images of the abdomen were recorded at 10 min, 4 and 22 hours in anterior and posterior position. 20 out of 22 patients with ovarian cancer with and without metastases were correctly diagnosed and confirmed at surgery. (author)

  7. Sup(123)I excretion in breast milk - additional data

    Energy Technology Data Exchange (ETDEWEB)

    Lawes, S.C. (Queen' s Medical Centre, Nottingham (United Kingdom))

    1992-07-01

    A woman with a suspected sublingual thyroid was referred for thyroid imaging with {sup 123}I-sodium iodide. On attending it was ascertained that she was currently breastfeeding her 3-month-old baby. Reference to the available literature showed little information regarding the excretion of {sup 123}I-sodium iodide in human breast milk apart from one single case. It was felt therefore that this would be an ideal opportunity to collect some useful data. Originally the presence of impurities in the radiopharmaceutical administered had been discounted as being of little significance. However, after consideration, a review of the contribution of any impurity was undertaken. (author).

  8. Radioisotope exploration of transplanted kidneys using 123I-hippuran

    International Nuclear Information System (INIS)

    Champailler, A.; Juge, J.; Herrmann, T.; Berthoux, F.; Healy, J.C.

    1983-01-01

    Hippuran labelled with iodine 123 is now used for short- and long-terme monitoring of renal transplants. Sixty-one explorations were performed in 24 patients, using this new radiopharmaceutical agent. Repeated explorations, facilitated by the lower doses of radiations as compared with 131 I-hippuran, are particularly useful to diagnose thrombosis of the renal artery, early acute tubular lesions, acute and chronic rejection and impaired evacuation of the kidney. 123 I-hippuran is the first-choice method of exploration of transplanted kidneys and can be followed, if required, by explorations more aggressive for the patient and the kidney [fr

  9. 22 CFR 123.16 - Exemptions of general applicability.

    Science.gov (United States)

    2010-04-01

    ... United States, by accredited U.S. institutions of higher learning of articles fabricated only for... FOR THE EXPORT OF DEFENSE ARTICLES § 123.16 Exemptions of general applicability. (a) The following exemptions apply to exports of unclassified defense articles for which no approval is needed from the...

  10. 7 CFR 1703.123 - Nonapproved purposes for grants.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Grant Program § 1703.123..., wages, or employee benefits to medical or educational personnel; (4) To pay for the salaries or... the applicant. (6) To duplicate facilities providing distance learning or telemedicine services in...

  11. 29 CFR 500.123 - Property damage insurance required.

    Science.gov (United States)

    2010-07-01

    ... MIGRANT AND SEASONAL AGRICULTURAL WORKER PROTECTION Motor Vehicle Safety and Insurance for Transportation of Migrant and Seasonal Agricultural Workers, Housing Safety and Health for Migrant Workers Insurance § 500.123 Property damage insurance required. (a) When a person who is an employer of a migrant or...

  12. Application of I-123 HIPDM as a lung imaging agent

    Energy Technology Data Exchange (ETDEWEB)

    Shih, W J; Coupal, J J; Dillon, M L; Kung, H F

    1988-04-01

    N,N,N'-Trimethyl-N'-(2-Hydroxyl-3-Methyl-5-/sup 123/I Iodobenzyl)-1,3-Propanediamine.Hcl (/sup 123/I-HIPDM) has been used for diagnosis of patients with strokes and demantias. Since this radiopharmaceutical is also accumulated in the lung, we routinely performed a lung image or images immediately prior to cerebral planar and SPECT images after a 3-5 mCi /sup 123/I-HIPDM injection. During the past 14 months, we obtained 78 (age from 41 to 92 years, average 66.7+-8.9 years; 64 males, 14 females) suspected stroke or dementia patients' lung images. All lung images were correlated to chest X-ray (CXR) or CT and other clinical data. Sixty five of 78 patients had normal lungs showing homogeneous distribution of activity throughout the lungs which correlated well to normal CXR and/or CT studies. Abnormal scintigraphic patterns of the 13 patients included lung defect (5 bronchogenic carcinoma with or without atelectasis) and decreased uptake in apices (8 chronic obstructive pulmonary disease). The findings of pulmonary intrathoracic pathologies on lung images with /sup 123/I-HIPDM suggests further evaluation of the agent for detection of localized pulmonary diseases and pulmonary physiological studies relating to amine metabolism.

  13. Efficient Synthesis of 1-Sulfonyl-1,2,3-triazoles

    Science.gov (United States)

    Raushel, Jessica; Fokin, Valery V.

    2010-01-01

    An efficient room temperature method for the synthesis of 1-sulfonyl-1,2,3-triazoles from in situ generated copper(I) acetylides and sulfonyl azides is described. Copper(I) thiophene-2-carboxylate (CuTC) catalyst produces the title compounds under both non-basic anhydrous and aqueous conditions in good yields. PMID:20931987

  14. Ocular melanoma: Detection using iodine-123-iodoamphetamine and SPECT imaging

    International Nuclear Information System (INIS)

    Dewey, S.H.; Leonard, J.C.

    1990-01-01

    Uptake of iodine-123-iodoamphetamine has been demonstrated in malignant melanoma using planar imaging techniques and has been used to detect an ocular melanoma at 12 hr postinjection. Using SPECT technique, an ocular melanoma is identified in a 64-yr-old male at 1 hr postinjection

  15. Construction of Association Scheme Using Some (123)-avoiding ...

    African Journals Online (AJOL)

    This paper presents some backgrounds research on association scheme using a class of (123)-avoiding pattern of Aunu numbers as an application area. It also attempts to highlight some further applications ... concept of association scheme. This research also shows us that the Aunu patterns can be used in design theory.

  16. 34 CFR 303.123 - Prohibition against commingling.

    Science.gov (United States)

    2010-07-01

    ... assurance in this section is satisfied by the use of an accounting system that includes an “audit trail” of... TODDLERS WITH DISABILITIES State Application for a Grant Statement of Assurances § 303.123 Prohibition against commingling. The statement must include an assurance satisfactory to the Secretary that funds made...

  17. Critical currents and weak links in melt textured R123

    International Nuclear Information System (INIS)

    Veal, B. W.; Zhang, H.; Claus, H.; Chen, L.; Paulikas, A. P.; Koshelev, A.; Crabtree, G. W.

    2000-01-01

    Weak link behavior is studied, using magnetization and Hall probe measurements of ring samples, in welded melt-textured R123 monoliths and in dual-seeded samples with disoriented domains. Techniques for welding samples yield transport currents across the junction that are in excess of 10 4 A/cm 2

  18. 13 CFR 123.12 - Are books and records required?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Are books and records required... PROGRAM Overview § 123.12 Are books and records required? You must retain complete records of all... disaster business or economic injury loan, you must also maintain current and accurate books of account...

  19. 49 CFR 192.123 - Design limitations for plastic pipe.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Design limitations for plastic pipe. 192.123... Design limitations for plastic pipe. (a) Except as provided in paragraph (e) and paragraph (f) of this section, the design pressure may not exceed a gauge pressure of 100 psig (689 kPa) for plastic pipe used...

  20. 7 CFR 4287.123 - Subordination of lien position.

    Science.gov (United States)

    2010-01-01

    ....123 Agriculture Regulations of the Department of Agriculture (Continued) RURAL BUSINESS-COOPERATIVE SERVICE AND RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE SERVICING Servicing Business and Industry... must be requested in writing by the lender and concurred in by the Agency in writing in advance of the...

  1. 30 CFR 229.123 - Standards for audit activities.

    Science.gov (United States)

    2010-07-01

    ... 229.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... required, including a knowledge of accounting, auditing, agency regulations, and industry operations. (ii... statement of standards. (iii) The auditor's report should contain a statement of positive assurance on those...

  2. 14 CFR 417.123 - Computing systems and software.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Computing systems and software. 417.123... systems and software. (a) A launch operator must document a system safety process that identifies the... systems and software. (b) A launch operator must identify all safety-critical functions associated with...

  3. 7 CFR 906.123 - Fruit for processing.

    Science.gov (United States)

    2010-01-01

    ... LOWER RIO GRANDE VALLEY IN TEXAS Rules and Regulations § 906.123 Fruit for processing. (a) No person... limited to, the following information: (1) Name and address of applicant; (2) Location of plant or plants... issued thereunder (7 CFR part 46) when buying Texas oranges and grapefruit for processing; (6) A...

  4. Myocardial turnover rates of I-123 heptadecanoic acid (HDA)

    International Nuclear Information System (INIS)

    Dudczak, R.; Schmoliner, R.; Kletter, K.; Derfler, D.K.; Frischauf, H.; Angelberger, P.; Losert, U.

    1982-01-01

    Myocardial scintigraphy was performed with I-123 labeled HDA in patients with coronary artery disease (CAD, n=37), cardiomyopathy (COCM, n=7) and controls (n=10). These results were compared with coronary angiography, Tl 201 scintigraphy and radionuclide angiography. Results from animal experiments (intracoronary application in calfes) and patient studies supported the assumption that myocardial scintigraphy with I-123 HDA reveals information about myocardial fatty acid utilisation. Summarizing all clinical results using I-123 HDA showed that from the myocardial accumulation pattern of the labeled fatty acid, as well as from Tl 201 perfusion scintigraphy, the value of the regional elimination rate (t/2) could not be predicted. In patients with COCM the mean t/2 was prolonged, but overlapped with controls. In ischemic regions ''shortened'', normal and prolonged elimination rates were found. These findings were related to the observed wall motion and the calculated regional ejection fraction (r=0.73, p<0.001). This data indicate, that I-123 HDA add a further aspect in nuclear cardiology; the results obtained bear a relation to the functional state of the diseased heart

  5. 19 CFR 123.22 - In-transit manifest.

    Science.gov (United States)

    2010-04-01

    ... CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.22 In-transit... cars or other overland carriers transiting Mexico a manifest on Customs Form 7512-B or 7533-C shall be... enter and reenter Canada in a continuing movement en route to a final destination in the United States...

  6. Substituted 4-hydroxy-1,2,3-triazoles

    DEFF Research Database (Denmark)

    Pippione, Agnese C.; Dosio, Franco; Ducime, Alex

    2015-01-01

    the distal (S)-glutamic acid carboxyl group using the 4-hydroxy-1,2,3-triazole moiety is applied, to obtain two promising glutamate analogs. In the second example, a scaffold hopping approach is applied, replacing the phenolic moiety present in MDG-1-33A, a potent inhibitor of Onchocerca volvulus chitinase...

  7. 123I and 13I purification for biomolecules labelling

    International Nuclear Information System (INIS)

    Catanoso, Marcela Forli

    2011-01-01

    The 123 I and 131 I are iodine radioisotopes widely used in Nuclear Medicine. The radioisotope 123 I is used in diagnosis through the SPECT technique and is routinely produced at IPEN in cyclotron through the reaction: '1 24 Xe (p, 2n) '1 23 Cs -> 123 Xe -> 123 I. The radioisotope 131 I is used both in diagnosis and therapy due to its physical characteristics of decay by β - and its γ-ray emissions that are softened with the use of specific collimators for diagnosis. It is routinely produced at IPEN using the nuclear reactor through the indirect reaction: 130 Te (n, γ) -> 131 Te -> 131 I, irradiating compounds containing Te. The radiopharmaceuticals prepared with these radioisotopes go through rigorous quality control tests and the chemical purity of the primary radioisotopes 123 I and 131 I are within the permissible limits currently defined. However, the presence of some chemical contaminants can prejudice the biomolecules labeling (monoclonal antibodies and peptides), that will produce radiopharmaceuticals of first generation to the oncology area. The aim of this work was to obtain a new purification method of these radioisotopes, allowing the labeling of biomolecules and also to established a process control on those radioisotopes. The methodology was separated on 3 steps: Evaluation of '1 23 I e 131 I radionuclidic purity using a hyper pure germanium detector, chemical purity using ICP-OES and the retention and elution study of 131 I in several absorbers to choose the most appropriate for the purification tests analyzing the behavior of the possible contaminants. The radionuclidic analyses showed the presence of Te and Co on 131 I samples and Te, Tc e Co on 123 I samples. The chemical purity analyses showed the presence of Al and Mo in 123 I, coming from the window material of the target holder and the presence of Al and Te in 131 I samples, coming from the target holder and the target, respectively. The retention and elution study selected the most

  8. Assessment of takotsubo (ampulla) cardiomyopathy using iodine-123 metaiodobenzylguanidine scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Pessoa, Pinheiro M.C.; Xavier, Salles S.; Lima, Souza Leao R.; Mansur, J.; Almeida, Altino S. de; Carvalho, Pires A.C.; Gutfilen, B.; Fonseca, Barbosa L.M. da [Hospital Univ. Clementino Fraga Filho, Univ. Federal do Rio de Janeiro (Brazil). Dept. de Radiologia

    2006-12-15

    Purpose: To evaluate the role of cardiac sympathetic innervation in patients whose clinical features consisted of chest pain, transient ST-segment elevation, left ventricular apical akinesis, minimal elevation of cardiac enzymes, and onset of symptoms shortly after a severe stress condition. Material and Methods: Five female patients, mean age 67{+-}14 years, underwent thoracic {sup 123}I-MIBG (planar and SPECT) and 67Ga citrate (planar) scans within 5 days after the onset of symptoms. The {sup 123}I-MIBG myocardial washout rate between early (30 min) and delayed (3 hours) planar images was calculated. All patients presented findings consistent with takotsubo-like syndrome. Echocardiograms showed the characteristic wall motion pattern of significant apical dysfunction. Acute-phase coronary angiographies revealed a non-obstructive pattern. A peculiar apical akinesis and basal normokinesis were observed on the ventriculograms. Results: Impairment of cardiac neuronal uptake of {sup 123}I-MIBG based on a reduction of the heart-to-mediastinum uptake ratio was observed in all patients, while the washout rate was raised in four patients. All patients presented an apical uptake defect in the {sup 123}I-MIBG SPECT and planar images and a normal 67Ga scintigraphy. Conclusion: Our data indicate that ampulla cardiomyopathy (AC) is associated with a cardiac sympathetic innervation deficit characterized by a reduced global {sup 123}I-MIBG uptake and an apical uptake defect. The lack of 67Ga uptake in the acute phase of this syndrome indicates that AC is probably not associated with an inflammatory process.

  9. Ab-initio study of pure sup 7 sup 7 Se and sup 1 sup 2 sup 5 Te systems and of the sup 7 sup 7 Se nuclear quadrupole interaction in tellurium

    CERN Document Server

    Oh, Y K; Cho, H S

    1999-01-01

    Using the Hartree-Fock cluster procedure, we have studied the electric-field gradient tensors at the nuclear sites of sup 7 sup 7 Se and sup 1 sup 2 sup 5 Te in pure sup 1 sup 2 sup 5 Te systems and in tellurium crystalline system's with a sup 7 sup 7 Se impurity. From the results for the pure systems, sup 7 sup 7 Se in selenium and sup 1 sup 2 sup 5 Te in tellurium, using the observed quadrupole moments: Q( sup 7 sup 7 Se) 0.75 +- 0.07 barns and Q( sup 1 sup 2 sup 5 Te) = 0.35 +- 0.04 barns. Comparison is made with earlier values obtained by different methods. Using our calculated values of Q and the results of a study of the field-gradient tensors for sup 7 sup 7 Se in tellurium, the theoretical values of the quadrupole coupling constants are found to agree, within about 7 percent, with experiment. The calculated asymmetry parameters are also found to be in reasonable agreement with the experiment values, although the agreement not as close as in the case of the quadrupole -coupling constants. Directions fo...

  10. Successful therapy with hemoperfusion and plasma exchange in acute 1,2,3-trichloropropane poisoning.

    Science.gov (United States)

    Liu, P; Liang, Y-G; Meng, Q-Y; Zhang, C-G; Wang, H-C; Zhang, X-G; Li, G; Liu, Z-Y; He, Y-Z

    2012-05-01

    1,2,3-trichloropropane (1,2,3-TCP) is commonly used as an intermediate in pesticide and an industrial specialty solvent. Acute 1,2,3-TCP poisoning is rare but a medical emergency. Sporadic cases of toxic hepatic injury from 1,2,3-TCP in humans have been reported. Liver is a target organ for 1,2,3-TCP toxicity, which may ensue in a short period after ingestion. A specific antidote against 1,2,3-TCP is not available. So it is important to distinguish that a patient with 1,2,3-TCP poisoning constitutes a medical emergency. In this case study, the poisoned patient's clinical condition and laboratory values improved gradually after she received hemoperfusion (HP) and plasma exchange, which indicated that the therapy with HP and plasma exchange were helpful in the treatment of 1,2,3-TCP poisoning.

  11. 7 CFR 1221.123 - Patents, copyrights, inventions, trademarks, information, publications, and product formulations.

    Science.gov (United States)

    2010-01-01

    ..., information, publications, and product formulations. 1221.123 Section 1221.123 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SORGHUM PROMOTION, RESEARCH, AND INFORMATION ORDER Sorghum...

  12. /sup 123/I production at the Milan AVF cyclotron

    Energy Technology Data Exchange (ETDEWEB)

    Acerbi, E; Birattari, C; Castiglioni, M; Resmini, F [Milan Univ. (Italy). Istituto di Fisica

    1976-01-01

    A program is described to make available quantities of at least 20 mCi of /sup 123/I per irradiation, on a weekly routine basis to medical users at the Clinical Physiology Laboratory of Pisa. Contaminants such as /sup 124/I should be kept below 3%. The isotope, or compounds of it, like iodo-antipyrine and ortho-iodohippuric acid, were to be used as scanning agents for pancreas, kidneys, thyroid and for the detection of the aqueous content in the pulmonary region. The production of /sup 123/I from enriched /sup 124/Te is described. Preliminary experiments on a distillation separation of iodine from the Te target have been performed and the method seems promising in comparison to the time-consuming chemical separation technique.

  13. 40 CFR 81.123 - Southeastern Oklahoma Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... Quality Control Region. 81.123 Section 81.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Air Quality Control Regions § 81.123 Southeastern Oklahoma Intrastate Air Quality Control Region. The Southeastern Oklahoma Intrastate Air Quality Control Region consists of the territorial area encompassed by the...

  14. Rhodamine-123: a p-glycoprotein marker complex with sodium lauryl sulfate.

    Science.gov (United States)

    Al-Mohizea, Abdullah M; Al-Jenoobi, Fahad Ibrahim; Alam, Mohd Aftab

    2015-03-01

    Aim of this study was to investigate the role of sodium lauryl sulfate (SLS) as P-glycoprotein inhibitor. The everted rat gut sac model was used to study in-vitro mucosal to serosal transport of Rhodamine-123 (Rho-123). Surprisingly, SLS decreases the serosal absorption of Rho-123 at all investigated concentrations. Investigation reveals complex formation between Rhodamine-123 and sodium lauryl sulfate. Interaction profile of SLS & Rho-123 was studied at variable SLS concentrations. The SLS concentration higher than critical micelle concentration (CMC) increases the solubility of Rho-123 but could not help in serosal absorption, on the contrary the absorption of Rho-123 decreased. Rho-123 and SLS form pink color complex at sub-CMC. The SLS concentrations below CMC decrease the solubility of Rho-123. For further studies, Rho-123 & SLS complex was prepared by using solvent evaporation technique and characterized by using differential scanning calorimeter (DSC). Thermal analysis also proved the formation of complex between SLS & Rho-123. The P values were found to be significant (<0.05) except group comprising 0.0001% SLS, and that is because 0.0001% SLS is seems to be very low to affect the solubility or complexation of Rho-123.

  15. 21 CFR 123.6 - Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan.

    Science.gov (United States)

    2010-04-01

    ... Control Point (HACCP) plan. 123.6 Section 123.6 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF... Provisions § 123.6 Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan. (a) Hazard... fish or fishery product being processed in the absence of those controls. (b) The HACCP plan. Every...

  16. Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle

    International Nuclear Information System (INIS)

    Bomanji, J.; Britton, K.E.

    1987-01-01

    Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context

  17. Uterine uptake of iodine-123 metaiodobenzylguanidine during the menstrual phase of uterine cycle

    Energy Technology Data Exchange (ETDEWEB)

    Bomanji, J.; Britton, K.E.

    1987-08-01

    Radioiodinated I-123 metaiodobenzylguanidine (MIBG) has been used for diagnostic purposes for detection of apudomas. In this paper normal physiological uptake of I-123 MIBG by the uterus during the menstrual phase of the uterine cycle is reported. It is likely that I-123 MIBG can be used to evaluate some of the problems in this context.

  18. 20 CFR 1001.123 - Performance standards governing the assignment and role of Local Veterans' Employment...

    Science.gov (United States)

    2010-04-01

    ... assignment and role of Local Veterans' Employment Representatives (LVERs). 1001.123 Section 1001.123... Veterans and Eligible Persons § 1001.123 Performance standards governing the assignment and role of Local... one member of each State agency staff, preferably an eligible veteran, shall be designated and...

  19. 30 CFR 250.123 - Will MMS allow gas storage on unleased lands?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Will MMS allow gas storage on unleased lands? 250.123 Section 250.123 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... § 250.123 Will MMS allow gas storage on unleased lands? You may not store gas on unleased lands unless...

  20. 40 CFR 90.123 - Denial, revocation of certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... conformity. 90.123 Section 90.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Emission Standards and Certification Provisions § 90.123 Denial, revocation of certificate of conformity... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...

  1. 40 CFR 91.123 - Denial, revocation of certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... conformity. 91.123 Section 91.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Certification Provisions § 91.123 Denial, revocation of certificate of conformity. (a) If, after review of the... conformity if the Administrator finds any one of the following infractions to be substantial: (1) The engine...

  2. Effect of growth anisotropy on the morphology and property of directionally solidified RE123

    International Nuclear Information System (INIS)

    Nakamura, Yuichi; Shibusawa, Akira; Ooishi, Yoshihiro; Misu, Tomohiko; Inada, Ryoji; Oota, Akio

    2005-01-01

    The REBa 2 Cu 3 O y (RE123: RE = Y, Sm, Gd etc.) superconducting current lead is a favorable application due to the high J c properties and low thermal conductivity. Since the RE123 crystal shows the anisotropy in the J c properties as well as the mechanical properties, the ab-plane of the crystal parallel to the growth direction is preferable. The preferential growth direction during directional solidification is determined by the growth anisotropy in the early stage of the growth. In order to get the fundamental information to control the growth orientation, we investigated the growth rates of the Gd123 and Sm123 crystals against the undercooling and the continuous growth condition of Sm123 in directional solidification process. The growth rates of Sm123 and Gd123 were found to be about 5-10 times larger than that of Y123 at the same undercooling. The Sm123 showed the continuous growth structure up to 15 mm/h for fiber samples and up to 10 mm/h for 2 mm circle rods by the zone melting process. These pulling rates for continuous growth are larger than those of Y123 although the difference in growth rates between Sm123 and Y123 is much larger than this difference

  3. Clinical application of l-123 MlBG cardiac imaging

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Do Young [College of Medicine, Donga Univ., Busan (Korea, Republic of)

    2004-10-01

    Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy.

  4. Clinical application of l-123 MlBG cardiac imaging

    International Nuclear Information System (INIS)

    Kang, Do Young

    2004-01-01

    Cardiac neurotransmission imaging allows in vivo assessment of presynaptic reuptake, neurotransmitter storage and postsynaptic receptors. Among the various neurotransmitter, I-123 MlBG is most available and relatively well-established. Metaiodobenzylguanidine (MIBG) is an analogue of the false neurotransmitter guanethidine. It is taken up to adrenergic neurons by uptake-1 mechanism as same as norepinephrine. As tagged with I-123, it can be used to image sympathetic function in various organs including heart with planar or SPECT techniques. I-123 MIBG imaging has a unique advantage to evaluate myocardial neuronal activity in which the heart has no significant structural abnormality or even no functional derangement measured with other conventional examination. In patients with cardiomyopathy and heart failure, this imaging has most sensitive technique to predict prognosis and treatment response of betablocker or ACE inhibitor. In diabetic patients, it allow very early detection of autonomic neuropathy. In patients with dangerous arrhythmia such as ventricular tachycardia or fibrillation, MIBG imaging may be only an abnormal result among various exams. In patients with ischemic heart disease, sympathetic derangement may be used as the method of risk stratification. In heart transplanted patients, sympathetic reinnervation is well evaluated. Adriamycin-induced cardiotoxicity is detected earlier than ventricular dysfunction with sympathetic dysfunction. Neurodegenerative disorder such as Parkinson's disease or dementia with Lewy bodies has also cardiac sympathetic dysfunction. Noninvasive assessment of cardiac sympathetic nerve activity with l-123 MlBG imaging may be improve understanding of the pathophysiology of cardiac disease and make a contribution to predict survival and therapy efficacy

  5. Electrostatic interaction energy and factor 1.23

    Science.gov (United States)

    Rubčić, A.; Arp, H.; Rubčić, J.

    The factor F≫1.23 has originally been found in the redshift of quasars. Recently, it has been found in very different physical phenomena: the life-time of muonium, the masses of elementary particles (leptons, quarks,...), the correlation of atomic weight (A) and atomic number (Z) and the correlation of the sum of masses of all orbiting bodies with the mass of the central body in gravitational systems.

  6. Brain SPECT with iodine-123-amphetamine in amyotrophic lateral sclerosis

    International Nuclear Information System (INIS)

    Boettger, I.G.; Ludolph, A.C.; Elger, C.E.; Lottes, G.

    1988-01-01

    The study of 17 patients with ALS by 123 I-amphetamine (BIMP) SPECT revealed reduced CBF/amphetamine uptake correlation with the clinical status and course of the disease. ALS appears to involve fronto-temporal structures/functions in the early stage finally leading to generalization with the exclusion of the cerebellum. Thus, in ALS an involvement of also other than only motor cerebral structures/functions, which may be reversible, has to be considered. (orig.)

  7. 19 CFR 123.61 - Baggage arriving in baggage car.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Baggage arriving in baggage car. 123.61 Section... car. An inward foreign manifest on Customs Form 7533 shall be used for all baggage arriving in baggage cars. [T.D. 70-121, 35 FR 8215, May 26, 1970, as amended by T.D. 82-145, 47 FR 35478, Aug. 16, 1982] ...

  8. Iodine 123-antipyrine. A diffusible tracer for brain exploration

    International Nuclear Information System (INIS)

    Dantonel-Mathieu, Evelyne.

    1978-09-01

    Iodine 123-labelled iodoantipyrine is a liposoluble diffusible tracer which crosses the blood-brain barrier intact. Its build-up in brain tissue is proportional to the regional blood flow. Its behavior was studied in undervascularised brain lesions and in cases where research with traditional radioactive tracers (99mTc and its different vectors for example) has proved limited. Because of the great diffusibility of iodoantipyrine a brain parenchyma image is obtained within minutes after its injection, and this by the use of a non-invasive technique and under good gamma-camera exploration conditions. 81 brain explorations including 11 standards have been carried out on subjects averaging 51,2 years old; these examinations took place in three nuclear medicine centres. The 123 I iodoantipyrine used in each nuclear medicine centre is supplied by the CEA. Iodoantipyrine is labelled with a good yield (>98%) checked by chromatography by means of a CEA kit. After intraveinous injection of 4 to 6 mCi iodine-123 iodoantipyrine, a dynamic study (from 0 to 60 seconds) of the tracer passage in the brain tissue may be followed by static images taken in the next minutes according to a standard procedure. The table of results shows the major interest of this tracer for the exploration of vascular accidents with ischemic lesions, especially in the early phase of the accident. The lesion appears as a hypoactive zone and this lack of perfusion lasts for some minutes after the injection [fr

  9. Pool Boiling Enhancement of R-123 Using Perforated Plates

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Nae-Hyun [Incheon Nat’l Univ., Incheon(Korea, Republic of)

    2016-05-15

    In this study, we investigate the pool boiling enhancement caused by perforated plates on top of a smooth surface. We conduct tests using R-123 at atmospheric pressure. It was shown that perforated plates significantly enhanced the pool boiling of the smooth surface. The reason may be attributed to the increased bubble contact area between the plates. The results showed that the enhancement ratio was dependent on the heat flux. At high heat flux, the enhancement ratio increased as the porosity increased. However, at low heat flux, the enhancement ratio decreased as the porosity increased. For the present investigation, the optimum configuration had a pore diameter of 2.0 mm, pore pitch of 2.5 mm×5.0 mm or 5.0 mm×5.0 mm, and a gap width of 0.5 mm, which yielded heat-transfer coefficients that are close to those of GEWA-T. The optimum porosity for R-123 was significantly larger than that of water or ethanol. The reason for this may be the large liquid-to-vapor density ratio along with the small latent heat of vaporization of R-123. The perforated plates yielded smaller boiling hysteresis compared with that of the smooth surface.

  10. The use of A123Systems technology in PHEV applications

    Energy Technology Data Exchange (ETDEWEB)

    Chu, A. [A123 Systems, Watertown, MA (United States)

    2007-07-01

    A123Systems is a leading plug-in hybrid electric vehicle (PHEV) conversion company that supplies Automotive Class Lithium Ion cells for the Saturn Vue and Chevy Volt PHEV development programs through its subsidiary Hymotion. This paper described the advantages in power, safety and service life of its batteries that use doped nanophosphate technology in transportation applications, including hybrid electric vehicles (HEVs), plug-in hybrid electric vehicles (PHEVs) and electric vehicles (EVs). A123's technology has the unique ability to use the same active materials for high power and high energy applications. In high power applications, the technology has very low impedance growth due to cycling or elevated temperature storage, thereby ensuring a consistent power capability over the lifetime of the battery. High-power combined with low impedance growth allows the batteries to be smaller and lighter with better price-performance. For PHEV applications that require more energy, A123's doped nanophosphate cells provide good energy density, while maintaining low cell impedance, thereby simplifying thermal management by minimizing waste heat production. The deep-discharge cycle life allows more of the battery's energy to be used, by widening the range of state-of-charge (SOC) during cycling. In addition, the technology offers better abuse tolerance which is important for large format applications.

  11. SPECT quantification of 123I - and - CIT in Parkinsonism

    International Nuclear Information System (INIS)

    Larcos, G.; Shaffi, M.; Hutton, B.F.; Hatton, R.; Kyme, A.; Fung, V.S.C.; Morris, J.G.L.

    2002-01-01

    Full text: Evaluation of presynaptic dopaminergic function using 2B-carboxymethoxy-3B-(4-[ 123 I] iodophenyl) tropane ( 123 I-and-CIT) SPECT has employed subjective or semi-quantitative methods. Our hypothesis is that disease classification in Parkinsonism may be improved by partial volume correction and co-registration with MRI. We studied seven patients (pts) with IPD (four men, three women, mean age=54.5+/-10.9 yrs; Hoehn and Yahr stage range 1-3; Schwab and England scale range: 30-100 [mean=67.1+/-26.9]) and two controls with 123 I- - CIT using 110-150 MBq and a dual-head camera equipped with fan-beam collimation. SPECT was registered to MRI and then aligned to a reference template. Specific to non-specific dopaminergic binding (UR) was calculated for the putamen and caudate nucleus, as well as the fractional volume (FV; fraction of the Structure affected) and residual uptake ratio (RUR; count density in area/remnant apparently unaffected by disease). Parameters that were statistically significant were the putamen (p; but not caudate) UR, FV and RUR. We conclude that: (a) it is possible to distinguish dopaminergic activity within the putamen from caudate using MRI image co-registration and (b) parameters other than UR may discriminate IPD from normal subjects and other entities. Copyright (2002) The Australian and New Zealand Society of Nuclear Medicine Inc

  12. Human pancreas scintigraphy using iodine-123-labeled HIPDM and SPECT

    International Nuclear Information System (INIS)

    Yamamoto, K.; Shibata, T.; Saji, H.; Kubo, S.; Aoki, E.; Fujita, T.; Yonekura, Y.; Konishi, J.; Yokoyama, A.

    1990-01-01

    The pancreatic affinity of iodine-123-labeled HIPDM (N,N,N'-trimethyl-N'-(2-hydroxy-3-methyl-5-iodobenzyl)-1,3-propane diamine) ([ 123 I]HIPDM) was studied in 18 cases (5 normal volunteers, 7 cases with pancreas cancer, and 6 with chronic pancreatitis). In the normal cases, the pancreas was visualized in the planar images as early as 3 hr, and again at 20 hr postinjection. Single-photon emission computed tomography (SPECT) performed following 3-hr planar scintigraphy, provided excellent pancreas images without an overlap of activity in the liver or spleen. The mean pancreas-to-liver (P/L) ratio was 1.26 +/- 0.22 in normal controls. With the exception of one case of massive calcification in the pancreas, the entire pancreas could be observed in the cases with chronic pancreatitis, but the P/L ratio was 0.74 +/- 0.15, significantly lower than that of normal cases. Defective areas of the distal portion of the pancreas were clearly seen in those with cancer of the pancreas. The results of our study indicate that [ 123 I] HIPDM may have clinical potential as a human pancreas imaging agent

  13. Development of I-123-labeled amines for brain studies: localization of I-123 iodophenylalkyl amines in rat brain

    International Nuclear Information System (INIS)

    Winchell, H.S.; Baldwin, R.M.; Lin, T.H.

    1980-01-01

    Localization in rat brain of forty iodophenylalkyl amines labeled with I-123 was evaluated in an attempt to develop I-123-labeled amines useful for brain studies. For the amines studied, the highest activity in brain and the brain-to-blood activity ratios ranked p > m > o as related to iodine position on the benzene ring: for alkyl groups the rank order was α-methylethyl > ethyl > methyl > none; for N additions it was single lipophilic group > H > two lipophilic groups. It is suggested that introduction of a halogen into the ring structure of many amines results in greater concentration of the agent in brain than is seen with the nonhalogenated parent compound. The agent N-isopropyl-p-iodoamphetamine was chosen for further study because, in the rat, it showed high brain activity (1.57%/g) and brain-blood ratio (12.6) at 5 min

  14. [Evaluation of myocardial uptake of beta-methyl-(123I)-iodophenylpentadecanoic acid (123I-BMIPP)].

    Science.gov (United States)

    Momose, M; Kobayashi, H; Saito, K; Matsumoto, N; Maki, M; Hosoda, S; Kusakabe, K

    1994-12-01

    To evaluate the myocardial uptake of beta-methyl-(123I)-iodophenylpentadecanoic acid (123I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63 +/- 7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior view of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r = 0.676, p < 0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r = -0.671, p < 0.01). Further studies for the significance of MU/LVM will be required.

  15. Evaluation of myocardial uptake of {beta}-methyl-({sup 123}I)-iodophenylpentadecanoic acid ({sup 123}II-BMIPP)

    Energy Technology Data Exchange (ETDEWEB)

    Momose, Mitsuru; Kobayashi, Hideki; Matsumoto, Nobusuke; Maki, Masako; Kusakabe, Kiyoko [Tokyo Women`s Medical Coll. (Japan); Saito, Katsumi; Hosoda, Saichi

    1994-12-01

    To evaluate the myocardial uptake of {beta}-methyl-({sup 123}I)-iodophenylpentadecanoic acid ({sup 123}I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63{+-}7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior veiw of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r=0.676, p<0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r=-0.671, p<0.01). Further studies for the significance of MU/LVM will be required. (author).

  16. Evaluation of myocardial uptake of β-methyl-(123I)-iodophenylpentadecanoic acid (123II-BMIPP)

    International Nuclear Information System (INIS)

    Momose, Mitsuru; Kobayashi, Hideki; Matsumoto, Nobusuke; Maki, Masako; Kusakabe, Kiyoko; Saito, Katsumi; Hosoda, Saichi.

    1994-01-01

    To evaluate the myocardial uptake of β-methyl-( 123 I)-iodophenylpentadecanoic acid ( 123 I-BMIPP), nineteen patients with ischemic heart disease including left ventricular hypertrophy (mean age 63±7.8, 14 males and 5 females) underwent BMIPP myocardial scintigraphy. Myocardial uptake (MU) of BMIPP to the total injected dose was calculated from anterior veiw of the planar image in all subjects, and was compared with plasma glucose (BS), triglyceride (TG), and free fatty acid (FFA). It was also compared with left ventricular mass (LVM) calculated with echocardiography. MU was not related to BS, TG, and FFA, however had the positive correlation with LVM (r=0.676, p<0.01). Myocardial uptake per left ventricular mass (MU/LVM) had the negative correlation with LVM (r=-0.671, p<0.01). Further studies for the significance of MU/LVM will be required. (author)

  17. Growth of PbTe nanorods controlled by polymerized tellurium anions and metal(II) amides via composite-hydroxide-mediated approach

    Energy Technology Data Exchange (ETDEWEB)

    Wan Buyong [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); College of Physics and Information Technology, Chongqing Normal University, Chongqing 400047 (China); Hu Chenguo, E-mail: hucg@cqu.edu.cn [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China); Liu Hong [State Key Laboratory of Crystal Materials, Shandong University, Jinan 250100 (China); Xiong Yufeng [National Center for Nanoscience and Technology, Beijing 100080 (China); Li Feiyun; Xi Yi; He Xiaoshan [Department of Applied Physics, Chongqing University, 174 Shapingba Street, Chongqing 400044 (China)

    2009-09-15

    The pure face-centered-cubic PbTe nanorods have been synthesized by the composite-hydroxide-mediated approach using hydrazine as a reducing agent. The method is based on reaction among reactants in the melts of potassium hydroxide and sodium hydroxide eutectic at 170-220 deg. C and normal atmosphere without using any organic dispersant or surface-capping agent. Scanning electron microscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy were used to characterize the structure, morphology and composition of the samples. The diameters of nanorods are almost fixed, while the lengths can be tunable under different growth time and temperatures. The growth mechanism of PbTe nanorods is investigated via UV-vis absorption, demonstrating that polymerized tellurium anions and metal(II) amides in the hydrazine hydroxide melts could control the crystallization and growth process of PbTe nanostructures. The band gap of as-synthesized PbTe nanorods has been calculated based on UV-vis-NIR optical diffuse reflectance spectra data.

  18. Growth of PbTe nanorods controlled by polymerized tellurium anions and metal(II) amides via composite-hydroxide-mediated approach

    International Nuclear Information System (INIS)

    Wan Buyong; Hu Chenguo; Liu Hong; Xiong Yufeng; Li Feiyun; Xi Yi; He Xiaoshan

    2009-01-01

    The pure face-centered-cubic PbTe nanorods have been synthesized by the composite-hydroxide-mediated approach using hydrazine as a reducing agent. The method is based on reaction among reactants in the melts of potassium hydroxide and sodium hydroxide eutectic at 170-220 deg. C and normal atmosphere without using any organic dispersant or surface-capping agent. Scanning electron microscopy, X-ray diffraction, transmission electron microscopy, and energy dispersive X-ray spectroscopy were used to characterize the structure, morphology and composition of the samples. The diameters of nanorods are almost fixed, while the lengths can be tunable under different growth time and temperatures. The growth mechanism of PbTe nanorods is investigated via UV-vis absorption, demonstrating that polymerized tellurium anions and metal(II) amides in the hydrazine hydroxide melts could control the crystallization and growth process of PbTe nanostructures. The band gap of as-synthesized PbTe nanorods has been calculated based on UV-vis-NIR optical diffuse reflectance spectra data.

  19. Electrical properties of tellurium clusters on the void sublattice of an opal crystal the important role played by the Te-SiO$_{2}$ interface

    CERN Document Server

    Berezovets, V A; Farbshtein, I I; Nizhankovskii, V I

    2002-01-01

    The temperature dependences of electrical resistivity and of the Hall effect of nanocluster tellurium crystals obtained by filling the voids in a dielectric (opal) matrix with a melt of pure and doped Te were studied. The Hall hole concentration p/sub eff/ was found to increase anomalously (by more than two orders of magnitude) in a sample prepared from pure Te and cooled to helium temperatures. At T = 1.45 K, the hole concentration in this sample was p/sub eff/ = equivalent to 6 * 10/sup 17/ cm/sup -3/. At the same time, the Hall effect in this sample was observed to reverse sign at T equivalent to 200 K from positive for T < 200 K to negative at higher temperatures. This implies a low impurity concentration (N/sub A/ is less than at least 10/sup 15/ cm/sup -3/). A nanocluster crystal of doped Te does not exhibit this anomaly; here, we have p/sub eff/ equivalent to 6 * 10/sup 17/ cm/sup -3/ throughout the temperature region covered, as in the original Te. These features are assigned to the formation of a ...

  20. Assessment of cerebral benzodiazepine receptor distribution in anxiety disorders by 123I-iomazenil-SPECT. Comparison to cerebral perfusion scintigraphy by 123I-IMP

    International Nuclear Information System (INIS)

    Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji

    1997-01-01

    123 I-Iomazenil ( 123 I-IMZ) and 123 I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On 123 I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on 123 I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower 123 I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of 123 I-IMZ, negative correlation (R 123 I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)

  1. Assessment of cerebral benzodiazepine receptor distribution in anxiety disorders by {sup 123}I-iomazenil-SPECT. Comparison to cerebral perfusion scintigraphy by {sup 123}I-IMP

    Energy Technology Data Exchange (ETDEWEB)

    Uchiyama, Mayuki; Sue, Hironari; Fukumitsu, Nobuyoshi; Mori, Yutaka; Kawakami, Kenji [Jikei Univ., Tokyo (Japan). School of Medicine

    1997-01-01

    {sup 123}I-Iomazenil ({sup 123}I-IMZ) and {sup 123}I-IMP imaging were performed in 5 patients with anxiety disorder (PAD) and 6 normal volunteers (NV). On {sup 123}I-IMZ delayed imaging, the 2 PAD showed abnormally decreased findings. In anxiety disorder, decreased accumulation on {sup 123}I-IMZ delayed images was seen in left hippocampus and parahippocampal gyrus in one patient, in right frontal and temporal lobe and left occipital pole in the other. Compared with NV, PAD had lower {sup 123}I-IMZ uptake on delayed image in right upper and left lower frontal cortices, indicating the involvement of the benzodiazepine receptor complex in anxiety disorder. Compared with grading for anxiety disorder with Hamilton anxiety scale (HAS) and delayed to early count ratios of {sup 123}I-IMZ, negative correlation (R<-0.7) was recognized hippocampus and parahippocampal gyrus, frontal and occipital cortices. Compared between HAS and the count ratio to the cerebellum on {sup 123}I-IMP image, positive correlation (R>0.7) was recognized in the hippocampus, the parahippocampal gyrus, the lower outer temporal cortex and the lower frontal cortex. (author)

  2. Temperature measurement of RE123 bulk superconductors on magnetizing process

    International Nuclear Information System (INIS)

    Yokoyama, K.; Kaneyama, M.; Oka, T.; Fujishiro, H.; Noto, K.

    2004-01-01

    We study on the magnetization behavior of to magnetize RE123 bulk superconductors to apply it as strong magnets. Through magnetizing process, the temperature of bulk superconductors is raised by pinning loss caused by the magnetic fluxes motion (e.g. flux jump of flux flow), and the trapped field is decreased. This paper presents the measurement of temperature changes of Sm123 bulk superconductors during the exciting process by iteratively magnetizing pulsed-field operation with reducing amplitudes (IMRA) method. Five thermocouples are put on the surface of Sm123 bulk superconductor of 46 mm in diameter. The temperatures at the center, on the growth sector boundary (GSB) line and in the sector region surrounded by GSB's line (inter-GSB region) are monitored. The temperature at a cold stage is also measured. A Hall sensor is attached near the center thermocouple to measure the trapped field. After a bulk superconductor is cooled by the GM type refrigerator until 40 K, iterative pulsed-fields of 2.32-5.42 T are applied by a magnetizing coil. When high magnetic field of 5.42 T is applied, a temperature of bulk superconductor reaches to 72.4 K and the magnetic field distribution has C form with which a part of circle is dented, and then, a trapped field is 2.28 T. When a lower magnetic field of 4.64 T is applied, a maximum temperature is 68.3 K and a trapped field is raised to 2.70 T, and moreover, the distribution becomes round shape like field-cooling method (FC). We showed clearly that heat generation by pinning loss was related to the mechanism of magnetic field capture

  3. Multiple endocrine neoplasia detection on I-123 MIBG imaging

    International Nuclear Information System (INIS)

    Reinhardt, C.A.; McEwan, L.M.; Wong, J.C.H.

    2000-01-01

    Full text: An 123 I meta-iodobenzylguanidine (MIBG) scan was performed on a 54-year-old lady with familial phaeochromocytoma, to evaluate for bilateral or extra-adrenal disease. She has hypertension with raised catecholamines and CT evidence of a right adrenal phaeochromocytoma, and a female sibling with bilateral phaeochromocytoma. Thyroid blockade using Lugol's Iodine was given orally prior to intravenous administration of 370 MBq 123 I MIBG. Planar and SPECT imaging were acquired at 24 hours. There was intense uptake in the known right phaeochromocytoma. An unexpected finding was focal intense uptake in the region of the right thyroid lobe, which may be either a functioning paraganglioma arising from the cervical sympathetic ganglia or a medullary thyroid carcinoma (MTC). At 48 hours, a further image of the neck showed no changes. This was followed by a standard injection of 150 MBq 99 Tc m pertechnetate for thyroid scanning. Imaging obtained on 99 Tc m energy window setting showed a large hypofunctioning region in the right thyroid lobe, corresponding in location to the focal 123 I MIBG uptake. This is in keeping with a MTC, a neuroendocrine tumour, as other thyroid carcinomas are non-MIBG avid. A subsequent serum calcitonin assay showed elevated levels. The patient underwent surgical removal of the right phaeochromocytoma followed several weeks later by a right hemithyroidectomy. Histological reports confirmed the tumour diagnoses. The patient's familial phaeochromocytoma is therefore part of the multiple endocrine neoplasia syndrome Type 2A (MEN 2A). To date, biochemistry has not shown any evidence of hyperparathyroidism which occurs in 15-20 per cent of patients with MEN 2A. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  4. Iodine-123 miniplasmin for the detection of deep venous thrombosis

    International Nuclear Information System (INIS)

    Schubiger, P.A.; Haeberli, A.; Gallino, A.; Straub, P.W.

    1989-09-01

    Human plasminogen (MW 90'000) is cleaved by elastase into several fragments, including one with a molecular weight of 38'000 (mini-plasminogen). This fragment retains sufficiently preserved fibrin binding sites but lacks the affinity for α 2 -antiplasmin. Therefore radiolabelled miniplasmin was tested in 21 patients with suspected deep venous thrombosis, in 5 patients with lymphedema and in 5 healthy controls for its potential use as fast marker of deep venous thrombosis. 250 μCi of Iodine-123 miniplasmin was given i.v. after previous activation with 3000 IU urokinase. The tracer distribution was measured 15, 30 and 60 minutes after injection at 10 points over each leg. The mean left/right ratio obtained in the 5 volunteers was 1.04 (range 0.89-1.12). In the patients the test was considered positive when the left/right ratio was greater than 1.15 or smaller than 0.85 at two adjacent locations and in two consecutive measuring times. In the 21 patients studied both tests gave concurrent results in 19, while in one patient with a positive and in one patient with a negative phlebography the miniplasmintest gave opposite results. In 4 of the 5 patients with edema and no thrombosis the miniplasmintest was negative. Most positive tests were conclusive as early as 15 minutes after injection of miniplasmin. The sensitivity was calculated to be 90% and the specificity 85%. Therefore Iodine-123 miniplasmin has been estimated as a fast, non invasive marker for the diagnosis of deep venous thrombosis and preliminary clinical studies with scintigraphy have been performed on over 50 patients. Evaluation gave a sensitivity between 40% and 86% and a specificity between 62% and 100%. Clinical studies have not been continued. Since I-123 miniplasmin is not available around the clock, it can't be used in emergency diagnosis. (author) 2 figs., 5 tabs., 30 refs

  5. Transformation and biodegradation of 1,2,3-trichloropropane (TCP)

    OpenAIRE

    Samin, Ghufrana; Janssen, Dick B.

    2012-01-01

    Purpose 1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for cheap and efficient technologies for the cleanup of TCP-contaminated sites. In situ or on-site bioremediation of TCP is an option if biodegradation can be achieved and stimulated. This pap...

  6. Superfluid phase stiffness in electron doped superconducting Gd-123

    Science.gov (United States)

    Das, P.; Ghosh, Ajay Kumar

    2018-05-01

    Current-voltage characteristics of Ce substituted Gd-123 superconductor exhibits nonlinearity below a certain temperature below the critical temperature. An exponent is extracted using the nonlinearity of current-voltage relation. Superfluid phase stiffness has been studied as a function of temperature following the Ambegaokar-Halperin-Nelson-Siggia (AHNS) theory. Phase stiffness of the superfluid below the superconducting transition is found to be sensitive to the change in the carrier concentration in superconducting system. There may be a crucial electron density which affects superfluid stiffness strongly. Electron doping is found to be effective even if the coupling of the superconducting planes is changed.

  7. Improved radiosynthesis of 2-[123I]iodomelatonin

    International Nuclear Information System (INIS)

    Rossouw, D. du T.; Langenhoven, J.H.

    1994-01-01

    An improved method for the radiosynthesis of [ 123 I]melatonin is presented. The suitability of several oxidizing agents, such as Iodo-Gen, chloramine-T, hydrogen peroxide and in situ generated peracetic acid were evaluated for the oxidative radioiodination reactions. The rates at which reactions progressed as well as the radiochemical yields and purities were compared. Peracetic acid proved to be the superior oxidizing agent, producing an average radiochemical yield of 70 ± 10% after 40 min reaction time, and causing less degradation of the melatonin molecule than Iodo-Gen or chloramine-T. (author)

  8. I-123 iodoamphetamine brain SPECT of leukoencephalopathy in dementia

    International Nuclear Information System (INIS)

    Kramer, E.L.; George, A.E.; Sanger, J.J.; De Leon, M.J.

    1987-01-01

    Six elderly patients with dementia underwent I-123 iodoamphetamine (IMP) SPECT and CT or MR imaging of the brain. In five of six, CT or MR imaging showed changes in the temporal lobes consistent with Alzheimer disease (AD). IMP scans in these five showed temporal and parietal defects. In five of six, CT or MR imaging showed white-matter lucencies and/or basal ganglia infarcts. In these, IMP defects corresponded to focal CT abnormalities but were more extensive and also involved structural normal adjacent cortex. IMP demonstrates the deficits of AD and leukoencephalopathy and may help clarify the contribution of small-vessel disease to dementia in the elderly

  9. Intracellular uptake of 123I-boronophenylalanine-fructose

    International Nuclear Information System (INIS)

    Woo, K. S.; Choi, T. H.; Choi, C. Y.; Jung, W. S.; Lim, S. J.; Lee, S. J.; Lim, S. M.

    1999-01-01

    Boronophenylalanine (BPA) has been used in malignant glioma or melanoma uptake for BNCT. We labeled BPA with 123 I for in vivo quantitation of BPA in BNCT, and tumor imaging with gamma camera. We investigated the amino acid BPA as a boron delivery agent fro BNCT. As the free amino acid, BPA has a limited solubility at physiological pH, which makes it unsuitable for IV or IP injection. Recent studies of the chemistry of BPA have yielded a method of solubilizing BPA at neutral pH using fructose, a common fruit sugar. The use of BPA-fructose has significantly improved high uptake compared to BPA alone in melanoma

  10. 1-123 iodoamphetamine SPECT findings in paranoid schizophrenia

    International Nuclear Information System (INIS)

    Simon, T.R.; Walker, B.S.; Matthieson, S.; Miller, C.D.; Raese, J.

    1989-01-01

    To find out if frontal metabolic and cerebral blood flow differ between normal subjects and patients with paranoid schizophrenia (PAR), the authors have examined regional synaptic amine metabolism. Using [I- 123]iodoamphetamine (IMP), the authors compared 85 subjects (61 PAR patients and 24 normal subjects) with single-head single-photon emission CT (SPECT). Virtually automatic analysis assigned relative tracer uptake to the frontal, anterior temporoparietal (TP), and posterior TP regions. Consistent with the visual inspection of two clinicians familiar with SPECT IMP images, this objective method yielded T-tests that showed higher relative frontal lobe ratios in normal subjects than in PAR patients (P =.03)

  11. Clinical evaluation of 123I-IMP SPECT in patients with various neurological diseases

    International Nuclear Information System (INIS)

    Yoneda, Naoto

    1993-01-01

    Single photon emission computed tomography with N-isopropyl-p-[ 123 I] iodoamphetamine ( 123 I-IMP SPECT) was performed in 57 patients with various neurological disease, and compared with the findings of brain CT, MRI, and EEG. The author also evaluated the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack after treatment with antiepileptic drugs in idiopathic epileptic patients. Abnormality of accumulation of 123 I-IMP SPECT was observed in 62.3% of all cases. Focal abnormality was detected in 28.3% of all cases by brain CT and 54.1% by MRI. The detectability of focal abnormality in brain CT and MRI was found to be lower than that of 123 I-TMP SPECT. There was very little significance in detectability between 123 I-IMP SPECT and EEG. But it infers that 123 I-IMP SPECT can detect the subictal state in epileptic patients. One comparative study of the relationship between the findings on 123 I-IMP SPECT and the condition of the control of the attack by antiepileptic drugs in patients with idiopathic epilepsy, abnormality of 123 I-IMP SPECT findings was found to be higher in patients who were not controlled sufficiently than in patients who were controlled sufficiently, and a significant difference is found by X 2 test. 123 I-IMP SPECT is useful for the evaluation of treatment in patients with epilepsy. (author)

  12. The anti-inflammatory effects of the tellurium redox modulating compound, AS101, are associated with regulation of NFκB signaling pathway and nitric oxide induction in macrophages

    Directory of Open Access Journals (Sweden)

    Sredni Benjamin

    2010-01-01

    Full Text Available Abstract Background LPS-activated macrophages produce mediators which are involved in inflammation and tissue injury, and especially those associated with endotoxic shock. The non toxic tellurium compound ammonium tri-chloro(dioxoethylene-O,O'-tellurate, AS101, has been recently shown to exert profound anti-inflammatory properties in animal models, associated with its Te(IV redox chemistry. This study explores the anti-inflammatory properties of AS101 with respect to modulation of inflammatory cytokines production and regulation of iNOS transcription and expression in activated macrophages via targeting the NFkB complex. Results AS101 decreased production of IL-6 and in parallel down-regulated LPS-induced iNOS expression and NO secretion by macrophages. AS101 reduced IkB phosphorylation and degradation, and reduced NFkB nuclear translocalization, albeit these effects were exerted at different kinetics. Chromatin immunoprecipitation assays showed that AS101 treatment attenuated p50-subunit ability to bind DNA at the NFkB consensus site in the iNOS promotor following LPS induction. Conclusions Besides AS101, the investigation of therapeutic activities of other tellurium(IV compounds is scarce in the literature, although tellurium is the fourth most abundant trace element in the human body. Since IKK and NFkB may be regulated by thiol modifications, we may thus envisage, inview of our integrated results, that Te(IV compounds, may have important roles in thiol redox biological activity in the human body and represent a new class of anti-inflammatory compounds.

  13. Effects of anesthetic agents on cellular 123I-MIBG transport and in vivo 123I-MIBG biodistribution

    International Nuclear Information System (INIS)

    Ko, Bong-Ho; Paik, Jin-Young; Jung, Kyung-Ho; Bae, Jun-Sang; Lee, Eun Jung; Choe, Yearn Seong; Kim, Byung-Tae; Lee, Kyung-Han

    2008-01-01

    Small animal imaging with meta-iodobenzylguanidine (MIBG) allows characterization of animal models, optimization of tumor treatment strategies, and monitoring of gene expression. Anesthetic agents, however, can affect norepinephrine (NE) transport and systemic sympathetic activity. We thus elucidated the effects of anesthetic agents on MIBG transport and biodistribution. SK-N-SH neuroblastoma and PC-12 pheochromocytoma cells were measured for 123 I-MIBG uptake after treatment with ketamine (Ke), xylazine (Xy), Ke/Xy, or pentobarbital (Pb). NE transporters were assessed by Western blots. Normal ICR mice and PC-12 tumor-bearing mice were injected with 123 I-MIBG 10 min after anesthesia with Ke/Xy, Ke, Xy, or Pb. Plasma NE levels and MIBG biodistribution were assessed. Cellular 123 I-MIBG uptake was dose-dependently inhibited by Ke and Xy but not by Pb. Treatment for 2 h with 300 μM Ke, Xy, and Ke/Xy decreased uptake to 46.0 ± 1.6, 24.8 ± 1.5, and 18.3 ± 1.6% of controls. This effect was completely reversed by fresh media, and there was no change in NE transporter levels. In contrast, mice anesthetized with Ke/Xy showed no decrease of MIBG uptake in target organs. Instead, uptakes and organ-to-blood ratios were increased in the heart, lung, liver, and adrenals. Plasma NE was notably reduced in the animals with corresponding decreases in blood MIBG, which partly contributed to the increase in target organ uptake. In spite of their inhibitory effect at the transporter level, Ke/Xy anesthesia is a satisfactory method for MIBG imaging that allows favorable target tissue uptake and contrast by reducing circulating NE and MIBG. (orig.)

  14. High-spin, multiparticle isomers in 121,123Sb

    International Nuclear Information System (INIS)

    Jones, G. A.; Walker, P. M.; Podolyak, Zs.; Cullen, I. J.; Garnsworthy, A. B.; Liu, Z.; Thompson, N. J.; Williams, S. J.; Zhu, S.; Carpenter, M. P.; Janssens, R. V. F.; Khoo, T. L.; Seweryniak, D.; Carroll, J. J.; Chakrawarthy, R. S.; Hackman, G.; Chowdhury, P.; Dracoulis, G. D.; Lane, G. J.; Kondev, F. G.

    2008-01-01

    Isomers in near-spherical Z=51, antimony isotopes are reported here for the first time using fusion-fission reactions between 27 Al and a pulsed 178 Hf beam of energy, 1150 MeV. γ rays were observed from the decay of isomeric states with half-lives, T 1/2 =200(30) and 52(3)μs, and angular momenta I=((25/2)) and I π =(23/2) + , in 121,123 Sb, respectively. These states are proposed to correspond to ν(h (11/2) ) 2 configurations, coupled to an odd d (5/2) or g (7/2) proton. Nanosecond isomers were also identified at I π =(19/2) - [T 1/2 =8.5(5) ns] in 121 Sb and I π =((15/2) - ) [T 1/2 =37(4) ns] in 123 Sb. Information on spins and parities of states in these nuclei was obtained using a combination of angular correlation and intensity-balance measurements. The configurations of states in these nuclei are discussed using a combination of spin/energy systematics and shell-model calculations for neighboring tin isotones and antimony isotopes

  15. Brain SPECT with 123I-isopropyl amphetamine in epilepsy

    International Nuclear Information System (INIS)

    Biersack, H.J.; Reske, S.N.; Rasche, A.; Reichmann, K.; Winkler, C.

    1983-01-01

    Ten patients were studied with N-isopropyl I-123 p-iodoamphetamine. Single photon emission computed tomography (SPECT) was carried out by hand of a rotating gamma camera system (Gammatome T9000/CGR, high resolution collimator). During 1 rotation (360 0 ) 64 frames (4k matrix) were acquired within 20 min 1 hour after injection of 6.5 mCi I-123 labeled amphetamine. The content of I-124 was less than 2%. After reconstruction of transverse slices coronar and sagittal reconstructions were rapidly performed using an array processor. Nine patients suffered from epilepsy and one from severe migraine. Excellent differentiation between gray and white matter of the cerebral cortex and the basal ganglia was evident in all of the cases. In 2 out of 3 patients with epilepsy and negative CT results SPECT revealed circumscribed areas with increased amphetamine uptake in accordance with the EEG findings. In 4 out of 6 cases with positive CT findings SPECT lesions with diminished amphetamine uptake could be established. One patient with severe migraine showed focal increased amphetamine uptake in accordance with the respective clinical results. (orig.)

  16. Long Gd-123 coated conductor by PLD method

    International Nuclear Information System (INIS)

    Fuji, H.; Igarashi, M.; Hanada, Y.; Miura, T.; Hanyu, S.; Kakimoto, K.; Iijima, Y.; Saitoh, T.

    2008-01-01

    We have developed long Gd-123 coated conductors by ion-beam-assisted deposition (IBAD) and pulsed-laser-deposition (PLD) method. Recently, large-scale reel-to-reel apparatus with the 110 cm x 15 cm assisting ion source was introduced to IBAD system. It was enable to produce 500 m-class IBAD-Gd 2 Zr 2 O 7 (GZO) tapes with Δφ of below 15 deg. and high throughputs of 3 m/h. Furthermore, apparatus with multi-lane and laser scanning was introduced to PLD system. As a result, end to end I c of 318 A were obtained for a 201.5 m long tape, and I c x L values were 64,077 Am. Furthermore, 500 m-class deposition was carried out by improving PLD conditions. As a result, I c x L values of 112,166 Am was obtained and it's a world record on August 2007. In the short samples, I c of over 500 A was obtained with Gd-123 thickness of 2.0 μm and over 100 A was obtained in magnetic field of 3 T, perpendicular to c-axis

  17. Automatic production of Iodine-123 with PLC 135/U

    International Nuclear Information System (INIS)

    Moghaddam-Banaem, L.; Afarideh, H.

    2004-01-01

    In this project, the automatic system for production of Iodine-123 with PLC/135μ Siemens, which is designed and installed for the first time in Iran, is discussed. The PLC (Programmable Logic Controller) is used to control industrial processing, which is similar to a computer and consists of central processing unit and memory and Input/Output units. PLC receives input information from auxiliary units such as sensors, switches, etc. and software processes data in memory and then sends commands to output units such as relays, motors, etc.The target section in Iodine production consists of 8 stages. In order to be sure automation works properly the system can be operated both manually and automatically. First PLC checks Manual/Automatic switch and in the case of automatic mode, PLC runs the program in memory and processing is done automatically. For this purpose, PLC takes the value of pressures and temperatures from analog inputs and after processing them it sends commands to digital output to activate valves or vacuum pumps or heaters. In this paper the following subjects are discussed: 1) Production of Iodine 123 2) PLC structure and auxiliary boards 3) Sensors and actuators and their connection to PLC 4) Software flowchart

  18. Reaction of 1-bromo-3-chloropropane with tellurium and dimethyl telluride in the system of hydrazine hydrate-alkali; Reaktsiya 1-brom-3-khlorpropana s tellurom i dimetilditelluridom v sisteme gidrazin-gidrat-shcheloch'

    Energy Technology Data Exchange (ETDEWEB)

    Russavskaya, N V; Levanova, E P; Sukhomazova, Eh N; Grabel' nykh, V A; Elaev, A V; Klyba, L V; Zhanchipova, E R; Albanov, A I; Korotaeva, I M; Toryashinova, D S.D.; Korchevin, N A [SO RAN, Irkutskij Inst. Khimii imeni A.E. Favorskogo, Irkutsk (Russian Federation)

    2006-05-15

    A synthesis of oligomeric substance of thiocol type, the poly(trimethyleneditelluride), from 1-bromo-3-chloropropane and elemental tellurium is performed using a hydrazine hydrate-alkali system. Reductive splitting of the tellurocol followed by alkylation with methyl iodide give rise to preparation of bis(methyltelluro)propane, which was synthesized also from dimethyl telluride and 1,3-dihalopropanes using the N{sub 2}H{sub 4}{center_dot}H{sub 2}O/KOH system. The reaction products were characterized by elementary analysis, NMR, and IR spectra. Mass spectra of the synthesized low molecular weight organotellurium compounds are considered.

  19. Dynamic myocardial scintigraphy with 123I-labelled free fatty acids

    International Nuclear Information System (INIS)

    Wall, E.E. van der.

    1981-01-01

    In this thesis, long-chain radioiodinated free fatty acids ( 123 I-FFA), 16-iodo- 123 I-cis-Δ 9 -hexadecenoic acid ( 123 I-HA) and 17-iodo- 123 I-heptade-canoic acid ( 123 I-Hsup(o)A), were employed for myocardial scintigraphy in patients with coronary artery disease. The results indicate that clearance of 123 I-FFA from the myocardium is dependent on the nature of ischemic injury. Clearance is delayed if the injury is reversible and accelerated in case of irreversible ischemia. Mechanisms responsible for divergent behaviour of FFA in patients with acute myocardial infarction versus patients with angina pectoris are purely speculative. This differential clearance from normally perfused, transiently ischemic and infarcted myocardium has practical application. The test provides a means to assess the nature of ischemic injury rapidly. These findings may have major consequences for logical management of patients presenting with chest pain and suspected coronary artery disease. (Auth.)

  20. Morphological stability of Sm123 superconductor during peritectic solidification from Sm211 + L mixture

    International Nuclear Information System (INIS)

    Sumida, Masaki; Shiohara, Yuh; Umeda, Takateru

    2000-01-01

    The interface stability of the Sm 123 superconductor was analyzed in accordance with the constitutional undercooling criterion. As the single-crystal growth of the 123 phase is largely dependent on the growth-interface stability, a quantitative analysis was very much required. From this analysis, it was clarified that the constitutional undercooling must exist in the liquid when the 123 growth interface comes close to a 211 particle during the peritectic solidification. It was also predicted that the larger 211 particle radius, smaller volume fraction of the 211 particles, larger growth rate, or smaller imposed temperature gradient would cause easy occurrence of the constitutional undercooling ahead of the 123 growth interface. Taking into account the nucleation at the L/211 interface just ahead of the 123 growth front due to the constitutional undercooling, the transition of 123 growth from a planar-interface morphology to an equiaxed blocky morphology was investigated quantitatively and qualitatively

  1. Studies of rhodamine-123: effect on rat prostate cancer and human prostate cancer cells in vitro.

    Science.gov (United States)

    Arcadi, J A; Narayan, K S; Techy, G; Ng, C P; Saroufeem, R M; Jones, L W

    1995-06-01

    The effect of the lipophilic, cationic dye, Rhodamine-123 (Rh-123), on prostate cancer in rats, and on three tumor cell lines in vitro is reported here. The general toxicity of Rh-123 in mice has been found to be minimal. Lobund-Wistar (L-W) rats with the autochthonous prostate cancer of Pollard were treated for six doses with Rh-123 at a dose of 15 mg/kg subcutaneously every other day. Microscopic examination of the tumors revealed cellular and acinar destruction. The effectiveness of Rh-123 as a cytotoxic agent was tested by clonogenic and viability assays in vitro with three human prostate cancer cell lines. Severe (60-95%) growth inhibition was observed following Rh-123 exposure for 2-5 days at doses as low as 1.6 micrograms/ml in all three prostate cancer cell lines.

  2. Clinical evaluation of sup 123 I-BMIPP myocardial scintigraphy in patients with hypertrophic cardiomyopathy

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsuki, Katsuichi; Sugihara, Hiroki; Umamoto, Ikuo (Kyoto Prefectural Univ. of Medicine (Japan)) (and others)

    1992-02-01

    {sup 123}I-{beta}-methyl-p-iodophenylpentadecanoic acid ({sup 123}I-BMIPP) myocardial scintigraphy was performed in 13 patients with hypertrophic cardiomyopathy and compared with {sup 201}Tl myocardial scintigraphy performed within 3 months for evaluating the clinical significance of {sup 123}I-BMIPP myocardial scintigraphy. SPECT images were divided into 13 segments and segmental images were visually scored on a 4 (increased tracer uptake) to 0 (severely decreased tracer uptake) scale according to the tracer uptake. In comparison of {sup 123}I-BMIPP early images and {sup 201}Tl perfusion images, mismatches were seen in about 70% of all segments. The number of segments demonstrating lower myocardial uptake of {sup 123}I-BMIPP was larger than that of {sup 201}Tl. In hypertrophic regions, the tracer uptake of {sup 123}I-BMIPP early images was significantly lower than that of {sup 201}Tl images and the lower uptake of {sup 123}I-BMIPP delayed images was more marked. In non-hypertrophic regions, no significant difference was seen between the tracer uptakes of {sup 123}I-BMIPP early images and {sup 201}Tl images but the tracer uptake of {sup 123}I-BMIPP delayed images was significantly lower than that of {sup 201}Tl images. The mismatch between the tracer uptakes of {sup 123}I-BMIPP images and {sup 201}Tl images was thought to be a reflection of disordered myocardial fatty acid metabolism. 'Washout', the difference between the tracer uptakes of {sup 123}I-BMIPP early images and delayed images was also thought to be a reflection of disordered myocardial fatty acid metabolism. These results suggest that {sup 123}I-BMIPP is a promising radiopharmaceutical for evaluating disordered myocardial fatty acid metabolism in patients with HCM. (author).

  3. Clinical evaluation of 123I-BMIPP myocardial scintigraphy in patients with hypertrophic cardiomyopathy

    International Nuclear Information System (INIS)

    Ohtsuki, Katsuichi; Sugihara, Hiroki; Umamoto, Ikuo

    1992-01-01

    123 I-β-methyl-p-iodophenylpentadecanoic acid ( 123 I-BMIPP) myocardial scintigraphy was performed in 13 patients with hypertrophic cardiomyopathy and compared with 201 Tl myocardial scintigraphy performed within 3 months for evaluating the clinical significance of 123 I-BMIPP myocardial scintigraphy. SPECT images were divided into 13 segments and segmental images were visually scored on a 4 (increased tracer uptake) to 0 (severely decreased tracer uptake) scale according to the tracer uptake. In comparison of 123 I-BMIPP early images and 201 Tl perfusion images, mismatches were seen in about 70% of all segments. The number of segments demonstrating lower myocardial uptake of 123 I-BMIPP was larger than that of 201 Tl. In hypertrophic regions, the tracer uptake of 123 I-BMIPP early images was significantly lower than that of 201 Tl images and the lower uptake of 123 I-BMIPP delayed images was more marked. In non-hypertrophic regions, no significant difference was seen between the tracer uptakes of 123 I-BMIPP early images and 201 Tl images but the tracer uptake of 123 I-BMIPP delayed images was significantly lower than that of 201 Tl images. The mismatch between the tracer uptakes of 123 I-BMIPP images and 201 Tl images was thought to be a reflection of disordered myocardial fatty acid metabolism. 'Washout', the difference between the tracer uptakes of 123 I-BMIPP early images and delayed images was also thought to be a reflection of disordered myocardial fatty acid metabolism. These results suggest that 123 I-BMIPP is a promising radiopharmaceutical for evaluating disordered myocardial fatty acid metabolism in patients with HCM. (author)

  4. Human absorbed dose calculations for 123I labeled phenyl pentadecanoic acid

    International Nuclear Information System (INIS)

    Kulkarni, P.V.; Clark, G.; Corbett, J.R.; Willerson, J.T.; Parkey, R.W.

    1986-01-01

    I-123 labeled fatty acids have been proposed for studying myocardial metabolism by scintigraphic methods. With the availability of clean I-123 and the advent of single photon emission tomography, I-123 labeled fatty acids would be well suited to study regional myocardial viability or metabolism in humans. The authors have studied I-125 and I-123 labeled iodophenyl pentadecanoic acid (IPPA) in rats and dogs. Clinical studies are in progress with I-123 (IPPA). They have studied the pharmacokinetics of this tracer in male Sprague-Dawley rats at 0.25, 0.5, 1, 3, 6, and 24 hours postinjection. The cumulated doses, due to both pure I-123 and a version contaminated with 1.4% I-125, in various organs and the total body in humans are estimated. The average dose to organs for humans injected with I-123 IPPA with pure I-123 and contaminated I-123 respectively, are (rads to organ per mCi injected): heart wall (0.0507, 0.0514), liver (0.0792, 0.0875), kidneys (0.0479, 0.0561), thyroid (0.0517, 0.0638), ovaries (0.0427, 0.0561), testes (0.0307, 0.0309), total body (0.0386, 0.0392). 12 references, 9 figures, 5 tables

  5. Effects of [123I]ADAM, a serotonin transporter radiopharmaceutical, on pregnant Sprague–Dawley rats

    International Nuclear Information System (INIS)

    Chang, K.W.; Lin, M.C.; Lee, S.Y.; Chen, H.Y.; Chen, C.C.; Fu, Y.K.

    2012-01-01

    Serotonin transport abnormalities are implicated in neuropsychiatric disorders. [ 123 I]ADAM ([ 123 I]-2-([2-({dimethylamino}methyl)phenyl]thio)-5-iodophenylamine) is a novel radiotracer that targets serotonin transporters. We assessed the toxicity of [ 123 I]ADAM (18.5 MBq) administered in early- and late-phases (8 and 14 day postfertilization, respectively) of pregnancy. The mortality, clinical status, and gross necropsy were measured in pregnant rats, and the fertility index was measured in rat offspring (weight, clinical observations). We found no dosing-related clinical signs. In conclusion, [ 123 I]ADAM was not toxic in an animal pregnancy model.

  6. Decreased myocardial 123I-MIBF uptake in Parkinson's disease

    International Nuclear Information System (INIS)

    Iwasa, K.; Takamori, M.; Nakajima, K.; Taki, J.; Yoshikawa, H.; Tada, A.

    1998-01-01

    We studied myocardial 123 I-metaiodobenzylguanidine (MIBG) accumulation in 12 patients with Parkinson's disease (PD). MIBG is an analog of norepinephrine (NE) and a tracer for sympathetic neuron integrity and function. MIBG uptake of the myocardium was significantly lower in PD than in controls. The heart to mediastinum ratio (H/M) was calculated by using the average count per pixel for the heart and mediastinum. In PD, H/M was lower than in controls (P<0.0001), while the washout ratio of the heart was higher (P<0.001). A decrease in myocardial accumulation of MIBG was observed in the early stage of PD. This suggests that the measurement of MIBF may help the diagnosis of early PD, and the causative factor underlying in PD may be operating the NE neuron as well as dopamine neuron. (au)

  7. FLUX PINNING EFFECTS IN Ag-DOPED YBCO (123 SUPERCONDUCTOR

    Directory of Open Access Journals (Sweden)

    Madelen Pérez

    2010-07-01

    Full Text Available Polycrystalline samples of Ag+-doped YBCO (123 (YBa2 (Cu1-xAgx3O7-δwith 0≤x≤0.3 were produced by solid state reaction method. The Ag- doped YBCO samples showed higher critical current densities (Jc with a Jc maximum for samples doped with x=0.05. This behavior can be assigned to an increase of pinning forces. The irreversibility temperature (Tirr, also increased in doped samples as a function of Ag content, with the highest temperature for the sample doped with x=0.05, wich correlates well with the observed Jc increasing. However, samples doped with x>0.05 displayed a decreasing of electrical properties (less Tirr, less Jc, etc. atributed to an excess of Ag in the grain boundaries which, reduces the grain sizes and increases the number of weak- links.

  8. Quantitative iodine-123 IMP imaging of brain perfusion in schizophrenia

    International Nuclear Information System (INIS)

    Cohen, M.B.; Lake, R.R.; Graham, L.S.

    1989-01-01

    Decreased perfusion in the frontal lobes of patients with chronic schizophrenia has been reported by multiple observes using a variety of techniques. Other observers have been unable to confirm this finding using similar techniques. In this study quantitative single photon emission computed tomography brain imaging was performed using p,5n [ 123 I]IMP in five normal subjects and ten chronically medicated patients with schizophrenia. The acquisition data were preprocessed with an image dependent Metz filter and reconstructed using a ramp filtered back projection technique. The uptake in each of 50 regions of interest in each subject was normalized to the uptake in the cerebellum. There were no significant confirmed differences in the comparable ratios of normal subjects and patients with schizophrenia even at the p = 0.15 level. Hypofrontality was not observed

  9. [(123)I]FP-CIT ENC-DAT normal database

    DEFF Research Database (Denmark)

    Tossici-Bolt, Livia; Dickson, John C; Sera, Terez

    2017-01-01

    quantifications methods, BRASS and Southampton, and explores the performance of the striatal phantom calibration in their harmonisation. RESULTS: BRASS and Southampton databases comprising 123 ENC-DAT subjects, from gamma cameras with parallel collimators, were reconstructed using filtered back projection (FBP......) and iterative reconstruction OSEM without corrections (IRNC) and compared against the recommended OSEM with corrections for attenuation and scatter and septal penetration (ACSC), before and after applying phantom calibration. Differences between databases were quantified using the percentage difference......-camera variability (-0.2%, p = 0.44). CONCLUSIONS: The ENC-DAT reference values are significantly dependent on the reconstruction and quantification methods and phantom calibration, while reducing the major part of their differences, is unable to fully harmonize them. Clinical use of any normal database, therefore...

  10. Improved selectivity for Pb(II) by sulfur, selenium and tellurium analogues of 1,8-anthraquinone-18-crown-5: synthesis, spectroscopy, X-ray crystallography and computational studies.

    Science.gov (United States)

    Mariappan, Kadarkaraisamy; Alaparthi, Madhubabu; Hoffman, Mariah; Rama, Myriam Alcantar; Balasubramanian, Vinothini; John, Danielle M; Sykes, Andrew G

    2015-07-14

    We report here a series of heteroatom-substituted macrocycles containing an anthraquinone moiety as a fluorescent signaling unit and a cyclic polyheteroether chain as the receptor. Sulfur, selenium, and tellurium derivatives of 1,8-anthraquinone-18-crown-5 (1) were synthesized by reacting sodium sulfide (Na2S), sodium selenide (Na2Se) and sodium telluride (Na2Te) with 1,8-bis(2-bromoethylethyleneoxy)anthracene-9,10-dione in a 1 : 1 ratio. The optical properties of the new compounds are examined and the sulfur and selenium analogues produce an intense green emission enhancement upon association with Pb(II) in acetonitrile. Selectivity for Pb(II) is markedly improved as compared to the oxygen analogue 1 which was also competitive for Ca(II) ion. UV-Visible and luminescence titrations reveal that 2 and 3 form 1 : 1 complexes with Pb(II), confirmed by single-crystal X-ray studies where Pb(II) is complexed within the macrocycle through coordinate covalent bonds to neighboring carbonyl, ether and heteroether donor atoms. Cyclic voltammetry of 2-8 showed classical, irreversible oxidation potentials for sulfur, selenium and tellurium heteroethers in addition to two one-electron reductions for the anthraquinone carbonyl groups. DFT calculations were also conducted on 1, 2, 3, 6, 6 + Pb(II) and 6 + Mg(II) to determine the trend in energies of the HOMO and the LUMO levels along the series.

  11. The Present, Mid-Term, and Long-Term Supply Curves for Tellurium; and Updates in the Results from NREL's CdTe PV Module Manufacturing Cost Model (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Woodhouse, M.; Goodrich, A.; Redlinger, M.; Lokanc, M.; Eggert, R.

    2013-09-01

    For those PV technologies that rely upon Te, In, and Ga, first-order observations and calculations hint that there may be resource constraints that could inhibit their successful deployment at a SunShot level. These are only first-order approximations, however, and the possibility for an expansion in global Te, In, and Ga supplies needs to be considered in the event that there are upward revisions in their demand and prices.In this study, we examine the current, mid-term, and long-term prospects of Tellurium (Te) for use in PV. We find that the current global supply base of Te would support <10 GW of annual traditional CdTe PV manufacturing production. But as for the possibility that the supply base for Te might be expanded, after compiling several preliminary cumulative availability curves we find that there may be significant upside potential in the supply base for this element - principally vis a vis increasing demand and higher prices. Primarily by reducing the Tellurium intensity in manufacturing and by increasing the recovery efficiency of Te in Cu refining processes, we calculate that it may prove affordable to PV manufacturers to expand the supply base for Te such that 100 GW, or greater, of annual CdTe PV production is possible in the 2030 - 2050 timeframe.

  12. The effect of aging and smoking on N-isopropyl-p-[123I]iodoamphetamine (123I-IMP) accumulation in the human lung

    International Nuclear Information System (INIS)

    Hara, Masafumi; Tomiguchi, Seiji; Kojima, Akihiro; Nakashima, Rumi; Ooyama, Youichi; Takahashi, Mutsumasa; Matsumoto, Masanori.

    1994-01-01

    123 I-IMP clearance on dynamic lung scintigraphy was studied by two exponential compartments analysis in order to evaluate the effects of aging and smoking on the pulmonary function. Twenty-four patients (14 smokers and 10 non-smokers), referred for 123 I-IMP brain perfusion study, underwent lung dynamic scintigraphy for 42 min immediately after 123 I-IMP injection. In the non-smoking group 123 I-IMP lung clearance was delayed with aging. A significant correlation was found between aging and clearance rate in the lung. There was also a significant difference in the clearance rates between smoker and non-smoker groups. These findings suggest that smoking and aging affect the pulmonary function. (author)

  13. A New Type of Synthesis of 1,2,3-Thiadiazole and 1,2,3-Diazaphosphole Derivatives Via-Hurd-Mori Cyclization

    Directory of Open Access Journals (Sweden)

    Mona A. Hosny

    2012-01-01

    Full Text Available We present a short and efficient synthesis of the title compounds starting with cheap and readily available camphor and derivatives of acetophenone. The optimized sequence allows the large-scale preparation of this new type of synthesis in a few steps. New 1,2,3-thiadiazole and 1,2,3-diazaphosphole derivatives 11-20, were prepared from the ketones 1-5 via the corresponding semicarbazones 6-10. The Hurd-Mori and Lalezari methods were used, respectively, for the preparation of these 1,2,3-thiadiazole and 1,2,3-diazaphospholene derivatives. These derivatives exhibit anticancer effect due to their high potential biological activity.

  14. Clinical evaluation of renal function study using I-123 orthoiodohippurate (I-123 OIH) in patients with obstructive uropathy

    International Nuclear Information System (INIS)

    Okada, Junichi; Uchiyama, Guio; Katsurai, Hiroshi; Uno, Koichi; Uematsu, Sadao.

    1984-01-01

    Functional images and regional renograms using I-123 OIH were evaluated by comparing with patients' clinical courses, intravenous pyelographies and Creatinine clearances. Twenty-one patients with obstructive uropathy were studied. Functional images were processed in three parameters of Tmax, T 1/2 and ERBF (effective renal blood flow). ERBF images were composed of regional counts in early blood flow phase of renograms. Regional renograms were produced on renal parenchyma and pelvis. ERBF images represented the functioning distributions of renal tissue after the surgery and the recoveries in the renal parenchyma. Tmax and T 1/2 images and pelvic regional renograms showed the good correlations with IVP findings which presented the dilatation of pelvis and the delay of excretion. Parenchymal regional renograms showed the poor correlations with Creatinine clearances and caused sometimes errors in ROI settings. The evaluation of renal function only by the parenchymal regional renogram seemed to be inappropriated. (author)

  15. Brain scintigraphy with N-isopropyl [123I] p-iodoamphetamine (123I IMP) in patients with various cerebral diseases

    International Nuclear Information System (INIS)

    Oshibuchi, Masao; Kanda, Teturo; Sato, Mitutaka; Miyagi, Jun; Ohtake, Hisasi; Suhara, Tetuya; Mori, Atuyoshi.

    1988-01-01

    Single photon emission computed tomography(SPECT) with N-isopropyl-p-[ 123 I]-iodoamphet amine(IMP) was utilized in 99 patients with various cerebral diseases and 3 healthy volunteers. By IMP SPECT, demaged area was observed as wider and faster in time than with X-ray CT or MRI. The nidus was visualized as defect of IMP in cases of AVM. In patients with subarachnoid hemorrhage, IMP SPECT was more useful for detecting of post hemorrhagic symptomatic vasospasm compared to X-ray CT or MRI. IMP SPECT was also useful to the differential diagnosis in cases of dementia. Grossed cerebellar diaschisis(CCD) was observed in 26 out of 67 cases (39 %) studied. In epilepsy the low uptake areas of IMP in the bilateral occipital lobes were observed in IMP SPECT. (author)

  16. Iodine-123 metaiodobenzylguanidine scintigraphy and iodine-123 ioflupane single photon emission computed tomography in Lewy body diseases: complementary or alternative techniques?

    Science.gov (United States)

    Treglia, Giorgio; Cason, Ernesto; Cortelli, Pietro; Gabellini, Anna; Liguori, Rocco; Bagnato, Antonio; Giordano, Alessandro; Fagioli, Giorgio

    2014-01-01

    To compare myocardial sympathetic imaging using (123)I-Metaiodobenzylguanidine (MIBG) scintigraphy and striatal dopaminergic imaging using (123)I-Ioflupane (FP-CIT) single photon emission computed tomography (SPECT) in patients with suspected Lewy body diseases (LBD). Ninety-nine patients who performed both methods within 2 months for differential diagnosis between Parkinson's disease (PD) and other parkinsonism (n = 68) or between dementia with Lewy bodies (DLB) and other dementia (n = 31) were enrolled. Sensitivity, specificity, accuracy, positive and negative predictive values of both methods were calculated. For (123) I-MIBG scintigraphy, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 83%, 79%, 82%, 86%, and 76%, respectively. For (123)I-FP-CIT SPECT, the overall sensitivity, specificity, accuracy, positive and negative predictive values in LBD were 93%, 41%, 73%, 71%, and 80%, respectively. There was a statistically significant difference between these two methods in patients without LBD, but not in patients with LBD. LBD usually present both myocardial sympathetic and striatal dopaminergic impairments. (123)I-FP-CIT SPECT presents high sensitivity in the diagnosis of LBD; (123)I-MIBG scintigraphy may have a complementary role in differential diagnosis between PD and other parkinsonism. These scintigraphic methods showed similar diagnostic accuracy in differential diagnosis between DLB and other dementia. Copyright © 2012 by the American Society of Neuroimaging.

  17. Myocardial turnover rates of I-123 heptadecanoic acid (HDA) and I-123 p-phenylpentadecanoic acid (pIPPA)

    International Nuclear Information System (INIS)

    Dudczak, R.; Kletter, K.; Frischauf, H.; Schmoliner, R.; Derfler, K.; Losert, U.

    1982-01-01

    To improve data interpretation an extended data acquisition is proposed for myocardial studies with I-123 labeled fatty acids. Its feasibility was tested after intracoronary bolus injection of HDA in calves (n=3), and in patients after intravenous HDA or pIPPA application. Patients comprised 17 with coronary artery disease (HDA/14, pIPPA/3), 8 controls (HDA/6, pIPPA/2), and 2 cardiomyopathies (pIPPA). To prove the hypothesis that HDA reveals information on myocardial fatty acid metabolism, we examined if its elimination behaviour can be influenced by pharmacological interventions. In repeated studies in calves the influence of 4 hour halothan anesthesia, and in 4 patients the impact of insulin - glucose (I-G) infusion on the myocardial count rate was evaluated. The myocardial time activity curve was biexponential in animals and patient studies. With the assumption of a two compartment model the data seem to fit in known facts on myocardial fatty acid utilisation. It is demonstrated that pharmacological interventions as well as a diminished blood supply exert definite influence on turnover rates of I-123 labeled fatty acids. Anesthesia delayed HDA consumption. Infusion of I-G abolished ν oxidation while esterification of HDA proceeds. Turnover rates of HDA and pIPPA were both prolonged in ischemic as compared to normal myocardium. This finding supports the assumption of an impaired fatty acid utilisation in the diseased heart. By compartmental analysis the relative amount of fatty acids which are incorporated into neutral lipids can be estimated, but their increase in diseased myocardium was not always accompanied by changes in the ratio of ν oxidation. For studies of myocardial fatty acid metabolism HDA as well as pIPPA can be used as indicators, whose significance can be enhanced by extended data acquisition. (Author)

  18. Cerebral emission computer tomography with a rotating gamma camera: clinic results with J-123 Isopropylamphetamin and J-123-Fenetyllin

    International Nuclear Information System (INIS)

    Biersack, H.J.; Hartmann, A.; Froescher, W.; Reske, S.-N.; Reichmann, K.; Knopp, R.; Winkler, C.

    1984-01-01

    Many amines can pass the blood brain barrier and accumulate in relatively large amounts in the brain tissue. For about 2 years 123-J amphetamines have, therefore, been used for brain imaging by several teams. Our experience sofar is based on 28 patients. Of these, 14 were epileptics, 10 had cerebrovascular diseases, 2 suffered from migraine and another 2 had brain tumors. In 3 patients with vascular lesions studies were repeated twice or three times. Amphetamine uptake in the brain was measured with a rotating gamma camera system (Gammatome T9000/CGR). At an examination time of 20 minutes 64 frames were acquired during one full rotation. The pulse rate was about 3000 second after injecting 6.5 mCi of 123-J amphetamine. Of the epileptics, 8 showed defects both on CT and SPECT, in 3 cases both studies were normal. While 1 patient with CT positivity had a normal SPECT, 2 cases were found to have lesions on SPECT inspite of a normal CT. The size of the lesion seen on amphetamine SPECT was lager than on CT in 3 of 9 patients. In the 10 patients with cerebrovascular lesions the 2 procedures showed concordant normal patterns in 1 and concordant abnormal patterns in 7 instances. 2 patients with normal CT were found to have a lesion on amphetamine scanning which corresponded to the neurologic findings. Regarding the size of the lesions, SPECT showed a more extensive involvement than CT in 2 cases. This again was in good agreement with the neurologic findings. Inspite of repeat studies cerebellar diaschisis was only seen in a single case with healed cerebral infarction and hemiplegia of some years' standing. Two patients suffered from migraine and compromised blood flow was identified as suggested by the neurologic findings inspite of a normal CT. (Author)

  19. Microautoradiography of [{sup 123}I]ADAM in mice treated with fluoxetine and serotonin reuptake inhibitors

    Energy Technology Data Exchange (ETDEWEB)

    Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J. E-mail: jjhwang@ym.edu.tw

    2004-07-01

    A radiopharmaceutical, {sup 123}I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([{sup 123}I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [{sup 123}I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [{sup 123}I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [{sup 123}I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [{sup 123}I]ADAM. Significant and selective accumulation of [{sup 123}I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [{sup 131}I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [{sup 123}I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine.

  20. Microautoradiography of [123I]ADAM in mice treated with fluoxetine and serotonin reuptake inhibitors

    International Nuclear Information System (INIS)

    Ye, X.-X.; Chen, J.-C.; Liu, R.-S.; Wey, S.-P.; Lee, J.-S.; Chen, C.-C.; Fu, Y.-K.; Ting, Gann; Hwang, J.-J.

    2004-01-01

    A radiopharmaceutical, 123 I-labeled 2-((2-((dimethylamino)methyl)phenyl)thio)-5-iodophenylamine ([ 123 I]ADAM), has been developed recently for evaluation of how serotonin transporters (SERT) function in the brain. However, the detailed biodistribution and specific binding in certain brain areas are not well investigated. In this study, both phosphor plate imaging and microautoradiography were applied to explore the binding characteristics of [ 123 I]ADAM in SERT neurons. The effect of two psychotropics and one narcotic on the binding of [ 123 I]ADAM to SERT was also studied. Fluoxetine and desipramine, both are psychotropics and specific SERT ligands and decreased the affinity of [ 123 I]ADAM, while p-chloroamphetamine (PCA), a narcotic, destroyed most of serotonergic neurons, as well as reducing the concentration of serotonin and the number of SERT in the brain as shown by the biodistribution of [ 123 I]ADAM. Significant and selective accumulation of [ 123 I]ADAM in the areas from midbrain to brain stem in normal mice with maximum target-to-background ratio was found at 90 minutes postinjection. A rapid clearance of [ 131 I]ADAM at 120 minutes postinjection was found in the CA1, CA3 and ThN brain areas. In addition, the inhibition effect on binding ability of [ 123 I]ADAM to SERT by the psychotropics and the narcotic was found to have the order of: PCA > fluoxetine > desipramine

  1. 13 CFR 123.200 - Am I eligible to apply for a physical disaster business loan?

    Science.gov (United States)

    2010-01-01

    ..., corporation, limited liability company, or other legal entity recognized under State law. Your business' size... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Am I eligible to apply for a physical disaster business loan? 123.200 Section 123.200 Business Credit and Assistance SMALL BUSINESS...

  2. 45 CFR 46.123 - Early termination of research support: Evaluation of applications and proposals.

    Science.gov (United States)

    2010-10-01

    ... of applications and proposals. 46.123 Section 46.123 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROTECTION OF HUMAN SUBJECTS Basic HHS Policy for Protection of Human... rights and welfare of human subjects (whether or not the research was subject to federal regulation). ...

  3. 21 CFR 516.123 - Informal conferences regarding agency administrative actions.

    Science.gov (United States)

    2010-04-01

    ... exemption, determining that a qualified expert panel does not meet the selection criteria, denying a request... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Informal conferences regarding agency administrative actions. 516.123 Section 516.123 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH...

  4. 7 CFR 28.123 - Costs of practical forms of cotton standards.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Costs of practical forms of cotton standards. 28.123 Section 28.123 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE COMMODITY STANDARDS AND STANDARD...

  5. Synthesis and binding to striatal membranes of non carrier added I-123 labeled 4'-iodococaine

    International Nuclear Information System (INIS)

    Metwally, S.A.M.; Gatley, S.J.; Wolf, A.P.; Yu, D.-W.

    1992-01-01

    An 123 I labeled cocaine analog, 4'-[ 123 I]iodococaine, has been prepared by oxidative destannylation of the tributyltin analog and shown to interact with cocaine binding sites in rat brain striatal membranes. It may thus be a suitable SPECT radiotracer for studies of the dopamine reuptake site in neurodegenerative diseases. (Author)

  6. Diagnostic performance of I-123-labeled serum amyloid P component scintigraphy in patients with amyloidosis

    NARCIS (Netherlands)

    Hazenberg, BPC; van Rijswijk, MH; Piers, DA; Lub-de Hooge, MN; Vellenga, E; Haagsma, EB; Hawkins, PN; Jager, PL

    Purpose: To assess the diagnostic accuracy and additional information provided by I-123-labeled serum amyloid P component ( SAP) scintigraphy in patients with systemic and localized amyloidosis. Subjects and Methods: I-123-labeled human SAP was injected intravenously into 20 controls and 189

  7. 13 CFR 123.11 - Does SBA require collateral for any of its disaster loans?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Does SBA require collateral for any of its disaster loans? 123.11 Section 123.11 Business Credit and Assistance SMALL BUSINESS...? Generally, SBA will not require that you pledge collateral to secure a disaster home loan or a physical...

  8. Iodine-123 and bromine-75 production and development program at Juelich

    International Nuclear Information System (INIS)

    Stoecklin, G.

    1985-01-01

    The iodine-123 and bromine-75 production and development program at the Nuclear Research Center in Juelich as of 1982 is described, and examples of recent 123 I- and 75 Br-analogue tracers that have been developed to the level of clinical trial are given. Iodine-123 is produced via the 127 I(d,6n) 123 Xe → 123 I process and by the 124 Te(p,2n) 123 I and 122 Te(d,n) 123 I reactions. These production methods are critically reviewed. Bromine-75-labeled benzodiazenes have been prepared for in vivo mapping of benzodiazepine receptor sites. The 7-( 75 Br)-5-(2-fluorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepine-2-one (BFB) was prepared with a specific activity of > 10 4 Ci/mmole. Finally, preparation and applications of the halogenated amino acid L-3-( 123 I)-iodo-α-methyltyrosine (IMT) and the analogous 75 Br compound (BMT) are reported. Both IMT and BMT have been successfully applied for pancreas imaging and tomography, and IMT has been used for imaging both melanotic and amelanotic malignant melanoma of the eye

  9. 47 CFR 69.123 - Density pricing zones for special access and switched transport.

    Science.gov (United States)

    2010-10-01

    ... switched transport. 69.123 Section 69.123 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... for special access and switched transport. (a)(1) Incumbent local exchange carriers not subject to... at least 15 percent of that carrier's special access and transport revenues within that study area...

  10. 19 CFR 123.27 - Feeding and watering animals in Canada.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Feeding and watering animals in Canada. 123.27...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Shipments in Transit Through Canada or Mexico § 123.27 Feeding and watering animals in Canada. If animals in sealed conveyances or compartments...

  11. Reproducibility of [123I]PE2I binding to dopamine transporters with SPECT

    DEFF Research Database (Denmark)

    Ziebell, Morten; Thomsen, Gerda; Knudsen, Gitte M

    2007-01-01

    The iodinated cocaine derivative [(123)I]PE2I is a new selective ligand for in vivo studies of the dopamine transporter (DAT) with SPECT. Recently, a bolus/infusion (B/I) protocol for [(123)I]PE2I measurements of DAT density was established [Pinborg LH et al. J Nucl Med 2005;46:1119-271]. The aims...

  12. 19 CFR 123.63 - Examination of baggage from Canada or Mexico.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Examination of baggage from Canada or Mexico. 123...; DEPARTMENT OF THE TREASURY CUSTOMS RELATIONS WITH CANADA AND MEXICO Baggage § 123.63 Examination of baggage from Canada or Mexico. (a) Opening vehicle or compartment to examine baggage. Customs officers are...

  13. Thallium-201 diethyldithiocarbamate: an alternative to iodine-123 N-isopropyl-p-iodoamphetamine

    NARCIS (Netherlands)

    de Bruine, J. F.; van Royen, E. A.; Vyth, A.; de Jong, J. M.; van der Schoot, J. B.

    1985-01-01

    The study of cerebral blood flow by single photon emission computed tomography (SPECT) requires lipophilic radiopharmaceuticals. The high cost and limited availability of N-isopropyl-p-[I-123]-iodoamphetamine ( [123I]IMP) led us to search for alternatives. Following our recent development of

  14. 29 CFR 825.123 - Unable to perform the functions of the position.

    Science.gov (United States)

    2010-07-01

    ... position within the meaning of the Americans with Disabilities Act (ADA), as amended, 42 U.S.C. 12101 et... 29 Labor 3 2010-07-01 2010-07-01 false Unable to perform the functions of the position. 825.123... Act § 825.123 Unable to perform the functions of the position. (a) Definition. An employee is “unable...

  15. 40 CFR 89.123 - Amending the application and certificate of conformity.

    Science.gov (United States)

    2010-07-01

    ... certificate of conformity. 89.123 Section 89.123 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... of conformity. (a) The manufacturer of nonroad compression-ignition engines must notify the... be made to a product line covered by a certificate of conformity. This notification must include a...

  16. Feasibility of dual radionuclide brain imaging with I-123 and Tc-99m

    International Nuclear Information System (INIS)

    Ivanovic, M.; Weber, D.A.; Loncaric, S.; Franceschi, D.

    1994-01-01

    A study was conducted to evaluate the feasibility of simultaneous dual radionuclide brain imaging with 123 I and 99m Tc using photopeak image subtraction techniques or offset photopeak image acquisition. The contribution of the photons from one radionuclide to a second radionuclide's photopeak energy window (crosstalk) was evaluated for SPECT and planar imaging of a brain phantom containing 123 I and 99m Tc for a range of activity levels and distribution properties approximating those in rCBF images of the adult human brain. Crosstalk was evaluated for 10% symmetrical energy windows centered on the 123 I and 99m Tc photopeaks and for 10% energy windows asymmetrically placed to the left and right of the center of the respective photopeaks. It was observed that the centered photopeak windows, 99m Tc crosstalk in the 123 I window is 8.9% of the 99m Tc seen in the 99m Tc window and ranges from 37.5% to 75.0% of the 123 I in the 123 I window. 123 I crosstalk is 37.8% of the 123 I seen in the 123 I window and ranges from 4.4% to 8.9% of the 99m Tc seen in the 99m Tc window. The spatial distribution of a radionuclide's crosstalk photons differs from that observed in the radionuclide's photopeak window. A 99m Tc photopeak window offset to the left does not decrease 123 I crosstalk, and the percentage of 99m Tc scattered photons is significantly increased in the window. Offsetting the 123 I window to the right decreases 99m Tc crosstalk to 9.0% to 17.9% of the 123 I counts, but decreases 123 I sensitivity by 39.9%. Offsetting both photopeak windows to the right decreases the 99m Tc scattered photons in the 99m Tc window, but increases 123 I crosstalk to 17.0% to 33.8% of the 99m Tc counts

  17. Preparation of [123I]- and [125I]epidepride: a dopamine D-2 receptor antagonist radioligand

    International Nuclear Information System (INIS)

    Clanton, J.A.; Schmidt, D.E.; Ansari, M.S.; Manning, R.G.; Kessler, R.M.; Paulis, T. de; Vanderbilt Univ., Nashville, TN; Baldwin, R.M.

    1991-01-01

    (S)-(-)-N-[(1-ethyl-2-pyrrolidinyl)methyl]-5-[ 123 I] iodo-2,3-dimethoxybenzamide (TDP 517) (proposed generic name, [ 123 I]epidepride) is the iodine-123 substituted analogue of isoremoxipride (FLB 457), both of which are very potent dopamine D-2 antagonists (epidepride K D 0.024 nM). [ 123 I] Epidepride was radioiodinated in 60-70% radiochemical yields in 35 min from the corresponding 5-(tributyltin) derivative using Na 123 I with a specific radioactivity of 3000 Ci/mmol, and oxidized in situ with chloramine-T. The aryltin precursor was prepared from non-labelled epidepride by palladium-catalyzed stannylation using bis(tri-n-butyltin) in triethylamine. Alternatively, using no carrier-added Na 125 I as the radioisotope, [ 125 I] epidepride at 2000 Ci/mmol specific radioactivity was prepared in 86% radiochemical yield and 99% radiochemical purity after purification by reverse phase HPLC in ethanolic phosphate buffer. (author)

  18. Radiosynthesis of 123I-labeled hesperetin for biodistribution study of orally administered hesperetin

    International Nuclear Information System (INIS)

    Jongho Jeon; So-Young Ma; Dae Seong Choi; Beom-Su Jang; Jung Ae Kang; You Ree Nam; Seonhye Yoon; Sang Hyun Park; Korea University of Science and Technology, Daejeon

    2015-01-01

    The purpose of this study is to synthesize 123 I-labeled hesperetin and to investigate its in vivo behavior. The optimized labeling condition provided two isomers of 123 I-labeled hesperetin with high radiochemical yields and radiochemical purities. Both 123 I-labeled products were orally administered to normal ICR mice, and the initial result showed that most of 123 I activity was detected in the stomach and the intestines. A part of 123 I-labeled hesperetin was absorbed from the small intestine to bloodstream and then it was distributed in normal organs. The results in the present study provided an efficient radiolabeling method of flavonoid and quantitative organ distribution of orally administered hesperetin. (author)

  19. Brain SPECT with 123I-Lisurid in patients with Parkinson's disease and in controls

    International Nuclear Information System (INIS)

    Hierholzer, J.; Cordes, M.; Schelosky, L.; Richter, W.; Schrag, A.; Poewe, W.; Schulze, P.E.; Semmler, W.; Eichstaedt, H.; Felix, R.

    1995-01-01

    The goal was to visualize cerebral dopamine-D 2 receptors in 6 patients with Parkinson's disease and in 3 healthy controls using iodine-123-Lisuride-SPECT. In addition, we performed receptor-replacement studies using 123 I-Lisuride and cold Lisuride as competitive ligands. The highest uptake of 123 I-Lisuride was observed in the striatum, a region with known high dopamine receptor density. In two patients premedication with cold Lisuride displaced 123 I-Lisuride from the dopamine receptor. 123 I-Lisuride is valuable as a radiotracer in cerebral dopamine-D 2 receptor scintigraphy. Whether or not it is possible to determine dynamic changes of dopamine receptor density or function by receptor replacement studies needs further evaluation in larger patient populations. (orig.) [de

  20. Study of {sup 124} I contamination in {sup 123} I used in medical applications

    Energy Technology Data Exchange (ETDEWEB)

    El-Samman, H [Faculty of Science, Menoufia University, Shibin El-Kom (Egypt); Arafa, W [Physics Department, Faculty of Women, Ain Shams University, Cairo (Egypt)

    1997-12-31

    The decay of 0.2 mCi capsules of iodide ({sup 123} I) used for diagnostic purpose and delivered to hamad hospital in Qatar, was studied using HPGe detector of (30% efficiency and 1.8 KeV energy resolution), coupled to a computer based 4096 multichannel analyzer. The acquisition parameters were controlled by computer program. The gamma spectra were analyzed using well developed gamma spectrum analysis program gamanl. Results showed that the isotope used is not pure {sup 123} I but it is a mixture of {sup 123} I and {sup 124} I. The percentage of the unwanted {sup 124} I isotope was estimated to be 15%. The dose taken by the patient due to the unwanted {sup 124} I isotope was estimated. Half-lives time of the {sup 123} I and {sup 123} I isotopes were determined with high accuracy and compared to the published values. 3 tabs.

  1. Clinical application of iodine 123 with special consideration of radionuclide purity, measuring accuracy and radiation dose

    International Nuclear Information System (INIS)

    Hermann, H.J.; Ammon, J.; Winkel, K. zum; Haubold, U.

    1975-01-01

    Iodine 123 is a nearly 'ideal' radionuclide for thyroid imaging. The production of Iodine 123 requires cyclotrons or accelerators. The production of multicurie amounts of Iodine 123 has been suggested through the use of high-energy accelerators (> 60 MeV). Most of the methods for the production of Iodine 123 using a compact cyclotron result in contamination with f.e. Iodine 124 which reduces the spatial resolution of imaging procedures and increases the radiation dose to the patient. The radiation dose has been calculated for three methods of production. The various contamination with Iodine 124, Iodine 125 and Iodine 126 result in comparable radiation dose of Iodine 131, provided that the time between production and application is more than four half-live-times of Iodine 123. (orig.) [de

  2. Clinical applications of brain spect with N-isopropyl-123I-p-iodoamphetamine

    International Nuclear Information System (INIS)

    Moretti, J.L.; Sergent, A.; Raynaud, C.; Baron, J.C.; Samson, Y.; Lassen, N.; Bourdoiseau, M.

    1985-01-01

    Single-photon emission computed tomography (SPECT) with N-isopropyl- 123 I-p-iodoamphetamine (IAMP-I-123) was used for 250 patients suffering from brain disorders, comprising brain tumours (36), normal-pressure hydrocephalus (NPH) (23), cerebrovascular pathologies (127) and partial epilepsy (64). Brain tumours were found to be hypoactive, whatever the grade and nature. Frontal hypoactivity was found in NPH patients, and IAMP-I-123 perfusion was improved after cerebral spinal fluid (CSF) lumbar drainage, giving a good predictive criterion of clinical outcome after CSF diversion. For cerebrovascular disorders, it was possible to obtain with IAMP-I-123 SPECT larger pictures of hypoactive areas than the pictures of hypodense lesions obtained with X-ray CT scans; other hypoactive areas that could not be observed with CT were also delineated by IAMP-I-123 SPECT. The hypoactive areas found in constituted infarctions can present two types of kinetics - those which are 'persistent' (still present on delayed scans performed 5 h after IAMP-I-123 injection) and those which disappear with time, thereby suggesting hypofunctional parenchyma without tissue impairment. IAMP-I-123 SPECT was proved to be useful in assessing ischaemia, especially in reversible ischaemia patients, by defining the affected arterial territory and guiding complementary arteriographic exploration in view of surgical procedures. IAMP-I-123 SPECT was able to accurately delineate the affected parenchymal areas. It could also be of help in the follow-up of the efficiency of drug therapy and surgery, and it can be regarded as a good predictive criterion for stroke rehabilitation. The results obtained with IAMP-I-123 indicate that the lesional and epileptogenic areas in epileptic patients are hypoactive. The localization of these territories by IAMP-I-123 SPECT correlates well with other, more accurate, neuroradiological and stereotactic techniques. (author)

  3. Clinical significance of I-123 IMP brain SPECT in children with brain diseases

    International Nuclear Information System (INIS)

    Takishima, Teruo; Machida, Kikuo; Honda, Norinari; Mamiya, Toshio; Takahashi, Taku; Kamano, Tsuyoshi; Hasegawa, Noriko

    1990-01-01

    Single photon emission computed tomography (SPECT) of the brain using N-isopropyl p-I-123-iodoamphetamine (I-123 IMP) was performed in 43 children with suspected brain diseases. Forty-three children (25 males and 18 females), with an age range of 24 days-15 years (mean: 6.6 years), were included in the study. Six patients were subsequently diagnosed as normal. Early SPECT of the brain was performed 30 minutes after intravenous administration of 74-111 MBq (2-3 mCi) I-123 IMP using a rotating gamma camera equipped with a 30-degree slant hole and medium energy collimator. Transverse images were reconstructed by Shepp-Logan filtered back projection method with attenuation correction after spatial filtering using an 8th order Butterworth-Wiener filter. Findings of I-123 IMP SPECT were compared with those of X-ray computed tomography (CT) and electroencephalography (EEG). The results showed that in I-123 IMP SPECT, abnormality was found in 30 out of 37 children with brain diseases. The incidence of abnormal findings in the 37 patients was 81% in I-123 IMP SPECT, 61% in X-ray CT, and 78% in EEG; in both cryptogenic and secondary epilepsy, the incidence of abnormality was higher in I-123 IMP SPECT than in X-ray CT. (70% and 94% vs 50% and 81% respectively), and epileptic foci detected by EEG did not correspond with defects found using I-123 IMP SPECT in 27% of the patients; and in asphyxiated infants, a high incidence of abnormality was observed on both I-123 IMP SPECT (86%) and X-ray CT (86%). In conclusion, I-123 IMP SPECT is a clinically useful examination in children with brain disease. (author)

  4. Diagnosis of pheochromocytoma using (123I)-compared with (131I)-metaiodobenzylguanidine scintigraphy

    International Nuclear Information System (INIS)

    Furuta, Nozomu; Kiyota, Hiroshi; Yoshigoe, Fukuo; Hasegawa, Norio; Ohishi, Yukihiko

    1999-01-01

    Patient with pheochromocytoma (PCT) cannot be cured without operation, therefore, preoperative determination of the localization of PCT should be performed accurately. ( 131 I)-Metaiodobenzylguanidine (MIBG) scintigraphy is a gold standard for the diagnosis of PCT. However, ( 123 I)-MIBG is also found to accumulate in PCT. In order to clarify the usefulness of ( 123 I)-MIBG scintigraphy for the local detection of PCT, we compared the distribution of ( 123 I)- and ( 131 I)-MIBG in patients with or without PCT. ( 131 I)- and ( 123 I)-MIBG scintigraphy was performed in 29 and 16 patients, respectively. In the former group, 14 patients had PCT, 12 had hypertension without any adrenal disorder and three had other diseases. In the latter group, eight patients had PCT, two had hypertension without any adrenal disorder and six had other diseases. The sensitivity, specificity and accuracy of ( 123 I)- with ( 131 I)-MIBG scintigraphy were compared. The sensitivity of ( 131 I)- and ( 123 I)-MIBG scintigraphy was 85.7 and 90%, respectively. The specificity of each test was 100%. The accuracy of ( 131 I)- and ( 123 I)-MIBG scintigraphy was 93.1 and 95%, respectively. The quality of images obtained using ( 123 I)-MIBG was better than with ( 131 I)-MIBG, because ( 123 I)-MIBG generated a higher dose of γ-rays with a higher specificity than ( 131 I)-MIBG. In addition, normal adrenal grands were visualized in 50% of patients tested with ( 123 I)-MIBG scintigraphy. These results indicate that ( 123 I)-MIBG scintigraphy is a valuable tool for the local detection of PCT, as is ( 131 I)-MIBG scintigraphy. Furthermore, it is possible that ( 123 I)-MIBG can be used as an alternative to ( 131 I)-MIBG for the detection of PCT. Our study was not a prospective study and the background of the patients was not matched. Further prospective studies are needed in order to determine the efficacy of ( 123 I)-MIBG scintigraphy for the diagnosis of PCT. (author)

  5. Transformation and biodegradation of 1,2,3-trichloropropane (TCP).

    Science.gov (United States)

    Samin, Ghufrana; Janssen, Dick B

    2012-09-01

    1,2,3-Trichloropropane (TCP) is a persistent groundwater pollutant and a suspected human carcinogen. It is also is an industrial chemical waste that has been formed in large amounts during epichlorohydrin manufacture. In view of the spread of TCP via groundwater and its toxicity, there is a need for cheap and efficient technologies for the cleanup of TCP-contaminated sites. In situ or on-site bioremediation of TCP is an option if biodegradation can be achieved and stimulated. This paper presents an overview of methods for the remediation of TCP-contaminated water with an emphasis on the possibilities of biodegradation. Although TCP is a xenobiotic chlorinated compound of high chemical stability, a number of abiotic and biotic conversions have been demonstrated, including abiotic oxidative conversion in the presence of a strong oxidant and reductive conversion by zero-valent zinc. Biotransformations that have been observed include reductive dechlorination, monooxygenase-mediated cometabolism, and enzymatic hydrolysis. No natural organisms are known that can use TCP as a carbon source for growth under aerobic conditions, but anaerobically TCP may serve as electron acceptor. The application of biodegradation is hindered by low degradation rates and incomplete mineralization. Protein engineering and genetic modification can be used to obtain microorganisms with enhanced TCP degradation potential.

  6. Pressure-frozen 1,2,3-trichloropropane.

    Science.gov (United States)

    Podsiadło, Marcin; Katrusiak, Andrzej

    2006-12-01

    The structure of 1,2,3-trichloropropane, ClCH2CHClCH2Cl, in-situ crystallized in a diamond-anvil cell, has been determined by single-crystal X-ray diffraction at 0.28 and 0.35 GPa. A melting point at 295 K and 0.22 GPa has been determined. The molecular conformation of aliphatic chain and terminal Cl atoms is approximately C2 symmetric. Of the intermolecular contacts, the tightest are the Cl...Cl and then the Cl...H contacts, whereas the H...H distances are considerably longer than the sum of the van der Waals radii and leave narrow voids in the structure. The elevated pressure reduces the H...H separations but hardly affects the Cl...Cl distances. The crystal growth rates, compression and types of intermolecular interactions in the structures can be correlated with the directions of the Cl...Cl contacts, which can be considered the main motif responsible for the molecular arrangement in the structure.

  7. Adrenocortical Carcinoma: False Positive in an I-123 Metaiodobenzylguanidine Scan

    Energy Technology Data Exchange (ETDEWEB)

    Rey, Cristina Rodriguez; Candil, Aida Ortega; Galvan, Eliseo Vano; Martin, Maria Nieves Cabrera; Delgado, Jose Luis Carreras [Clinico San Carlos Hospital, Madrid (Spain)

    2016-06-15

    A 55-year-old man with a personal his history of left pheochromocytoma 2 years previously presented with an abdominal ultrasound showed a large left upper quadrant solid mass (calipers), with heterogeneous echogenicity and central cystic degeneration areas or necrosis. F-18 Fluorodeoxyglucose (FDG) positron emission tomography (PET)/CT was performed as ACC was suspected. ACC is an uncommon malignant neoplasm of unknown cause; however, smoking and oral contraceptives may be risk factors. Patients usually present with advanced-stage disease and have poor prognosis, with a 2-year recurrence rate that ranges form 73 to 86 %. An MIBG scan was performed after injection of 185 MBq of I-123 MIBG intravenously. Single photon emission tomography (SPECT)/CT scan showed abnormal isotope accumulation in the tumor region. The patient underwent total resection of the tumor. The histology was of ACC, with areas of necrosis and cystic areas, so the result of the MIBG scan was a false positive. Authors divided false-positive MIBG studies into three categories. The first category is neuroendocrine lesions other than pheochromocytomas (tumors of the APUD series). the second category consists in adrenal lesions other than pheochromocytomas (adenomas, ACC) the reasons for this abnormal uptake are unclear. The third category consists of tracer uptake adjacent to the adrenal due to abnormalities in the route of excretion.

  8. Peripheral giant cell granuloma: A review of 123 cases

    Directory of Open Access Journals (Sweden)

    Niloofar Shadman

    2009-01-01

    Full Text Available Background: Peripheral giant cell granuloma is one of the reactive hyperplastic lesions of the oral cavity, which originates from the periosteum or periodontal membrane following local irritation or chronic trauma. The purpose of this study was to present the clinical characteristics of peripheral gi-ant cell granuloma in a group of Iranian population. Methods: A series of 123 consecutive confirmed cases of peripheral giant cell granuloma after biopsy were evaluated. Age, sex, anatomic location, consistency, etiologic factor, pain and bleeding history, color, surface texture, and pedicle situation were recorded and were analyzed by chi-square test and values were considered to be significant if P < 0.05. Results: Age ranged from 6 to 75 years (mean 33 years. Women affected more than men (M/F 1:1.1. Peripheral giant cell granuloma was seen in the mandible more than in the maxilla and in the anterior region more than in the posterior region. In most cases, lesions were pink, pedunculated and had non-ulcerated surface. In less than half of the cases, there was no history of bleeding and also pain was rarely reported. Calculus was the most common etiologic factor. Conclusion: The results confirmed that the clinical features of peripheral giant cell granuloma in a group of Iranian population are almost similar to those reported by other investigators.

  9. Compton profile with synchrotron light - application to Y-123 superconductivity

    International Nuclear Information System (INIS)

    De, Udayan

    2005-01-01

    Electron beam accelerated to 6 GeV in the European Synchrotron Radiation Facility (ESRF) at Grenoble, France, can deliver highly mono-energetic, intense (10 12 photons/sec at sample at 100 mA ring current) and fine photon beam reaching x-ray and γ energies. So photons of 57 keV from this synchrotron has been used for Compton Profile or CP experiment (at different temperatures down to 70 K) on our YBa 2 Cu 3 O 7 or Y-123 single crystals with T c = 91 K. Photons, Compton scattered even at a definite angle, θ, show a distribution (called Compton Profile) of energy and hence of momentum reflecting the EMD or electron momentum distribution in the solid. The temperature variation of S-parameter, defined as the fraction of low momentum electrons, has been found from preliminary CP data. It confirmed the surprising double minimum found from Doppler broadening of positron annihilation radiation lineshape (DBPARL). The CP set-up at the synchrotron including the detectors and cryogenics as well as the new results are outlined. (author)

  10. I-123 Iofetamine SPECT scan in children with neurological disorders

    International Nuclear Information System (INIS)

    Flamini, J.R.; Konkol, R.J.; Wells, R.G.; Sty, J.R.

    1990-01-01

    I-123 Iofetamine (IMP) single photon emission computed tomography (SPECT) imaging of the brain in 42 patients (ages 14 days to 23 years) was compared with other localizing studies in children with neurological diseases. All had an EEG and at least one imaging study of the brain (computed tomography (CT) or magnetic resonance imaging (MRI), or both). Seventy-eight percent of the patients had an EEG within 24-72 hours of the IMP-SPECT scan. Thirty-five (83%) had a history of seizures, and the remainder had other neurological conditions without a history of seizures. In most cases, a normal EEG reading with normal CT or MRI result predicted a normal SPECT study. When the EEG was abnormal the majority of the IMP-SPECT scans were abnormal and localized the abnormality to the same region. A comparison with CT and MRI showed that structural abnormalities involving the cortex were usually well demonstrated with IMP-SPECT imaging. Structural lesions confined to the white matter were generally not detectable with IMP-SPECT. In a few cases, SPECT scans revealed abnormalities in deep brain areas not identified by EEG. IMP-SPECT imaging is a valuable technique for the detection and localization of abnormal cerebral metabolic activity in children with seizure disorders. A correlation with CT or MRI is essential for proper interpretation of abnormalities detected with IMP SPECT imaging

  11. Dynamic low dose I-123-iodophenylpentadecanoic acid metabolic cardiac imaging

    International Nuclear Information System (INIS)

    Murray, G.L.; Magill, H.L.; Schad, N.C.

    1993-01-01

    Recognition of stunned and hibernating myocardium is essential in this era of cardiac revascularization. Positron emission tomography (PET) accurately identifies viability but is costly and unavailable to most patients. Dynamic low dose I-123-iodophenylpentadecanoic acid (IPPA) metabolic cardiac imaging is a potentially cost-effective alternative to PET. Using transmural myocardial biopsies obtained during coronary bypass surgery as the viability gold standard, resting IPPA imaging agreed with 39/43 (91%) biopsies, with a sensitivity for viability of 33/36(92%) and a specificity of 6/7 (86%) in patients with severe ischemic cardiomyopathy. Eighty percent of IPPA viable, infarcted segments improved wall motion postoperatively. Furthermore, when compared to reinjection thallium (SPECT-Tl) scans after myocardial infarction, there was IPPA-Tl concordance in 27/35 (77%)(Kappa=0.536, p=0.0003). Similar to PET, IPPA demonstrated more viability than SPECT-Tl, 26/35 (74%) vs. 18/35 (51%)(p=0.047). Finally, when compared to transvenous endomyocardial biopsy for detecting rejection following cardiac transplantation, IPPA sensitivity for ≥Grade II rejection was 100%, and IPPA screening assessment for the necessity of biopsy could result in a 31% cost-savings. Therefore, IPPA metabolic cardiac imaging is a safe, inexpensive technique with a promising future. (author)

  12. 123I-IMP-SPECT in vascular dementia

    International Nuclear Information System (INIS)

    Namura, Yasuhiro; Miyoshi, Toshihiko; Shio, Hideo; Yamaguchi, Shinya; Kimura, Jun

    1990-01-01

    Cerebral blood flow (CBF) was studied by N-isopropyl-p- 123 I-iodoamphetamine (IMP)-single photon emission computed tomography (SPECT) in patients with vascular dementia. Patients were divided by CT/MRI findings into multiple or localized type and cortical or subcortical type. Of patients with multiple lesions in the cortex, the reduction of CBF was noted in several cortex corresponding to CT/MRI findings. Patients in this group had a high incidence of aphasia, agraphia, dyscalculia, and amnesia. Patients with multiple lesions in the white matter and basal ganglia were subdivided into 3 groups by clinical manifestations. CBF in those with dementia showed generalized reduction in all cerebral cortex and especially in bilateral frontal regions. CBF in those with slightly impaired mentality was almost normal. In another group with pseudobulbar palsy and/or extrapyramidal sings, CBF was reduced intermediately only in bilateral frontal regions. Typical symptoms in demented patients were apathy, emotional lability, and forgetfulness. In those with the localized type, CBF was reduced in cerebral cortical areas correlating with the impaired mental functions. (author)

  13. sup 123 I-IMP-SPECT in vascular dementia

    Energy Technology Data Exchange (ETDEWEB)

    Namura, Yasuhiro; Miyoshi, Toshihiko; Shio, Hideo; Yamaguchi, Shinya; Kimura, Jun (Kyoto Univ. (Japan). Hospital)

    1990-12-01

    Cerebral blood flow (CBF) was studied by N-isopropyl-p-{sup 123}I-iodoamphetamine (IMP)-single photon emission computed tomography (SPECT) in patients with vascular dementia. Patients were divided by CT/MRI findings into multiple or localized type and cortical or subcortical type. Of patients with multiple lesions in the cortex, the reduction of CBF was noted in several cortex corresponding to CT/MRI findings. Patients in this group had a high incidence of aphasia, agraphia, dyscalculia, and amnesia. Patients with multiple lesions in the white matter and basal ganglia were subdivided into 3 groups by clinical manifestations. CBF in those with dementia showed generalized reduction in all cerebral cortex and especially in bilateral frontal regions. CBF in those with slightly impaired mentality was almost normal. In another group with pseudobulbar palsy and/or extrapyramidal sings, CBF was reduced intermediately only in bilateral frontal regions. Typical symptoms in demented patients were apathy, emotional lability, and forgetfulness. In those with the localized type, CBF was reduced in cerebral cortical areas correlating with the impaired mental functions. (author).

  14. SPECT imaging using [{sup 123}I]{beta}-CIT and [{sup 123}I]IBF in extrapyramidal diseases

    Energy Technology Data Exchange (ETDEWEB)

    Sasaki, Takahiro; Amano, Takahiro; Hashimoto, Jun; Itoh, Yoshiaki; Muramatsu, Kazuhiro; Kubo, Atsushi; Fukuuchi, Yasuo [Keio Univ., Tokyo (Japan). School of Medicine

    2003-01-01

    Imaging of dopaminergic function is useful in the investigation of patients with Parkinson disease (iPD) and other extrapyramidal diseases. Using agents that bind to dopamine transporters ([{sup 123}I]{beta}-CIT) and receptors ([{sup 123}I]IBF SPECT), we investigated SPECT in 9 healthy volunteers and 24 patients for dopamine transporters as well as 15 patients for dopamine receptors. In {beta}-CIT SPECT studies, we examined 17 iPD patients (63.3{+-}9.9 y/o), 3 multiple system atrophy (MSA) patients (olivopontocerebellar atrophy (OPCA) type) (64.0{+-}8.0 y/o), 2 vascular parkinsonism (VP) patients (71.0{+-}0.0 y/o), 1 progressive supranuclear palsy (PSP) patient (69 y/o), 1 cortico-basal degeneration (CBD) patient (50 y/o) and nine healthy controls (39.1{+-}9.3 y/o). For IBF SPECT studies 11 iPD patients (60.6{+-}10.9 y/o), 3 MSA patients (2 OPCA type (50.5{+-}3.5 y/o) and 1 striatonigral degeneration (SND) type (65 y/o)) and 1 PSP patient (60 y/o) underwent SPECT scans after the injection of [{sup 123}I]IBF. The specific to nonspecific striatal ratio (St/Oc-1), ratio of putaminal uptake to caudatal uptake (Pu/Ca), and asymmetry indices (AI) were estimated. {beta}-CIT studies showed ST/Oc-1 as follows; iPD: 2.66{+-}1.09 (n=17), VP: 5.73 and 7.39, MSA: 1.84{+-}0.46 (n=3), PSP: 2.34, CBD: 2.16. In all extrapyramidal diseases except VP, St/Oc-1 ratios were significantly lower than those in normal volunteers (6.46{+-}1.08) (p<0.01). Also in early-phase iPD patients (Yahr I-II), St/Oc-1 (3.16{+-}1.49: n=4) was significantly lower than those in normal volunteers (p<0.01). In IBF studies, St/Oc-1 ratios were significantly higher in early-phase (Yahr I-II) iPD patients (1.82{+-}0.25: n=5) than those in late-phase (Yahr III-IV) iPD patients (1.38{+-}0.32: n=6) (p<0.05). The Pu/Ca ratios in iPD patients (1.12{+-}0.13) and MSA (OPCA type) patients (0.95{+-}0.05) were higher than that in MSA (SND type) patient (0.78) and were lower than that in PSP patient (1.55). In conclusion

  15. Production of high purity iodine-123 from xenon-124 at energies between 15 and 34 MeV

    International Nuclear Information System (INIS)

    Firouzbakht, M.L.; Teng Renrui; Schlyer, D.J.; Wolf, A.P.

    1987-01-01

    The production of I-123 from the proton bombardment of isotopically enriched Xe-124 is reported over the energy range of 15 to 34 MeV via the 124 Xe (p,pn) 123 Xe (β + , 2.1 hr) → 123 I and 124 Xe (p,2n) 123 Cs (β + , 6 min) → 123 Xe (β + , 2.1 hr) → 123 I pathways. The thick target yields for this target are tabulated and compared to theoretical cross-section calculations of the nuclear reactions leading to the production of Xe-123. The radiochemical purity of the I-123 is greater than 99.9% and the contamination of I-125 is below detectable limits (< 0.1%) at 6.6 hrs after the end of bombardment. (orig.)

  16. Switchable Synthesis of 4,5-Functionalized 1,2,3-Thiadiazoles and 1,2,3-Triazoles from 2-Cyanothioacetamides under Diazo Group Transfer Conditions.

    Science.gov (United States)

    Filimonov, Valeriy O; Dianova, Lidia N; Galata, Kristina A; Beryozkina, Tetyana V; Novikov, Mikhail S; Berseneva, Vera S; Eltsov, Oleg S; Lebedev, Albert T; Slepukhin, Pavel A; Bakulev, Vasiliy A

    2017-04-21

    High yield solvent-base-controlled, transition metal-free synthesis of 4,5-functionalized 1,2,3-thiadiazoles and 1,2,3-triazoles from 2-cyanothioacetamides and sulfonyl azides is described. Under diazo transfer conditions in the presence of a base in an aprotic solvent 2-cyanothioacetamides operating as C-C-S building blocks produce 5-amino-4-cyano-1,2,3-thiadiazoles exclusively. The use of alkoxide/alcohol system completely switches the reaction course due to the change of one of the reaction centers in the 2-cyanothioacetamide (C-C-N building block) resulting in the formation of 5-sulfonamido-1,2,3-triazole-4-carbothioamide sodium salts as the only products. The latter serve as good precursors for 5-amino-1,2,3-thiadiazole-4-carboximidamides, the products of Cornforth-type rearrangement occurring in neutral protic medium or under acid conditions. According to DFT calculations (B3LYP/6-311+G(d,p)) the rearrangement proceeds via intermediate formation of a diazo compound, and can be catalyzed by acids via the protonation of oxygen atom of the sulfonamide group.

  17. Cardiac Iodine-123 metaiodobenzylguanidine (123I-MIBG) scintigraphy parameter predicts cardiac and cerebrovascular events in type 2 diabetic patients without structural heart disease

    International Nuclear Information System (INIS)

    Yufu, Kunio; Takahashi, Naohiko; Okada, Norihiro; Shinohara, Tetsuji; Nakagawa, Mikiko; Hara, Masahide; Yoshimatsu, Hironobu; Saikawa, Tetsunori

    2012-01-01

    Cardiac iodine-123 metaiodobenzylguanidine ( 123 I-MIBG) scintigraphy is an established method of assessment of cardiovascular sympathetic function. The aim of the present study was to investigate the long-term cardiovascular predictive value of cardiac 123 I-MIBG scintigraphy parameters in Japanese type 2 diabetic patients without structural heart disease. Cardiac 123 I-MIBG scintigraphy in 108 patients with type 2 diabetes who did not have structural heart disease, was evaluated. The washout rate (WR) was considered enhanced if it was ≥40%. Accurate follow-up information for 4.6 years was obtained in 54 enhanced WR patients (27 male; mean age, 61±11 years) and in 54 sex- and age-matched preserved WR patients (27 male; mean age, 61±10 years). Major adverse cardiac and cerebrovascular events (MACCE) were investigated. During follow-up, 10 enhanced WR patients developed MACCE including cardiac death, coronary revascularization, stroke, and congestive heart failure, while MACCE occurred in only 3 male patients. The Kaplan-Meier curves indicated that enhanced WR patients had higher incidence of MACCE than those with preserved WR (P 123 I-MIBG scintigraphy at baseline has long-term cardiovascular predictive value in Japanese patients with type 2 diabetes without structural heart disease. (author)

  18. Effects of cigarette smoking on I-123 IMP clearance from the lung

    International Nuclear Information System (INIS)

    Katoh, Kunihiko; Takahashi, Tsuneo

    1990-01-01

    N-isopropyl-p-I-123-iodoamphetamine (I-123 IMP), originally developed as a brain scanning agent, is also taken up by the lung. To evaluate the cigarette smoking on the uptake of IMP by the lung, we studied I-123 IMP clearance from the lung on 14 volunteers; 5 non-smokers and 9 smokers. After the injection of 111 MBq (3mCi) of I-123 IMP into the medial cubital vein, the time-activity curve for 60 minutes and the regional activity using 1 frame per minute and a 64 x 64 matrix was obtained. I-123 IMP clearance curve was described as follows: C(t)=A 1 e -k1t +A 2 e -k2t (A 1 , A 2 : intercepts, and k 1 , k 2 : slopes of the exponential components). I-123 IMP clearance was delayed in smokers, and k 2 was smaller in smokers. Also a significant correlations between k 1 , k 2 , and the number of cigarettes smoked per day were found. In conclusion, this study suggests that the delayed clearance and retention of I-123 IMP in the lung indicate the lung metabolic disorders due to cigarette smoking. (author)

  19. Comparison of I-123 IMP cerebral uptake and MR spectroscopy following experimental carotid occlusion

    International Nuclear Information System (INIS)

    Holman, B.L.; Jolesz, F.A.; Polak, J.F.; Kronauge, J.F.; Adams, D.F.

    1985-01-01

    Both I-123 IMP scintigraphy and MRI have been suggested as sensitive detectors of changes shortly after acute cerebral infarction. We compared the uptake of N-isopropyl I-123 p-iodoamphetamine (IMP) and MR spectroscopy of the brain after internal carotid artery ligation. Thirteen gerbils were lightly anesthetized with ether. After neck dissection, an internal carotid artery was occluded. After 2.8 hours, 100 muCi I-123 IMP was injected intravenously into the 13 experimental animals plus three controls. Seven gerbils remained asymptomatic while six developed hemiparesis. At 3 hours after ligation, the animals were killed. The brains were bisected and T1 and T2 relaxation times were determined for the right and left hemispheres by MR spectroscopy immediately after dissection. I-123 IMP uptake was then determined in the samples. Interhemispheric differences in uptake for I-123 IMP were 0.1 +/- 1.7% (SEM) in the control, 33.5 +/- 10% in the asymptomatic and 54.6 +/- 9.7% in the symptomatic animals. Significant differences were seen with I-123 IMP in 6/7 asymptomatic and 6/6 symptomatic animals. In conclusion, I-123 is more sensitive than T1 or T2 relaxation times for the detection of cerebral perfusion abnormalities. Prolongation in T1 and T2 relaxation times correlates closely with increased brain tissue water content and the development of symptoms, indicators of structural brain damage and probable infarction

  20. Effects of cigarette smoking on iodine 123 N-isopropyl-f-iodoamphetamine clearance from the lung

    International Nuclear Information System (INIS)

    Kato, Kunihiko; Harada, Satoshi; Takahashi, Tsuneo; Katsuragawa, Shigehiko; Yanagisawa, Toru

    1991-01-01

    Iodine 123 N-isopropyl-p-iodoamphetamine ( 123 I-IMP), originally developed as a brain scanning agent, is also taken up by the lung. To evaluate the effects of cigarette smoking on the kinetics of IMP in the lung, we studied 123 I-IMP clearance from the lung in 18 volunteers (8 non-smokers and 10 smokers). After the injection of 111 MBq of 123 I-IMP into the medial cubital vein, the time-activity curve for 60 min and the regional activity using 1 frame per minute and a 64x64 matrix were obtained. The 123 I-IMP clearance curve was described as follows: C(t)=A 1 e ( -k 1 t)+A 2 e ( -k 2 t)(A 1 , A 2 : intercepts, and k 1 , k 2 : slopes of the exponential components). 123 I-IMP clearance was delayed in smokers, and k 2 was smaller in smokers. Also, a correlation between k 1 , k 2 , and the number of cigarettes smoked per day was found (r=-0.65, r=-0.74, respectively, P 123 I-IMP in the lung indicate lung metabolic disorders due to cigarette smoking. (orig.)

  1. DNA and chromosome breaks induced by 123I-estrogen in CHO cells

    International Nuclear Information System (INIS)

    Schwartz, J.L.

    1997-01-01

    The effects of the Auger electron-emitting isotope I-123, covalently bound to estrogen, on DNA single- and double-strand breakage and on chromosome breakage was determined in estrogen positive Chinese hamster ovary (CHO-ER) cells. Exposure to the 123 I-estrogen induced both single- and double-strand breaks with a ratio of single- to double-strand breaks of 2.2. The corresponding ratio with 60 Co gamma rays was 15.6. The dose-response was biphasic suggesting that either receptor sites are saturated at high does, or that there is a nonrandom distribution of breaks induced by the 123 I-estrogen. The 123 I-estrogen treatment induced chromosome aberrations with an efficiency of about 1 aberration for each 1,000 disintegrations per cell. This corresponds to the mean lethal dose of 123 I-estrogen for these cells suggesting that the lethal event induced by the Auger electron emitter bound to estrogen is a chromosome aberration. Most of the chromosome-type aberrations were dicentrics and rings, suggesting that 123 I-estrogen-induced chromosome breaks are rejoined. The F-ratio, the ratio of dicentrics to centric rings, was 5.8 ± 1.7, which is similar to that seen with high LET radiations. Their results suggest that I-123 bound to estrogen is an efficient clastogenic agent, that the cytotoxic damage produced by I-123 bound to estrogen is very like high LET-induced damage, and the I-123 in the estrogen-receptor-DNA complex is probably in close proximity to the sugar-phosphate backbone of the DNA

  2. Effect of light rare earth doping in 123 high temperature supercoductors

    Directory of Open Access Journals (Sweden)

    M. Mirzadeh

    2006-09-01

    Full Text Available   We have studied the structural and electrical properties of Gd(Ba2-xLaxCu3O7+δ [Gd(BaLa123], Gd(Ba2-xNdxCu3O7+δ [Gd(BaNd123], and Nd(Ba2-xPrxCu3O7+δ [Nd(BaPr123] compounds with 0.0≤x≤0.8 prepared by the standard solid-state reaction. The XRD patterns show that all of the samples with x≤0.5 are isosructure 123 phase, but in Gd(BaNd123 and Nd(BaPr123 there are several impurity peaks in the XRD patterns for x≥0.6. We estimated the xcsolubility=1.1, 0.6 and 0.55 in Gd(BaLa123, Nd(BaPr123, and Gd(BaNd123, respectively. The resistivity increases with the increase of doping. The decrease of Tc with the increase of Pr doping is faster than Nd and La doping. The normal-state resistivity is fitted for two and three dimensional variable range hopping (2D&amp3D-VRH and Coulomb gap (CG regimes, separately. Our results indicate that the dominant mechanism for x≥xcSIT is 3D-VRH. The broadening of magnetoresistance have been investigated by TAFC and AH models. The pinning energy and Josephson coupling energy, decrease with the increase of applied magnetic field as U~H-β, these values also decrease with doping concentration Pr is more effective than Nd and La.

  3. 12 CFR 221.123 - Combined credit for exercising employee stock options and paying income taxes incurred as a...

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Combined credit for exercising employee stock options and paying income taxes incurred as a result of such exercise. 221.123 Section 221.123 Banks and... (REGULATION U) Interpretations § 221.123 Combined credit for exercising employee stock options and paying...

  4. Synthesis of carbon-14 analogue of 1,5 diaryl-5-[14C]-1,2,3-triazoles

    International Nuclear Information System (INIS)

    Matloubi, Hojatollah; Shafiee, Abbas; Saemian, Nader; Shirvani, Gholamhossein; Daha, Fariba Johari

    2004-01-01

    Two 1,2,3-triazole anticonvulsants, 1-(4-methylsulfone-phenyl)-5-(4-methyl-phenyl)-1,2,3-triazole and 1-(4-methylsulfone-phenyl)-5-phenyl-1,2,3-triazole, both labeled with carbon-14 in the 5-position were prepared from para-tolunitrile-[cyano- 14 C] and benzonitrile-[cyano- 14 C], respectively

  5. Acute administration of haloperidol does not influence 123I-FP-CIT binding to the dopamine transporter

    NARCIS (Netherlands)

    Booij, Jan; van Loon, Guus; de Bruin, Kora; Voorn, Pieter

    2014-01-01

    A recent (123)I-FP-CIT ((123)-I-N-ω-fluoropropyl-2β-carbomethoxy-3β-(4-iodophenyl)nortropane) SPECT study on rats suggested that a single 1 mg/kg dose of the antipsychotic haloperidol induces enough dopamine release to compete with (123)I-FP-CIT for binding to the dopamine transporter. Taking into

  6. 13 CFR 123.19 - May I request an increase in the amount of an economic injury loan?

    Science.gov (United States)

    2010-01-01

    ... amount of an economic injury loan? 123.19 Section 123.19 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION DISASTER LOAN PROGRAM Overview § 123.19 May I request an increase in the amount of an economic... increase is essential for your business to continue and is based on events occurring after SBA approved...

  7. Kinetic modelling of [123I]CNS 1261--a potential SPET tracer for the NMDA receptor

    International Nuclear Information System (INIS)

    Erlandsson, Kjell; Bressan, Rodrigo A.; Mulligan, Rachel S.; Gunn, Roger N; Cunningham, Vincent J.; Owens, Jonathan; Wyper, David; Ell, Peter J.; Pilowsky, Lyn S.

    2003-01-01

    N-(1-napthyl)-N'-(3-[ 123 I]-iodophenyl)-N-methylguanidine ([ 123 I]CNS 1261) is a novel SPET ligand developed for imaging the NMDA receptor intra-channel MK 801/PCP/ketamine site. Data was acquired in 7 healthy volunteers after bolus injection of [ 123 I]CNS 1261. Kinetic modeling showed reversible tracer binding. Arterial and venous time-activity curves overlapped after 90 min. The rank order of binding was: Thalamus > striatum > cortical regions > white matter. This distribution concurs with [ 11 C]-ketamine and [ 18 F]-memantine PET studies . These data provide a methodological basis for further direct in vivo challenge studies

  8. New syntheses of No-carrier-added 123I-labeled agents via organoborane chemistry

    International Nuclear Information System (INIS)

    Kabalka, G.W.

    1985-01-01

    No-carrier-added 123 I-labeled agents are readily prepared via the reaction of organoboranes with sodium iodide- 123 I in the presence of mild oxidizing agents. The reactions are rapid and regiospecific, and they produce excellent yields of the labeled products. The organoboranes are readily prepared from alkenes and alkynes via the hydroboration reaction. A wide variety of functional groups are tolerated by the hydroboration-iodination sequence. The sequence has been utilized to prepare 123 I-labeled steroids and fatty acids, as well as a number of labeled esters, and aromatic derivatives

  9. Recent developments in 99mTc and 123I-radiopharmaceuticals for SPECT imaging

    International Nuclear Information System (INIS)

    Kulkarni, P.V.

    1991-01-01

    Availability of 123 I of high radionuclidic purity has encouraged the development of 123 I-based radiopharmaceuticals for the assessment of myocardial fatty acid metabolism, myocardial neuronal activity, and for receptor and antibody imaging. Advances in the chemistry of technetium have resulted in the development of novel agents for myocardial and cerebral perfusion and renal function studies. Monoclonal antibodies labeled with 99m Tc show promise for imaging neoplastic lesions, myocardial infarcts, and thrombus localization. Recent developments in 123 I and 99m Tc agents for myocardial and brain imaging studies are discussed. (author)

  10. 123 I production using CV-28 cyclotron from IPEN-CNEN/SP

    International Nuclear Information System (INIS)

    Mestnik, S.A.C.; Mengatti, J.; Nieto, W.; Yanagawa, S.I.; Sumiya, L.C.A.; Silva, C.P.G.; Osso Junior, J.A.

    1992-01-01

    The main conditions for iodine 123 production by 124 Te (p,2 n) 123 I reaction were presented, using the cyclotron CV-28 at IPEN-CNEN/SP, with protons of E max = 24 MeV. Two types of targets (Te O 2 and Te O 2 + 2% Al 2 O 3 ) and the influence of Al 2 O 3 in iodine release were studied. After the selection, the 124 Te O 2 (96,2%) target, was melted in platinum support and irradiated with proton current until 12 mu A. The separation of 123 I was made by dry distillation, using induction furnace and O 2 atmosphere. (C.G.C.)

  11. Iodine-123 uptake in vertebral haemangiomas in a patient with papillary thyroid carcinoma

    International Nuclear Information System (INIS)

    Sameer Khan, S.; Dunn, J.; All-Nahhas, A.; Strickland, N.

    2008-01-01

    We present a case of a 58-year-old woman with papillary carcinoma of the thyroid and elevated thyroglobulin. Whole body 123 I scan with SPECT images demonstrated focal uptake in the thoracic spine, reported as bone metastases. Subsequent 18 F DG PET and 99m Tc HDP bone were normal. MRI and CT scans confirmed the presence of vertebral haemangiomas corresponding to the uptake seen on the 123 I scan. False-positive uptake of 123 I in benign vertebral haemangiomas should be considered in the differential diagnosis of focal vertebral uptake. (authors)

  12. Study of 123I-IMP SPECT on diabetic patients

    International Nuclear Information System (INIS)

    Kinoshita, Ikuo; Takeo, Goh; Iwanaga, Keisuke; Uotani, Shigeo; Nakamura, Minoru; Sohda, Masanori; Ohe, Haruto; Toshimitsu, Takashi; Ohe, Nobuharu

    1991-01-01

    The involvement of peripheral nerves and nerve roots often leads to neurological manifestations which have frequently been described in association with diabetes mellitus. Whether there is any specific involvement of the central nervous system in this process has yet to be determined. Recently, many reports have suggested that significant neurophysiologic abnormalities in the central nervous system can sometimes be found in diabetic patients. In order to accurately examine the existence of central nervous system involvement in patients with diabetes mellitus, comparisons of 123 I-IMP (IMP) washout rates were made between normal adults (n=19, average age 43.3 years) and diabetic patients (n=23, average age 43.3 years), and these results were graphically demonstrated by color images. Early images were obtained 30 minutes after intravenous injection, while delayed images were made 4 hours after injection. The IMP washout rate was obtained by subtracting the values of the delayed image with the early image. The standard deviation (SD) of the IMP washout rate for each patient was compared to the averaged SD obtained from healthy adults. After calculating the deviation from SD levels of healthy adults, we made an image of the patient's IMP washout rates. These images were divided into seven degrees (I, II: normal, III, IV: borderline, V∼VII: abnormal) and the ratio of each degree was expressed by a histogram in each cerebral hemisphere as the washout rate index. In 23 diabetic subjects, seven patients were found to be borderline while sixteen patients were abnormal. These impairments were not related either to the presence of diabetic triopathy or the duration of disease. By utilising such a noninvasive method, we were able to accurately evaluate the extent of diabetic central neuropathy. Therefore this subtraction method, which uses the specificity of IMP SPECT, is thus considered to be highly useful for broad clinical application. (author)

  13. VASCULAR INJURIES IN TEHRAN: A REVIEW OF 123 CASES

    Directory of Open Access Journals (Sweden)

    M. Karbakhsh M. R. Zarei

    2006-09-01

    Full Text Available Abstract- Studies of the epidemiology of civilian vascular trauma in developing countries are rather few. This is a prospective study of our experience with vascular trauma in a referral university hospital in Tehran, Iran. The aim was to study the etiology, pattern of injuries and the mortality and morbidity rates due to vascular trauma in our population. In this cross-sectional study, all trauma patients suspicious of having vascular injuries who were admitted to Sina Hospital between March 2002 and May 2003 were included. Among 123 studied cases, there were 109 males and 14 females.Blunt injuries were more common than penetrating ones (56.1% vs. 43.9%. The most common anatomical site of vascular injuries had been knee and lower leg. In fact, cases with lower extremities vascular trauma were twice as common as those with vascular trauma in upper limbs (59.1% vs. 27.3%. The commonest injured vessels were popliteal artery followed by femoral artery. Arterial repair with graft interposition was done in 23 cases and bypass graft in 13 cases. Procedures on veins were performed in 24 cases. Five patients (4.06% died and in 3 cases the patients died because of non-vascular reasons. The present study allows an understanding of the epidemiology of vascular trauma in the one of the major trauma centers in the metropolitan city of Tehran. The majority of our cases were young males sustaining vascular injuries due to road traffic accidents or being stabbed with knives. It also has important implications for vascular injury prevention in our community.

  14. Diagnostic value of asymmetric striatal D2 receptor upregulation in Parkinson's disease: an [123I]IBZM and [123I]FP-CIT SPECT study

    International Nuclear Information System (INIS)

    Verstappen, C.C.P.; Bloem, B.R.; Haaxma, C.A.; Horstink, M.W.I.M.; Oyen, W.J.G.

    2007-01-01

    Striatal postsynaptic D 2 receptors in Parkinson's disease (PD) are thought to be upregulated in the first years of the disease, especially contralateral to the clinically most affected side. The aim of this study was to evaluate whether the highest striatal D 2 binding is found contralateral to the most affected side in PD, and whether this upregulation can be used as a diagnostic tool. Cross-sectional survey was undertaken of 81 patients with clinically asymmetric PD, without antiparkinsonian drugs and with a disease duration of ≤5 years and 26 age-matched controls. Striatal D 2 binding was assessed with [ 123 I]IBZM SPECT, and severity of the presynaptic dopaminergic lesion with [ 123 I]FP-CIT SPECT. The mean striato-occipital ratio of [ 123 I]IBZM binding was significantly higher in PD patients (1.56 ±0.09) than in controls (1.53 ±0.06). In PD patients, higher values were found contralateral to the clinically most affected side (1.57 ±0.09 vs 1.55 ±0.10 ipsilaterally), suggesting D 2 receptor upregulation, and the reverse was seen using [ 123 I]FP-CIT SPECT. However, on an individual basis only 56% of PD patients showed this upregulation. Our study confirms asymmetric D 2 receptor upregulation in PD. However, the sensitivity of contralateral higher striatal [ 123 I]IBZM binding is only 56%. Therefore, the presence of contralateral higher striatal IBZM binding has insufficient diagnostic accuracy for PD, and PD cannot be excluded in patients with parkinsonism and no contralateral upregulation of D 2 receptors, assessed with [ 123 I]IBZM SPECT. (orig.)

  15. Tellurium sulfates from reactions in oleum and sulfur trioxide: syntheses and crystal structures of TeO(SO_4), Te_4O_3(SO_4)_5, and Te(S_2O_7)_2

    International Nuclear Information System (INIS)

    Logemann, Christian; Bruns, Joern; Schindler, Lisa Verena; Zimmermann, Vanessa; Wickleder, Mathias S.

    2015-01-01

    The reaction of K_2TeO_4 with fuming sulfuric acid (65 % SO_3) in sealed glass ampoules at 250 C led to colorless single crystals of TeO(SO_4) [triclinic, P anti 1, Z = 8, a = 819.89(3) pm, b = 836.95(4) pm, c = 1179.12(5) pm, α = 82.820(2) , β = 70.645(2) , γ = 81.897(2) , V = 753.11(6) x 10"6 pm"3]. A horseshoe type [Te_4O_3] fragment is the basic motif in the layer structure of the compound. The [Te_4O_3] moieties are linked to infinite chains by further oxide ions. Monomeric [Te_4O_3] horseshoes are found in the crystal structure of Te_4O_3(SO_4)_5 [trigonal, P3_221, Z = 3, a = 859.05(2) pm, c = 2230.66(7) pm, V = 1425.61(6) x 10"6 pm"3], which was obtained from TeO_2 and fuming sulfuric acid (65 % SO_3) at 200 C as colorless single crystals. By switching to neat SO_3 as reaction medium colorless crystals of Te(S_2O_7)_2 [P2_1/n, Z = 4, a = 1065.25(3) pm, b = 818.50(2) pm, c = 1206.27(3) pm, β = 102.097(1) , V = 1028.40(5) x 10"6 pm"3] form when ortho-telluric acid, H_6TeO_6, is used as the tellurium source. The compound was reported previously, however, obviously with a wrong crystallographic description. In the crystal structure the tellurium atoms are coordinated by two chelating disulfate ions. Further Te-O contacts link the [Te(S_2O_7)_2] units to an extended network. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  16. Iodine-123-labeled meta-iodobenzylguanidine myocardial scintigraphy evaluation of Machado-Joseph disease

    International Nuclear Information System (INIS)

    Kazuta, Toshinari; Hayashi, Michiyuki; Yoshita, Mitsuhiro; Hirai, Shunsaku

    1998-01-01

    Iodine-123-labeled meta-iodobenzylguanidine (( 123 I)MIBG), an analogue of guanetidine, is used as a tracer for evaluation of the function of sympathetic neurons. To investigate cardiac sympathetic function in Machado-Joseph disease (MJD), ( 123 I)MIBG myocardial scintigraphy was performed in 12 patients with MJD and 20 controls. In planar imaging studies, the heart to the mediastinum of the average count ratio (H/M) was calculated for both early and delayed images. The mean values of H/M in delayed images of MJD was lower than those of controls (p 123 I)MIBG myocardial scintigraphy in MJD can be seen earlier than abnormal sudomotor system detected by SSR. (author)

  17. Imaging tissue hypoxia: clinical and pre-clinical experience with {sup 123}IAZA

    Energy Technology Data Exchange (ETDEWEB)

    Wiebe, L.I. [University of Alberta, Edmonton (Canada). Noujaim Institute for Pharmaceutical Oncology Research, Faculty of Pharmacy and Pharmaceutical Sciences

    1997-10-01

    The molecular mechanisms that underline the selective binding of iodazomycin arabinoside, IAZA, and related nitromidazoles are reviewed as a basis for interpretation of preclinical and clinical data for hypoxic binding of radioiodinated IAZA. Clinical data are presented for {sup 123}IAZA uptake in a number of pathologies including metastatic tumours, peripheral vascular disease in diabetes, muscle stress and rheumatoid arthritis. The results of studies to determine the influence of tumour type on uptake of {sup 123} I-IAZA in patients with a variety of deep-seated solid tumours will be presented. Correlations of hypoxia-dependent binding with {sup 99m}Tc-HMPAO perfusion images will be reviewed and early correlations of uptake to treatment response in cancer will be presented. Unusual features of {sup 123}I-IAZA biodistribution will also be discussed together with detailed pharmacokinetic and radiation dosimetry data for `2{sup 123}I- IAZA in normal volunteers 27 refs., 1 fig.

  18. 19 CFR 123.74 - Notice of selection; appeal of determination.

    Science.gov (United States)

    2010-04-01

    ... (b) through (d) of § 123.73 shall constitute the criteria used to evaluate the competency of the... is exercising substantial ownership or control over the carrier operation or corporate officer; (2...

  19. Kinetics of 17-(123I) iodoheptadecanoic acid in myocardium of rats

    International Nuclear Information System (INIS)

    Reske, S.N.; Auner, G.; Winkler, C.

    1983-01-01

    Myocardial uptake and turnover of 17-( 123 I)-iodoheptadecanoic acid, injected i.v., was studied in rats. Kinetics of radioactivity incorporated into myocardial tissue and heart lipids as well as myocardial radioactivity recovered as 123 I iodide were determined. Maximal heart uptake of IHA (7.9% dose/g) heart was observed as early as 30 sec., p.i., followed by monocomponent elimination period. Already 10 to 30 sec p.i. 70 to 80% of total myocardial radioactivity was recovered as 123 I iodide. IHA was incorporated only in modest amounts into myocardial phospholipids and triglycerides. Time course of total myocardial radioactivity grossly paralleled to that recovered as 123 I iodide. These findings indicate stringent limitations in utility of IHA as a tracer for assessment of β-oxidation. (author)

  20. Rhodium-Catalyzed Enantioselective Cyclopropanation of Olefins with N-Sulfonyl 1,2,3-Triazoles

    Science.gov (United States)

    Chuprakov, Stepan; Kwok, Sen Wai; Zhang, Li; Lercher, Lukas; Fokin, Valery V.

    2009-01-01

    N-Sulfonyl 1,2,3-triazoles readily form rhodium(II) azavinyl carbenes, which react with olefins to produce cyclopropanes with excellent diastereo- and enantioselectivity and in high yield. PMID:19928917

  1. Disposition of nebulized pentamidine measured using the direct radiolabel 123I-iodopentamidine

    International Nuclear Information System (INIS)

    O'Doherty, M.J.; Nunan, T.O.; Bateman, N.T.; Thomas, S.H.L.; Page, C.J.; Blower, P.J.

    1993-01-01

    The pulmonary deposition of nebulized pentamidine (300 mg, Respirgard II nebulizer) was measured in seven human immunodeficiency virus (HIV)-positive men using a new radiopharmaceutical, 123 I-iodopentamidine. Mean total pulmonary deposition was 15.3 mg or 5.1% of the initial nebulizer dose. Further studies in two of the patients showed that at 24h, 87% of deposited 123 I was retained in the lungs. Small amounts of activity (expressed as a percentage of the initial nebulizer activity) were also detected over the thyroid (0.4%), bladder (1%) and gut (0.7%). The ratio of 123 I activity to pentamidine concentration was similar in the nebulizer solution and urine. These results suggest that 123 I-pentamidine may be sufficiently stable in vivo to be used to study the biodistribution of inhaled and parenteral pentamidine in humans. (author)

  2. New preparation of (123I) iodolisuride from the 2-tri-n-butylstannalisuride derivative

    International Nuclear Information System (INIS)

    Mauclaire, L.; Loc'h, C.; Berthommier, E.; Ottaviani, M.; Boulanger, H.D.; Coulon, C.; Maziere, B.

    1999-01-01

    A simplified and efficient method is described for the preparation of [ 123 I]2-iodolisuride. The radioiodination of 3-(9,10-didehydro-6methyl-8a-ergolinyl)-1,1-diethylurea (lisuride) is based on tributyltin to 123 I exchange in oxidative conditions. After optimization of the reaction parameters [ 123 I]2-iodolisuride was obtained without high performance liquid chromatography purification with radiochemical yields >90% and a radiochemical purity higher than 95%. The specific activity of the product was more than 500 MBq/nmol. In vitro binding studies on striatal membranes and ex vivo autoradiography in rats showed that [ 123 I] or [ 125 I]2-iodolisuride prepared using this method, have the same radiopharmacological characteristics as radioiodinated iodolisuride prepared using the Iodogen[reg] method

  3. I-123(131)-metyrapone for imaging of the adrenal cortex

    International Nuclear Information System (INIS)

    Zolle, I.; Bergmann, H.; Hoefer, R.; Robien, W.

    1982-01-01

    Attempts to label metyrapone with radioiodine resulted in the synthesis of 4'-bromometyrapone that is labelled with I-123(131) by halogen exchange before use. The synthesis of I-123(131)-metyrapone involves 4 intermediate compounds. 4'-bromometyrapone serves as a precursor with indefinite shelf-life that is labelled selectively in the 4'-position of ring B. Studies of the biodistribution of I-131-metyrapone indicate the highest concentration in the adrenal gland 10-20 min after injection, peak uptake in the normal adrenal corresponds to 0.2% of the administered dose. In hyperfunctioning adrenals the uptake is higher. In a patient with bilateral modular hyperplasia, 0.8% of the injected radioactivity were measured in the enlarged adrenals at 2 resp. 2.8 hrs after injection of I-123-metyrapone. We have performed the first adrenal scintigram on the same patient with 1.25 mCi of I-123-metyrapone. (Author)

  4. Indocyanine green labeled with 123I for dynamic studies of the hepato-biliary system

    International Nuclear Information System (INIS)

    Lambrecht, R.M.; Ansari, A.N.; Wolf, A.P.; Atkins, H.L.

    1975-01-01

    This report summarizes the results to develop an iodine-123 labeled agent for dynamic studies of the hepato-biliary system. Iodine-123 is an ideal nuclide for radiopharmaceuticals, because of its short half-life (T/sub 1 / 2 / = 13.3 hr); its decay with a high abundance (83%) of 159 keV photons; and the reduced patient radiation exposure (a factor of 100 less than iodine-131). Indocyanine green, a tricarbanocyanine dye, was introduced by Heseltine and co-workers in 1956, has several characteristics which suggested that iodine-123 labeled ICG might be potentially useful for hepatic functional evaluation. The plasma clearance and biliary excretion kinetics of 123 I-ICG (in dogs) will be compared to 131 I-rose bengal and bromosulphalein labeled with iodine-125

  5. Imaging tissue hypoxia: clinical and pre-clinical experience with 123IAZA

    International Nuclear Information System (INIS)

    Wiebe, L.I.

    1997-01-01

    The molecular mechanisms that underline the selective binding of iodazomycin arabinoside, IAZA, and related nitromidazoles are reviewed as a basis for interpretation of preclinical and clinical data for hypoxic binding of radioiodinated IAZA. Clinical data are presented for 123 IAZA uptake in a number of pathologies including metastatic tumours, peripheral vascular disease in diabetes, muscle stress and rheumatoid arthritis. The results of studies to determine the influence of tumour type on uptake of 123 I-IAZA in patients with a variety of deep-seated solid tumours will be presented. Correlations of hypoxia-dependent binding with 99m Tc-HMPAO perfusion images will be reviewed and early correlations of uptake to treatment response in cancer will be presented. Unusual features of 123 I-IAZA biodistribution will also be discussed together with detailed pharmacokinetic and radiation dosimetry data for '2 123 I- IAZA in normal volunteers

  6. Synthesis and evaluation of iodine-123 labelled tricyclic tropanes as radioligands for the serotonin transporter

    International Nuclear Information System (INIS)

    Quinlivan, Mitchell; Mattner, Filomena; Papazian, Vahan; Zhou, Jia; Katsifis, Andrew; Emond, Patrick; Chalon, Sylvie; Kozikowski, Alan; Guilloteau, Denis; Kassiou, Michael

    2003-01-01

    The tricyclic tropane analogues (1S,3S,6R,10S)-(Z)-10-(benzoyloxymethyl)-9-(3-chloro-4-iodobenzylidene)-7 -azatricyclo[4.3.1.0 3,7 ]decane, 1, and (1S,3S,6R,10S)-(Z)-9-(3-chloro-4-iodobenzylidene)-7-azatricyclo[4.3.1.0 3,7 ] = decane-10-carboxylic acid methyl ester, 2, have been shown to be potent and selective serotonin transporter (SERT) ligands. They possess nanomolar affinity for the SERT (Ki = 0.06 nM and 1.8 nM respectively) and are suitable for radiolabelling using iodine-123. In the present study we prepared [ 123 I]1 and [ 123 I]2 from the appropriate tributylstannane precursors using acidic media with chloramine-T as the oxidising agent. The radiochemical yield obtained for [ 123 I]1 varied between 50-60% while for [ 123 I]2 the range was 65-80%. Both radioligands were obtained with radiochemical purity > 97% and specific activity estimated to be > 185 GBq/μmol. The biodistribution of [ 123 I]1 demonstrated low degree of brain penetration at 5 min (0.14%ID/g) with a homogenous distribution. The radioactivity cleared quickly from all brain regions with no preferential localization. In comparison, [ 123 I]2 demonstrated on average a higher brain uptake at 5 min (0.5%ID/g). However the distribution of radioactivity was homogenous and cleared to levels similar to [ 123 I]1 at 1 hr post-injection. Pre-administration of citalopram failed to show any significant inhibition of [ 123 I]2 uptake in the rat brain. The high lipophilicity of 1 and 2 (HPLC-derived log P 7.4 values of 6.41 and 4.25 respectively) and in vivo metabolism, seen by high thyroid uptake would explain the absence of any specific binding observed in the rat brain. In view of these results [ 123 I]1 and [ 123 I]2 do not appear to be suitable radioligands for in vivo studies of the SERT

  7. Synthesis and evaluation of iodine-123 labelled tricyclic tropanes as radioligands for the serotonin transporter

    Energy Technology Data Exchange (ETDEWEB)

    Quinlivan, Mitchell; Mattner, Filomena; Papazian, Vahan; Zhou, Jia; Katsifis, Andrew; Emond, Patrick; Chalon, Sylvie; Kozikowski, Alan; Guilloteau, Denis; Kassiou, Michael E-mail: mkassiou@med.usyd.edu.au

    2003-10-01

    The tricyclic tropane analogues (1S,3S,6R,10S)-(Z)-10-(benzoyloxymethyl)-9-(3-chloro-4-iodobenzylidene)-7 -azatricyclo[4.3.1.0{sup 3,7}]decane, 1, and (1S,3S,6R,10S)-(Z)-9-(3-chloro-4-iodobenzylidene)-7-azatricyclo[4.3.1.0{sup 3,7}] = decane-10-carboxylic acid methyl ester, 2, have been shown to be potent and selective serotonin transporter (SERT) ligands. They possess nanomolar affinity for the SERT (Ki = 0.06 nM and 1.8 nM respectively) and are suitable for radiolabelling using iodine-123. In the present study we prepared [{sup 123}I]1 and [{sup 123}I]2 from the appropriate tributylstannane precursors using acidic media with chloramine-T as the oxidising agent. The radiochemical yield obtained for [{sup 123}I]1 varied between 50-60% while for [{sup 123}I]2 the range was 65-80%. Both radioligands were obtained with radiochemical purity > 97% and specific activity estimated to be > 185 GBq/{mu}mol. The biodistribution of [{sup 123}I]1 demonstrated low degree of brain penetration at 5 min (0.14%ID/g) with a homogenous distribution. The radioactivity cleared quickly from all brain regions with no preferential localization. In comparison, [{sup 123}I]2 demonstrated on average a higher brain uptake at 5 min (0.5%ID/g). However the distribution of radioactivity was homogenous and cleared to levels similar to [{sup 123}I]1 at 1 hr post-injection. Pre-administration of citalopram failed to show any significant inhibition of [{sup 123}I]2 uptake in the rat brain. The high lipophilicity of 1 and 2 (HPLC-derived log P{sub 7.4} values of 6.41 and 4.25 respectively) and in vivo metabolism, seen by high thyroid uptake would explain the absence of any specific binding observed in the rat brain. In view of these results [{sup 123}I]1 and [{sup 123}I]2 do not appear to be suitable radioligands for in vivo studies of the SERT.

  8. Altered insulin distribution and metabolism in type I diabetics assessed by [123I]insulin scanning

    International Nuclear Information System (INIS)

    Hachiya, H.L.; Treves, S.T.; Kahn, C.R.; Sodoyez, J.C.; Sodoyez-Goffaux, F.

    1987-01-01

    Scintigraphic scanning with [ 123 I]insulin provides a direct and quantitative assessment of insulin uptake and disappearance at specific organ sites. Using this technique, the biodistribution and metabolism of insulin were studied in type 1 diabetic patients and normal subjects. The major organ of [ 123 I]insulin uptake in both diabetic and normal subjects was the liver. After iv injection in normal subjects, the uptake of [ 123 I]insulin by the liver was rapid, with peak activity at 7 min. Activity declined rapidly thereafter, consistent with rapid insulin degradation and clearance. Rapid uptake of [ 123 I]insulin also occurred in the kidneys, although the uptake of insulin by the kidneys was about 80% of that by liver. In type 1 diabetic patients, uptake of [ 123 I]insulin in these organ sites was lower than that in normal subjects; peak insulin uptakes in liver and kidneys were 21% and 40% lower than those in normal subjects, respectively. The kinetics of insulin clearance from the liver was comparable in diabetic and normal subjects, whereas clearance from the kidneys was decreased in diabetics. The plasma clearance of [ 123 I]insulin was decreased in diabetic patients, as was insulin degradation, assessed by trichloroacetic acid precipitability. Thirty minutes after injection, 70.9 +/- 3.8% (+/- SEM) of [ 123 I]insulin in the plasma of diabetics was trichloroacetic acid precipitable vs. only 53.9 +/- 4.0% in normal subjects. A positive correlation was present between the organ uptake of [123I]insulin in the liver or kidneys and insulin degradation (r = 0.74; P less than 0.001)

  9. Cardiac iodine-123 metaiodobenzylguanidine uptake in animals with diabetes mellitus and/or hypertension

    International Nuclear Information System (INIS)

    Dubois, E.A.; Kam, K.L.; Somsen, G.A.; Boer, G.J.; Bruin, K. de; Batink, H.D.; Pfaffendorf, M.; Royen, E.A. van; Zwieten, P.A. van

    1996-01-01

    The aim of the present study was to evaluate the use of the noradrenaline analogue iodine-123 metaiodobenzylguanidine ([ 123 I]MIBG) for the assessment of cardiac sympathetic activity in the presence of diabetes mellitus and/or hypertension in animal models. One model used Wistar-Kyoto rats (WKY) and spontaneously hypertensive rats (SHR) rendered diabetic at 12 weeks of age by an intravenous injection of streptozotocin (STZ). The other model used lean and obese Zucker rats. In all groups basic haemodynamic values were established and animals received an intravenous injection of 50 μCi [ 123 I]MIBG. Initial myocardial uptake and washout rates of [ 123 I]MIBG were measured scintigraphically during 4 h. After sacrifice, plasma noradrenaline and left cardiac ventricular β-adrenoceptor density was determined. The diabetic state, both in STZ-treated rats (direct induction) and in obese Zucker rats (genetic induction), appeared to induce a lower cardiac density of β-adrenoceptors, indicative of increased sympathetic activity. Cardiac [ 123 I]MIBG then showed increased washouts, thereby confirming enhanced noradrenergic activity. This parallism of results led to the conclusion that [ 123 I]MIBG wash-out measurements could provide an excellent tool to assess cardiac sympathetic activity noninvasively. However, in hypertension (WKY vs SHR), both parameters failed to show parallelism: no changes in β-adrenoceptor density were found, whereas [ 123 I]MIBG wash-out rate was increased. Thus, either [ 123 I]MIBG washout or β-adrenoceptor density may not be a reliable parameter under all circumstances to detect changes in the release of noradrenaline. (orig./MG)

  10. 123-I ioflupane (Datscan) presynaptic nigrostriatal imaging in patients with movement disorders

    International Nuclear Information System (INIS)

    Soriano Castrejon, Angel; Garcia Vicente, Ana Maria; Cortes Romera, Montserrat; Rodado Marina, Sonia; Poblete Garcia, Victor Manuel; Ruiz Solis, Sebastian Ruiz; Talavera Rubio, Maria del Prado; Vaamonde Cano, Julia

    2005-01-01

    123-I Ioflupane (Datscan) presynaptic imaging has been shown to have a significant utility in the assessment of patients with movement disorders 123 I Ioflupane SPECT is able to distinguish between Parkinson's disease (PD) and other forms of parkinsonism without degeneration of the nigrostriatal pathway, including a common movement disorder such as essential tremor, and to assess disease progression in PD and other neuro degenerative disorders involving the substantia nigra. (author)

  11. Collimator Selection in Nuclear Medicine Imaging Using I-123 Generated by Te-124 Reaction

    International Nuclear Information System (INIS)

    Kim, Hee Joung; Son, Hye Kyung; Nam, Ki Pyo; Lee, Hee Kyung; Bong, Joung Kyun

    1996-01-01

    In the case of I-123 from the Te-124(p,2n)reaction, the radionuclidic impurity is the high-energy gamma-emitting I-124, which interferes greatly with nuclear medicine images. The choice of a collimator can affect the quality of clinical SPECT images of [I-123]MIBG, [I-123]μ-CIT, or [I-123]IPT. The tradeoffs that two different collimators make among spatial resolution, sensitivity, and scatter were studied by imaging a line source at 5 cm, 10 cm, 15 cm distance using a number of plexiglass sheets between source and collimator, petridish, two-dimensional Hoffman brain phantom, Jaszczak phantom, and three-dimensional Hoffman brain phantom after filling with I-123. (FWHM, FWTM, Sensitivity) for low-energy ultrahigh-resolution parallel-hole(LEUHRP) collimator and medium-energy general-purpose(MEGP) collimator were measured as (9.27 mm, 61.27 mm, 129 CPM/μCi) and (10.53 mm, 23.17 mm, 105CPM/μ/Ci), respectively. The image quality of two-dimensional Hoffman brain phantom with LEUHRP looked better than the one with MEGP. However, the image quality of Jaszczak phantom and three-dimensional Hoffman brain phantom with LEUHRP looked much worse than the one with MEGP because of scatter contributions in three-dimensional imaging situation. The results suggest that the MEGP is preferable to LEUHRP for three-dimensional imaging studies of [I-123]MIBG, [I-123] β-CIT, or [I-123] IPT.

  12. Comparative evaluation of 123I and /sup 99m/Tc for thyroid studies

    International Nuclear Information System (INIS)

    Atkins, H.L.; Ansari, A.N.; Bradley-Moore, P.R.; Lambrecht, R.; Wolf, A.

    1975-01-01

    Both /sup 99m/Tc and 123 I can be used to advantage in assessing thyroid function and anatomy. The nuclides have similar principal gamma photons, and their short physical half-lives result in low radiation dose, thus allowing administration of large quantities of activity. The very early uptakes of these radionuclides by the thyroid do not bear a consistent relationship, and that requires further study. The clinical value of 123 I depends ultimately on its consistent availability at reasonable cost

  13. Synthesis of N-isopropyl p-[123I]iodoamphetamine via organoborane chemistry

    International Nuclear Information System (INIS)

    Kabalka, G.W.; Varma, R.S.; Gai, Y.

    1990-01-01

    Iodine-123 labeled amphetamines have proven to be excellent cerebral perfusion tracers. The radioiodination of aromatic amines is generally achieved via high temperature substitution reactions which are prone to side reactions. The authors report that N-isopropyl p-[ 123 I]iodoamphetamine, and other iodophenylamines, are readily synthesized from the corresponding air stable, boronic acids. The reaction is based on the no-carrier-added radioiodination sequence developed in their laboratory

  14. CuO-Nanoparticles Catalyzed Synthesis of 1,4-Disubstituted-1,2,3 ...

    Indian Academy of Sciences (India)

    John Paul Raj

    2018-04-13

    Apr 13, 2018 ... has been developed for the synthesis of 1,2,3-triazoles. A library of 1 ... Kuang et al., described Cu-catalyzed synthesis of 1H-. 1,2,3-triazoles from 1 ..... Tornøe C W, Christensen C and Meldal M 2002 Peptido- triazoles on solid ... 2015 Copper-catalyzed [3+2] cycloaddition/oxidation reactions between ...

  15. Iodobell in vivo kits for labelling with 123I or 131I

    International Nuclear Information System (INIS)

    Koernyei, J.; Horvath, M.; Pszota, A.; Lakatos, M.; Szirtes, L.

    1988-01-01

    Iodobell in vivo kits provide an easy and fast method for 'on the spot' radioiodination with 123 I (or 131 I). Until now three kits have been developed in the Institute of Isotopes Budapest, the heptadecanoic acid, the hippurate and the MIBG kits. From these, the heptadecanoic acid kit is being tested in humans in Hungary, the other two are under the registration procedure. The Iodobell in vivo kits may contribute to the application of 123 I radioisotope in Hungary. (orig.)

  16. Anomalous behavior of tellurium abundances

    Energy Technology Data Exchange (ETDEWEB)

    Cohen, B L

    1984-01-01

    The cosmic abundance of Te is larger than for any element with atomic number greater than 40, but it is one of the least abundant elements in the earth's lithosphere and it is one of the five elements never reported in sea water. On the other hand, it is the fourth most abundant element in the human body (after Fe, Zn and Rb), and is unusually abundant in human food. It is shown that the high abundance in human food combined with the low abundance in soil requires that it be picked up by plant roots very much more efficiently than any other trace element.

  17. Acute 1,2,3-trichloropane poisoning: a case report and literature review.

    Science.gov (United States)

    Han, Hui

    2010-12-01

    1,2,3-Trichloropropane is widely used in industrial and agricultural production. However 1,2,3-trichloropropane poisoning has been rarely encountered in clinical practices. Here, a 45-year-old farmer who suffered fulminant hepatic failure due to ingestion of 1,2,3-trichloropropane has been reported and literature about 1,2,3-trichloropane poisoning has been reviewed. For this case, reduced glutathione, vitamin K, pantoprazole were infused intravenously, and transfusion of blood plasma, platelets and red blood cells were carried out. Unfortunately, the patient's family gave up treatment and they left the hospital with the patient because of the low chance of recovery 20 hr after admission. Based on blood toxicology screening, patient history and rapid deterioration of the patient, the cause of fulminant hepatic failure was determined to be acute intoxication of 1,2,3-trichloropropane by unintentional toxicity. 1,2,3-trichloropropane has histopathological toxic effects on many organs and this toxic effect occurs within a short period after ingestion, with liver as the major affected organ. © 2010 The Author. Basic & Clinical Pharmacology & Toxicology © 2010 Nordic Pharmacological Society.

  18. Labeling of 3H11 With 123I and Its Biodistribution

    International Nuclear Information System (INIS)

    Qin Hongbin; Yin Wei; Gao Huibo; Chen Daming; Qi Benzhong; Jin Xiaohai; Bai Hongsheng; Zhang Wenhui; Yang Zhi

    2010-01-01

    3H11 was labeled with 123 I by Iodogen method,and the labeling product were purified with PD-10 column. The labeling yield and the radiochemical purity of the product was determined by paper chromatography. The biodistribution of 123 I-3H11 in normal mice was car ride out as well. The optimal experimental conditions of 123 I-3H11 was as follow: Iodogen 10 μg, 3H11 30 μg, Na 123 I solution 20 μL (13.3 MBq), PBS 100 μL (pH 7.4, 0.2 mol/L), the normal temperature for 8 min. The labeling yield of 123 I-3H11 was 70%-80%. After stored at 4 degree C for 48 h in human serum,the radiochemical purity was more than 92%. The results of biodistribution showed that the clearance of radiolabeled antibody in blood (half time, T 1/2 ) was 12.25±0.25 h, and the radioactivity in the stomach was up taken obviously. The above results indicated that 123 I-3H11 appears to show some potential as gastric cancer imaging diagnostic agent. (authors)

  19. Clinical evaluation of 123I-MIBG for assessment of sympathetic nervous system in the heart

    International Nuclear Information System (INIS)

    Hirosawa, Koushitiro; Tanaka, Takeshi; Hisada, Kin-ichi; Bunko, Hisashi.

    1991-01-01

    Multi-center clinical trial of 123 I-metaiodobenzylguanidine ( 123 I-MIBG) was carried out to assess its utility as a scintigraphic imaging agent reflecting sympathetic neuronal function in cardiovascular field. Studies were performed on patients with heart diseases of three categories, myocardial infarction, angina pectoris and cardiomyopathy. Scintigraphic images, reflecting sympathetic neuronal function, were obtained with 123 I-MIBG from all of those categories of patients and the efficacy of the imaging was revealed in 781 (95.0%) out of 822 patients. In some patients abnormality was suggested in sympathetic neuronal function with 123 I-MIBG imaging, in spite of normal findings with myocardial perfusion scintigraphy by 201 TlCl. In all 981 patients studied with 123 I-MIBG, there have been no severe adverse reactions, except complaints of burning on injection site of the agent or nausea, ect. from 4 patients. We conclude that 123 I-MIBG imaging is one of the effective tools for diagnostic use reflecting topical sympathetic neuronal function in the heart, judging from its safety and efficacy. (author)

  20. 123I-BMIPP delayed scintigraphic imaging in patients with chronic heart failure

    International Nuclear Information System (INIS)

    Kida, Keisuke; Akashi, Yoshihiro J.; Yoneyama, Kihei; Shimokawa, Mitsuhiro; Musha, Haruki

    2008-01-01

    The objective of the present study was to clarify the ability of 123 I-beta-methyl-iodophenylpentadecanoic acid ( 123 I-BMIPP) to evaluate the heart-to-mediastinum (H/M) ratio and myocardial global washout rate (WR) in patients with chronic heart failure (CHF). The severity of CHF was evaluated on the basis of the New York Heart Association (NYHA) classification. Twenty patients with CHF (13 with idiopathic dilated cardiomyopathy and 7 with ischemic cardiomyopathy) and 11 age-matched controls underwent myocardial radionuclide imaging. Scintigraphic images were obtained from each participant at the early (30 min following radio-isotope injection) and late (4 h) phases using 123 I-BMIPP. The H/M ratio and WR were calculated from planar images. Concentrations of plasma brain natriuretic peptide (BNP) were measured prior to the scintigraphic study. The 123 I-BMIPP uptake of early H/M and global WR did not significantly differ among groups, but uptake of delayed H/M was significantly lower in patients with NYHA class III than in controls (control 2.47±0.39; class III 1.78±0.28 P 123 I-BMIPP uptake of delayed H/M enhances the image of CHF severity. The myocardial WR of 123 I-BMIPP also effectively depicted the severity of CHF. (author)