WorldWideScience

Sample records for technology iut che

  1. Cloning and characterization of the iron uptake gene iutA from avian Escherichia coli

    Directory of Open Access Journals (Sweden)

    Dorismey Vieira Tokano

    2008-06-01

    Full Text Available The aim of this work was to isolate, clone and characterize the iron uptake gene iutA from avian pathogenic E. coli (APEC. The iutA gene was isolated from the strain APEC 9, serotype O2:H9, which was cloned in the expression vector pET101/D-TOPO. The gene of 2.2 Kb was sequenced (AY602767, which showed high similarity to the iutA gene from three plasmids, two from APEC, pAPEC-02-ColV (AY545598.4 and pTJ100 (AY553855.1, and one from a human invasive E. coli strain, the pColV K30. The recombinant protein IutA was over expressed in E. coli BL21(DE-3 and was solubilized with urea and purified by Ni-NTA column. This method produced a relatively high yield of r-IutA of approximately 74kDa, which was used to produce the antibody anti-IutA. This anti-IutA reacted with the protein r-IutA and native IutA of APEC 9, as demonstrated by Western blot, showing that the r-IutA conserved epitopes and its antigenicity was preserved. The anti-IutA IgY was able to inhibit the IutA biological activity, inhibiting the sensitivity to cloacin DF13 of APEC9. However, it did not inhibit the growth of APEC9 in M9 and did not protect the chickens inoculated with the APEC, suggesting that the APEC possessed another iron acquisition mechanism distinct of aerobactin.A proteína de membrane externa IutA (iron uptake transport é o receptor para aerobactina férrica, um fator de virulência encontrado mais frequentemente entre as amostras de E. coli pathogênicas para aves (APEC do que entre os isolados fecais de aves saudáveis. O gene iutA da amostra APEC 9, sorotipo O2:H9, foi amplificado e clonado no vetor pET101/D-TOPO. O gene iutA 2.2 Kb foi sequenciado (AY602767 e mostrou alta similaridade para gene iutA de três plasmidios, dois da APEC, pAPEC-02-ColV (AY545598.4 e pTJ100 (AY553855.1, e um da amostra E. coli invasiva humana, pColV K30. A proteína IutA recombinante (r-IutA foi produzida em Escherichia coli BL21(DE-3, solubilizada com uréia e purificada em coluna de n

  2. Cyclic AMP-receptor protein activates aerobactin receptor IutA expression in Vibrio vulnificus.

    Science.gov (United States)

    Kim, Choon-Mee; Kim, Seong-Jung; Shin, Sung-Heui

    2012-04-01

    The ferrophilic bacterium Vibrio vulnificus can utilize the siderophore aerobactin of Escherichia coli for iron acquisition via its specific receptor IutA. This siderophore piracy by V. vulnificus may contribute to its survival and proliferation, especially in mixed bacterial environments. In this study, we examined the effects of glucose, cyclic AMP (cAMP), and cAMP-receptor protein (Crp) on iutA expression in V. vulnificus. Glucose dose-dependently repressed iutA expression. A mutation in cya encoding adenylate cyclase required for cAMP synthesis severely repressed iutA expression, and this change was recovered by in trans complementing cya or the addition of exogenous cAMP. Furthermore, a mutation in crp encoding Crp severely repressed iutA expression, and this change was recovered by complementing crp. Accordingly, glucose deprivation under iron-limited conditions is an environmental signal for iutA expression, and Crp functions as an activator that regulates iutA expression in response to glucose availability.

  3. The ferric aerobactin receptor IutA, a protein isolated on agarose column, is not essential for uropathogenic Escherichia coli infection El receptor de aerobactina IutA, una proteína aislada en columna de agarosa, no es esencial para la infección por Escherichia coli uropatógena O receptor de aerobactina IutA, uma proteína isolada em coluna de agarose, não é essencial para a infecção por Escherichia coli uropatogênica

    Directory of Open Access Journals (Sweden)

    Taise Natali Landgraf

    2012-04-01

    Full Text Available Although many proteins have been described involved in Escherichia coli colonization and infection, only few reports have shown lectins as important components in these processes. Because the mechanisms underlying E. coli colonization process involving lectins are not fully understood, we sought to identify the presence of other non-described lectins in E. coli. Here, we isolated a 75-kDa protein from E. coli on Sepharose column and identified it as ferric aerobactin receptor (IutA. Since IutA is controversially associated with virulence of some E. coli strains, mainly in uropathogenic E. coli (UPEC, we evaluated the presence of iutA gene in UPEC isolated from patients with urinary infection. This gene was present in only 38% of the isolates, suggesting a weak association with virulence. Because there is a redundancy in the siderophore-mediated uptake systems, we suggest that IutA can be advantageous but not essential for UPEC.La falta de una clara comprensión de los mecanismos de participación de las lectinas en el proceso de colonización por Escherichia coli, nos motivó a identificar la presencia de otras lectinas que no han sido descritas en E. coli. En este estudio, se aisló una proteína de 75kDa de E. coli en una columna de Sepharosa, correspondiente al receptor de aerobactina (IutA. La asociación de IutA con cepas virulentas de E coli es controvertido, especialmente en E. coli uropatógena (UPEC, lo que nos llevó a evaluar la presencia del gen iutA en UPECs aisladas de pacientes con infección urinaria. El gen estaba presente en 38% de los aislamientos, lo que sugiere una débil asociación con la virulencia. Debido a la existencia de redundancia en los sistemas de captura de hierro, se sugiere que IutA puede ser una ventaja, sin embargo no es esencial para la UPEC.Apenas alguns relatos na literatura demonstram que lectinas são importantes nos processos de colonização e infecção por Escherichia coli. A falta de compreens

  4. Cholinesterase (ChE) response and related mortality among birds fed ChE inhibitors

    Science.gov (United States)

    Ludke, J.L.; Hill, E.F.; Dieter, M.P.

    1975-01-01

    Patterns of mortality and inhibition of brain and plasma ChE in birds treated with ChE inhibitors were studied in an attempt to determine the validity of using ChE activity as a monitoring and diagnostic technique. Analysis of brain ChE activity proved to be reliable for diagnosing and monitoring effects of selected ChE inhibitors in birds. Brain ChE inhibition exceeding 20% indicated exposure, and inhibition greater than 50% was sufficient for diagnosing cause of death. Individuals that died from dietary exposure to parathion or carbofuran had brain ChE activities below 55% of normal; although individuals could survive with brain ChE activity lower than 50%. Problems associated with collection, storage, and analysis of tissues for ChE activity are discussed.

  5. El humanismo del Che Che's Humanism

    OpenAIRE

    Avelino Fernández Espert; Cristina Fernández Rivero

    2004-01-01

    Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che) en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profes...

  6. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  7. Dicty_cDB: CHE636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  8. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  9. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  10. Notas sobre el che

    Directory of Open Access Journals (Sweden)

    Virginia Bertolotti

    2010-06-01

    Full Text Available In the present work, I review, in the first place, the bibliography that summarizes the discussion surrounding the etymology of the word che. Then, I analyze the uses of this term in the diachrony as in the synchrony of the Río de la Plata Spanish, which allows me to propose a classification of the uses of the word che in this region. In the third part of the article, I discuss the categorial adscrption of the word che. Finally, the categorial analysis of the diachronic and synchronic empirical evidence allows me to conclude that the vocative uses of the term are a loan from the nominal determinant of the guaraní language, and not a phonic change in the Spanish interjection, thus resolving the etymological issues.

  11. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  12. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  13. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  14. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  15. CheMentor Software System by H. A. Peoples

    Science.gov (United States)

    Reid, Brian P.

    1997-09-01

    CheMentor Software System H. A. Peoples. Computerized Learning Enhancements: http://www.ecis.com/~clehap; email: clehap@ecis.com; 1996 - 1997. CheMentor is a series of software packages for introductory-level chemistry, which includes Practice Items (I), Stoichiometry (I), Calculating Chemical Formulae, and the CheMentor Toolkit. The first three packages provide practice problems for students and various types of help to solve them; the Toolkit includes "calculators" for determining chemical quantities as well as the Practice Items (I) set of problems. The set of software packages is designed so that each individual product acts as a module of a common CheMentor program. As the name CheMentor implies, the software is designed as a "mentor" for students learning introductory chemistry concepts and problems. The typical use of the software would be by individual students (or perhaps small groups) as an adjunct to lectures. CheMentor is a HyperCard application and the modules are HyperCard stacks. The requirements to run the packages include a Macintosh computer with at least 1 MB of RAM, a hard drive with several MB of available space depending upon the packages selected (10 MB were required for all the packages reviewed here), and the Mac operating system 6.0.5 or later.

  16. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  17. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  18. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  19. Heterozygous Che-1 KO mice show deficiencies in object recognition memory persistence.

    Science.gov (United States)

    Zalcman, Gisela; Corbi, Nicoletta; Di Certo, Maria Grazia; Mattei, Elisabetta; Federman, Noel; Romano, Arturo

    2016-10-06

    Transcriptional regulation is a key process in the formation of long-term memories. Che-1 is a protein involved in the regulation of gene transcription that has recently been proved to bind the transcription factor NF-κB, which is known to be involved in many memory-related molecular events. This evidence prompted us to investigate the putative role of Che-1 in memory processes. For this study we newly generated a line of Che-1(+/-) heterozygous mice. Che-1 homozygous KO mouse is lethal during development, but Che-1(+/-) heterozygous mouse is normal in its general anatomical and physiological characteristics. We analyzed the behavioral characteristic and memory performance of Che-1(+/-) mice in two NF-κB dependent types of memory. We found that Che-1(+/-) mice show similar locomotor activity and thigmotactic behavior than wild type (WT) mice in an open field. In a similar way, no differences were found in anxiety-like behavior between Che-1(+/-) and WT mice in an elevated plus maze as well as in fear response in a contextual fear conditioning (CFC) and object exploration in a novel object recognition (NOR) task. No differences were found between WT and Che-1(+/-) mice performance in CFC training and when tested at 24h or 7days after training. Similar performance was found between groups in NOR task, both in training and 24h testing performance. However, we found that object recognition memory persistence at 7days was impaired in Che-1(+/-) heterozygous mice. This is the first evidence showing that Che-1 is involved in memory processes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  20. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    idea that a real linguistic apocalypse is to be found on one hand, in what. Calvino ... nell'italiano contemporaneo da una prospettiva che, audacemente, definiamo ...... 'terrore semantico', cioè la fuga di fronte a ogni vocabolo che abbia di.

  1. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  2. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  3. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  4. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...... with the achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  5. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  6. Award ceremony for the "Crèche and School" competition

    CERN Multimedia

    Staff Association

    2018-01-01

    Whenever there is a competition, there are obviously participants – and especially winners! The awards ceremony for the competition to find a new name for the CERN Staff Association's Crèche and School took place on 15 May. During the ceremony, jointly led by Céline Grobon (President of the Crèche and School Steering Committee), Carole Dargagnon (Headmistress of the Crèche and School) and Jean-Baptiste Zenner (Staff Association delegate), the proposals selected by the jury were rewarded. The first place went to Marie-Luz Cavagna for her proposal "Le jardin des petits chercheurs", and the second place to Sarah Palluel for her proposal "Le Jardin des Zélectrons". Finally, Aude Mourey and Sandra Fleury tied for third place with their respective proposals "Les petits atomes" and "La crèche des particules". Can we find the winning name of the competition among...

  7. Los marcadores che y boludo: ¿un caso de rivalidad conversacional?

    Directory of Open Access Journals (Sweden)

    Markéta Šmídová

    2016-11-01

    Full Text Available It has been recently suggested that the Argentinian conversational marker che is being replaced by another typical expression, boludo. The purpose of the present paper is to provide a pilot comparative study of these two Argentinian markers in order to examine their free interchangeability and to refute it eventually. A commutation test has been used as a basic tool to compare the behavior and functions of che and boludo and the results have helped to reveal contexts in which it would be inadmissible or inappropriate to employ boludo instead of che due to the possible violation of politeness norms. In the article, che and boludo are considered mainly from the sociolinguistic and pragmatic approaches although some important cultural phenomena are discussed as well.

  8. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  9. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    comprised of Green Berets, to go to Bolivia and train a Ranger battalion 40 in counter-insurgency operations. Leading this 16-man team was Maj...York: Routledge & Kegan Ltd., 1987. Sinclair, Andrew. Che Guevara. New York: The Viking Press, 1970. Study of the “Diary of ‘Che’ Guevara in

  10. à l'encoche sèche

    African Journals Online (AJOL)

    Chez Hevea brasiliensis, la production de latex est affectée par l'encoche sèche qui se manifeste par l'arrêt de l'écoulement de ... coagulation pour donner le caoutchouc naturel. ..... relationship between latex sugar content, the metabolic ...

  11. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  12. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  13. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  14. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  15. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  16. LE SOLUTRÉEN ANCIEN EN ARDÈCHE (FRANCE: UNE RÉVISION CRITIQUE DES INDUSTRIES LITHIQUES

    Directory of Open Access Journals (Sweden)

    Sophie Guegan

    2013-11-01

    assemblages have been conducted. Three key-sites of this early phase have been tackled: Oullins cave (Gard-Ardèche, Chabot cave (Gard and Granouly cave (Ardèche. Here we present the preliminary results of this new study. A typological approach have been first conducted, especially to precise the main features of the unifacial leaf-points, the most characteristic artefact of this period. Then a technological approach permited to confirm the homogeneity of the technical choices made by early Solutrean populations of Ardèche, South-Western France and Paris Basin. Finally, a study of the lithic raw material shows surprising economical choices, notably material coming from northern regions and from the other side of the Rhône valley.

  17. The Emotional Communication in Hearing Questionnaire (EMO-CHeQ): Development and Evaluation.

    Science.gov (United States)

    Singh, Gurjit; Liskovoi, Lisa; Launer, Stefan; Russo, Frank

    2018-06-11

    The objectives of this research were to develop and evaluate a self-report questionnaire (the Emotional Communication in Hearing Questionnaire or EMO-CHeQ) designed to assess experiences of hearing and handicap when listening to signals that contain vocal emotion information. Study 1 involved internet-based administration of a 42-item version of the EMO-CHeQ to 586 adult participants (243 with self-reported normal hearing [NH], 193 with self-reported hearing impairment but no reported use of hearing aids [HI], and 150 with self-reported hearing impairment and use of hearing aids [HA]). To better understand the factor structure of the EMO-CHeQ and eliminate redundant items, an exploratory factor analysis was conducted. Study 2 involved laboratory-based administration of a 16-item version of the EMO-CHeQ to 32 adult participants (12 normal hearing/near normal hearing (NH/nNH), 10 HI, and 10 HA). In addition, participants completed an emotion-identification task under audio and audiovisual conditions. In study 1, the exploratory factor analysis yielded an interpretable solution with four factors emerging that explained a total of 66.3% of the variance in performance the EMO-CHeQ. Item deletion resulted in construction of the 16-item EMO-CHeQ. In study 1, both the HI and HA group reported greater vocal emotion communication handicap on the EMO-CHeQ than on the NH group, but differences in handicap were not observed between the HI and HA group. In study 2, the same pattern of reported handicap was observed in individuals with audiometrically verified hearing as was found in study 1. On the emotion-identification task, no group differences in performance were observed in the audiovisual condition, but group differences were observed in the audio alone condition. Although the HI and HA group exhibited similar emotion-identification performance, both groups performed worse than the NH/nNH group, thus suggesting the presence of behavioral deficits that parallel self

  18. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  19. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  20. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  1. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  2. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  3. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  4. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  5. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  6. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  7. Altruisti, cooperativi e morali: Perché è più facile esserlo domani che oggi

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.

    2013-01-01

    Un portafogli smarrito e ritrovato. Una donazione ad un ente che si occupa di ricerca sulle malattie degenerative. Una tangente non accettata. Un divorzio che si conclude senza il ricorso al tribunale. Alla base di tutti questi eventi vi è la tendenza umana a cooperare, ad essere altruisti e ad

  8. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  9. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  10. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  11. Natural gas prices in Italy. Tariffs geographical distribution; Metano. Paese che vai, prezzo che trovi

    Energy Technology Data Exchange (ETDEWEB)

    Marrocchelli, A. [ENEA, Rome (Italy). Centro Ricerche Casaccia

    2000-11-01

    The annual report on services and activity carries at some evaluations of data concerned the natural gas market: total consumption, costs and prices in Italy and comparative evaluations with other european countries. [Italian] La relazione annuale sullo stato dei servizi e sull'attivita' svolta, presentata dal Presidente dell'Autorita' per l'energia elettrica e il gas, porta ad alcune considerazioni sui dati che riguardano il mercato del gas naturale: i consumi totali, i costi e i prezzi in Italia, il confronto con i costi e i prezzi praticati negli altri paesi europei.

  12. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  13. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  14. Storie ‘vere’ ed eroine dei romanzi. Rappresentare la Somalia in 'Ilaria Alpi. La ragazza che voleva raccontare l’inferno' e 'Non dirmi che hai paura'

    Directory of Open Access Journals (Sweden)

    Simone Brioni

    2016-09-01

    Full Text Available ‘True’ Stories and Heroines in Novels: The Representation of Somalia in Ilaria Alpi: The Young Woman Who Wanted to Narrate Hell and Don’t Tell Me You Are AfraidThis article analyses Gigliola Alvisi’s Ilaria Alpi: La ragazza che voleva raccontare l’inferno [Ilaria Alpi: The Young Woman Who Wanted to Narrate the Hell] (2014 and Giuseppe Catozzella’s Non dirmi che hai paura [Don’t Tell Me You Are Afraid] (2014, two novels that deal with two recent events in Somali and Italian history, the killing of the journalist Ilaria Alpi in Mogadishu in 1994 and the death of Samia Yosuf Omar while she was trying to reach the Italian shores from Libya by boat. Alvisi’s text is analysed in comparison with other fictional and journalistic representations of Ilaria Alpi, while Non dirmi che hai paura is examined through what Catozzella considers the two constitutive dimensions of the novel: documentation and identification. Drawing on Stefano Jossa’s reflections on the construction of literary heroes, the article challenges Alvisi’s and Catozzella’s claims that they represent ‘true stories’. The article also argues that the main characters of these literary works are portrayed as heroines and role models for the emancipation of Muslim women.

  15. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  16. La Pubblica Amministrazione in uno scenario che cambia

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2009-03-01

    Full Text Available Questo numero, mirato alle implicazioni dell'utilizzo del dato territoriale nel contesto delle PA, le Pubbliche Amministrazioni, si arricchisce di un contenuto ulteriore, particolarmente spaziale; GEOmedia esce infatti in coincidenza con una manifestazione che possiamo considerare la vetrina mediterranea privilegiata per la promozione culturale, scientifica e commerciale delle istituzioni e del segmento dell’industria aerospaziale europea ed italiana.

  17. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  18. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  19. Demonstrating the Open Data Repository's Data Publisher: The CheMin Database

    Science.gov (United States)

    Stone, N.; Lafuente, B.; Bristow, T.; Pires, A.; Keller, R. M.; Downs, R. T.; Blake, D.; Dateo, C. E.; Fonda, M.

    2018-04-01

    The Open Data Repository's Data Publisher aims to provide an easy-to-use software tool that will allow researchers to create and publish database templates and related data. The CheMin Database developed using this framework is shown as an example.

  20. Molecular Interaction and Cellular Location of RecA and CheW Proteins in Salmonella enterica during SOS Response and Their Implication in Swarming.

    Science.gov (United States)

    Irazoki, Oihane; Aranda, Jesús; Zimmermann, Timo; Campoy, Susana; Barbé, Jordi

    2016-01-01

    In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  1. Molecular interaction and cellular location of RecA and CheW proteins in Salmonella enterica during SOS response and their implication in swarming

    Directory of Open Access Journals (Sweden)

    Oihane Irazoki

    2016-10-01

    Full Text Available In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  2. CheShift-2 resolves a local inconsistency between two X-ray crystal structures

    International Nuclear Information System (INIS)

    Vila, Jorge A.; Sue, Shih-Che; Fraser, James S.; Scheraga, Harold A.; Dyson, H. Jane

    2012-01-01

    Since chemical shifts provide important and relatively accessible information about protein structure in solution, a Web server, CheShift-2, was developed for structure interrogation, based on a quantum mechanics database of 13 C α chemical shifts. We report the application of CheShift-2 to a local inconsistency between two X-ray crystal structures (PDB IDs 1IKN and 1NFI) of the complex between the p65/p50 heterodimer of NFκB and its inhibitor IκBα. The availability of NMR resonance assignments that included the region of the inconsistency provided an opportunity for independent validation of the CheShift-2 server. Application of the server showed that the 13 C α chemical shifts measured for the Gly270-Pro281 sequence close to the C-terminus of IκBα were unequivocally consistent with the backbone structure modeled in the 1IKN structure, and were inconsistent with the 1NFI structure. Previous NOE measurements had demonstrated that the position of a tryptophan ring in the region immediately N-terminal in this region was not consistent with either structure. Subsequent recalculation of the local structure in this region, based on the electron density of the deposited structure factors for 1IKN, confirmed that the local backbone structure was best modeled by 1IKN, but that the rotamer of Trp258 is consistent with the 1NFI structure, including the presence of a hydrogen bond between the ring NεH of Trp258 and the backbone carbonyl group of Gln278. The consensus between all of these measures suggests that the CheShift-2 server operates well under circumstances in which backbone chemical shifts are available but where local plasticity may render X-ray structural data ambiguous.

  3. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  4. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  5. X-Ray Diffraction on Mars: Scientific Discoveries Made by the CheMin Instrument

    Science.gov (United States)

    Rampe, E. B.; Blake, D. F.; Ming, D. W.; Bristow, T. F.

    2017-01-01

    The Mars Science Laboratory Curiosity landed in Gale crater in August 2012 with the goal to identify and characterize habitable environments on Mars. Curiosity has been studying a series of sedimentary rocks primarily deposited in fluviolacustrine environments approximately 3.5 Ga. Minerals in the rocks and soils on Mars can help place further constraints on these ancient aqueous environments, including pH, salinity, and relative duration of liquid water. The Chemistry and Mineralogy (CheMin) X-ray diffraction and X-ray fluorescence instrument on Curiosity uses a Co X-ray source and charge-coupled device detector in transmission geometry to collect 2D Debye-Scherrer ring patterns of the less than 150 micron size fraction of drilled rock powders or scooped sediments. With an angular range of approximately 2.52deg 20 and a 20 resolution of approximately 0.3deg, mineral abundances can be quantified with a detection limit of approximately 1-2 wt. %. CheMin has returned quantitative mineral abundances from 16 mudstone, sandstone, and aeolian sand samples so far. The mineralogy of these samples is incredibly diverse, suggesting a variety of depositional and diagenetic environments and different source regions for the sediments. Results from CheMin have been essential for reconstructing the geologic history of Gale crater and addressing the question of habitability on ancient Mars.

  6. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  7. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  8. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  9. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  10. The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima

    International Nuclear Information System (INIS)

    Vu, Anh; Hamel, Damon J.; Zhou Hongjun; Dahlquist, Frederick W.

    2011-01-01

    The bacterial histidine autokinase CheA contains a histidine phosphotransfer (Hpt) domain that accepts a phosphate from the catalytic domain and donates the phosphate to either target response regulator protein, CheY or CheB. The Hpt domain forms a helix-bundle structure with a conserved four-helix bundle motif and a variable fifth helix. Observation of two nearly equally populated conformations in the crystal structure of a Hpt domain fragment of CheA from Thermotoga maritima containing only the first four helices suggests more mobility in a tightly packed helix bundle structure than previously thought. In order to examine how the structures of Hpt domain homologs may differ from each other particularly in the conformation of the last helix, and whether an alternative conformation exists in the intact Hpt domain in solution, we have solved a high-resolution, solution structure of the CheA Hpt from T. maritima and characterized the backbone dynamics of this protein. The structure contains a four-helix bundle characteristic of histidine phosphotransfer domains. The position and orientation of the fifth helix resembles those in known Hpt domain crystal and solution structures in other histidine kinases. The alternative conformation that was reported in the crystal structure of the CheA Hpt from T. maritima missing the fifth helix is not detected in the solution structure, suggesting a role for the fifth helix in providing stabilizing forces to the overall structure.

  11. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  12. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-03-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  13. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  14. Reading Strategies: Issues in the Computerization of Machiavelli's "Il demonio che prese moglie".

    Science.gov (United States)

    Morgan, Leslie Zarker

    1994-01-01

    The ideal computer-based foreign language reading program must include cognitive background, a learning taxonomy, sound computer design, and knowledge of what is needed for the specific language. Machiavelli's "Il demonia che prese moglie" is chosen for study due to its historical interest. (63 references) (CK)

  15. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  16. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  17. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  18. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  19. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to <150 microns, and delivered to instruments in the body of the rover. A drilled sample of sediment in outcrop is anticipated. At the time of writing this abstract, promising outcrops are

  20. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  1. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  2. Invasive urodynamic testing prior to surgical treatment for stress urinary incontinence in women: cost-effectiveness and value of information analyses in the context of a mixed methods feasibility study.

    Science.gov (United States)

    Homer, Tara; Shen, Jing; Vale, Luke; McColl, Elaine; Tincello, Douglas G; Hilton, Paul

    2018-01-01

    INVESTIGATE-I (INVasive Evaluation before Surgical Treatment of Incontinence Gives Added Therapeutic Effect?) was a mixed methods study to assess the feasibility of a future randomised controlled trial of invasive urodynamic testing (IUT) prior to surgery for stress urinary incontinence (SUI) in women. Here we report one of the study's five components, with the specific objectives of (i) exploring the cost-effectiveness of IUT compared with clinical assessment plus non-invasive tests (henceforth described as 'IUT' and 'no IUT' respectively) in women with SUI or stress-predominant mixed urinary incontinence (MUI) prior to surgery, and (ii) determining the expected net gain (ENG) from additional research. Study participants were women with SUI or stress-predominant MUI who had failed to respond to conservative treatments recruited from seven UK urogynaecology and female urology units. They were randomised to receive either 'IUT' or 'no IUT' before undergoing further treatment. Data from 218 women were used in the economic analysis. Cost utility, net benefit and value of information (VoI) analyses were performed within a randomised controlled pilot trial. Costs and quality-adjusted life years (QALYs) were estimated over 6 months to determine the incremental cost per QALY of 'IUT' compared to 'no IUT'. Net monetary benefit informed the VoI analysis. The VoI estimated the ENG and optimal sample size for a future definitive trial. At 6 months, the mean difference in total average cost was £138 ( p  = 0.071) in favour of 'IUT'; there was no difference in QALYs estimated from the SF-12 (difference 0.004; p  = 0.425) and EQ-5D-3L (difference - 0.004; p  = 0.725); therefore, the probability of IUT being cost-effective remains uncertain. The estimated ENG was positive for further research to address this uncertainty with an optimal sample size of 404 women. This is the largest economic evaluation of IUT. On average, up to 6 months after treatment, 'IUT' may

  3. A technician monitors the CHeX, a USMP-4 experiment which will be flown on STS-87, in the SSPF

    Science.gov (United States)

    1997-01-01

    United States Microgravity Payload-4 (USMP-4) experiments are prepared to be flown on Space Shuttle mission STS-87 in the Space Station Processing Facility at Kennedy Space Center (KSC). Here, a technician is monitoring the Confined Helium Experiment, or CHeX, that will use microgravity to study one of the basic influences on the behavior and properties of materials by using liquid helium confined between silicon disks. CHeX and several other experiments are scheduled for launch aboard STS-87 on Nov. 19 from KSC.

  4. Pretreatment with P-Nitrophenyl Phosphoramides: Spontaneous Reactivation of Blood ChE after Oral Administration to Guinea Pigs

    National Research Council Canada - National Science Library

    Polhuijs, M

    1997-01-01

    ... and of the reference compounds pyridostigmine and physostigmine has been studied in the guinea pig, as determined by measuring spontaneous reactivation of blood ChE inhibited by these pretreatment compounds...

  5. La représentation sociale de la culture de l'Autre : Figures opposées de l'Indien Primitif et du Maghrebin Indépendant chez des élèves de 1ère année d'IUT en situation de problème absurde

    OpenAIRE

    Maffiolo, Daniel

    2006-01-01

    Dans le cadre d'une intervention pédagogique, 47 élèves en 1ère année d'IUT sont soumis à un problème absurde de sciences humaines comparant un groupe de Maghrebins et un groupe de Zapotèques. Après avoir présenté les effets quantitatifs en termes de contrat de communication didactique, on propose une analyse qualitative intertextuelle des copies, mettant à jour la production collective d'une double représentation sociale opposant sous forme argumentative l'Indien Primitif au Maghrebin Indépe...

  6. Report to EuCheMS Division of Analytical Chemistry on CITAC Activity

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Wegsheider, Wolfhard

    Although the CITAC organisation [1] was founded on traceability, it embraces a variety of concepts allocated specifically to quality assurance. Collaboration with other organisations that promote practices and procedures of quality assurance is essential, and appointed liaison persons...... are encouraged to support this effort. In continuation of this aim a close contact to EuCheMS is desired together with contacts to IUPAC, ISO/REMCO, BIPM/CCQM, ILAC, EA, APLAC, EUROMET, SIM, APMP, AOACI, IAEA, IFCC and SADCMET....

  7. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  8. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  9. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  10. The burden and outcome of in utero transfers.

    Science.gov (United States)

    Musson, Rebecca E; Harrison, Catherine M

    2016-05-01

    To quantify the number of intrauterine transfers (IUTs) arranged by Embrace Yorkshire and Humber Infant and Children's Transport Service and, to determine the outcome of when women delivered their babies, or when they were discharged following transfer. Identification of all IUTs Embrace arranged between January 1, 2011 and February 29, 2012 with data collection to determine delivery time or date of discharge. There were 623 IUT referrals with a mean time taken to arrange a transfer of 109 minutes. The mean distance of IUT was 42.5 miles, and the main reason for IUT request was capacity of referring unit. 247 (52%) women delivered during the same admission and 156 delivered within 48 hours of transfer. Of those undelivered, 111 (48.7%) were discharged within 48 hours. Fibronectin test was used in 51 patients. The IUT service provided by Embrace is busy, with significant demands on administrative staff time. Neonatal cot capacity and gestation are the main reasons for transfer. There is potentially a cohort of women who may not have benefitted from IUT. We suggest the use of obstetric expertise will enhance the service, while ongoing work looking at neonatal unit cot capacity problems continues. ©2015 Foundation Acta Paediatrica. Published by John Wiley & Sons Ltd.

  11. Tempi che cambiano, luoghi che si trasformano: i mutamenti nei nuraghi fra l’età del Bronzo ed il Primo Ferro

    Directory of Open Access Journals (Sweden)

    Mauro Perra

    2017-01-01

    Full Text Available Riassunto: Il lungo percorso della Civiltà Nuragica, compreso fra XVII e X-IX secolo a.C., si caratterizza come un’epoca di grandi trasformazioni che si susseguono nel tempo e lasciano visibili tracce in un paesaggio mutevole, come in un succedersi di macroscopiche unità stratigrafiche. Si trasformano profondamente così non solo i monumenti ed il paesaggio, ma anche le stesse strutture sociali e politiche delle comunità nuragiche fino alla trasfigurazione del ricordo in mito nei centri cerimoniali o santuari. Abstract: The long trajectory of the Nuragic civilisation (17th - 10th/9th centuries B.C. is characterised by a succession of dramatic changes leaving visible traces in a varying landscape, like stratigraphy on a regional scale. These changes affect not only the Nuragic monuments and landscape but also the social and political institutions of Nuragic communities, culminating in a transfiguration of memory and a new mythology apparent in ceremonial centres and sanctuaries.

  12. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  13. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  14. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  15. I mutamenti tecnologici nelle condizioni odierne: riflessioni di un economista. (Technological changes in present-day conditions: reflections of an economist

    Directory of Open Access Journals (Sweden)

    P. SYLOS LABINI

    2013-12-01

    Full Text Available Tutti gli economisti concordano sul fatto che i cambiamenti tecnologici costituiscono la principale fonte di sviluppo economico . Tuttavia , molti economisti sono convinti che tali cambiamenti sono importanti solo per spinegre verso l'alto il tasso di sviluppo economico, che a lungo andare sarebbe altrimenti più basso e costante , con l'accumulazione di capitale e forza lavoro di crescita in atto gradualmente . Al contrario , il presente lavoro sostiene che nel lungo periodo , il progresso tecnico non è il fattore principale dello sviluppo economico , ma piuttosto una condizione necessaria . L'autore esamina l'evoluzione tecnologica nella teoria economica e la storia dello sviluppo economico . La disoccupazione tecnologica e la disoccupazione keynesiana sono quindi analizzate , così come la riduzione dell'orario di lavoro . Infine , l'autore considera più recenti sviluppi tecnologici ed economici e la loro relazione con il lavoro manuale e intellettuale .All economists agree that technological changes constitute the main source of economic development. Nonetheless, many economists are convinced that such changes are important only in pushing up the rate of economic development, which in the long run would otherwise be lower and constant, with capital accumulation and labor force growth taking place gradually. To the contrary, the present work argues that in the long run, technical progress is not the main factor of economic development, but rather a necessary condition. The author examines technological change in economic theory and the history of economic development. Technological unemployment and Keynesian unemployment are then considered as well as the reduction of working hours. Finally, the author considers more recent technological and economic developments and their relation to manual and intellectual labour.JEL: O33, E24

  16. Luzia Simionescu - Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Luzia Simionescu. Articles written in Journal of Chemical Sciences. Volume 112 Issue 1 February 2000 pp 19-26 Inorganic and Analytical. Improved technology for manufacture of carbon electrodes · A Platon A Dumbrava N Iutes-Petrescu Luzia Simionescu · More Details ...

  17. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  18. “Nell’occhio che riscopre la luce”: tempo, Storia e memoria nella poesia di Salvatore Quasimodo

    OpenAIRE

    Alessandro Martini

    2015-01-01

    La riflessione sul rapporto dell’uomo con il tempo e con la storia percorre senza soluzione di continuità l’opera poetica di Salvatore Quasimodo. Spesso a disagio in una dimensione temporale fissa e definita, schiacciato tra dolore dell’esilio, insensatezza della guerra e crisi del dopoguerra, il poeta interroga gli evi passati e le ere future in cerca di un’armonia che appare il più delle volte sfuggente.

  19. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  20. Lessons Learned from the Crew Health Care System (CHeCS) Rack 1 Environmental Control and Life Support (ECLS) Design

    Science.gov (United States)

    Williams, David E.

    2006-01-01

    This paper will provide an overview of the International Space Station (ISS) Environmental Control and Life Support (ECLS) design of the Crew Health Care System (CHeCS) Rack 1 and it will document some of the lessons that have been learned to date for the ECLS equipment in this rack.

  1. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  2. Technological innovation in the Italian school. A critical and historical analysis

    Directory of Open Access Journals (Sweden)

    Camilla Moricca

    2016-04-01

    Full Text Available Technological introduction into school takes place in the form of innovations that maintaining low awareness and memories of the previous phases. The work recalls briefly the main institutional initiatives and best-known theories of reference in order to foster a historical-critical awareness of what the experience may have informed us. In the last part we focus on references in vogue, such as coding and robotics, wondering if they are really innovations and if they are based on valid educational criteria. L’innovazione tecnologica nella scuola italiana. Per un’analisi critica e storicaL’introduzione tecnologica nella scuola è caratterizzata da ondate che si succedono conservando scarsa consapevolezza e ricordo della fase precedente. Il lavoro ripercorre in modo sintetico le principali iniziative istituzionali e le più note teorie di riferimento che le hanno accompagnate nell’ottica di favorire una consapevolezza storico-critica su ciò che l’esperienza ci può aver insegnato. Nell’ultima parte ci si sofferma su riferimenti oggi in voga, quali il coding e la robotica, chiedendoci se siano davvero nuovi e se poggino su criteri pedagogici fondati.

  3. Cherenkov and scintillation light separation on the CheSS experiment

    Science.gov (United States)

    Caravaca, Javier; Land, Benjamin; Descamps, Freija; Orebi Gann, Gabriel D.

    2016-09-01

    Separation of the scintillation and Cherenkov light produced in liquid scintillators enables outstanding capabilities for future particle detectors, the most relevant being: particle directionality information in a low energy threshold detector and improved particle identification. The CheSS experiment uses an array of small, fast photomultipliers (PMTs) and state-of-the-art electronics to demonstrate the reconstruction of a Cherenkov ring in liquid scintillator using two techniques: based on the photon density and using the photon hit time information. A charged particle ionizing a scintillation medium produces a prompt Cherenkov cone and late isotropic scintillation light, typically delayed by several ns. The fast response of our PMTs and DAQ provides a precision well below the ns level, making possible the time separation. Furthermore, the usage of the new developed water-based liquid scintillators (WbLS) enhances the separation since it allows tuning of the Cherenkov/Scintillation ratio. Latest results on the separation for pure liquid scintillators and WbLS will be presented.

  4. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  5. CheD: chemical database compilation tool, Internet server, and client for SQL servers.

    Science.gov (United States)

    Trepalin, S V; Yarkov, A V

    2001-01-01

    An efficient program, which runs on a personal computer, for the storage, retrieval, and processing of chemical information, is presented, The program can work both as a stand-alone application or in conjunction with a specifically written Web server application or with some standard SQL servers, e.g., Oracle, Interbase, and MS SQL. New types of data fields are introduced, e.g., arrays for spectral information storage, HTML and database links, and user-defined functions. CheD has an open architecture; thus, custom data types, controls, and services may be added. A WWW server application for chemical data retrieval features an easy and user-friendly installation on Windows NT or 95 platforms.

  6. Changes of serum levels of prealbumin (PAB), cholinesterase (CHE), total bile acid (TBA) and ALT as related to the severity of inflammatory process and hepatic fibrosis in patients with chronic virus B hepatitis

    International Nuclear Information System (INIS)

    Chi Xiaoxia; Chen Jianxiong; Xiong Ying

    2005-01-01

    Objective: To study the correlationship between the serum levels of PAB, CHE, TBA, ALT and the severity of the disease process in patients with chronic virus B hepatitis. Methods: Serum levels of PAB, CHE, ALT (with biochemical methods) and TBA (with RIA) were examined in 93 patients with biopsy proven virus B hepatitis and 46 controls. Results: The 93 patients were of two groups: a less advanced group (n=51) and a more advanced group (n=42). Serum TBA, ALT levels were significnatly higher and serum PAB, CHE levels were significantly lower in the more advanced group than those in the less advanced group (P 0 to s 4 . Changes of levels of ALT were of no regular pattern, but serum levels of TBA regularly increased and levels of PAB, CHE regularly decreased as the fibrosis grading proceeded from s 0 to s 4 and the differences between the levels in s 4 and any other grading were significant (P<0.01). Conclusion: Combined determination of these serum markers might reflect the degree of inflammatory process and hepatic fibrosis in patients with virus B hepatitis, leading to earlier detection of cirrhosis. (authors)

  7. Teachers’ training and the use of educational technologies: research results

    Directory of Open Access Journals (Sweden)

    Marina Chiaro

    2017-01-01

    Full Text Available Acquire technological skills is an important requirement clearly evident by teachers in primary and secondary school at the end of a blended training course held at the University of Rome Three about issues related to students with Learning Disabilities. It is also significant the chance for teachers to constitute professional communities, such as the Community of Practice in the Lifelong Learning perspective, that might lead to collaborative strategies, knowledge sharing, discussion and reflection that are necessary to face the difficulties that every innovation involves. These factors can help teachers to overcome the condition of isolation which represents an important barrier to the development of an inclusive school in order to design inclusive educational strategies with the use of Information and Communication Technology according to the cultural perspective of the International Classification of Functioning, Disability and Health for Children and Youth.Formazione degli insegnanti ed impiego delle tecnologie didattiche per l’inclusione: risultati di ricercaAcquisire competenze tecnologiche rappresenta una importante esigenza palesata da docenti in servizio nella scuola primaria e secondaria di I e II grado al termine di un percorso formativo svolto in modalità blended presso l’Università degli Studi di Roma Tre su tematiche relative agli allievi con Disturbi Specifici di Apprendimento. Rilevante anche la possibilità per gli insegnanti di costituire delle comunità professionali, quali le Comunità di Pratica, in ottica di lifelong learning, che possano dar luogo a strategie collaborative, di condivisione delle conoscenze, di confronto e riflessione necessari per affrontare le difficoltà che ogni innovazione comporta. Tali modalità possono rappresentare un supporto al superamento della condizione di isolamento in cui spesso i docenti si trovano ad operare, aspetto che costituisce uno dei principali ostacoli allo sviluppo di una

  8. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d'Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean-François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d'Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d'Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey.

  9. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  10. Intrauterine transfusion and non-invasive treatment options for hemolytic disease of the fetus and newborn - review on current management and outcome.

    Science.gov (United States)

    Zwiers, Carolien; van Kamp, Inge; Oepkes, Dick; Lopriore, Enrico

    2017-04-01

    Hemolytic disease of the fetus and newborn (HDFN) remains a serious pregnancy complication which can lead to severe fetal anemia, hydrops and perinatal death. Areas covered: This review focusses on the current prenatal management, treatment with intrauterine transfusion (IUT) and promising non-invasive treatment options for HDFN. Expert commentary: IUTs are the cornerstone in prenatal management of HDFN and have significantly improved perinatal outcome in the past decades. IUT is now a relatively safe procedure, however the risk of complications is still high when performed early in the second trimester. Non-invasive management using intravenous immunoglobulin may be a safe alternative and requires further investigation.

  11. The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

    Directory of Open Access Journals (Sweden)

    Yehuda Ben-Shahar

    2010-02-01

    Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

  12. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d’Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean–François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d’Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d’Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey. PMID:26745626

  13. Membrane technologies for desalting seawater and managing water resources; Le tecnologie di membrana per la dissalazione dell'acqua di mare e la gestione della risorsa idrica

    Energy Technology Data Exchange (ETDEWEB)

    Pizzichini, M. [ENEA, Divisione Biotecnologie e Agricoltura, Rome (Italy); Braccio, G. [ENEA, Divisione Fonti Rinnovabili, Rome (Italy); Bozzini, A. [Food and Agriculture Organization of the United Nations, Rome (Italy)

    2001-04-01

    Water is an irreplaceable resource for life that fundamentally conditions human economic and social development, especially in arid regions. Clean technologies such as membrane separation processes, in particular reverse osmosis, whether or not coupled with photovoltaic technology, can solve local water-deficit problems that jeopardise development and human life itself. The commercialisation of these systems offers an interesting opportunity for Italian manufacturers. [Italian] L'acqua e' una fonte di vita insostituibile che condiziona profondamente lo sviluppo economico e sociale dell'uomo, specialmente nelle aree geografiche aride. L'impiego di tecnologie pulite come i processo separativi a membrana, in particoalre di osmosi inversa accoppiati o meno alla tecnologia fotovoltaica, possono risolvere problemi locali di carenza idrica che mettono a rischio lo sviluppo e la vita stessa delle popolazioni.

  14. Serum cholinesterase polymorphism (CHE1 and CHE2 loci) among several Indian groups from Amazon region of Brazil, and segregation of the C5 variant in families.

    Science.gov (United States)

    Guerreiro, J F; Santos, S E; Aguiar, G F

    1989-04-01

    Eight Indian tribes from the Amazon region of Brazil (Araweté, Arara, Yamamadi, Kararaô, Karitiana, Waiampi, Surui and Cinta Larga) were studied for the distribution of the atypical and C5 variants of serum cholinesterase. None of them presented the CHE1*A allele, but the C5 variant was found in the Araweté (20.4%), Kararaô (15.6%), Karitiana (50.5%), Surui (12.3%) and Cinta Larga (19.6%) tribes. The frequency of the C5+ phenotype in the Karitiana is the highest reported thus far in human populations. Segregation studies considering the C5 variant were made among the Karitiana, and also among the Urubu-Kaapor and Munduruku tribes previously studied by Guerreiro et al [1987a, 1987b]. Most of the data were in agreement with the genetic hypothesis, but they also revealed a significant lack of the C5+ phenotype in offspring from C5+ X C5+ matings, as well as the occurrence of two C5+ children from C5- X C5- unions, in the Urubu-Kaapor tribe.

  15. Per un dizionario della ricerca sul Technology Enhanced Learning

    Directory of Open Access Journals (Sweden)

    Nicolas Balacheff

    2012-12-01

    Full Text Available Questo articolo presenta le principali linee di azione di un meta-progetto iniziato nell’ambito della Rete di Eccellenza STELLAR con l’obiettivo di creare e dare struttura a un Thesaurus e a un Dizionario dei termini e delle espressioni in uso nell’ambito della ricerca sul Technology Enhanced Learning (TEL. Questo meta-progetto intende fornire gli strumenti per superare le difficoltà dovute alla ricchezza e alla rapida evoluzione di quest’area di ricerca multidisciplinare, allo scopo di facilitare il coinvolgimento dei ricercatori giovani e di quelli che si accostano per la prima volta a questo settore, nonché di tutti coloro che a vario titolo si interessano al TEL. Il meta-progetto in questione ha anche l’ambizione di facilitare la comunicazione tra individui appartenenti a diverse culture scientifiche e tra le lingue nazionali. Dopo una presentazione delle motivazioni, vengono discussi gli attuali sviluppi del lavoro e presentati i criteri seguiti per le principali scelte effettuate in merito ai metodi e alle tecnologie utilizzate.

  16. Information and technology are not enough: we need also knowledge and science.

    Directory of Open Access Journals (Sweden)

    Ferdinando Boero

    2011-09-01

    Full Text Available EnThe era of Information and Technology has changed our life, allowing those who can access an internet connection to consult an almost unlimited number of sites covering almost all topics. It is difficult, however, to distinguish reliable information from unreliable one. The data posted in the web might be very precise while lacking accuracy. It is very important that information is based on solid knowledge, like the one guaranteed by peer-reviewed scientific journals. It is argued, with some examples, that the current policy of Information availability throught the internet is not based on sufficient knowledge. More reliability is available at the sites of scientific journals, but they often require a subscription and enforce copyright restrictions, so hampering the spread of knowledge which is the basis of scientific "publication" (i.e. the delivery of the results of science to the public.ItL'era della Tecnologia dell'Informazione ha cambiato la nostra vita, permettendo a chi abbia una connessione internet di consultare un numero illimitato di siti che coprono quasi tutti gli argomenti. E' difficile, tuttavia, distinguere le informazioni attendibili da quelle inattendibili. I dati pubblicati nella rete possono essere molto precisi ma mancare completamente di accuratezza. E' molto importante che le informazioni siano basate su solide conoscenze, come quella garantita dalla revisione dei pari (peer-review utilizzata dalle riviste scientifiche. Questo lavoro suggerisce, con alcuni esempi, che la politica corrente di disponibilità di informazioni attraverso internet non è basata su sufficiente conoscenza. Una maggiore attendibilità è disponibile sui siti delle riviste scientifiche, ma essi spesso richiedono un abbonamento e impongono restrizioni basate sul copyright, impedendo così la diffusione delle conoscenze che è alla base delle "pubblicazioni" scientifiche (cioè della disponibilità pubblica dei risultati della ricerca scientifica.

  17. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  18. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Multimedia

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  19. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  20. Linee di ricerca emergenti nell’educational technology

    Directory of Open Access Journals (Sweden)

    Maria Ranieri

    2015-12-01

    Full Text Available Il presente contributo intende restituire un quadro delle linee di ricerca emergenti nel campo dell’educational technology. Le fonti utilizzate a questo scopo e illustrate nella sezione introduttiva hanno permesso di individuare sei aree di interesse, vale a dire: apprendere in mobilità; social web e apprendimento; learning analytics; digital literacy/digital reading; OER e MOOC; ambienti immersivi e videogame. Per ciascuna di queste aree vengono delineate le principali direttrici di ricerca che le connotano e i relativi avanzamenti. Il lavoro si conclude con alcune considerazioni di sintesi sulle tendenze generali della ricerca nel settore.

  1. Nouvelles fonctions de l'agriculture et dynamiques des exploitations: une analyse chorématique dans les monts d'Ardèche

    Directory of Open Access Journals (Sweden)

    Muriel Bonin

    2001-06-01

    Full Text Available Les modèles spatiaux sont utilisés pour l'analyse des trajectoires d'exploitations agricoles pour mettre en évidence les liens entre les transformations socio-économiques et les dynamiques de territoires. Les traits de dynamiques spatiales sont identifiés et utilisés pour analyser l'impact de l'introduction de l'agritourisme dans les exploitations dans le Parc naturel régional des monts d'Ardèche.

  2. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  3. International trade, technological change and evolution of work market; Commercio internazionale, cambiamento tecnologico e mercato del lavoro

    Energy Technology Data Exchange (ETDEWEB)

    Cacciotti, M.

    1999-07-01

    The report estimates the historic series of wages and employment depending on the average unit value of importation prices in the most important european countries, Italy, France and Germany for the years 1988-1996. Results shows that in the traditional sectors, with unskilled employment are negative influenced by international trade, otherwise, in the technological advanced sectors, influenced are to be considered positive. [Italian] Lo studio sottopone a stima le serie storiche dei salari e dell'occupazione in funzione del valore medio unitario dei prezzi alle importazioni per i piu' importanti paesi europei, Italia, Francia, Germania, durante il periodo 1988-1996. I risultati mostrano che per i settori tradizionali, che impiegano manodopera meno qualificata, il commercio internazionel tende ad influenzare negativamente i livelli salariali ed occupazionali, mentre per i settorui tecnologicamente piu' avanzati determina variazioni positive dei salari e dell'occupazioni.

  4. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  5. Un uomo che valuta

    Directory of Open Access Journals (Sweden)

    Massimiliano Nicoli

    2015-12-01

    Full Text Available This article – written as a short story in the second-person narrative mode – focuses on the subjective, everyday experience of an individual concerned by some practices of evaluation. Through the telling of this concrete experience, it aims at giving substance to the idea that the practices of evaluation constitute an «environmental technology of government» typical of neoliberal governmentality as well as a self-disciplined technique of building one’s own «soul» as human capital.

  6. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  7. Web 2.0 technologies at school: formal and informal learning strategies

    Directory of Open Access Journals (Sweden)

    Davide Parmigiani

    2012-08-01

    Full Text Available Questo articolo presenta uno studio che focalizza le strategie di apprendimento degli alunni della scuola secondaria di primo grado che utilizzano frequentemente le tecnologie e il web 2.0. La ricerca è stata strutturata su tre questioni fondamentali: l’utilizzo del web 2.0 e dei social network supporta negli alunni la motivazione allo studio, la pianificazione e l’autoregolazione dei propri processi di apprendimento e, infine, l’utilizzo di strategie funzionali allo studio? Lo studio sottolinea che alcune potenzialità delle applicazioni 2.0 sono utili per allenare gli alunni ad usare strategie cognitive efficaci, se sostenute da una progettazione e da modelli didattici aperti al problem-solving e alla ricerca-azione.

  8. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  9. L’utilisation des strat��gies d’apprentissage d’une langue dans un environnement des TICE L’utilisation des stratégies d’apprentissage d’une langue dans un environnement des TICE

    Directory of Open Access Journals (Sweden)

    Janet Atlan

    2000-06-01

    Full Text Available L'étude des différences individuelles qui caractérisent les apprenants s'intègre de plus en plus dans les travaux en didactique des langues. L'utilisation des stratégies d'apprentissage est un type de différences individuelles qui semble être assez sensible à l'environnement pédagogique. Cet article rend compte d'une étude expérimentale entreprise avec des étudiants français en IUT qui avait pour objectif de déterminer si l'utilisation des stratégies d'apprentissage par un apprenant de langues est influencée par la technologie de l'information et de la communication (TIC utilisée pour la présentation d'une tâche d'apprentissage. Le "Strategy Inventory for Language Learning" d'Oxford a été utilisé comme instrument lors de cette étude. L'étude a montré qu'il y a effectivement interaction entre la TIC utilisée et le choix de stratégies effectué par l'apprenant et les résultats permettent de tirer quelques conclusions quant à l'utilité d'un entraînement spécifique à l'utilisation des stratégies d'apprentissage en présence des technologies de l’information et de la communication pour l’enseignement (TICE.The study of the individual differences which characterize learners is becoming more and more common in language learning research, and the use of learning strategies is an instance of individual differences which seems to be rather sensitive to the pedagogical environment. This article reports on an experimental study undertaken with students in a French technical college to determine if the use of learning strategies by a foreign language student is influenced by the technology used to present a language learning task. Oxford's Strategy Inventory for Language Learning was the principal instrument used for this study. The study showed that there was indeed some interaction between the technology used and the choice of learning strategies and the results lead to some interesting considerations on the usefulness

  10. Low Energy X-Ray and Electron Physics and Technology for High-Temperature Plasma Diagnostics

    Science.gov (United States)

    1987-10-01

    cransmission band for Che rejeccion of such background radiacions around Che 500-1000 eV region by combining as a primary monochromator a 300 ßg...X-Radiations of the Solar Corona," Technical Report No. 7, 1-413, AFOSR 66-2446 (September 1966). 30. "X-Ray Absorption in the 2 to

  11. Intrauterine exposure to tobacco and executive functioning in high school.

    Science.gov (United States)

    Rose-Jacobs, Ruth; Richardson, Mark A; Buchanan-Howland, Kathryn; Chen, Clara A; Cabral, Howard; Heeren, Timothy C; Liebschutz, Jane; Forman, Leah; Frank, Deborah A

    2017-07-01

    Executive functioning (EF), an umbrella construct encompassing gradual maturation of cognitive organization/management processes, is important to success in multiple settings including high school. Intrauterine tobacco exposure (IUTE) correlates with negative cognitive/behavioral outcomes, but little is known about its association with adolescent EF and information from real-life contexts is sparse. We evaluated the impact of IUTE on teacher-reported observations of EF in urban high school students controlling for covariates including other intrauterine and adolescent substance exposures. A prospective low-income birth cohort (51% male; 89% African American/Caribbean) was followed through late adolescence (16-18 years old). At birth, intrauterine exposures to cocaine and other substances (52% cocaine, 52% tobacco, 26% marijuana, 26% alcohol) were identified by meconium and/or urine assays, and/or maternal self-report. High school teachers knowledgeable about the student and unaware of study aims were asked to complete the Behavior Rating Inventory of Executive Functioning-Teacher Form (BRIEF-TF) annually. Teachers completed at least one BRIEF-TF for 131 adolescents. Multivariable analyses included controls for: demographics; intrauterine cocaine, marijuana, and alcohol exposures; early childhood exposures to lead; and violence exposure from school-age to adolescence. IUTE was associated with less optimal BRIEF-TF Behavioral Regulation scores (p <0.05). Other intrauterine substance exposures did not predict less optimal BRIEF-TF scores, nor did exposures to violence, lead, nor adolescents' own substance use. IUTE is associated with offspring's less optimal EF. Prenatal counseling should emphasize abstinence from tobacco, as well as alcohol and illegal substances. Copyright © 2017 Elsevier B.V. All rights reserved.

  12. Novel activation domain derived from Che-1 cofactor coupled with the artificial protein Jazz drives utrophin upregulation.

    Science.gov (United States)

    Desantis, Agata; Onori, Annalisa; Di Certo, Maria Grazia; Mattei, Elisabetta; Fanciulli, Maurizio; Passananti, Claudio; Corbi, Nicoletta

    2009-02-01

    Our aim is to upregulate the expression level of the dystrophin related gene utrophin in Duchenne muscular dystrophy, thus complementing the lack of dystrophin functions. To this end, we have engineered synthetic zinc finger based transcription factors. We have previously shown that the artificial three-zinc finger protein named Jazz fused with the Vp16 activation domain, is able to bind utrophin promoter A and to increase the endogenous level of utrophin in transgenic mice. Here, we report on an innovative artificial protein, named CJ7, that consists of Jazz DNA binding domain fused to a novel activation domain derived from the regulatory multivalent adaptor protein Che-1/AATF. This transcriptional activation domain is 100 amino acids in size and it is very powerful as compared to the Vp16 activation domain. We show that CJ7 protein efficiently promotes transcription and accumulation of the acetylated form of histone H3 on the genomic utrophin promoter locus.

  13. Electricity to natural gas competition under customer-side technological change: a marginal cost pricing analysis; Cambiamento tecnologico a valle del contatore e concorrenza fra elettricita' e gas naturale

    Energy Technology Data Exchange (ETDEWEB)

    Gulli' , Francesco [Bocconi Univ., Milan (Italy). Iefe

    2004-07-01

    of specific technological solutions. [Italian] Questo articolo si prefigge di valutare l'impatto del cambiamento tecnologico (a valle del contatore) nell'industria energetica a rete (elettricita' e gas naturale). Le prestazioni degli impianti di generazione elettrica di piccola taglia e delle pompe di calore elettriche sono significamente migliorate negli ultimi dieci anni, rendendo possibile (o maggiormente conveniente) due traiettorie tecnologiche alternative: il sistema basato esclusivamente sull'utilizzo del gas naturale, possibile grazie all'utilizzo di piccoli impianti di cogenerazione che prefigurerebbe una forte decentrazione dell'offerta energetica; il sistema basato esclusivamente (o quasi) sull'utilizzo dell'elettricita', che invece, grazie all'utilizzo della pompa di calore reversibile, accentuerebbe le caratteristiche di centralizzazione dell'offerta. L'articolo confronta le due alternative sulla base dei corrispondenti costi sociali, somma dei costi interni (privati) e dei costi esterni (di natura prevalentemente ambientale), e conclude che, in termini paradigmatici, il sistema totalmente elettrico risulta preferibile ad una forte decentralizzazione basata sulla diffusione della cosiddetta decentrazione distribuita. Il lavoro tiene opportunamente conto della forte incertezza in merito alle stime dei costi esterni (ed in particolare del costo marginale delle emissioni di gas-serra) e suggerisce che l'attuale grande interesse nello sviluppo della generazione distribuita potrebbe essere attribuibile alla presenza di distorsioni di mercato.

  14. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  15. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  16. Cholestasis in neonates with red cell alloimmune hemolytic disease: incidence, risk factors and outcome.

    Science.gov (United States)

    Smits-Wintjens, Vivianne E H J; Rath, Mirjam E A; Lindenburg, Irene T M; Oepkes, Dick; van Zwet, Erik W; Walther, Frans J; Lopriore, Enrico

    2012-01-01

    Etiology of cholestatic liver disease in neonates with hemolytic disease of the newborn (HDN) has been associated with iron overload due to intrauterine red cell transfusions (IUTs). Data on the incidence and severity of cholestasis in neonates with HDN are scarce, and little is known about pathogenesis, risk factors, neonatal management and outcome. To evaluate incidence, risk factors, management and outcome of cholestasis in neonates with red cell alloimmune hemolytic disease. All (near-) term neonates with HDN due to red cell alloimmunization admitted to our center between January 2000 and July 2010 were included in this observational study. Liver function tests (including conjugated bilirubin) were routinely performed in the neonatal period. We recorded the presence of cholestasis, investigated several potential risk factors and evaluated the management and outcome in affected neonates. A total of 313 infants with red cell alloimmune hemolytic disease treated with or without IUTs were included. The incidence of cholestasis was 13% (41/313). Two risk factors were independently associated with cholestasis: treatment with at least one IUT (OR 5.81, 95% CI 1.70-19.80, p = 0.005) and rhesus D type of alloimmunization (OR 4.66, 95% CI 1.05-20.57, p = 0.042). Additional diagnostic tests to investigate possible causes of cholestasis were all negative. In 5 infants (12%), supportive medical and nutritional therapy was started, and one neonate required iron chelation therapy. Cholestasis occurs in 13% of neonates with HDN due to red cell alloimmunization, and it is independently associated with IUT treatment and rhesus D type of alloimmunization. Copyright © 2012 S. Karger AG, Basel.

  17. Actes de la 9ème conférence des Technologies de l’Information et de la Communication pour l’Enseignement (TICE 2014)

    OpenAIRE

    Frasson , Claude; Labat , Jean-Marc; Gandon , Fabien; Cassagne , David; Jonquet , Clement; Cerri , Stefano A.; pujas , philippe

    2014-01-01

    National audience; Le cycle de conférence TICE a pour objectif de faire tous les deux ans le point sur les résultats de recherches, les nouvelles applications, les derniers usages, et les retours d’expériences dans le domaine de l’éducation supérieure numérique. Le colloque TICE 2014 est organisé par l’IUT de Beziers, une composante de l’Université Montpellier 2. Cette neuvième édition du colloque TICE sera l’occasion de rassembler à Béziers, du 18 au 20 Novembre 2014, la communauté scientifi...

  18. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  19. L’applicazione delle tecnologie fotovoltaiche integrate sulle coperture degli edifici con software GIS

    Directory of Open Access Journals (Sweden)

    Stefano Bonesso

    2013-08-01

    Full Text Available Per pianificare l’utilizzo di tecnologie che sfruttano energia rinnovabile su un territorio, in particolare quelle che riguarda il solare, si possono utilizzare i software GIS (Sistemi Informativi Geografici che consentono di analizzare e rappresentare un dato geo-riferito.  Potential of photovoltaic technologies on buildings’ roofs using geographic information systems (GIS - In order to plan the diffusion of renewable energy technologies, geographic information systems (GIS can be useful. In this study photovoltaic technologies in urban environments were examined, considering the shadows of urban contest and of territory orography evaluated with GIS (ESRI ArcGIS. The results of potential photovoltaic technologies strongly depend on input data but not always roof data are accurate. The aim of this workis to define a tool to improve the results of a GIS simulation on urban scale. To validate the procedure, the results were compared with data monitored by PERSIL project. The analysis was based on the use of geographic information systems, data scanner laser (LiDAR, and software for 3D reconstruction of the buildings.

  20. THE IMPORTANCE AND THE ROLES OF INFORMATION TECHNOLOGIES IN PRESCHOOL EDUCATION

    Directory of Open Access Journals (Sweden)

    Nazım BURGUL

    2008-06-01

    Full Text Available The aim of this research is to determine the importance and the roles of the existing informationtechnologies in preschool education and to do a content analysis.The research is done by using the descriptive study method which is one of the general scanning models. Having examinedthe results of the previous researches, the theoretical framework that would light the way for the research was prepared. Theavailable information about the subject was scanned from resources such as documents, other written sources and also theinternet, and expert’s opinions were asked for. The content analysis of the collected information was done.The preschool period is a process to which all education scientists attach great importance. However, in order to realize theaim of this process, well planned education programmes are needed. The preschool education period provides crèche,nursery and reception education activities. Because of the annual changes of education technologies, positive differences areseen for the teaching activities in this area. On the other hand, there are some requirements to do to speed up the educationand to increase the productivity of education in our present day information society.The preschool education programmes are “the Crèche Programme (0-36 months”, “The Nursery Programme (37-60months and “The Reception Programme (61-72 months”. Optimum educational programs must be prepared for activitiesthat will take place on a daily basis according to specific aims and attitudes to determine the educational status of theseactivities. After having examined the technology-based education model, it is observed by the evaluation and assessmentdiscipline that using equipment such as tv, radio, computer, video, projection, overhead projector and slide apparatus makesthe learning process more effective and productive.As a result, information has become the most expensive product today. The roles of computer-aided education and the

  1. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  2. Technology for a Social Cause: Formulated Emergency Relief Foods for Super Typhoon Yolanda (Haiyan Survivors

    Directory of Open Access Journals (Sweden)

    Maria Patricia V. Azanza

    2015-06-01

    Full Text Available This study details how ready-to-eat (RTE rice and rice-cornstarch noodle (bihon product formulations of the College of Home Economics (CHE of the University of the Philippines Diliman (UPD were used to produce emergency relief foods for the survivors of super typhoon Yolanda (international name: Haiyan in the Philippines. The RTE products were developed using established pasteurization technologies covered with commercial sterility test certifications from the Pilot Food Plant (PFP of UPD-CHE and published food safety considerations for acidified foods. They do not require any cooking or reheating before consumption. They were prescribed with a one-month shelflife at ambient storage temperature (28±2°C during deployment as relief foods. About 5,000 and 3,000 production units of the RTE cooked rice (200 g/pack and bihon (150 g/pack, respectively, were produced at the PFP. Around 300 volunteers composed of faculty, staff, alumni, students, and acquaintances of UPD-CHE’s departments and organizations manned the two-week staggered production, scheduled from late November to the f irst week of December 2013. In cooperation with organizations and private entities, the RTE products were deployed without cost from UPD to the stricken areas of Aklan, Iloilo, and Leyte. Feedback from the recipients of the products was favorable, indicating that the RTE foods are useful as emergency relief ration.

  3. The iron uptake mechanisms of enteroinvasive Escherichia coli Mecanismos de captação de ferro de Escherichia coli enteroinvasora

    Directory of Open Access Journals (Sweden)

    Agda Andrade

    2000-09-01

    Full Text Available Enteroinvasive Escherichia coli strains (EIEC of different serotypes isolated from patients with acute diarrhea were examined for the ability to produce siderophores and iron-regulated outer membrane proteins (IROMP. For iron starvation cultures were grown at 37°C in LB supplied with 200 muM of a-alpha’dypirydil. All strains produced enterobactin and twelve (40% produced aerobactin. The strains showed IROMP varying from 67-82 kDa. Proteins were either induced or stimulated by the iron starvation. Differences were observed in the electrophoretic profile among the serotypes, originating 5 electrophoretic profiles. All serotypes expressed proteins of 82 kDa (FepA and 76 kDa (IutA (except serotype O28ac:H- that did not produce the 76 kDa protein. Several strains (O29:H-, O144:H-, O152:H-, and O167:H- expressed IutA in the outer membrane, in the absence of aerobactin production. Additionally to well characterized proteins (FepA and IutA, we found two IROMP of unknown function in some serotypes: a 71 kDa protein was detected in three profiles and a 67 kDa protein was present in serotype O152:H-. Moreover, two bands (39 and 43 kDa which were not iron-regulated bound specifically to human lactoferrin.Cepas de Escherichia coli enteroinvasora de diferentes sorotipos isoladas de pacientes com diarréia aguda foram examinadas quanto a capacidade de produzir sideróforos e proteínas de membrana externa reguladas pelo ferro (IROMP. O crescimento bacteriano em meio com deficiência em Fe foi obtido em caldo Lúria acrescido de 200 mM de alfa-a’dipiridil. Todas as cepas produziram enterobactina e 40% produziram aerobactina. As cepas produziram IROMPs com MM variando de 82-67 kDa. As proteínas foram induzidas ou estimuladas pela deficiência de ferro. Diferenças foram observadas no perfil eletroforético entre os sorotipos, originando 5 perfis eletroforéticos. Todos os sorotipos, com exceção do sorotipo O28ac:H- (onde a proteína de 76 kDa não foi

  4. RELÉ ELECTRÓNICO PARA LA DETECCIÓN DEL MOVIMIENTO EN LOS TANQUES DE SEDIMENTACIÓN DE LA EMPRESA COMANDANTE ¨ERNESTO CHE GUEVARA¨

    Directory of Open Access Journals (Sweden)

    Orlys Ernesto Torres Breffe

    2011-02-01

    Full Text Available En este trabajo se muestran los resultados del diseño de un dispositivo electrónico para detectar el movimiento del tanquede sedimentación de la planta de lixiviación de la Empresa Ernesto Che Guevara.Estos tanque actualmente se encuentran sin esta protección y su parada por avería solo es detectada de forma visual por eloperario o cuando la densidad de la pulpa aumente a valores tan altos que sea reflejado en el sistema de monitoreo instalado(EROS. La parada inadvertida de estos tanque casi siempre sucede por razones fácilmente corregibles, pero si no se detectaa tiempo la sedimentación del minerales es casi inevitable y las pérdidas de recursos y materiales son cuantiosas.La propuesta electrónica en sustitución a las desechas electromagnéticas, es muy barata y su reproducción es fácilmenterealizable en la propia empresa, dado que los elementos que se utiliza son clásicos, sin exigencias de fabricación, tolerancias,etc.  The main goal of this research paper is to show the electronic device design results while dealing with the location of thesedimentation tank on the leaching plant located on Ernesto Che Guevara factory.Nowadays there is no protection for this tank, thus, if it stops working it can only be noticed by the engine sunner on avisual way or when the extremely high figures of the pulp density are reflected on the available monitor system (EROS.The unnoticed misfunctioning of this device is caused mainly to easily solved reasons. Nevertheless, when not detected ontime, the mineral sedimentation is almost unavoidable which results on the losses of resources.The electronic proposal to substitute the electromagnetic scraps is very cheap and easily to reproduce on the factory itself forthe needed elements are classic with no resistance and manufacture demands.

  5. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  6. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  7. Genes associated with pathogenicity of avian Escherichia coli (APEC isolated from respiratory cases of poultry Genes associados à patogenicidade de Escherichia coli patogênica para aves (APEC isoladas de frangos de corte com sintomatologia clínica respiratória

    Directory of Open Access Journals (Sweden)

    Ana C.G.P. Rocha

    2008-03-01

    Full Text Available The virulence mechanisms of avian pathogenic Escherichia coli (APEC have been continually studied and are believed to be multi-factorial. Certain properties are primarily associated with virulent samples and have been identified in avian isolates. In this study a total of 61 E. coli, isolates from chicken flocks with respiratory symptomatology, were probed by Polimerase Chain Reation (PCR for the presence of genes responsible for the adhesion capacity, P fimbria (papC e F11 fimbria (felA, colicin production (cvaC, aerobactin presence (iutA, serum resistance (iss, temperature-sensitive hemagglutinin (tsh, and presence of K1 and K5 capsular antigens (kpsII. The iss gene was detected in 73,8%, tsh in 55,7%, iutA in 45,9%, felA in 39,3%, papC in 24,3%, cvaC in 23% and kpsII in18%.Os mecanismos de virulência das amostras de Escherichia coli potencialmente patogênicas para aves (APEC têm sido continuamente estudados e acredita-se ser multifatorial. Certas propriedades são associadas primariamente a amostras virulentas e vêm sendo identificadas em amostras de E. coli isoladas de aves. Neste estudo um total de 61 amostras de E. coli, isoladas de frangos de corte com problemas respiratórios, foram testadas através da Reação em Cadeia da Polimerase (PCR, para a presença dos genes responsáveis pela capacidade de adesão, fimbria P (papC e fimbria F11 (felA, produção de colicinas (cvaC, presença de aerobactina (iutA, resistência sérica (iss, hemaglutinina temperatura sensível (tsh e presença de dos antígenos capsulares K1 e K5 (kpsII. O gene iss foi detectado em 73,8%, tsh em 55,7%, iutA em 45,9%, felA em 39,3%, papC em 24,3%, cvaC em 23% e kpsII em 18%.

  8. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  9. Environmental trace analysis by means of supersensitive GC-IMS

    International Nuclear Information System (INIS)

    Leonhardt, J.W.

    1997-01-01

    The effective control of pollutants in ambient air requires their fast in situ identification and concentration determination of chemical compounds in the range of micrograms per m 3 . There are attempts to use conventional analytical techniques as portable GC and GC-MS. These systems are relatively expensive. A new supersensitive ion Mobility Sensor (IMS) was developed and checked by IUT Ltd, which meets the new demands. The use of tritium sources is an advantage in comparison with other IMS being equipped by nickel-63, the application of which is rather critical in respect of the radiation protection. On the other hand an integrated separation column allows to reduce interferences by matrix effects. The technical parameters of the IUT GC- IMS and some of its most important applications are briefly presented

  10. La normativa italiana sui contratti di lavoro a tempo determinato nel settore della scuola è contraria al diritto dell’Unione: la Corte di Giustizia UE apre al risarcimento per i docenti che abbiano svolto supplenze annuali per la copertura di posti vacanti

    Directory of Open Access Journals (Sweden)

    Arando Plaia

    2015-01-01

    Full Text Available La Corte di Giustizia UE con sentenza 26 novembre 2014, cause riunite C-22/13, C-61/13, C-62/13, C-63/13, C-418/13, Mascolo, ha ritenuto che la normativa europea sul lavoro a tempo determinato, applicabile anche al settore pubblico della scuola (casi Rosado Santana, Marrosu Sardino e Adelener, osta ad un sistema di assunzione per svolgere “supplenze annuali” nelle scuole pubbliche che non prevede almeno una delle seguenti “misure di prevenzione”: l’indicazione delle “ragioni oggettive” che giustificano il rinnovo dei contratti; la determinazione della “durata massima totale dei contratti” o del “numero dei loro rinnovi”, in assenza peraltro di una misura sanzionatoria proporzionata, effettiva e dissuasiva, da applicarsi in caso di utilizzo abusivo di successione di contratti a tempo determinato (clausola 5 dell’accordo quadro 18 marzo 1999 allegato dir. 1999/70/CE. Sebbene dunque il settore dell’insegnamento implichi inevitabilmente una certa “flessibilità”, e la normativa europea non enunci un obbligo generale degli Stati membri di prevedere la sanzione della trasformazione dei contratti di lavoro a tempo determinato in contratti a tempo indeterminato (CGUE 3 luglio 2014, Fiamingo, causa C-362/13, la normativa italiana non prevede misure atte a “prevenire” o “sanzionare” l’utilizzo abusivo di successione di contratti a tempo determinato. Questo (e non altro il principio di diritto affermato dalla Corte di giustizia: la sentenza ribadisce l’assenza di misure di prevenzione imposte dalla disciplina europea nonché di una sanzione risarcitoria rispetto al ricorso abusivo ai contratti a tempo determinato nel settore scolastico.

  11. Clinical input of anti-D quantitation by continuous-flow analysis on autoanalyzer in the management of high-titer anti-D maternal alloimmunization.

    Science.gov (United States)

    Toly-Ndour, Cécile; Mourtada, Haifa; Huguet-Jacquot, Stéphanie; Maisonneuve, Emeline; Friszer, Stéphanie; Pernot, Françoise; Thomas, Pauline; Jouannic, Jean-Marie; Carbonne, Bruno; Cortey, Anne; Mailloux, Agnès

    2018-02-01

    In addition to titration by indirect antiglobulin test most widely used, anti-D quantitation by continuous-flow analysis (CFA) may be performed to assess severity of maternal immunization. Only five studies have reported its added value in the management of pregnancies complicated by anti-D immunization. A retrospective study of 74 severe anti-D-immunized pregnancies was conducted from January 1, 2013, to December 31, 2014, in the Trousseau Hospital in Paris (France). Concentration of maternal anti-D was measured by titration and by CFA two-stages method (2SM; total amount of anti-D) and one-stage method (1SM; high-affinity IgG1 anti-D). These biologic data were analyzed according to the severity of the hemolytic disease of the fetus and the newborn. The value of 5 IU anti-D/mL in maternal serum is validated as a threshold to trigger ultrasonographic and Doppler fetal close follow-up. A high 1SM/2SM ratio was associated with a higher risk of intrauterine transfusion (IUT). For pregnancies requiring IUT and without increasing titer, maternal 1SM anti-D concentration tends to correlate with the precocity of fetal anemia. In the "without-IUT" group 1SM and 2SM anti-D concentrations correlate significantly with cord bilirubin levels of the newborn at birth. Altogether our results underline the importance of anti-D quantitation by CFA to optimize the management of anti-D-alloimmunized pregnancies. © 2017 AABB.

  12. Environmental trace analysis by means of supersensitive GC-IMS

    Energy Technology Data Exchange (ETDEWEB)

    Leonhardt, J.W. [IUTLimited, Berlin, (Germany)

    1997-10-01

    The effective control of pollutants in ambient air requires their fast in situ identification and concentration determination of chemical compounds in the range of micrograms per m{sup 3}. There are attempts to use conventional analytical techniques as portable GC and GC-MS. These systems are relatively expensive. A new supersensitive ion Mobility Sensor (IMS) was developed and checked by IUT Ltd, which meets the new demands. The use of tritium sources is an advantage in comparison with other IMS being equipped by nickel-63, the application of which is rather critical in respect of the radiation protection. On the other hand an integrated separation column allows to reduce interferences by matrix effects. The technical parameters of the IUT GC- IMS and some of its most important applications are briefly presented 6 refs., 1 tab., 5 figs.

  13. The CheMin XRD on the Mars Science Laboratory Rover Curiosity: Construction, Operation, and Quantitative Mineralogical Results from the Surface of Mars

    Science.gov (United States)

    Blake, David F.

    2015-01-01

    The Mars Science Laboratory mission was launched from Cape Canaveral, Florida on Nov. 26, 2011 and landed in Gale crater, Mars on Aug. 6, 2012. MSL's mission is to identify and characterize ancient "habitable" environments on Mars. MSL's precision landing system placed the Curiosity rover within 2 km of the center of its 20 X 6 km landing ellipse, next to Gale's central mound, a 5,000 meter high pile of laminated sediment which may contain 1 billion years of Mars history. Curiosity carries with it a full suite of analytical instruments, including the CheMin X-ray diffractometer, the first XRD flown in space. CheMin is essentially a transmission X-ray pinhole camera. A fine-focus Co source and collimator transmits a 50µm beam through a powdered sample held between X-ray transparent plastic windows. The sample holder is shaken by a piezoelectric actuator such that the powder flows like a liquid, each grain passing in random orientation through the beam over time. Forward-diffracted and fluoresced X-ray photons from the sample are detected by an X-ray sensitive Charge Coupled Device (CCD) operated in single photon counting mode. When operated in this way, both the x,y position and the energy of each photon are detected. The resulting energy-selected Co Kalpha Debye-Scherrer pattern is used to determine the identities and amounts of minerals present via Rietveld refinement, and a histogram of all X-ray events constitutes an X-ray fluorescence analysis of the sample.The key role that definitive mineralogy plays in understanding the Martian surface is a consequence of the fact that minerals are thermodynamic phases, having known and specific ranges of temperature, pressure and composition within which they are stable. More than simple compositional analysis, definitive mineralogical analysis can provide information about pressure/temperature conditions of formation, past climate, water activity and the like. Definitive mineralogical analyses are necessary to establish

  14. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  15. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  16. Intrauterine transfusion combined with partial exchange transfusion for twin anemia polycythemia sequence: modeling a novel technique

    NARCIS (Netherlands)

    Slaghekke, F.; van den Wijngaard, J. P. H. M.; Akkermans, J.; van Gemert, M. J. C.; Middeldorp, J. M.; Klumper, F. J.; Oepkes, D.; Lopriore, E.

    2015-01-01

    Twin anemia-polycythemia sequence (TAPS) is a newly described disease in monochorionic twin pregnancies, characterized by large inter-twin hemoglobin differences. Optimal management for TAPS is not clear. One of the possible treatment modalities is intrauterine blood transfusion (IUT) in the donor

  17. Long-term neurodevelopmental outcome after intrauterine transfusion for hemolytic disease of the fetus/newborn: the LOTUS study

    NARCIS (Netherlands)

    Lindenburg, Irene T.; Smits-Wintjens, Vivianne E.; van Klink, Jeanine M.; Verduin, Esther; van Kamp, Inge L.; Walther, Frans J.; Schonewille, Henk; Doxiadis, Ilias I.; Kanhai, Humphrey H.; van Lith, Jan M.; van Zwet, Erik W.; Oepkes, Dick; Brand, Anneke; Lopriore, Enrico

    2012-01-01

    To determine the incidence and risk factors for neurodevelopmental impairment (NDI) in children with hemolytic disease of the fetus/newborn treated with intrauterine transfusion (IUT). Neurodevelopmental outcome in children at least 2 years of age was assessed using standardized tests, including the

  18. Successful management of severe hemolytic disease of the fetus due to anti-Jsb using intrauterine transfusions with serial maternal blood donations: a case report and a review of the literature.

    Science.gov (United States)

    Al Riyami, Arwa Z; Al Salmani, Moza; Al Hashami, Sabria; Al Mahrooqi, Sabah; Al Hinai, Sumaiya; Al Balushi, Halima; Al Riyami, Nihal; Gowri, V; Al Dughaishi, Tamima; Al Hosni, Saif; Al-Khabori, Murtadha; Al-Farsi, Khalil; Al Huneini, Mohammed; Alkindi, Salam

    2014-01-01

    The management of pregnant women with anti-Jsb is challenging due to the paucity of antigen-negative blood for fetal and neonatal transfusion. A 29-year-old woman with anti-Jsb was referred for assessment of recurrent fetal losses. With the presence of the sister as a historically matched donor, she was planned for active surveillance for fetal anemia during pregnancy. The fetus remained well until 21 weeks of gestation when signs of fetal anemia and early hydrops fetalis were noted. Anti-Jsb titer was at 128. The sister's red blood cells (RBCs) were cross-match incompatible. Urgent intrauterine transfusion (IUT) was performed with washed irradiated maternal RBCs, donated after cessation of heparin. The mother was given intravenous iron (IV-Fe) and continued on weekly recombinant human erythropoietin (rHu-EPO). Repeated IUTs were needed every 1 to 3 weeks. Throughout a 7-week period, three maternal donations were performed with total donated whole blood volume of 1250 mL, supporting four IUTs. At 29 weeks of gestation, the procedure was complicated by umbilical cord hematoma necessitating urgent cesarean section. A male newborn was delivered, transfused at birth, and subsequently treated with phototherapy and five top-up transfusions. This case represents a successful example of managing hemolytic disease of the fetus due to a rare antibody using maternal blood. It also supports previous data on safety of maternal donations during pregnancy and the use of combination of rHu-EPO and IV-Fe as a supportive measure. © 2013 American Association of Blood Banks.

  19. Inequality and rising levels of socio-economic segregation : Lessons from a pan-European comparative study

    NARCIS (Netherlands)

    Marcinczak, S.; Musterd, S.; Van Ham, M.; Tammaru, T.

    2015-01-01

    The research leading to these results has received funding from the Estonian Research Council (Institutional Research Grant IUT no. 2–17 on Spatial Population Mobility and Geographical Changes in Urban Regions); the European Research Council under the European Union’s Seventh Framework Programme

  20. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  1. Association between antimicrobial resistance and virulence genes in Escherichia coli obtained from blood and faeces

    DEFF Research Database (Denmark)

    Bagger-Skjøt, Line; Sandvang, Dorthe; Frimodt-Møller, Niels

    2007-01-01

    Escherichia coli isolates obtained from faeces (n = 85) and blood (n = 123) were susceptibility tested against 17 antimicrobial agents and the presence of 9 virulence genes was determined by PCR. Positive associations between several antimicrobial resistances and 2 VF genes (iutA and traT) were...

  2. NEW BEDFORD, FINAL WETLAND STUDY REPORT (08/10/88 TRANSMITTAL LETTER IS ATTACHED), 06-01-1988, SDMS# 51717

    Science.gov (United States)

    2013-06-11

    ... U 4 i' Hilli,i! J4 . Diu'it.i: nJl:iut..i.on Heli-sri Waldorf ... 'I . i 1! . i! li;i:iv I nciiiiiniiji t iil^Ji::'!! ii.iii:| nia I ILIIIII; Fn-'/ i ciiiiii I ii\\ re ;; i: i (! ii t I ciiin.!! ...

  3. Hemolytic disease of the fetus and newborn owing to anti-U, successfully treated with repeated intrauterine transfusions.

    Science.gov (United States)

    Strindberg, Johanna; Lundahl, Joachim; Ajne, Gunilla

    2013-01-01

    Hemolytic disease of the fetus and newborn (HDFN) owing to anti-U has rarely been reported. U is part of the MNS system.M and N glycoproteins are located on glycophorin A (GPA); Sand s antigens are on glycophorin B (GPB). Individuals who lack GPB are S- and s- and also lack U. The U- phenotype occurs almost exclusively in the African population and has a very low frequency (0.25%). Anti-U is of immunoglobulin G class and can cause hemolytic transfusion reaction and HDFN. In this report we present the use of a noninvasive method to detect anemia in the fetus and the subsequent use of intrauterine transfusion(IUT) with blood of a very rare phenotype. For the first time, we used deglycerolized and 3-week-old red blood cell units for IUT without signs of adverse reactions and with the expected effect on the hemoglobin value. We conclude that this transfusion strategy could be applied safely.

  4. Fetal Intra-Peritoneal Transfusion for the Management of Very Early Spontaneous Twin Anemia-Polycythemia Sequence in an Obese Patient With a Whole Anterior Placenta.

    Science.gov (United States)

    Guenot, Cécile; Robyr, Romaine; Jastrow, Nicole; Vial, Yvan; Raio, Luigi; Baud, David

    2016-04-01

    Twin anemia-polycythemia sequence (TAPS) is a rare condition in monochorionic twin pregnancies. Small intertwin placental vascular communications allow transfusion, which results in a hemoglobin difference in the twins in the absence of oligohydramnios or polyhydramnios. We report here a case of TAPS diagnosed at 17 weeks' gestation in an obese patient (BMI 42) with a whole anterior placenta. The only possible treatment at this stage of pregnancy was intra-uterine transfusion (IUT), which was repeated weekly until photocoagulation of placental anastomoses was feasible. Fetoscopic laser surgery is the only curative treatment, but is challenging in TAPS because of the absence of polyhydramnios and the presence of minuscule anastomoses. An anterior placenta and high BMI can make the procedure even more challenging. This case report demonstrates that very early and rapidly progressing TAPS with technically complicated conditions (elevated BMI and anterior placenta) can be successfully managed with IUT until laser procedure is achievable.

  5. Improved quality control of carbon-14 labelled compounds

    International Nuclear Information System (INIS)

    Leonhardt, J.W.; Fuchs, P.; Standtke, K.

    1997-01-01

    IUT Ltd is a producer of carbon-14 labelled organic compounds like benzene, methanol, phenol, formaldehyde, Na-acetates and also special ordered compounds. The quality control of these compounds is carried out by means of HPLC and GC-MS due to chemical purity. Molar activity was determined by Liquid Scintillation Counting and HPLC being equipped by a radioactivity detector. Unfortunately the accuracy of the activity determination was arrived only ±4% relatively. This error is too high because of the large dilution factors. In respect of the IUT accreditation as an analytical laboratory in Germany the accuracy had to be improved remarkably. Therefore the GC-MS-determination of molar activities of labelled compounds is used as the 14 C-labelled compound. A special evaluation code is used to determine the enrichment values relative to the unlabelled molecules. Taking into account the results of GC-MS the accuracy of molar activity determination is improved to ±2%. The spectra evaluation is demonstrated and some examples are discussed

  6. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible) by David Fassmann (1725)

    OpenAIRE

    Ekaterina A. Skvortcova

    2017-01-01

    The journal created by David Fassmann (1683–1744), Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987). The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, w...

  7. Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

    Directory of Open Access Journals (Sweden)

    Massimo Melillo

    2015-07-01

    Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

  8. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  9. Che cosa comporta introdurre nuove tecnologie didattiche a scuola : un modello

    Directory of Open Access Journals (Sweden)

    Alessandro Antonietti

    2009-01-01

    Full Text Available This article discusses a model on the set of factors that come into play in seguitodell'introduzione to school for a new educational technology. The model regards the relations between gliobiettivi or needs that motivate the adoption of a new educational tool, the choice of this instrument, the way it is impiegatoe the effects it produces. The model also takes into account the relationship between the individual and social representations sisviluppano about the needs and objectives of the technological tool, its use and changes induce.Vengono discussed the implications of the model for the management of these complex relationships in the school context.

  10. Remote Testing of Timed Specifications

    DEFF Research Database (Denmark)

    David, Alexandre; Larsen, Kim Guldstrand; Mikucionis, Marius

    2013-01-01

    We present a study and a testing framework on black box remote testing of real-time systems using UPPAAL TIGA. One of the essential challenges of remote testing is the communication latency between the Tester and the System Under Test (IUT) that may lead to interleaving of inputs and outputs. Thi...

  11. Parvovirus B19 infection in pregnancy: maternal and fetal viral load measurements related to clinical parameters

    NARCIS (Netherlands)

    de Haan, Timo R.; Beersma, Matthijs F. C.; Oepkes, Dick; de Jong, Eveline P.; Kroes, Aloys C. M.; Walther, Frans J.

    2007-01-01

    To correlate quantitative maternal and fetal parvovirus B19 (B19V) viral loads and antibody levels at intrauterine transfusion (IUT) as a predictor of fetal morbidity. Prospectively collected clinical data and quantitative B19V viral load and specific IgM and IgG values in fetal and maternal blood

  12. Properties and processing technologies of polymers for medical devices; Proprieta' e tecnologie di lavorazione dei polimeri utilizzati nei dispositivi medici

    Energy Technology Data Exchange (ETDEWEB)

    Salernitano, E [ENEA, Divisione Nuovi Materiali, Centro Ricerche Casaccia, Rome (Italy)

    2000-07-01

    The variety of biomaterials applications in medical devices for substitution or functional integration of organs and tissues has remarkably grown. This has allowed an increased survival of patients affected by traumatic or pathologic events. Biomaterials growing variety and improvement were remarkable and constant over the last twenty years; this fact yielded important clinical effects in every medical area, especially in orthopaedics, cardiovascular surgery and dentistry. Performances of medical materials are evaluated according to their bio functionality and biocompatibility. These concepts are strongly connected: bio functionality refers to devices physical and mechanical properties which allow to perform a specific function. Several transformation methods and different processing technologies allow to obtain products having different physico-chemical and mechanical properties. Among them, chemical and physical stability, biocompatibility, possibility to undergo sterilisation process, control of gases and moisture permeability, control of biodegradation products, wear and fatigue resistance and toughness are the most relevant. Most of research efforts are devoted to improve reliability and last of biomaterials already used thanks to their bio functionality and biocompatibility. Expected developments of medial devices are associated with the design of bio artificial organs, where biomaterials act as a scaffold for the three-dimensional cells growth. [Italian] Il numero delle applicazioni dei biomateriali in dispositivi medici che sostituiscono od integrino dal punto di vista funzionale organi o tessuti e' cresciuto notevolmente. Questo ha portato ad un aumento della sopravvivenza dei pazienti colpiti da eventi patologici o traumatici. La crescita ed il perfezionamento dei biomateriali e' stata, infatti, nell'ultimo ventennio considerevole e costante ed ha avuto importanti ricadute cliniche in tutte le discipline mediche ed in particolare in ortopedia, in

  13. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  14. Properties and processing technologies of polymers for medical devices; Proprieta' e tecnologie di lavorazione dei polimeri utilizzati nei dispositivi medici

    Energy Technology Data Exchange (ETDEWEB)

    Salernitano, E. [ENEA, Divisione Nuovi Materiali, Centro Ricerche Casaccia, Rome (Italy)

    2000-07-01

    The variety of biomaterials applications in medical devices for substitution or functional integration of organs and tissues has remarkably grown. This has allowed an increased survival of patients affected by traumatic or pathologic events. Biomaterials growing variety and improvement were remarkable and constant over the last twenty years; this fact yielded important clinical effects in every medical area, especially in orthopaedics, cardiovascular surgery and dentistry. Performances of medical materials are evaluated according to their bio functionality and biocompatibility. These concepts are strongly connected: bio functionality refers to devices physical and mechanical properties which allow to perform a specific function. Several transformation methods and different processing technologies allow to obtain products having different physico-chemical and mechanical properties. Among them, chemical and physical stability, biocompatibility, possibility to undergo sterilisation process, control of gases and moisture permeability, control of biodegradation products, wear and fatigue resistance and toughness are the most relevant. Most of research efforts are devoted to improve reliability and last of biomaterials already used thanks to their bio functionality and biocompatibility. Expected developments of medial devices are associated with the design of bio artificial organs, where biomaterials act as a scaffold for the three-dimensional cells growth. [Italian] Il numero delle applicazioni dei biomateriali in dispositivi medici che sostituiscono od integrino dal punto di vista funzionale organi o tessuti e' cresciuto notevolmente. Questo ha portato ad un aumento della sopravvivenza dei pazienti colpiti da eventi patologici o traumatici. La crescita ed il perfezionamento dei biomateriali e' stata, infatti, nell'ultimo ventennio considerevole e costante ed ha avuto importanti ricadute cliniche in tutte le discipline mediche ed in particolare in

  15. Deciphering chemotaxis pathways using cross species comparisons

    Directory of Open Access Journals (Sweden)

    Armitage Judith P

    2010-01-01

    Full Text Available Abstract Background Chemotaxis is the process by which motile bacteria sense their chemical environment and move towards more favourable conditions. Escherichia coli utilises a single sensory pathway, but little is known about signalling pathways in species with more complex systems. Results To investigate whether chemotaxis pathways in other bacteria follow the E. coli paradigm, we analysed 206 species encoding at least 1 homologue of each of the 5 core chemotaxis proteins (CheA, CheB, CheR, CheW and CheY. 61 species encode more than one of all of these 5 proteins, suggesting they have multiple chemotaxis pathways. Operon information is not available for most bacteria, so we developed a novel statistical approach to cluster che genes into putative operons. Using operon-based models, we reconstructed putative chemotaxis pathways for all 206 species. We show that cheA-cheW and cheR-cheB have strong preferences to occur in the same operon as two-gene blocks, which may reflect a functional requirement for co-transcription. However, other che genes, most notably cheY, are more dispersed on the genome. Comparison of our operons with shuffled equivalents demonstrates that specific patterns of genomic location may be a determining factor for the observed in vivo chemotaxis pathways. We then examined the chemotaxis pathways of Rhodobacter sphaeroides. Here, the PpfA protein is known to be critical for correct partitioning of proteins in the cytoplasmically-localised pathway. We found ppfA in che operons of many species, suggesting that partitioning of cytoplasmic Che protein clusters is common. We also examined the apparently non-typical chemotaxis components, CheA3, CheA4 and CheY6. We found that though variants of CheA proteins are rare, the CheY6 variant may be a common type of CheY, with a significantly disordered C-terminal region which may be functionally significant. Conclusions We find that many bacterial species potentially have multiple

  16. Facility Management personalizzato per realtà complesse

    Directory of Open Access Journals (Sweden)

    Autodesk Italia Autodesk Italia

    2007-04-01

    Full Text Available Il mercato dei servizi oggi è caratterizzato da una crescente complessità; in particolare il mondo dell’Information & Communication Technology si trova di fronte a un processo di vera e propria trasformazione del concetto di servizio: dalla semplice manutenzione hardware e software si è passati alla presa in carico di attività che un tempo erano affidate a fornitori diversi. Le aziende di global services necessitano quindi di informazioni aggiornate e complete, per poter rispondere tempestivamente e con efficacia alle richieste delle aziende. In qualità di struttura istituzionale di supporto all’attività del Presidente del Consiglio, la Presidenza del Consiglio dei Ministri aveva la necessità di realizzare un sistema informativo che supportasse i propri fornitori nell’erogazione dei servizi, in particolare nell’espletamento del contratto siglato per la manutenzione degli edifici e nell’ottimizzazione della manutenzione di questi servizi. Questi ultimi includono manutenzioni di carattere ordinario e straordinario, che vanno dalla sostituzione di una lampadina, alla tinteggiatura, al ripristino di un affresco o di un fregio artistico, alla manutenzione del verde sia all’esterno che all’interno degli edifici della Presidenza del Consiglio.

  17. More efficient services with the new EMAS; Piu' possibilita' per i servizi con il nuovo EMAS

    Energy Technology Data Exchange (ETDEWEB)

    Luciani, R; Andriola, L [ENEA, Casaccia, RM (Italy). Dipt. Ambiente

    1999-12-01

    The article discusses the new EMAS regulations, which are also applicable in the service sector. It has been described the pilot projects launched by ENEA (National Agency for New Technology, Energy and the Environment) in collaboration with the Ministry of Industry, Federturismo, Ministry of Environmental and the municipality of Modena, in the hotel sector and in public administration. [Italian] L'articolo discute il nuovo regolamanto EMAS che estende l'applicazione della certificazione ambientale anche all'area dei servizi. Si descrivono i progetti che l'ENEA ha condotto in collaborazione con il Ministero dell'Industria, il Ministero dell'Ambiente, Federturismo e il comune di Modena nel settore alberghiero e nella pubblica amministrazione.

  18. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  19. I parchi eolici: la complessa interazione tra natura, uomo e tecnologia - The wind farms: the complex interaction among nature, man and technology

    Directory of Open Access Journals (Sweden)

    Massimiliano Masullo

    2015-10-01

    Full Text Available Sin dai tempi antichi l’uomo ha costruito macchine che, sfruttando l’energia del vento, lo hanno aiutato a nutrire se stesso, la terra e a svolgere lavorazioni complesse. Con la scoperta dell’elettricità la funzione di queste macchine è cambiata radicalmente. Negli ultimi venti anni, politiche d'incentivazione hanno portato allo sviluppo di impianti eolici ed alla loro diffusione sul territorio, determinando una interazione sempre più intensa fra turbine eoliche, ambiente circostante ed uomo. Questo articolo presentata una rassegna dei principali fattori che determinano o modificano la percezione dell’impatto che queste macchine hanno sull’uomo e sull’ambiente circostante. ------ Since ancient times the man has built machines which exploiting the energy of the wind have helped to feed himself, the land and carry out complex operations. With the discovery of electricity the function of these machines is changed radically. In the last twenty years, incentive policies have led to the development of wind farms and their diffusion over the territory, resulting in a more intense interaction between wind turbines, environment and man. This article presents a review of the main factors that determine or affect the perception of the impact that these machines have on humans and the surrounding environment.

  20. Reconstruction of the Chemotaxis Receptor-Kinase Assembly

    International Nuclear Information System (INIS)

    Park, S.; Borbat, P.; Gonzalez-Bonet, G.; Bhatnagar, J.; Pollard, A.; Freed, J.; Bilwes, A.; Crane, B.

    2006-01-01

    In bacterial chemotaxis, an assembly of transmembrane receptors, the CheA histidine kinase and the adaptor protein CheW processes environmental stimuli to regulate motility. The structure of a Thermotoga maritima receptor cytoplasmic domain defines CheA interaction regions and metal ion-coordinating charge centers that undergo chemical modification to tune receptor response. Dimeric CheA-CheW, defined by crystallography and pulsed ESR, positions two CheWs to form a cleft that is lined with residues important for receptor interactions and sized to clamp one receptor dimer. CheW residues involved in kinase activation map to interfaces that orient the CheW clamps. CheA regulatory domains associate in crystals through conserved hydrophobic surfaces. Such CheA self-contacts align the CheW receptor clamps for binding receptor tips. Linking layers of ternary complexes with close-packed receptors generates a lattice with reasonable component ratios, cooperative interactions among receptors and accessible sites for modification enzymes

  1. i-Locate - Indoor/Outdoor location and Asset Management through Open Data

    Directory of Open Access Journals (Sweden)

    Claudio Eccher

    2015-02-01

    Full Text Available Studi recenti hanno evidenziato che, in media, trascorriamo circa il 90% del nostro tempo in ambienti chiusi e, spesso, non familiari. L’esigenza di localizzare/guidare persone o ogg etti in spazi sia esterni che interni (senza discontinuità tra esterno ed interno darà origine ad una serie di nuovi servizi di tipo LBS (Location-Based Services che potranno avere anche una notevole rilevanza economica. i-locate (Indoor / outdoor location and Asset Management Through open geodata is a project that aims to develop a set of tools and services based on geo location technologies based on open data for the location and management of objects in indoor and outdoor spaces. The tools are intended both to citizens who use their smartphones to access services, aids to navigation from the front door to internal destinations to buildings (public office, clinic, shop, etc.. Obtaining any information available to support (code , unforeseen changes in the path, suggestions, etc., and professionals for specific activities that require the location of people, equipment, etc. i-locate to an intense use of GIS technologies for navigation and tracking "indoor" (indoor GIS, 3D GIS, to locate people (eg. Alzheimer's patients and their movements in areas not suited (geofencing to identify and track objects / portable equipment for their location, management and maintenance.

  2. i-Locate - Indoor/Outdoor location and Asset Management through Open Data

    Directory of Open Access Journals (Sweden)

    Claudio Eccher

    2015-02-01

    Full Text Available Studi recenti hanno evidenziato che, in media, trascorriamo circa il 90% del nostro tempo in ambienti chiusi e, spesso, non familiari. L’esigenza di localizzare/guidare persone o ogg etti in spazi sia esterni che interni (senza discontinuità tra esterno ed interno darà origine ad una serie di nuovi servizi di tipo LBS (Location-Based Services che potranno avere anche una notevole rilevanza economica.i-locate (Indoor / outdoor location and Asset Management Through open geodata is a project that aims to develop a set of tools and services based on geo location technologies based on open data for the location and management of objects in indoor and outdoor spaces. The tools are intended both to citizens who use their smartphones to access services, aids to navigation from the front door to internal destinations to buildings (public office, clinic, shop, etc.. Obtaining any information available to support (code , unforeseen changes in the path, suggestions, etc., and professionals for specific activities that require the location of people, equipment, etc. i-locate to an intense use of GIS technologies for navigation and tracking "indoor" (indoor GIS, 3D GIS, to locate people (eg. Alzheimer's patients and their movements in areas not suited (geofencing to identify and track objects / portable equipment for their location, management and maintenance.

  3. Il mondo dentro il mondo

    CERN Document Server

    Barrow, John D

    1991-01-01

    Davvero esistono “lì fuori” leggi di natura, che stanno in attesa di essere scoperte, indipendenti dal nostro modo di pensare, o esse rappresentano soltanto la descrizione più conveniente di ciò che abbiamo visto? Come è nata l’idea stessa di “leggi di natura”? Queste costituiscono la realtà profonda o sono soltanto pezzi di un regolamento che ci siamo dati per organizzare meglio la nostra conoscenza del mondo? o semplici paletti che piantiamo e ci lasciamo alle spalle come segnali via via che procediamo nella giungla dell’esperienza? È possibile che non esistano affatto leggi di natura? Forse esse, e anche l’universo che da esse sembra regolato, sono del tutto creazioni della nostra mente: un’illusione che scompare appena cessiamo di pensarvi. Ma allora, che cosa accadrebbe, se non ci fossero osservatori dell’universo?». Interrogativi di questo genere, che incontriamo sulla soglia del Mondo dentro il mondo, sarebbero suonati eccentrici fino a qualche anno fa. Oggi, al contrario, circ...

  4. Disturbi dello spettro autistico tra filosofia della medicina e delle neuroscienze

    Directory of Open Access Journals (Sweden)

    Carlo Maria Cirino

    2012-05-01

    Full Text Available L’autismo è un disturbo pervasivo dello sviluppo neuropsicologico che interessa all’incirca un bambino su mille. Purtroppo, si tratta di un dato destinato ad aumentare, anche per via dell’interesse mediatico e scientifico che questa patologia è stata capace di richiamare intorno a sé. Da un lato, infatti, sono aumentate le richieste di screening presso i numerosi centri che monitorano questa complessa patologia neurologica e dall’altro sono migliorate le tecniche di diagnosi che sempre più spesso si avvalgono di esami genetici all’avanguardia in aggiunta alle ormai classiche interviste psicologiche. L’autismo pone, dunque, serie questioni all’attenzione della ricerca scientifica sia nel vasto campo delle neuroscienze che in quello della neuropsichiatria e della psicologia clinica. Ebbene: quel settore della filosofia che guarda alla scienza con interesse particolare, non può che seguire con partecipazione i progressi nella spiegazione di questa misteriosa patologia che, attualmente, resta un vero e proprio rompicapo per tutti coloro che hanno a che fare con la complessità dell’organizzazione cerebrale dell’essere umano.

  5. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... watering, fish culturing and nursery of seedlings. Air is also very ... synthesized organic and inorganic fertilizers are made, synthesized pesticides and herbicides for ..... production and nutritional quality of grains. (Graham and ...

  6. Criteri di indagine degli spazi voltati nell’ambito dell’architettura storica e in archeologia

    Directory of Open Access Journals (Sweden)

    Luca Cipriani

    2014-07-01

    Full Text Available ItLo studio degli spazi voltati nell’ambito dell’architettura storica è un tema di grande interesse, che da sempre vede impegnati vari studiosi afferenti ad ambiti disciplinari diversi, dall’archeologia, alla storia dell’arte, alla conservazione. In tale contesto interdisciplinare molto spesso il ruolo di ingegneri ed architetti, che si occupano di indagare le matrici geometriche alla base della progettazione di tali spazi, viene relegato ad un ruolo accessorio rispetto a quello dei conservatori, che materialmente si occupano delle pratiche di manutenzione e di restauro. Con l’avanzare delle tecnologie di rilevamento, che spaziano con sempre maggiore affidabilità dalla documentazione dei caratteri morfologici superficiali a quelli più intrinseci alla base dei manufatti, quale può essere il ruolo attuale di chi si occupa di comprendere il progetto che generò tali ambienti? In altri termini, quel vasto patrimonio immateriale che sta alla base della concezione progettuale di un manufatto, specialmente se scaturito da una raffinata conoscenza matematica e geometrica, ha oggi un ruolo riconoscibile e sufficientemente autorevole rispetto all’ammontare di conoscenze tecniche che permettono alle “macchine” di funzionare?Con questo contributo si intende mostrare come l’integrazione di vari know-how legati sia alla modellazione reality-based che alla conoscenza dei criteri e degli strumenti di progettazione del passato, possa fornire un input sostanziale per l’intervento e per la conoscenza di manufatti caratterizzati da una evidente complessità geometrica e costruttiva. Per ricaduta si intende poi mostrare come la documentazione fine a se stessa, per quanto accurata, certificata e garantita attraverso le più avanzate tecnologie e metodologie integrate, non si configuri come base di scambio e di dialogo interdisciplinare. En The study of vaulted spaces in the context of the historic architecture is a topic of great interest

  7. La fisica del Novecento per un bilancio critico

    CERN Document Server

    Selleri, Franco

    1999-01-01

    Ma chi ha detto che la fine della fisica è vicina? Che tutto quello che c'era da scoprire è già stato scoperto? E che le generazioni future potranno solo precisare e raffinare, e mai negare o arricchire le attuali teorie? Questo libro si contrappone a pensatori come Heisenberg, Feyman e Hawking che hanno predetto la morte della fisica. L'autore sostiene che grandi progressi sono possibili, ma che il prezzo da pagare per realizzarli è una modifica radicale delle basi della fisica moderna, in particolare abbandonando l'indeterminismo, la non località (paradosso di Einstein, Podolsky e Rosen) e lo stesso principio di relatività.

  8. La mente incarnata e le prospettive morali della Fenomenologia della Percezione

    Directory of Open Access Journals (Sweden)

    Francesco Consiglio

    2015-03-01

    Full Text Available In contrasto con quella che era stata la tradizione dell’empirismo classico di matrice hobbesiana e lockiana da un lato, e la tradizione razionalista a erente al nucleo loso co cartesiano, Merleau-Ponty elabora una “terza via” che si propone di riportare la conoscenza nell’ambito dello stretto rapporto tra il corpo e i fenomeni che esso esperisce in quanto corpo vivente e non mero oggetto tra gli oggetti. Il mio corpo non è, come credeva convintamente Cartesio, mera res extensa, separata dalla mia più pura e vera essenza di res cogitans; anzi è proprio col mio essere corpo vivente che conosco pienamente il mondo. Noi non costruiamo il mondo naturale, ma lo viviamo. È in esso che avviene l’incontro con l’Altro, l’incontro di prospettive che ci mette alla prova nell’agire morale; è in questo incontro che nasce il senso che esso assume per noi. È in questo rapporto d’intersoggettività che si genera il nodo di signi cati che costituisce il mondo culturale e più ancora quello morale. In questo contesto l’ottica del corpo vissuto costituisce un presupposto radicale che modi ca n dal principio il rapporto tra soggetto e mondo, tra soggetto singolo e altri individui.

  9. Variations of intracavitary applicator geometry during multiple HDR brachytherapy insertions in carcinoma cervix and its influence on reporting as per ICRU report 38

    International Nuclear Information System (INIS)

    Datta, Niloy Ranjan; Kumar, Shaleen; Das, Koilpillai Joseph Maria; Pandey, Chandra Mani; Halder, Shikha; Ayyagari, Sunder

    2001-01-01

    Purpose: This paper examines the extent of variation in the applicator geometry during multiple high dose rate (HDR) intracavitary brachytherapy (ICBT) applications and its impact on reporting as per ICRU report 38. Materials and methods: Eighty orthogonal radiographs from 20 consecutive patients of carcinoma cervix (FIGO stages, IIA-IIIB) having four HDR ICBT applications of 6 Gy each at weekly intervals following teletherapy were evaluated. The applicator consisted of a flexible intrauterine tandem (IUT) independent of the ovoid assembly. The applicator geometry was evaluated in terms of: α angle, β angle, intrauterine length (IUTL), interovoid (IOV), os to right ovoid (ORT) and os to left ovoid (OLT) distances along with vertical (VDL) and anteroposterior displacements (ADL) of the os with respect to the ovoids. The Cartesian co-ordinates (X, Y, and Z) of the IUT tip, centre of both ovoids and os were also measured. Doses to right point A (ARD), left point A (ALD), along with a reference volume of 6 Gy for ICRU height (IRH), width (IRW), thickness (IRT) and volume (IRV) were estimated for each application. Results: Highly significant differences (P<0.001) between four insertions in any given patient across 20 patients for α angle, β angle, IUTL, IOV, ORT, VDL, co-ordinates of the IUT, ovoids and os were observed, except for ADL (P=0.041) and OLT (P=0.247). As a consequence, variations were observed in ARD (P=0.027), ALD (P=0.017); IRH, IRW, IRT and IRV (all P<0.001). Applicator factors which influenced the various dose specification parameters were: β angle and ORT for both ARD and ALD; UTLN, VDL and ORT for IRH; UTLN and IOV for IRW; UTLN for IRT and VDL for the 6 Gy IRV. Conclusions: A significant variation of the applicator geometry and its movement was observed in patients undergoing multiple HDR ICBT. This could have implications for reporting dose and volume specifications as required by ICRU report 38

  10. Detecção de fatores de virulência de Escherichia coli e análise de Salmonella spp. em psitacídeos Detection of virulence factors in Escherichia coli and analysis of Salmonella spp. in psittacines

    Directory of Open Access Journals (Sweden)

    Isadora M. de O. Corrêa

    2013-02-01

    Full Text Available A flora entérica dos psitacídeos é composta principalmente por bactérias Gram positivas. Bactérias Gram negativas, como Escherichia coli e Salmonella spp., apresentam elevado potencial patogênico, sendo consideradas indicativo de problemas de manejo, que poderão culminar em manifestação de doenças em decorrência de fatores estressantes, dietas deficientes e superlotação, combinados com alta carga bacteriana no ambiente. O objetivo deste trabalho foi avaliar a presença de Salmonella spp., Escherichia coli e os fatores de virulência dos genes iss e iutA dos isolados de E. coli. Analisou-se um total de 44 amostras provenientes de psitacídeos criados em cativeiro, sendo estas 15 fragmentos de órgãos de aves submetidas a exame de necropsia e também 29 amostras de swabs de cloaca e inglúvio de papagaios-charão (Amazona pretrei criados em cativeiro. Nenhuma amostra foi positiva para Salmonella spp. Nas amostras de E. coli detectou-se ambos os fatores de virulência pesquisados.The enteric flora of psittacines is mainly composed of Gram positive bacteria. Gram negative bacteria, like Escherichia coli and Salmonella spp., have a high pathogenic potential and can be considerate as an indicative of management problems that may culminate in disease manifestation due to stress factors, poor diets and overcrowding, in combination with a high bacterial load on the environment. The objective of this study was evaluated the presence of Salmonella spp., Escherichia coli and the virulence genes iss and iutA from E. coli isolates. Forty-four samples were analyzed from psittacines living in captivity, which fifteen samples were from organs fragments of necropsied birds, and twenty-nine were from cloacal and crop swabs of red-spectacled parrots (Amazona pretrei keeping in captivity. No samples were positive for Salmonella spp. In the samples in which E. coli was detected, both virulence factors (genes iss and iutA were present.

  11. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    che intellettuali o analfabeti, fortunati o disgraziati, poveri o ricchi, alla fine il bilancio è sempre lo stesso. [...] È la vita, e basta, e se riesco a dirla in modo che altri la riconosca in fraternità leggendomi, questo è il solo dovere che conti, la sola estetica che sia anche un'etica. Che sollievo! Infine l'ho detto, e in prima persona”.

  12. Divergent effects of postmortem ambient temperature on organophosphorus- and carbamate-inhibited brain cholinesterase activity in birds

    Science.gov (United States)

    Hill, E.F.

    1989-01-01

    Time- and temperature-dependent postmortem changes in inhibited brain cholinesterase (ChE) activity may confound diagnosis of field poisoning of wildlife by anticholinesterase pesticide. Carbamate-inhibited ChE activity may return to normal within 1 to 2 days of exposure of intact carcass to moderate ambient temperature (18-32C). Organophosphorus-inhibited ChE activity becomes more depressed over the same time. Uninhibited ChE activity was resilient to above freezing temperature to 32C for 1 day and 25C for 3 days. Carbamate- and organophosphorus-inhibited ChE can be separated by incubation of homogenate for 1 hour at physiological temperatures; carbamylated ChE can be readily reactivated while phosphorylated ChE cannot.

  13. Induction of reactive oxygen species-stimulated distinctive autophagy by chelerythrine in non-small cell lung cancer cells.

    Science.gov (United States)

    Tang, Zheng-Hai; Cao, Wen-Xiang; Wang, Zhao-Yu; Lu, Jia-Hong; Liu, Bo; Chen, Xiuping; Lu, Jin-Jian

    2017-08-01

    Chelerythrine (CHE), a natural benzo[c]phenanthridine alkaloid, shows anti-cancer effect through a number of mechanisms. Herein, the effect and mechanism of the CHE-induced autophagy, a type II programmed cell death, in non-small cell lung cancer (NSCLC) cells were studied for the first time. CHE induced cell viability decrease, colony formation inhibition, and apoptosis in a concentration-dependent manner in NSCLC A549 and NCI-H1299 cells. In addition, CHE triggered the expression of phosphatidylethanolamine-modified microtubule-associated protein light-chain 3 (LC3-II). The CHE-induced expression of LC3-II was further increased in the combination treatment with chloroquine (CQ), an autophagy inhibitor, and large amounts of red-puncta were observed in the CHE-treated A549 cells with stable expression of mRFP-EGFP-LC3, indicating that CHE induces autophagy flux. Silence of beclin 1 reversed the CHE-induced expression of LC3-II. Inhibition of autophagy remarkably reversed the CHE-induced cell viability decrease and apoptosis in NCI-H1299 cells but not in A549 cells. Furthermore, CHE triggered reactive oxygen species (ROS) generation in both cell lines. A decreased level of ROS through pretreatment with N-acetyl-L-cysteine reversed the CHE-induced cell viability decrease, apoptosis, and autophagy. Taken together, CHE induced distinctive autophagy in A549 (accompanied autophagy) and NCI-H1299 (pro-death autophagy) cells and a decreased level of ROS reversed the effect of CHE in NSCLC cells in terms of cell viability, apoptosis, and autophagy. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  14. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  15. Income related inequality and influencing factors: a study for the incidence of catastrophic health expenditure in rural China.

    Science.gov (United States)

    Gu, Hai; Kou, Yun; Yan, Zhiwen; Ding, Yilei; Shieh, Jusheng; Sun, Jun; Cui, Nan; Wang, Qianjing; You, Hua

    2017-09-20

    Catastrophic health expenditure (CHE) puts a heavy disease burden on patients' families, aggravating income-related inequality. In an attempt to reduce the financial risks of rural families incurring CHE, China began the New Rural Cooperative Medical System (NCMS) on a trial basis in 2003 and has raised the reimbursement rates continuously since then. Based on statistical data about rural families in sample area of Jiangsu province, this study measures the incidence of CHE, analyzes socioeconomic inequality related to CHE, and explores the influences of the NCMS on the incidence of CHE. Statistical data were acquired from two surveys about rural health care, one conducted in 2009 and one conducted in 2010. In 2009, 1424 rural families were analyzed; in 2010, 1796 rural families were analyzed. An index of CHE is created to enable the evaluation of the associated financial risks. The concentration index and concentration curve are used to measure the income-related inequality involved in CHE. Multiple logistic regression is utilized to explore the factors that influence the incidence of CHE. The incidence of CHE decreased from 13.62% in 2009 to 7.74% in 2010. The concentration index of CHE was changed from -0.298 (2009) to -0.323 (2010). Compared with rural families in which all members were covered by the NCMS, rural families in which some members were not covered by the NCMS had a lower incidence of CHE: The odds ratio is 0.65 with a 95% confidence interval of 0.43 to 1.00. For rural families in which all members were covered by the NCMS, the increase in reimbursement rates is correlated to the decline in the incidence of CHE if other influencing factors were controlled: The odds ratio is 0.48 with a 95% confidence interval of 0.36 to 0.64. Between 2009 and 2010, the incidence rate of CHE in the sampled area decreased sharply, CHE was more concentrated among least wealthy and inequality increased during study period. As of 2010, the poorest rural families still had

  16. Il cielo sopra Roma I luoghi dell’astronomia

    CERN Document Server

    Buonanno, Roberto

    2008-01-01

    L’astronomia a Roma c’è sempre stata, ma un po’ nascosta: era nei palazzi, nelle chiese o, meglio, sopra le chiese, specole disseminate lungo un percorso che oramai conoscono in pochi. I romani hanno assistito, incuriositi ed impauriti, al rogo di Giordano Bruno in un angolo di Campo de' Fiori a loro familiare, ma probabilmente non capirono bene di quale colpa fosse accusato. Non pensarono certo che si trattasse di un filosofo e di uno scienziato che aveva cercato di immaginare in che modo era fatto il mondo. Chi era questo Galileo, di cui si celebrava il processo a S. Maria sopra Minerva? Era un uomo che voleva cambiare la prospettiva del mondo e che, per questo, era stato ammonito da Roberto Bellarmino. E chi era questo gesuita, Secchi, che nel 1870 costringeva gli Italiani a privare Roma del suo Osservatorio Astronomico, visto che il Direttore non riconosceva lo Stato Italiano? Come è possibile che dopo la visita di Hitler a Mussolini alla vigilia della Guerra, la Germania decise di regalare all’...

  17. Role of motility and chemotaxis in the pathogenesis of Dickeya dadantii 3937 (ex Erwinia chrysanthemi 3937).

    Science.gov (United States)

    Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo

    2009-02-01

    Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA<cheYZ, which correlated with the degree to which swimming was affected. These results clearly indicate that motility plays an important role in the pathogenicity of this bacterium.

  18. Relations between residential and workplace segregation among newly arrived immigrant men and women

    OpenAIRE

    Tammaru, Tiit; Strömgren, Magnus; van Ham, Maarten; Danzer, Alexander M.

    2016-01-01

    The research leading to these results has received funding from the Estonian Research Council (Institutional Research Grant IUT2-17 on Spatial Population Mobility and Geographical Changes in Urban Regions); the Estonian Science Foundation (grant no. 8774 and 9247); the European Research Council under the European Union's Seventh Framework Programme (FP/2007-2013) / ERC Grant Agreement n. 615159 (ERC Consolidator Grant DEPRIVEDHOODS, Socio-spatial inequality, deprived neighbourhoods, and neigh...

  19. Arylesterase Phenotype-Specific Positive Association Between Arylesterase Activity and Cholinesterase Specific Activity in Human Serum

    Directory of Open Access Journals (Sweden)

    Yutaka Aoki

    2014-01-01

    Full Text Available Context: Cholinesterase (ChE specific activity is the ratio of ChE activity to ChE mass and, as a biomarker of exposure to cholinesterase inhibitors, has a potential advantage over simple ChE activity. Objective: To examine the association of several potential correlates (serum arylesterase/paraoxonase activity, serum albumin, sex, age, month of blood collection, and smoking with plasma ChE specific activity. Methods: We analyzed data from 195 cancer-free controls from a nested case-control study, accounting for potential confounding. Results: Arylesterase activity had an independent, statistically significant positive association with ChE specific activity, and its magnitude was the greatest for the arylesterase phenotype corresponding to the QQ PON1192 genotype followed by phenotypes corresponding to QR and RR genotypes. Serum albumin was positively associated with ChE specific activity. Conclusions: Plasma arylesterase activity was positively associated with plasma ChE specific activity. This observation is consistent with protection conferred by a metabolic phenotype resulting in reduced internal dose.

  20. Time course of cholinesterase inhibition in adult rats treated acutely with carbaryl, carbofuran, formetanate, methomyl, methiocarb, oxamyl or propoxur

    International Nuclear Information System (INIS)

    Padilla, S.; Marshall, R.S.; Hunter, D.L.; Lowit, A.

    2007-01-01

    To compare the toxicity of seven N-methyl carbamates, time course profiles for brain and red blood cell (RBC) cholinesterase (ChE) inhibition were established for each. Adult, male, Long Evans rats (n = 4-5 dose group) were dosed orally with either carbaryl (30 mg/kg in corn oil); carbofuran (0.5 mg/kg in corn oil); formetanate HCl (10 mg/kg in water); methomyl (3 mg/kg in water); methiocarb (25 mg/kg in corn oil); oxamyl (1 mg/kg in water); or propoxur (20 mg/kg in corn oil). This level of dosing produced at least 40% brain ChE inhibition. Brain and blood were taken from 0.5 to 24 h after dosing for analysis of ChE activity using two different methods: (1) a radiometric method which limits the amount of reactivation of ChE activity, and (2) a spectrophotometric method (Ellman method using traditional, unmodified conditions) which may encourage reactivation. The time of peak ChE inhibition was similar for all seven N-methyl carbamate pesticides: 0.5-1.0 h after dosing. By 24 h, brain and RBC ChE activity in all animals returned to normal. The spectrophotometric method underestimated ChE inhibition. Moreover, there was a strong, direct correlation between brain and RBC ChE activity (radiometric assay) for all seven compounds combined (r 2 = 0.73, slope 1.1), while the spectrophotometric analysis of the same samples showed a poor correlation (r 2 = 0.09). For formetanate, propoxur, methomyl, and methiocarb, brain and RBC ChE inhibitions were not different over time, but for carbaryl, carbofuran and oxamyl, the RBC ChE was slightly more inhibited than brain ChE. These data indicate (1) the radiometric method is superior for analyses of ChE activity in tissues from carbamate-treated animals (2) that animals treated with these N-methyl carbamate pesticides are affected rapidly, and recover rapidly, and (3) generally, assessment of RBC ChE is an accurate predictor of brain ChE inhibition for these seven pesticides

  1. Il potere di Prometeo e il dovere di Kant

    Directory of Open Access Journals (Sweden)

    Stefano Picchetti

    2006-10-01

    Full Text Available Kant ci suggerisce qualcosa che Prometeo e il mito greco avevano già accennato. L'imperativo che pone freno al fare, è già in sé nel soggetto ed è per questo che egli che egli è responsabile delle proprie azioni, indipendentemente dalla legge scritta.

  2. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  3. BOOK REVIEWS / RECENSIONI

    African Journals Online (AJOL)

    User

    colei che trascorre il tempo accompagnandolo ai giovanotti, dando prova della sua peccaminosità sia sul piano individuale che su quello sociale”. (191). Secondo Bernardino le donne che cercavano di abbellirsi con i cosmetici in realtà finivano per imbruttirsi e compromettere la loro bellezza naturale, oltre che annullare “la ...

  4. Voyage in Italy : Roberto Rossellini's Non–Dualistic View of the ...

    African Journals Online (AJOL)

    Sostengo inoltre che Viaggio in Italia è il primo passo nella creazione di un cinema inteso come attività che aiuta gli spettatori a liberare se stessi da stereotipi e preconcetti. Concludo affermando che Viaggio in Italia anticipa la caratteristiche estetiche e filosofiche del cinema storico e didattico di Rossellini, che culmina ...

  5. Il passato nell’epoca della sua (ri)producibilità digitale. Torino 1943 - 45. Metodologia della ricerca con tecnologie informatiche. Sistema storico-territoriale di informazione multimediale

    OpenAIRE

    Tosatto, Claudio

    2008-01-01

    Se il lavoro dello storico è capire il passato come è stato compreso dalla gente che lo ha vissuto, allora forse non è azzardato pensare che sia anche necessario comunicare i risultati delle ricerche con strumenti propri che appartengono a un'epoca e che influenzano la mentalità di chi in quell'epoca vive. Emergenti tecnologie, specialmente nell’area della multimedialità come la realtà virtuale, permettono agli storici di comunicare l’esperienza del passato in più sensi. In che...

  6. A Multi-Institution Study of Student Demographics and Outcomes in Chemical Engineering

    Science.gov (United States)

    Lord, Susan M.; Layton, Richard A.; Ohland, Matthew W.; Brawner, Catherine E.; Long, Russell A.

    2014-01-01

    Using a large multi-institutional dataset, we describe demographics and outcomes for students starting in and transferring into chemical engineering (ChE). In this dataset, men outnumber women in ChE except among black students. While ChE starters graduate in ChE at rates comparable to or above their racial/ethnic population average for…

  7. Conversazioni autobiografiche con Albino Sacco-Casamassima

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2004-03-01

    Full Text Available Nel 1948 venne Olivetti a Matera. Olivetti venne a Matera con un certo ambasciatore americano che praticamente aveva preparato o stava dando una mano per il piano Marschall, venne a Matera e mi vollero incontrare. Io sono stato chiamato dalla piazza, stavo nella piazza, era il mese di luglio, una cosa di questo genere, e andai in un bar, un bar ad angolo mi ricordo in Via Don Minzioni, dove questo Olivetti mi disse 'ma lei che cosa fa coi sassi?' 'Che cos'è questa storia?' Gli raccontai un po' che cosa facevo io con questi amici, avevamo fatto questo, insomma tutto quello che avevamo fatto nei sassi e che volevamo preparare ancora per presentare a qualcuno un piano di revisionamento dei sassi. Mi ricordo, era la prima volta che avevo visto Adriano Olivetti, ne avevo sentito parlare però non avevo mai visto quest'uomo con gli occhi celesti, minuto, coi capelli bianchi, riccioluto, con una cravatta bianca, cosa che mi fece impressione, una specie di angelo.

  8. Quali interlocutori per ’inchiesta sociale?

    Directory of Open Access Journals (Sweden)

    Piano b

    2009-06-01

    Full Text Available La chiusura delle fabbriche, la scomparsa della classe operaia, la riconversione dei capannoni dismessi. La città post-industriale, dei servizi, dei centri commerciali. L’immigrazione, la città multietnica, la questione della sicurezza, l’insicurezza percepita dai cittadini italiani nei propri quartieri. Il lavoro precario, il consumismo, la speculazione edilizia, l’inquinamento, la fine delle “comunità”, la parcellizzazione dei rapporti sociali. Parole che da anni leggiamo e ascoltiamo e che ci sembra descrivano in modo appropriato i fenomeni e le trasformazioni in atto nelle città italiane. Ma anche parole di “senso comune”, che diamo per scontate. Descrizioni dei mondi in cui viviamo che è difficile mettere in discussione, che solitamente vengono evocate piuttosto che argomentate. Parole che basta nominare perché tutti bene o male capiscano di cosa si sta parlando. Che ci mostrano in maniera inequivocabile la direzione nella quale sta andando la società in cui viviamo. E, aspetto non secondario, inibiscono l’azione politica collettiva e la nascita di progetti di segno diverso.

  9. Funzioni identitarie dell'alternanza linguistica in apprendenti di italiano durante lo svolgimento di attività in gruppo

    Directory of Open Access Journals (Sweden)

    Roberta Ferroni

    2013-12-01

    Full Text Available Questo articolo indaga, servendosi degli strumenti teorici messi a disposizione dall’analisi della conversazione, coadiuvata da una serie di nozioni e riferimenti tratti dagli studi che esaminano la struttura dell’interazione nella classe di lingua, i diversi usi che gli apprendenti di italiano LS fanno delle lingue presenti nella classe, specialmente della loro LM, durante lo svolgimento di attività di gruppo per dare voce alle multiple identità che costituiscono ciascun individuo. Dallo studio emerge che l’identità degli apprendenti è in continua trasformazione. Infatti, per potersi affermare, gli apprendenti dovranno “interpretare” un insieme di ruoli che cambiano e che dovranno negoziare in base al contesto d’interazione

  10. Genealogy of the body and genealogical body

    Directory of Open Access Journals (Sweden)

    Paola Cecchetti

    2011-06-01

    Full Text Available A partire da un quadro di Frida Kahlo intitolato I miei nonni, i miei genitori e io le due autrici indagano quel testo-immagine che sta all'origine dello stile di lettura del soggetto. Posto dinanzi alla stessa immagine, ciascuno ne fa una rappresentazione estremamente personale, un quadro delle proprie vicissitudini interne e dei legami transgenerazionali che lo hanno segnato. I momenti nei quali si articola la ricerca sono tre: la scrittura dell’occhio, il ricalco e il percorso della mano, il negativo e l’assenza.A essi segue poi lo psicodramma. Tale successione temporale abitua a vedere nell'immagine disegnata l'immagine negata, assente. L'esperienza sembra aver creato un nuovo metodo di indagine della psiche rispetto al transgenerazionale, metodo che intreccia il genogramma (di origini sistemico-relazionale e lo psicodramma analitico, e che viene chiamato “genodramma psicoanalitico”. Partendo da un dato clinico – l'esilità del legame che le nuove generazioni intrattengono con quelle che le precedono, sembra vogliano rinegoziare il contratto narcisistico che assegna al passato il posto dell'assenza. Il contributo si chiude con un interrogativo: “Alla ricerca di che cosa? Della presenza o, meglio, delle tracce lasciate nel soggetto dall'Altro che precede l'insediamento dell'Io”.

  11. Cumulative incidence, distribution, and determinants of catastrophic health expenditure in Nepal: results from the living standards survey.

    Science.gov (United States)

    Ghimire, Mamata; Ayer, Rakesh; Kondo, Masahide

    2018-02-14

    Nepal has committed to the global community to achieve universal health coverage by 2030. Nevertheless, Nepal still has a high proportion of out-of-pocket health payment and a limited risk-pooling mechanism. Out-of-pocket payment for the healthcare services could result in catastrophic health expenditure (CHE). Evidence is required to effectively channel the efforts to lower those expenses in order to achieve universal health coverage. However, little is known about CHE and its determinants in a broad national context in Nepal. Therefore, this study was conducted to explore the cumulative incidence, distribution, and determinants of CHE in Nepal. Data were obtained from the nationally representative survey, the Nepal Living Standards Survey-third undertaken in 2010/11. Information from 5988 households was used for the analyses. Households were classified as having CHE when their out-of-pocket health payment was greater than or equal to 40% of their capacity to pay. Remaining households were classified as not having CHE. Logistic regression analyses were used to identify determinants of CHE. Based on household-weighted sample, the cumulative incidence of CHE was 10.3% per month in Nepal. This incidence was concentrated in the far-western region and households in the poorer expenditure quartiles. Multivariable logistic regression revealed that households were more likely to face CHE if they; consisted of chronically ill member(s), have a higher burden of acute illness and injuries, have elderly (≥60 years) member(s), belonged to the poor expenditure quartile, and were located in the far-western region. In contrast, households were less likely to incur CHE when their household head was educated. Having children (≤5 years) in households did not significantly affect catastrophic health expenditure. This study identified a high cumulative incidence of CHE. CHE was disproportionately concentrated in the poor households and households located in the far

  12. La narrazione dell’azione sociale: spunti dal Trattato di Vilfredo Pareto

    Directory of Open Access Journals (Sweden)

    Ilaria Riccioni

    2017-08-01

    Full Text Available La rilettura dei classici porta con sé sempre una duplice operazione: da una parte un ritorno a riflessioni, ritmi, storicità che spesso sembrano già superate; dall’altra la riscoperta delle origini di fenomeni contemporanei da punti di vista che ne delineano le interconnessioni profonde, non più visibili allo stato di avanzamento in cui le osserviamo oggi. Tale maggiore chiarezza è forse dovuta al fatto che ogni fenomeno nella sua fase aurorale è più chiaramente identificabile rispetto alle sue fasi successive, dove le caratteristiche primarie tendono a stemperarsi nelle cifre dominanti della contemporaneità, perdendosi nelle pratiche quotidiane che ne celano la provenienza. Se la sociologia è un processo di conoscenza della realtà dei fenomeni, il punto centrale della scienza sociale va distinto tra quelle scienze che schematizzano il reale in equazioni formali funzionali e funzionanti, il sistema economico, normativo, e le scienze sociali che si occupano della realtà e della sua complessità, che in quanto scienze si devono occupare non tanto di ciò che la realtà deve essere, bensì di ciò che la realtà è, di come si pone e di come manifesta i movimenti desideranti e profondi del vivere collettivo oltre il sistema che ne gestisce il funzionamento. Il punto che Pareto sembra scorgere, con estrema lucidità, è la necessità di ribaltare l’importanza della logica economica nell’organizzazione sociale da scienza che detta la realtà a scienza che propone uno schema di gestione di essa: da essa si cerca di dettare la realtà, ma l’economia, dal greco moderno Oikòs, Oikòsgeneia (casa e generazione, il termine utilizzato per definire l’unità famigliare non è di fatto “la realtà”, sembra dirci Pareto in più digressioni, bensì l’arte e la scienza della gestione di unità familiari e produttive. La realtà rimane in ombra e non può che essere “avvicinata” da una scienza che ne registri, ed eventualmente

  13. UNPUBLISHED TEXTS / INEDITI

    African Journals Online (AJOL)

    User

    È come una fetta di luna. L'nguria che assaggi e che sputi non ti puoi saziare come del mare e dell'aria e dei pini marittimi e di questa quercia alberi dal tronco di sughero che è facile strappare, corteccia che ricresce. Non ti puoi saziare di questo mare verde e profondo luminosa acqua pietre pesci coralli gusci di perle.

  14. Io è una storia: autore, narratore, personaggi nella narrazione di sé

    Directory of Open Access Journals (Sweden)

    Giorgio Bert

    2011-04-01

    Full Text Available L’io che si racconta non parla di ciò che avviene ma di ciò che è avvenuto, e anche se sono passati pochi istanti si tratta già di passato. Il presente non si può narrare, il presente è un vortice, un caos; il tentativo di raccontare le cose mentre avvengono si risolve in una comunicazione confusa, spezzettata, balbettante in cui si intrecciano in modo poco coerente e disordinato eventi, fatti, emozioni, interpretazioni. Tra l’io che vive e l’io che racconta esiste un fossato invalicabile. Quando la persona narra e si narra costruisce una storia che –per quanto tenga conto di fatti effettivamente avvenuti- non è (né potrebbe essere una fedele descrizione di quanto è accaduto. La narrazione dà alla sequenza degli eventi un ordine arbitrario, colmando i vuoti, omettendo particolari e spesso, più o meno consapevolmente, inventandone di nuovi. Ciò che ne risulta è in ogni caso fiction.

  15. La strana storia della luce e del colore

    CERN Document Server

    Guzzi, Rodolfo

    2011-01-01

    Sino al 1600 la luce era oggetto di studio degli scienziati ed il colore dei filosofi. Questa dicotomia fu superata dall’Esperimentum Crucis di Newton che spiego’ come la luce contenesse il colore. Il libro analizza le teorie che furono sviluppate dai greci, per evolversi successivamente nelle teorie degli scienziati arabi e approdare al medio evo. Con l’Esperimentum Crucis Newton dimostro’ che la luce conteneva i colori primari. Tra gli esperimenti che egli fece ci furono anche quelli sulla percezione che risultarono sbagliati; solo Goethe capi’ quale era la vera portata di quegli esperimenti e li rifece dando una interpretazione che, oggi, sappiamo essere vera, ma che a quel tempo fu alquanto osteggiata. Nel frattempo la comunita’ scientifica progrediva sul concetto di visione e di sensazione, poiche’ gli strumenti di indagine si raffinavano. Bisogna pero’ arrivare ai giorni nostri per avere una spiegazione sul comportamento della luce e del colore e come questa viene percepita da noi. Solo ...

  16. Il Servizio Nazionale di Valutazione e le prove Invalsi. Stato dell’arte e proposte per una valutazione come agente di cambiamento

    Directory of Open Access Journals (Sweden)

    Roberto Trinchero

    2014-12-01

    Full Text Available Qual è la funzione del Servizio Nazionale di Valutazione formativa degli istituti scolastici? A cosa servono davvero le prove Invalsi? Le critiche che spesso vengono mosse a queste prove sono veramente fondate? Come può la valutazione dell’offerta formativa scolastica costituire davvero un agente di miglioramento? Il presente articolo intende fornire alcune risposte a queste domande, partendo dalle istanze che hanno ispirato l’autonomia scolastica e offrendo spunti per un utilizzo non fazioso della valutazione. La valutazione può essere davvero agente di cambiamento a patto che: i sia attribuito ai dati il corretto significato; ii la scuola sia in grado di comprendere i potenziali suggerimenti che la valutazione può dare e si apra al cambiamento positivo. La valutazione applicata ad una “scuola che si difende” non può che provocare inutili esiti di facciata. La valutazione applicata ad una “scuola che apprende” può davvero aiutarla ad esplicare appieno tutte le proprie potenzialità.

  17. Cercare mondi esplorazioni avventurose ai confini dell'universo

    CERN Document Server

    Tonelli, Guido

    2017-01-01

    Abitiamo un sottile guscio sferico, di pochi chilometri di spessore, intorno alla superficie della Terra. Anche se esploriamo gli abissi più profondi dell'oceano o scaliamo le vette dell'Himalaya, il nostro regno ha dimensioni ridicole. Per questo, se riflettiamo su quelle dell'universo, ci resta una sensazione di lieve sgomento. Non solo. Il nostro piccolo mondo è anche popolato di chimere, fantasmi e terribili inganni: pensiamo che quello che percepiamo sia reale, invece tutto cambia appena ci allontaniamo dall'angolo tranquillo in cui si svolge la nostra esistenza. Quando cerchiamo di capire i fenomeni che si osservano nel meraviglioso tappeto di galassie che ricopre la volta stellata, o quelli che caratterizzano la materia nei suoi componenti elementari, dobbiamo rinunciare alle certezze che governano la nostra vita e intraprendere un viaggio vertiginoso che lascia senza fiato. Guido Tonelli, fisico al Cern di Ginevra e uno dei padri della scoperta del bosone di Higgs, ci fa compiere questo viaggio irri...

  18. Antibiofilm activity of coconut (Cocos nucifera Linn.) husk fibre extract

    Science.gov (United States)

    Viju, N.; Satheesh, S.; Vincent, S.G.P.

    2012-01-01

    In this study, antibiofilm activity of coconut husk extract (CHE) was tested by various assays in the laboratory. The effects of CHE on extracellular polymeric substance (EPS) production, hydrophobicity and adhesion ability of Pseudomonas sp., Alteromonas sp. and Gallionella sp. and the antimicrobial activity of the extract against these bacteria were assessed. CHE was found to possess antibacterial activity against all the bacterial strains and affected the EPS production. The CHE affected the growth of the biofilm-forming bacteria in a culture medium. The hydrophobicity of the bacterial cells was also changed due to the CHE treatment. The active compound of the CHE was characterised by thin-layer chromatography (TLC), high performance liquid chromatography (HPLC) and fourier transform infrared (FT-IR) analysis. HPLC spectrum showed a single peak and the FT-IR spectrum indicated the presence of an OH-group-containing compound in the extract. In conclusion the CHE could be used as a source for the isolation of antifouling compounds. PMID:23961225

  19. Issues relating to classification of colluvial soils in young morainic areas (Chełmno and Brodnica Lake District, northern Poland

    Directory of Open Access Journals (Sweden)

    Świtoniak Marcin

    2015-06-01

    Full Text Available Colluvial soils (in Polish: gleby deluwialne are an important part of the soil cover in young morainic landscapes of northern Poland. They evolved as a result of the accumulation of eroded material at the foot of the slopes and bottoms of closed depressions. The aim of this study was to determine the systematic position of colluvial soils commonly found in the Chełmno and Brodnica Lake District, northern Poland. Ten soil pits located in different types of landscapes were selected for testing soil properties. The colluvial material is characterized by diversified properties: thickness, particle-size distribution, organic carbon content, color, pH, and base saturation. As a result, the investigated soils represent broad spectrum of typological units according to Polish Soil Classification (2011. Some of them contain epipedons mollic and meet the criteria of colluvial chernozemic soils. They were found mainly on buried black earths in areas with small slope inclinations. Many pedons contain pale colored acidic colluvial material with low base saturation and low organic carbon content and must be classified as other types: arenosols (in Polish: arenosole or rusty soils (in Polish: gleby rdzawe. These soils occur mostly in areas with intensive relief and overlay the different soil types, including rusty soil and organic soils. They are formed as a result of soils lessivés and rusty soils truncation. An introduction of the additional units of “proper colluvial soils” which have epipedon ochric, and “rusty-colluvial soils” with endopedon sideric to the next edition of Polish Soil Classification would enable a more precise expression of the genesis of these soils in the type rank. Moreover, the definition of chernozemic colluvial soils could be extended to colluvial soils with umbric horizon. Classifying soils derived from colluvial material as soils of other types leads to the disappearance of this units on maps and underestimation of the

  20. Protecting patients with cardiovascular diseases from catastrophic health expenditure and impoverishment by health finance reform.

    Science.gov (United States)

    Sun, Jing; Liabsuetrakul, Tippawan; Fan, Yancun; McNeil, Edward

    2015-12-01

    To compare the incidences of catastrophic health expenditure (CHE) and impoverishment, the risk protection offered by two health financial reforms and to explore factors associated with CHE and impoverishment among patients with cardiovascular diseases (CVDs) in rural Inner Mongolia, China. Cross-sectional study conducted in 2014 in rural Inner Mongolia, China. Patients with CVDs aged over 18 years residing in the sample areas for at least one year were eligible. The definitions of CHE and impoverishment recommended by WHO were adopted. The protection of CHE and impoverishment was compared between the New Cooperative Medical Scheme (NCMS) alone and NCMS plus National Essential Medicines Scheme (NEMS) using the percentage change of incidences for CHE and impoverishment. Logistic regression was used to explore factors associated with CHE and impoverishment. The incidences of CHE and impoverishment under NCMS plus NEMS were 11.26% and 3.30%, respectively, which were lower than those under NCMS alone. The rates of protection were higher among households with patients with CVDs covered by NCMS plus NEMS (25.68% and 34.65%, respectively). NCMS plus NEMS could protect the poor households more from CHE but not impoverishment. NCMS plus NEMS protected more than one-fourth of households from CHE and more than one-third from impoverishment. NCMS plus NEMS was more effective at protecting households with patients with CVDs from CHE and impoverishment than NCMS alone. An integration of NCMS with NEMS should be expanded. However, further strategies to minimise catastrophic health expenditure after this health finance reform are still needed. © 2015 John Wiley & Sons Ltd.

  1. Effects of energetic restriction diet on butyrylcholinesterase in obese women from southern Brazil - A longitudinal study.

    Science.gov (United States)

    Santos, Willian Dos; Tureck, Luciane Viater; Saliba, Louise Farah; Schenknecht, Caroline Schovanz; Scaraboto, Débora; Souza, Ricardo Lehtonen R; Furtado-Alle, Lupe

    2017-01-01

    Butyrylcholinesterase (BChE) activity has been associated with obesity, lipid concentrations, and CHE2 locus phenotypes. This, the aim of this study was to evaluate the effects of an energetic restriction diet intervention on anthropometrical and biochemical variables and on absolute and relative BChE activity in CHE2 C5+ and CHE2 C5- individuals. One hundred eleven premenopausal obese women from Southern Brazil participated in an energetic restriction diet intervention (deficit of 2500 kJ/day) for 8 weeks. Their anthropometric and biochemical parameters were evaluated before and after the intervention. Plasma BChE activity was measured, and BChE bands in plasma and CHE2 locus phenotypes were detected by electrophoresis. The dietetic intervention decreased anthropometric and biochemical parameters as well as absolute BChE activity and relative activity of the G4 band. The CHE2 C5+ phenotype presented a different effect when compared with the CHE2 C5- phenotype. The CHE2 C5+ phenotype showed an effect in absolute BChE activity and in the relative activity of the G4 form, maintaining higher BChE activity regardless of the metabolic changes. In our study, 8 weeks was not sufficient time to lower the body mass index to normal, but it was enough to significantly reduce the absolute BChE activity, which became similar to the levels in nonobese individuals. CHE2 C5+ individuals were resistant to the decrease in BChE activity compared to CHE2 C5- individuals. This shows that the diet did not affect the CHE2 and G4 fraction complex and that the products of the CHE2 locus in association with BChE have a role in energy metabolism, maintaining high levels of enzymatic activity even after dietary intervention.

  2. Corpi abit(uati: relazioni di relazioni e unità sistemica

    Directory of Open Access Journals (Sweden)

    Sergio Straface

    2014-11-01

    Full Text Available Consacrare uno spazio, allora, un’abitazione, un corpo, il corpo persona e personificato potrebbe generare quella connessione sistemica che disabit(ua… Questo è forse uno dei motivi per cui è spesso così difficile imparare le lingue. E allora, l’unità sistemica, quella nuova, che genera significati vivi, potrebbe essere possibile con-sé-crandosi all’unità stessa ricordando quella lingua connettiva e correttiva, sistemica, che riconnette il sé al proprio corpo, lo stesso corpo che non dimentica e che si esprime in gesti e toni di voce. Forse. Per una antropologia degli spazi… persona.

  3. In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi.

    Science.gov (United States)

    Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

    2016-01-01

    Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus-host interaction was conducted by the same assay. CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes with viral entry process in the host cell and acts directly on the viral

  4. In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi

    Science.gov (United States)

    Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

    2016-01-01

    Background: Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. Objective: To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. Materials and Methods: The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus–host interaction was conducted by the same assay. Results: CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. Conclusion: The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. SUMMARY Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes

  5. Performance Analysis of Cofiring Densified Refuse Derived Fuel in a Military Boiler.

    Science.gov (United States)

    1981-12-01

    Use of Waste Oils to Improve Densified Refuse-Derived Fuel 79 Study of the State of the Art of Dioxin from Corbustion Sour ,-es 81 Numerical...very large hammermills for shredu-,nt ii -et re C strean . Tne suitability of this technique has beer . : , 1:d aeauie of its undesirable proper- ,V.>- ir...oe iut- fraction while reducing the hrsepower requiie:: ,. ht uuty shredders have -c-en used as a pfre -. . :-r,der-s have not beer perfected wnich

  6. Geologia, misura e posizionamento spaziale

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-04-01

    Full Text Available Le Scienze della Terra sono poi date dall’insieme delle discipline che studiano la struttura interna, la morfologia superficiale e tutta l’atmosfera che circonda il pianeta Terra e la sua evoluzione nel tempo. Potremmo anche dire ormai che lo studio della Terra costituisce un caso particolare delle Scienze Planetarie, che si occupano dello studio dei pianeti presenti nel nostro sistema solare.

  7. Summer school in nuclear and radiochemistry at Brookhaven National Laboratory

    International Nuclear Information System (INIS)

    Kolsky, K.L.

    2005-01-01

    The U.S. Department of Energy supports 24 fellowships for students to attend six-week programs at either San Jose State University in California, or Brookhaven National Laboratory (BNL) in New York. The American Chemical Society through the Division of Nuclear Science and Technology operates both schools. The twelve students at the BNL program are enrolled in the State University of New York at Stony Brook (SUNYSB) and receive 3 college credits for the lecture course (CHE-361) and 3 additional credits for the laboratory course (CHE-362). In addition to lectures and laboratories, students tour various nuclear facilities offsite, at BNL, and at SUNYSB. Opportunities are given the students to interact with faculty and scientists within the profession through the Guest Lecture Program. Further details are discussed along with results of student surveys for the years 1999 through 2002. (author)

  8. How to organize a maths e-book for vocational training schools

    Directory of Open Access Journals (Sweden)

    Damiano Trombini

    2016-04-01

    Full Text Available This paper aims to examine the educational planning in order to realize a maths e-book which might be used by teachers in vocational training schools. Along with the analysis of the advantages and the efficiency that a teacher could obtain adopting this type of multimedia technology, this paper will also analyze how to organize and insert into an e-book resources which allow to implement instructional strategies such as flipped classroom, cooperative learning, peer tutoring and all the aspects relating to the learning evaluation. Come organizzare un e-book per l’insegnamento della matematica nelle classi prime di istituti ad indirizzo professionaleLo scopo di questo saggio è quello di esaminare la progettazione didattica per la realizzazione di un e-book per l’insegnamento della matematica nelle classi prime di istituti secondari di secondo grado ad indirizzo professionale. Unitamente all’analisi dei vantaggi e dell’efficacia che un docente potrebbe ottenere nell’avvalersi di questo tipo di tecnologia multimediale, si analizzeranno le modalità di organizzazione e inserimento nell’e-book di risorse che permettano di implementare strategie didattiche come la flipped classroom, cooperative learning e il peer tutoring, nonché gli aspetti che riguardano la valutazione dell’apprendimento.

  9. [I direttori delle riviste vanno avanti: attenersi ai principi accademici, adottare trasparenza e rispetto e applicare le regole.

    Science.gov (United States)

    Teixeira da Silva, Jaime A; Dobránszki, Judit

    2018-05-01

    Nonostante i cambiamenti in corso nell'ambito delle pubblicazioni scientifiche (STEM - scienza, tecnologia, ingegneria e medicina), è indubbio che i direttori delle riviste restano i più importanti custodi del processo editoriale. In questo articolo vengono analizzati i motivi per cui i direttori delle riviste devono continuare ad attenersi ai principi editoriali fondamentali e a utilizzare le nuove tecnologie digitali solo per dare forza al contenuto, ma non per sostituirlo nella sua qualità. Per raggiungere questo obiettivo, in un'epoca caratterizzata da controlli ed equilibri, i direttori delle riviste devono essere attentamente sorvegliati e ritenuti responsabili tanto quanto gli autori che essi stessi valutano. Qualunque scorciatoia potrebbe avere conseguenze negative e inaspettate per quella rivista che non si attenesse a tali regole, che vedrebbe intaccata la propria reputazione e che dovrebbe faticare per recuperare la fiducia dei propri lettori. Quindi, a rischio di sembrare scontati, è meglio prevenire il danno alla reputazione piuttosto che curarlo. L'unico modo per evitarlo è che i direttori delle riviste si adattino a un crescente movimento sempre più critico, che richiede maggiore trasparenza e responsabilità da parte di chi contribuisce a costruire la base delle conoscenze scientifiche e dalla società, specialmente laddove la ricerca è finanziata pubblicamente.

  10. La fotografia tra lutto, riparazione e creatività

    Directory of Open Access Journals (Sweden)

    Stefano Ferrari

    2010-12-01

    Full Text Available In questo saggio vengono analizzati i molteplici processi psichici che caratterizzano la fotografia. Essa viene considerata sia nel suo statuto fondamentale e in particolare nel rapporto con il motivo della caducità e della morte (che sancisce dunque la sua stretta relazione con il tema del lutto, sia nelle dinamiche che riguardano la psicologia di chi fotografa e di chi viene fotografato. Nel primo caso prevalgono meccanismi di difesa: la fotografia è una modalità di controllo onnipotente sulla realtà, che viene resa inoffensiva attraverso un processo di oggettivazione e di addomesticamento. Non mancano qui implicazioni di carattere aggressivo e perverso, legate soprattutto a meccanismi di identificazione introiettiva. Nel secondo caso colui che viene fotografato subisce dunque una trasformazione da soggetto a oggetto: secondo le parole di Roland Barthes, egli vive “una microesperienza della morte” che dà luogo a evidenti effetti di “perturbante”. Nel testo vengono inoltre analizzati alcuni meccanismi di fruizione che intervengono quando si osservano le fotografie; ma in particolare vengono considerati i processi psichici che si attivano nel momento in cui il soggetto è indotto a scegliere una sua propria fotografia. Quest’ultimo aspetto fa già parte della psicologia dell’autoritratto fotografico, a cui viene dedicata l’ultima parte del saggio.

  11. I desideri e le masse. Una riflessione sul presente

    Directory of Open Access Journals (Sweden)

    Guido Mazzoni

    2013-08-01

    Full Text Available Negli ultimi quarantacinque anni la vita psichica delle masse occidentali ha subito una metamorfosi senza precedenti; noi tutti ne siamo stati trasformati e travolti. Fedele a un’idea eroica e maschile dell’accadere e dell’esperienza, all’idea che le rotture epocali si manifestino sotto forma di guerre e rivoluzioni, una parte della cultura contemporanea continua a sottovalutare la portata di quanto è avvenuto. È una miopia che si manifesta talvolta in forma esplicita e più spesso in forma implicita, come accade ogni volta che applichiamo alla nostra epoca concetti, parole e miti che non reggono più. Molte delle categorie con cui giudichiamo il presente, con cui prendiamo una posizione etico-politica sui problemi della nostra epoca, danno l’impressione di scivolare sulla realtà senza afferrarla, o perché fanno riferimento a un futuro che, non rimandando più a un progetto politico, rappresenta solo la proiezione di un desiderio, o perché fanno riferimento a un passato che non ritornerà. Quali sono i tratti più vistosi della metamorfosi? Che cosa è accaduto?

  12. Il marketing del nuovo millennio

    OpenAIRE

    M. Addis

    2007-01-01

    Con la consueta maestria, Kolter, supportato da Keller, mette a disposizione dei suoi numerosi lettori uno strumento di grande efficacia, dalla struttura estremamente agile, che potrà essere apprezzato da coloro che il marketing lo insegnano e dai professionisti che cercano un'opera di riferimento autorevole e aggiornata ma al contempo di facile consultazione, che possa accompagnarli nello svolgimento delle attività quotidiane. Il testo è una guida essenziale alla disciplina del marketing,...

  13. European Marine Information System. Eumaris; European Marine Information System. Eumaris

    Energy Technology Data Exchange (ETDEWEB)

    Caiaffa, E. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    The present paper summarises the activities developed by ETC/MCE, under European Environment Agency (EEA) contract, on the Geographic Information System. The aim of present paper is to introduce some general concepts about the Geographic Information Systems and to investigate the potential of G.I.S. as tool for the assessment of the European seas. Care has also been taken to explain the main technical and educational reasons that led to EUMARIS GIS birth, its evolution in the last year, till to its presentation at the Inter-Regional Forum of the European Conventions held in Venice. GIS is a technological tool phenomenon involving various aspects and different issues; many examples of thematic maps involving that different subjects are shown in the paper. [Italian] Il presente articolo riassume le attivita' svolte, nell'ambito del Geographic Information System, dall'ETC/MCE sotto contratto con l'Agenzia Europea per l'Ambiente (EEA) che ha sede a Copenhagen. Scopo del presente articolo e' quello di introdurre alcuni concetti generali sui Geographic Information System (GIS) e di dimostrare la possibilita' di utilizzare il GIS stesso come strumento per la valutazione dello stato dei mari dell'Europa. Si e' cercato di spiegare le principali ragioni tecniche che hanno portato alla nascita del progeto del GIS EUMARIS, alla sua realizzazione fino alla sua presentazione all'Inter-Regional Forum of European Conventions tenutosi a Venezia. Si e' cercato anche di mostrare come un GIS per sua natura e' uno strumento che coinvolge vari aspetti tecnologici e differenti tipi di dati; nell'articolo vengono mostrati diversi esempi di mappe tematiche che contengono tali differenti argomenti.

  14. Cornice epistemologica e metodologica del modello sistemico pluralista

    Directory of Open Access Journals (Sweden)

    Cecilia Edelstein

    2013-12-01

    Full Text Available L’articolo illustra il modello di lavoro che si è sviluppato negli ultimi trent’anni, attraverso l’intreccio tra ricerca, formazione, clinica e lavori di comunità, e che ha dato spazio all’approccio sistemico pluralista in ambito interculturale. Quest’ultimo ha sviluppato una cornice che comprende lo sviluppo di nuovi concetti, metodologie di lavoro e tecniche specifiche che attingono a teorie diverse. L’articolo, quindi, offre un quadro epistemologico, ma anche metodologico e concettuale.

  15. A Drosophila protein family implicated in pheromone perception is related to Tay-Sachs GM2-activator protein.

    Science.gov (United States)

    Starostina, Elena; Xu, Aiguo; Lin, Heping; Pikielny, Claudio W

    2009-01-02

    Low volatility, lipid-like cuticular hydrocarbon pheromones produced by Drosophila melanogaster females play an essential role in triggering and modulating mating behavior, but the chemosensory mechanisms involved remain poorly understood. Recently, we showed that the CheB42a protein, which is expressed in only 10 pheromone-sensing taste hairs on the front legs of males, modulates progression to late stages of male courtship behavior in response to female-specific cuticular hydrocarbons. Here we report that expression of all 12 genes in the CheB gene family is predominantly or exclusively gustatory-specific, and occurs in many different, often non-overlapping patterns. Only the Gr family of gustatory receptor genes displays a comparable variety of gustatory-specific expression patterns. Unlike Grs, however, expression of all but one CheB gene is sexually dimorphic. Like CheB42a, other CheBs may therefore function specifically in gustatory perception of pheromones. We also show that CheBs belong to the ML superfamily of lipid-binding proteins, and are most similar to human GM2-activator protein (GM2-AP). In particular, GM2-AP residues involved in ligand binding are conserved in CheBs but not in other ML proteins. Finally, CheB42a is specifically secreted into the inner lumen of pheromone-sensing taste hairs, where pheromones interact with membrane-bound receptors. We propose that CheB proteins interact directly with lipid-like Drosophila pheromones and modulate their detection by the gustatory signal transduction machinery. Furthermore, as loss of GM2-AP in Tay-Sachs disease prevents degradation of GM2 gangliosides and results in neurodegeneration, the function of CheBs in pheromone response may involve biochemical mechanisms critical for lipid metabolism in human neurons.

  16. A Drosophila Protein Family Implicated in Pheromone Perception Is Related to Tay-Sachs GM2-Activator Protein*

    Science.gov (United States)

    Starostina, Elena; Xu, Aiguo; Lin, Heping; Pikielny, Claudio W.

    2009-01-01

    Low volatility, lipid-like cuticular hydrocarbon pheromones produced by Drosophila melanogaster females play an essential role in triggering and modulating mating behavior, but the chemosensory mechanisms involved remain poorly understood. Recently, we showed that the CheB42a protein, which is expressed in only 10 pheromone-sensing taste hairs on the front legs of males, modulates progression to late stages of male courtship behavior in response to female-specific cuticular hydrocarbons. Here we report that expression of all 12 genes in the CheB gene family is predominantly or exclusively gustatory-specific, and occurs in many different, often non-overlapping patterns. Only the Gr family of gustatory receptor genes displays a comparable variety of gustatory-specific expression patterns. Unlike Grs, however, expression of all but one CheB gene is sexually dimorphic. Like CheB42a, other CheBs may therefore function specifically in gustatory perception of pheromones. We also show that CheBs belong to the ML superfamily of lipid-binding proteins, and are most similar to human GM2-activator protein (GM2-AP). In particular, GM2-AP residues involved in ligand binding are conserved in CheBs but not in other ML proteins. Finally, CheB42a is specifically secreted into the inner lumen of pheromone-sensing taste hairs, where pheromones interact with membrane-bound receptors. We propose that CheB proteins interact directly with lipid-like Drosophila pheromones and modulate their detection by the gustatory signal transduction machinery. Furthermore, as loss of GM2-AP in Tay-Sachs disease prevents degradation of GM2 gangliosides and results in neurodegeneration, the function of CheBs in pheromone response may involve biochemical mechanisms critical for lipid metabolism in human neurons. PMID:18952610

  17. Tendenza al minor sforzo dell'espressione nelle lingue romanze

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    2013-12-01

    Full Text Available Lʼidea dello sforzo minore - in linea generale valida e rispettata - è senzʼaltro giusta. Havers (1931 a pienamente ragione. Dobbiamo però considerare che lʼesprimersi troppo succintamente non è sempre il più facile, anche se per il locutore più sbrigativo, e - se non cʼè dubbio che esprimersi ampiamente, con più elementi linguistici, sia desiderabile e auspicabile da parte dellʼinterlocutore - non è sempre facile nemmeno per il locutore, "più facile" nel senso di trovare subito il termine adeguato, forse più espressivo che convenga allʼinterlocutore. Il locutore è certo il nucleo della comunicazione, vuol dire, può creare espressioni nuove, il che è nella lingua un procedimento costante, oppure scegliere tra le possibilità che gli si offrono, persino violando il sistema morfosintattico valido il che può portare addirittura allʼannientamento del sistema in vigore e la sua sostituzione con un altro. Il che si verificò, nel mondo linguistico romanzo, appunto con il declino totale dellʼesistenza del sistema della flessione del sostantivo, e parzialmente nel sistema del verbo, in misura minore in quello del pronome. Analizzando tali cambiamenti constatiamo che il principio della legge del minor sforzo, formulato da Havers (1931, è senzʼaltro valido, cerchiamo tuttavia di trovare le ragioni le quali, talvolta, spingono il locutore a violare il sistema in vigore. Crediamo che anche in tale scelta abbia un peso importante una espressione o una struttura spontanea, perciò più naturale e con questo più facile.

  18. Aristotele, Einstein e gli altri i grandi scienziati tra pensiero e vita quotidiana

    CERN Document Server

    Fischer, Ernst Peter

    1997-01-01

    Abbiamo spesso un'idea confusa di quelle che sono state le vite degli uomini che hanno consacrato all'impresa scientifica le loro migliori energie. Eppure, non solo nell'arte e nella filosofia, ma anche nella scienza "lo stile è l'uomo" e la psicologia del singolo scienziato può rivelarsi il miglior aiuto per capire la logica della scoperta scientifica. Questa è una "storia della scienza raccontata agli amici davanti al caminetto", come l'autore stesso definisce la propria opera. Che non è soltanto una ricostruzione puntuale delle svolte principali che hanno portato alla scienza contemporanea, ma un racconto delle vicende personali di tutti quegli scienziati che sono stati divorati dalla passione del conoscere.

  19. Sviluppo e crisi. Per una prospettiva della compresenza

    Directory of Open Access Journals (Sweden)

    Andrea Pirni

    2011-02-01

    Full Text Available Il paradigma della modernità, adottando il concetto di sviluppo come tema chiave, ha elaborato moltissime teorie del mutamento: qui sviluppo e crisi risultano necessariamente contrapposti sia sotto il profilo teorico che empirico. La complessità crescente delle società europee contemporanee mette in discussione la capacità interpretativa del mutamento che le coinvolge attualmente e suggerisce l’elaborazione di nuove prospettive che focalizzino il processo di trasformazione in corso piuttosto che soffermarsi sul risultato. Dopo aver sinteticamente inquadrato il concetto di sviluppo nell’ambito del paradigma della modernità l’articolo intende sostenere l’utilità di una prospettiva che considera congiuntamente crisi e sviluppo per analizzare il mutamento delle democrazie contemporanee.

  20. NOTES AND GLEANINGS / NOTE E CURIOSITÀ

    African Journals Online (AJOL)

    Principe D. Sigismondo Chigi ed altri” con il numero di catalogo. 1815/IV. .... ricorre a formula del tipo “un certo Pietro che non so dei quali”. Frequente l'uso di 'con' ...... catene di Sant'Antonio; che sono convinte che ficcando uno spillone in ...

  1. Teatri della memoria: una ricerca sulle mediatiche domestiche

    Directory of Open Access Journals (Sweden)

    Olimpia Affuso

    2011-12-01

    Full Text Available Questo contributo ruota intorno ai risultati di una ricerca collettiva che riguarda i rapporti fra alcuni oggetti della casa e le memorie di chi li raccoglie. Il tema di sfondo della ricerca è molto ampio. Nelle case ci sono mobili e soprammobili, fotografie e manifesti, quadri, e infiniti altri oggetti. Possiamo dire che la casa intera è un deposito di “mnemoteche”, di teche della memoria, che è la stessa disposizione dello spazio domestico a fungere da dispositivo mnestico. Rispetto a tutto ciò, abbiamo scelto quelli che hanno a che fare con il mondo dei media. Ci siamo occupati cioè di come vengono raccolti, selezionati, conservati, usati e scartati oggetti come libri, dischi, videocassette, CD e DVD, e anche file sui computer, telefonini e lettori portatili (audio-video. Si tratta di un insieme di oggetti la cui analisi consente di comprendere sia diversi aspetti dei rapporti che le persone intrattengono con le proprie memorie, sia alcuni dei modi in cui spazi privati e pubblici si interconnettono. Poiché questi prodotti hanno a che fare con le industrie mediali, abbiamo chiamato l’insieme di questi oggetti mediateche domestiche.

  2. Meccanica quantistica: problemi scelti 100 problemi risolti di meccanica quantistica

    CERN Document Server

    Angelini, Leonardo

    2008-01-01

    Questo libro è dedicato essenzialmente agli studenti che preparano l'esame scritto di un corso di Meccanica Quantistica. Di riflesso questa raccolta può risultare molto utile anche ai docenti che devono proporre problemi ai loro studenti sia a lezione che per gli esami. Si assume che i contenuti del corso siano sostanzialmente identici a quelli di un tradizionale corso di Istituzioni di Fisica Teorica dei vecchi ordinamenti del corso di laurea in Fisica. Nei nuovi ordinamenti gli stessi argomenti sono stati, in generale, ripartiti su più corsi. Come molti altri libri di problemi di Meccanica Quantistica non bisogna aspettarsi un particolare sforzo di novità. L'intento è di presentare dei problemi che, oltre a sondare la comprensione della materia e l'abilità ad applicarla concretamente da parte dello studente, siano risolubili in un tempo limitato ed utilizzando gli strumenti matematici che vengono normalmente forniti nei corsi per la laurea in Fisica. Questo proposito difficilmente si coniuga con una r...

  3. Gravità, stringhe e particelle una escursione nell’ignoto

    CERN Document Server

    Gasperini, Maurizio

    2014-01-01

    E' un libro che parla di fisica rivolgendosi a lettori che non hanno necessariamente una preparazione specifica in questo campo, ma sono comunque interessati a scoprire la novità, l'originalità e le possibili strane implicazioni di alcune sorprendenti idee utilizzate dalla fisica teorica moderna. Si può classificare come libro di divulgazione scientifica, ma di stampo piuttosto non convenzionale perchè si focalizza non solo ciò che è già noto ma anche - e soprattutto - su ciò che ancora è ignoto. Molte parti di questo libro sono infatti dedicate all'introduzione e all'illustrazione di modelli e risultati teorici che sono potenzialmente di importanza cruciale per una comprensione più profonda della Natura, ma che sono ancora in attesa di una definitiva conferma (o smentita) sperimentale. Da questo punto di vista il libro potrebbe avere interesse anche per i fisici di professione, specializzati o no nel campo della fisica teorica e delle interazioni fondamentali. La focalizzazione sui tre temi elencat...

  4. Onde elettromagnetiche

    CERN Document Server

    Toraldo di Francia, Giuliano

    1988-01-01

    Prefazione: "L'opera "Onde Elettromagnetiche" di Giuliano Toraldo di Francia vide la luce per i tipi della Casa Editrice Zanichelli nel lontano 1953. Tradotta ben presto in inglese e in giapponese, ha incontrato il favore di varie generazioni di studenti universitari e un apprezzamento dei docenti che non sembra ancora estinto. Ma è evidente che in trentacinque anni tante cose, troppe cose sono avvenute in quel campo di studio, per poter pensare che oggi il vecchio libro non presenti cospicue lacune. Ed è proprio a colmare tali lacune che ci siamo dedicati nell'elaborare il presente volume, pur conservando quasi tutto il materiale che aveva dato buona prova nel suo progenitore. La mole è inevitabilmente raddoppiata; eppure siamo ben lungi dall'avere esaurito un dominio così vasto, né ci eravamo proposti di farlo. Quello che presentiamo è il frutto di una scelta ragionata. Abbiamo ritenuto opportuno ampliare la parte sulle onde piane (con l'introduzione dei parametri di Stokes, e dei concetti di velocit�...

  5. Identità di genere in adolescenza: Lo sguardo di Tiresia sul maschio e la femmina

    Directory of Open Access Journals (Sweden)

    Arturo Casoni

    2015-12-01

    Full Text Available Nell’articolo la riflessione sul genere parte da Tiresia, l’indovino del ciclo mitologico di Edipo che ha attraversato sia la condizione di maschio sia di femmina, e che viene identificato come supposto sapiente al riguardo. Quindi si propone un panorama di ciò che è stato detto di innovativo sul tema negli ultimi cento anni, da Freud alla Queer Theory, passando per Simone de Beauvoir, il ‘femminismo psicoanalitico’, Lacan. Ciò che emerge è che, se molto è cambiato nella percezione del gender, ancora molto rimane insoluto riguardo agli stereotipi maschio/femmina, alle “gabbie” del genere e ai drammi da esse prodotti. Un cardine per riattivare la riflessione innovativa è - a proposito di ‘complesso di Edipo, momento di costruzione dell’identità di genere specialmente in età adolescenziale - trovare uno spazio teorico a ciò che possiamo definire l’originaria bisessualità dei ruoli genitoriali.

  6. L’estetica dell’ebreo e del cristiano nei racconti de Lo scialle andaluso di Elsa Morante

    NARCIS (Netherlands)

    Cascio, G.

    2007-01-01

    Quest’articolo indaga alcuni elementi fisiognomici ricorrenti nelle figure che popolano le novelle de Lo scialle andaluso di Elsa Morante. Cioè, qui suggeriamo l’ipotesi che nel piano narrativo ci sia una categorizzazione estetica che si riversa nel progetto dei contenuti e si proponga di dedurre i

  7. Il corpo, lo sport, le immagini

    Directory of Open Access Journals (Sweden)

    Nicola Porro

    2009-07-01

    Full Text Available E’ stato per primo Norbert Elias, nella sua critica al riduzionismo sociologico, a lamentare la difficoltà delle scienze sociali a misurarsi con le problematiche dello sport, così come delle emozioni, della sessualità, del gioco e della guerra. Attività umane che convergono in quell’autentico luogo sociale che è il corpo. Nel caso che ci interessa, si tratta di connettere il corpo, nella sua dimensione biologica, psichica e sociale, con quell’aspetto cruciale della civilizzazione che Elias definisce sportivizzazione.

  8. Il corpo narratore

    Directory of Open Access Journals (Sweden)

    Ivano Gamelli

    2005-09-01

    Full Text Available Sapere cosa provo attraverso il mio corpo di fronte all’altro mi permette non solo di capire cosa l'altro prova, soprattutto di generare naturalmente un’effettiva sintonizzazione, di evidenziare e nominare emozioni e sentimenti che in-formano la relazione con quel particolare bambino, adolescente o adulto che sia. Il rapporto con il linguaggio del corpo, prima ancora di divenire pratica psicopedagogica, è una 'pedagogia dell'esistenza'. Una pratica della nostra quotidianità che possiamo affinare oltre e prima che essa diventi pratica psicopedagogica.

  9. The Use of Radioactive Marker as a Tool to Evaluate the Drug Release in Plasma and Particle Biodistribution of Block Copolymer Nanoparticles

    Directory of Open Access Journals (Sweden)

    Sharon Johnstone

    2011-01-01

    Full Text Available Diblock copolymer nanoparticles encapsulating a paclitaxel prodrug, Propac 7, have been used to demonstrate the usefulness of a nonmetabolizable radioactive marker, cholesteryl hexadecyl ether (CHE, to evaluate nanoparticle formulation variables. Since CHE did not exchange out of the nanoparticles, the rate of clearance of the CHE could be used as an indicator of nanoparticle stability in vivo. We simultaneously monitored prodrug circulation and carrier circulation in the plasma and the retention of CHE relative to the retention of prodrug in the plasma was used to distinguish prodrug release from nanoparticle plasma clearance. Nanoparticles labelled with CHE were also used to evaluate accumulation of nanoparticles in the tumour. This marker has provided relevant data which we have applied to optimise our nanoparticle formulations.

  10. La politica ottimale per il Mezzogiorno:un commento a Moro

    Directory of Open Access Journals (Sweden)

    Bert Jossa

    2002-09-01

    Full Text Available In uno scritto recente ho sostenuto la tesi che la politica ottimale per il Mezzogiorno non è il laissez faire, né l’intervento diretto dello stato nell’economia, ma un intervento pubblico, anche “massiccio”, realizzato mediante leggi generali e astratte, che per loro natura sono di tipo non discrezionale.La necessità di un intervento generalizzato a favore di una zona meno sviluppata si giustifica con l’esistenza delle “diseconomie esterne”, che frenano lo sviluppo di tutte le imprese che operano in quella zona. Ha destato, perciò, in me meraviglia leggere l’articolo scritto contemporaneamente da Beniamino Moro (2001 e pubblicato nel numero 215 di questa rivista, che raggiunge lo stesso risultato con argomentazioni di segno opposto.

  11. Optimization and evaluation of chelerythrine nanoparticles composed of magnetic multiwalled carbon nanotubes by response surface methodology

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Yong [School of Life and Environmental Sciences, Guilin University of Electronic Technology, Guilin, Guangxi 541014 (China); Yuan, Yulin [Department of Clinical Laboratory, the People' s Hospital of Guangxi Zhuang Autonomous Region, Nanning, Guangxi 530021 (China); Zhou, Zhide; Liang, Jintao; Chen, Zhencheng [School of Life and Environmental Sciences, Guilin University of Electronic Technology, Guilin, Guangxi 541014 (China); Li, Guiyin, E-mail: liguiyin01@163.com [School of Life and Environmental Sciences, Guilin University of Electronic Technology, Guilin, Guangxi 541014 (China)

    2014-02-15

    In this study, a new chelerythrine nanomaterial targeted drug delivery system (Fe{sub 3}O{sub 4}/MWNTs-CHE) was designed with chelerythrine (CHE) as model of antitumor drug and magnetic multiwalled carbon nanotubes (Fe{sub 3}O{sub 4}/MWNTs) nanocomposites as drug carrier. The process and formulation variables of Fe{sub 3}O{sub 4}/MWNTs-CHE were optimized using response surface methodology (RSM) with a three-level, three-factor Box–Behnken design (BBD). Mathematical equations and response surface plots were used to relate the dependent and independent variables. The experimental results were fitted into second-order response surface model. When Fe{sub 3}O{sub 4}/MWNTs:CHE ratio was 20.6:1, CHE concentration was 172.0 μg/mL, temperature was 34.5 °C, the drug loading content and entrapment efficiency were 3.04 ± 0.17% and 63.68 ± 2.36%, respectively. The optimized Fe{sub 3}O{sub 4}/MWNTs-CHE nanoparticles were characterized by scanning electron microscopy (SEM), Zeta potential, in vitro drug release and MTT assays. The in vitro CHE drug release behavior from Fe{sub 3}O{sub 4}/MWNTs-CHE displayed a biphasic drug release pattern and followed Korsmeyer–Peppas model with Fickian diffusion mechanism for drug release. The results from MTT assays suggested that the Fe{sub 3}O{sub 4}/MWNTs-CHE could effectively inhibit the proliferation of human hepatoma cells (HepG2), which displayed time or concentration-dependent manner. All these preliminary studies were expected to provide a theoretical basis and offer new methods for preparation efficient magnetic targeted drug delivery systems.

  12. Prefazione

    NARCIS (Netherlands)

    Gobbo, F.; Caligaris, I.

    2016-01-01

    Chi sono gli esperantisti? Perché scelgono di studiare l’esperanto? Per quali ragioni si accostano al movimento? Che cosa rappresenta per loro questa lingua? Quali valori veicola? Che posizione occupa nel loro repertorio linguistico? Ma soprattutto: l’esperanto è solo una lingua? E in che modo è

  13. Family Planning - A Priority Social and Health Action Programme for ...

    African Journals Online (AJOL)

    personal identity and value, make connections wich ancestors and descendants" ... which promote che use of safe and effective modern mechods of contraception which ... ety as a whole. FP services, on the other hand, are motivated ... you cannot fail to have noticed che almost total collapse of che economies of many ...

  14. "A chiare lettere" Editoriale gennaio 2007

    Directory of Open Access Journals (Sweden)

    Giuseppe Casuscelli

    2011-02-01

    Full Text Available Ad onta delle crisi ricorrenti che investono il diritto ecclesiastico, nell’anno appena iniziato la nostra disciplina raccoglie il testimone inatteso della speranza. Il 2006 ci ha offerto la pubblicazione di tre manuali1 che, con un taglio ed un’impostazione nuovi, si rivolgono ad un’utenza che non è fatta soltanto degli studenti delle nostre Università; la pubblicazione del primo numero della nuova rivista semestrale “Diritto e Religioni”2, che intende trattare il fattore religioso da molteplici punti di vista aprendosi ad una molteplicità di scienze affini (antropologia, sociologia, storia, filosofia; la nascita di questa rivista telematica che non vuole avere un proprio indirizzo o orientamento, ma si prefigge lo scopo di essere strumento e manifesto della pluralità e del pluralismo delle scuole, delle sensibilità, dei metodi che alimentano il patrimonio comune del sapere teorico perché in esso trovi a sua volta alimento il concreto, quotidiano farsi dell’esperienza giuridica. Due ricorrenze di particolare rilievo segnano, ancora, questa fase: i cinquanta anni della Corte costituzionale, alla cui attività molto è legato il rinnovamento del “diritto ecclesiastico”, che ha partecipato alla celebrazione corale offrendo uno specifico contributo di analisi della sua giurisprudenza 3; i dodici lustri della Costituzione repubblicana, un’età “matura” che offre l’occasione per un bilancio della sua vitalità, delle compiute attuazioni, delle attese non ancora realizzate.

  15. Un anello per domarli tutti

    CERN Document Server

    Merlini, Antonio

    2014-01-01

    Questa tesina tratta degli acceleratori di particelle. I motivi della loro nascita, la loro evoluzione, il loro presente e il loro futuro. Particolare attenzione sarà data al Large Hadron Collider, il più grande di essi e la più incredibile macchina mai realizzata dall’uomo. Inoltre si parlerà dei rilevatori, che permettono lo studio di particelle invisibili all’uomo; del fatto che gli scienziati non escludono che gli strumenti che utilizzano possano potenzialmente distruggere il pianeta; e di come gli acceleratori hanno cambiato la nostra vita.

  16. A Modular Approach to Integrating Biofuels Education into ChE Curriculum Part I--Learning Materials

    Science.gov (United States)

    He, Q. Peter; Wang, Jin; Zhang, Rong; Johnson, Donald; Knight, Andrew; Polala, Ravali

    2016-01-01

    In view of potential demand for skilled engineers and competent researchers in the biofuels field, we have identified a significant gap between advanced biofuels research and undergraduate biofuels education in chemical engineering. To help bridge this gap, we created educational materials that systematically integrate biofuels technologies into…

  17. Mortality of Kalliapseudes schubartii in unvegetated soft bottoms of the estuarine region of the Lagoa dos Patos

    Directory of Open Access Journals (Sweden)

    Fonseca Duane Barros

    2006-01-01

    Full Text Available Studies were carried iut on seasonal mortality by taking samples of Kalliapseudes schubartii (Crustacea: Tanaidacea for a year in the estuarine region of the Lagoa dos Patos (southern Brazil. Results demonstrated no significant difference in seasonal mortality rates, which suggest that populations of K. schubartii was heavily preyed on year round and that an assumption of a significantly higher mortality in summer/autumn than in spring/winter might not be held in unvegetated soft bottoms of the estuarine regions of the Lagoa dos Patos.

  18. [The activity of blood cholinesterase in rats exposed to dimehypo].

    Science.gov (United States)

    Wan, Weiguo; Xu, Mailing; Zou, Hejian; Lu, Ailing; Shen, Xinyu; Chen, Yuming

    2002-12-01

    To determine whether and to what degree the activity of cholinesterase(ChE) is inhibited by dimehypo at different doses of dimehypo [scientific name: 2-dimethylamine-1,3-bi(sodium hyposulfit)]. Rats were dosed with dimehypo or methamidophos orally, and were randomly divided into four subgroups according to the pesticide doses, which were 1/16, 1/8, 1/4 and 1/2 of LD50 respectively(the LD50 of dimethypo and methamidophos is 342 mg/kg and 20 mg/kg respectively). The activity of ChE in blood was determined before and 30 min, 1, 2, 4 and 24 h after exposure. The modified Ellman Method was employed to measure the activity of ChE. 1/16 LD50 dose of dimehypo did not affect the activity of ChE. When the dose increased, the activity of ChE decreased accordingly. 1/2 LD50 dose of dimehypo inhibited the activity of ChE by 35.9% compared with that of control group(P dimehypo at various doses was significantly lower than that in the rats dosed with corresponding doses of methamidophos(P dimehypo may inhibit the activity of ChE. However, as compared with methamidophos, dimehypo is a weaker inhibitor of ChE.

  19. LIFE-WRITING / NARRARSI

    African Journals Online (AJOL)

    User

    12 nov 2004 ... pochi minuti, prima che il vecchio scendesse dall'autobus, una sorta di intimità fra di noi che ricordo mi infastidiva. Una vicinanza eccessiva che mi faceva percepire chiaramente quanto incolmabile fosse la nostra distanza. Prima di scendere dall'autobus quel vecchio mi diede altri consigli su argomenti ...

  20. Subversion and reconstruction of the detective novel: a reading of ...

    African Journals Online (AJOL)

    Nella lettura che si fa del terzo romanzo poliziesco di Sciascia, lo si scompone per dimostrare come l'autore intenzionalmente sovverte, manipola e rielabora la tecnica e gli elementi che costituiscono il 'giallo' come genere. Nel contempo si cerca di decifrare la pletora di citazioni pittoriche e letterarie che s'intrecciano nella ...

  1. La narrazione orale tra bambini ed adulti: da flusso continuo a vena carsica?

    Directory of Open Access Journals (Sweden)

    Milena Bernardi

    2010-02-01

    Full Text Available Con il segmento di ricerca che viene presentato nella sua prima fase si prende in esame l’ipotesi di un processo, in atto da tempo, di trasformazione e/o di declino della narrazione orale nel rapporto quotidiano tra adulti e bambini, inteso, in questo specifico contesto, come “spia” dei mutamenti degli stili educativi e degli interscambi tra famiglie ed operatori dei servizi in relazione all’alleanza educativa. La complessità dei filoni di studio che rimandano alla voce “narrazione” negli ambiti delle scienze umane esige la precisazione della curvatura “narrativa” scelta per la ricerca in corso: curvatura che appartiene all’epistemologia della letteratura per l’infanzia e della pedagogia della narrazione in quanto permette di imboccare la strada della ricerca pedagogica rivolta innanzi tutto ai significati che il narrare assume nella relazione educativa e poi ai modi ed alle forme della narrazione che coinvolgono l’infanzia. In un’epoca di grande vitalità e visibilità delle narrazioni, tra cui abbondano le produzioni scritte, illustrate, filmate per l’infanzia, sembra esserci una zona marginale e quasi sommersa della comunicazione narrante che rischia di sfumare in una sorta di oblio. E’ la zona della narrazione orale esperita in praesentia da bambini ed adulti insieme, tessuta con fili di parole che restituiscono senso all’intero arco delle esperienze, tentando di riordinare il disordine che spesso connota la realtà, interpretando, stabilendo connessioni, impregnando di quel senso i vissuti, i fatti, le relazioni, le cose e le parole stesse, ancora, nelle voci. Del rischio e delle conseguenze che possono derivare dalla sua mancanza si occupa questo contributo di ricerca che, dal punto di vista metodologico, si è avvalso e si avvale sia di analisi condotte sul corpus dei testi sia della raccolta di dati e informazioni tramite incontri condotti con la modalità del focus group, con educatrici e genitori.

  2. Book review, Tecniche infermieristiche, Paola Rueca & Matteo Tommasini Degna

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2008-06-01

    Full Text Available Quella dell'infermiere veterinario è una figura professionale anomala, non di rado persino avversata dai medici veterinari che la vedono come un rivale, un potenziale pericolo che può ‘‘rubare’’ una fetta di lavoro. D'altronde il contesto lavorativo del veterinario italiano è difficile perchè rispetto agli altri Paesi della Comunità Europea e agli Stati Uniti i numeri sono superiori a quelli che il mercato richiederebbe, mentre la preparazione pratica veterinaria è inferiore. Ciò porta a periodi di apprendistato lunghi e mal retribuiti, che interferiscono con la professione dell'ausiliario creando equivoci. Gli autori di questo utile manuale partono dall’assunto che medici e infermieri veterinari svolgono ruoli molto differenti, seppur complementari. Pertanto la figura dell'infermiere deve essere concepita come un fondamentale supporto. Si tratta di un lavoro di assistenza, aiuto e preparazione che facilita, velocizza e ottimizza ma non sostituisce assolutamente il lavoro del veterinario.A suffragare questa tesi, in prefazione, il dottor Tommasini Degna aggiunge: ‘‘è vero che conosco Paola Rueca da vent’anni e che è in grado di farmi fare un intervento, rispettando i principi della sterilità, anche nel deserto del Sahara sotto una tenda.’’. La coautrice del volume, infatti, nasce come infermiera diplomata umana per poi passare alla medicina veterinaria dove plasma la sua conoscenza in vent’anni di esperienza sul campo: frequenta Università statunitensi per vedere come funziona in altri Paesi una figura professionale di veterinary technician ben affermata e mette a disposizione questo bagaglio per tutti coloro che desiderano diventare infermieri veterinari in Italia.Questo libro si propone come valida guida per chi si vuole avvicinare alla professione dell’ausiliario veterinario, una base di consultazione pratica, ma anche un modo per cercare di chiarire questa posizione ai medici veterinari. Un incentivo a

  3. Mineralogy, provenance, and diagenesis of a potassic basaltic sandstone on Mars: CheMin X-ray diffraction of the Windjana sample (Kimberley area, Gale Crater)

    International Nuclear Information System (INIS)

    Treiman, Allan H.; Bish, David L.; Chipera, Steve J.; Blake, David F.

    2015-01-01

    The Windjana drill sample, a sandstone of the Dillinger member (Kimberley formation, Gale Crater, Mars), was analyzed by CheMin X-ray diffraction (XRD) in the MSL Curiosity rover. From Rietveld refinements of its XRD pattern, Windjana contains the following: sanidine (21% weight, ~Or 95 ); augite (20%); magnetite (12%); pigeonite; olivine; plagioclase; amorphous and smectitic material (~25%); and percent levels of others including ilmenite, fluorapatite, and bassanite. From mass balance on the Alpha Proton X-ray Spectrometer (APXS) chemical analysis, the amorphous material is Fe rich with nearly no other cations—like ferrihydrite. The Windjana sample shows little alteration and was likely cemented by its magnetite and ferrihydrite. From ChemCam Laser-Induced Breakdown Spectrometer (LIBS) chemical analyses, Windjana is representative of the Dillinger and Mount Remarkable members of the Kimberley formation. LIBS data suggest that the Kimberley sediments include at least three chemical components. The most K-rich targets have 5.6% K 2 O, ~1.8 times that of Windjana, implying a sediment component with >40% sanidine, e.g., a trachyte. A second component is rich in mafic minerals, with little feldspar (like a shergottite). A third component is richer in plagioclase and in Na 2 O, and is likely to be basaltic. The K-rich sediment component is consistent with APXS and ChemCam observations of K-rich rocks elsewhere in Gale Crater. The source of this sediment component was likely volcanic. Finally, the presence of sediment from many igneous sources, in concert with Curiosity's identifications of other igneous materials (e.g., mugearite), implies that the northern rim of Gale Crater exposes a diverse igneous complex, at least as diverse as that found in similar-age terranes on Earth.

  4. [Psychosocial factors of chronic hand eczema].

    Science.gov (United States)

    Li, Li; Liu, Panpan; Li, Ji; Xie, Hongfu; Kuang, Yehong; Li, Jie; Su, Juan; Zhu, Wu

    2017-02-28

    To study the psychosocial factors in patient with chronic hand eczema (CHE).
 Methods: Personality traits, emotional state, and quality of life of 240 patients with CHE and 221 normal control (NC) subjects were assessed by General Questionnaire, Eysenck Personality Questionnaire (EPQ), Self-Rating Depression Scale (SDS), Self-Rating Anxiety (SAS), and Eczema Quality of Life Scale (EQOLS).
 Results: In comparison, EPQ scores, scores of extraversion (E) factor in patients with CHE were significantly lower than those in NC subjects (P0.05). Patients with CHE had significantly higher scores in SDS and SAS compared with the NC subjects (Pemotional instability of introverts.Patients with CHE have a higher level of depression and anxiety, and exert a negative effect on their quality of life, which is related to severity of disease.

  5. Il museo partecipativo sul web: forme di partecipazione dell’utente alla produzione culturale e alla creazione di valore culturale / The participatory museum on the Web: forms of user participation in cultural production and the creation of cultural value

    Directory of Open Access Journals (Sweden)

    Elisa Bonacini

    2012-05-01

    Full Text Available Obiettivo di questo lavoro è un inquadramento sia del nuovo rapporto fra il museo partecipativo e l’utenza che delle forme di partecipazione dell’utenza alla produzione culturale e alla creazione di valore culturale, alla luce delle potenzialità offerte dalle ICT, soprattutto dal web e dai vari social media. Questo nuovo rapporto, che ha le sue radici più profonde proprio nell’ampia adozione di tutte le piattaforme tecnologiche oggi in uso, consente anche una reinterpretazione del significato stesso di cultural value. Il quadro, che viene qui delineato ed arricchito da numerosi esempi soprattutto stranieri, chiarisce anche quanto l’aspetto partecipativo e l’utilizzo di tags, folksonomie e user generated contents possano incidere sulla fidelizzazione dell’utenza. Infine, in una tabella presentata a fine del contributo, si evidenziano le maggiori componenti che caratterizzano il definitivo passaggio dalla fase Museo 1.0 alla fase Museo 2.0. The aim of this paper is a framework both of the new relationship between the participatory museum and the audience and a framework of multiple forms of audience participation in cultural production and in the creation of cultural value, given the potential offered by ICTs, especially the web and various social media. This new relationship, which has its deepest roots just in the adoption of all technology platforms in use today, also allows for a reinterpretation of the meaning of cultural value. The framework, outlined here and enriched by numerous examples especially foreigners, also makes clear that participation and use of tags, folksonomies and user-generated contents may have an impact on users loyalty. Finally, presented in a table at the end of the paper, we highlight the most important features characterizing the transition from the Museum 1.0 phase to the Museum 2.0 one.

  6. Il sapore dell’ italia: i nomi delle marche alimentari pseudoitaliane in Germania

    Directory of Open Access Journals (Sweden)

    Marie A. Rieger

    2013-10-01

    Full Text Available La cucina italiana è famosa e apprezzata in tutto il mondo. Per molti, la sua varietà e leggerezza sono l’espressione tangibile della proverbiale gioia di vivere degli italiani, per altri evoca il sole, il mare e le vacanze. Sicuramente tutti concordano sul fatto che la cucina italiana sia sinonimo di bontà e qualità. In Germania, in particolare, la gastronomia italiana può vantare quasi sessant’anni di storia e un fatturato annuale che supera i tre miliardi di Euro. Il successo del mangiare all’italiana si rispecchia anche sugli scaffali dei supermercati che sono pieni di prodotti alimentari tipici della cucina italiana. Ma accanto alle marche BARILLA, BUITONI e LAVAZZA si possono trovare anche gli spaghetti COMBINO, la pizza RIGGANO e il caffè BELLAROM. A differenza dei primi tre nomi, tutte marche tradizionali italiane, gli ultimi tre sono marche commerciali tedesche che hanno l’evidente obiettivo di suggerire l’origine italiana dei rispettivi prodotti. Poiché l’origine italiana è garante di bontà e qualità, anche aziende tedesche cercano di sfruttare il cosiddetto country-of-origin effect. L’analisi linguistica di un corpus di 41 nomi di marche tedesche italianizzanti dimostra che le naming strategies possono essere ricondotte a pochi modelli formativi, il che sembrerebbe violare l’imperativo dell’innovazione e della diversità imposto dalle strategie del marketing. Eppure, i nomi sono perfettamente funzionali: dal momento che corrispondono all’idea che i tedeschi hanno della lingua italiana, come dimostrano degli studi empirici condotti da me, tali nomi sono percepiti come italiani e ai rispettivi prodotti viene attribuita un’origine italiana che funge, a sua volta, da marchio di qualità.

  7. National Health Insurance Scheme: How Protected Are Households in Oyo State, Nigeria from Catastrophic Health Expenditure?

    Directory of Open Access Journals (Sweden)

    Olayinka Stephen Ilesanmi

    2014-05-01

    Full Text Available Background The major objective of the National Health Insurance Scheme (NHIS in Nigeria is to protect families from the financial hardship of large medical bills. Catastrophic Health Expenditure (CHE is rampart in Nigeria despite the take-off of the NHIS. This study aimed to determine if households enrolled in the NHIS were protected from having CHE. Methods The study took place among 714 households in urban communities of Oyo State. CHE was measured using a threshold of 40% of monthly non-food expenditure. Descriptive statistics were done, Principal Component Analysis was used to divide households into wealth quintiles. Chi-square test and binary logistic regression were done. Results The mean age of household respondent was 33.5 years. The median household income was 43,500 naira (290 US dollars and the range was 7,000–680,000 naira (46.7–4,533 US dollars in 2012. The overall median household healthcare cost was 890 naira (5.9 US dollars and the range was 10-17,700 naira (0.1–118 US dollars in 2012. In all, 67 (9.4% households were enrolled in NHIS scheme. Healthcare services was utilized by 637 (82.9% and CHE occurred in 42 (6.6% households. CHE occurred in 14 (10.9% of the households in the lowest quintile compared to 3 (2.5% in the highest wealth quintile (P= 0.004. The odds of CHE among households in lowest wealth quintile is about 5 times. They had Crude OR (CI: 4.7 (1.3–16.8, P= 0.022. Non enrolled households were two times likely to have CHE, though not significant Conclusion Households in the lowest wealth quintiles were at higher risk of CHE. Universal coverage of health insurance in Nigeria should be fast-tracked to give the expected financial risk protection and decreased incidence of CHE.

  8. Il narratore algoritmico

    Directory of Open Access Journals (Sweden)

    Paolo Sordi

    2017-06-01

    Ciò che resta dell’ipertesto è una “rete televisiva”, una piattaforma di broadcasting che privilegia oralità, video e slideshow in modo che con le loro performance dai palchi di TED e YouTube i guru dell’epica digitale e dell’innovazione possano affermarsi come le vere pop star di questa epoca neoliberista.

  9. The Construction of Ethiopian National Cuisine

    Directory of Open Access Journals (Sweden)

    Abbebe Kifleyesus

    2006-12-01

    Full Text Available L'Etiopia ha sempre beneficiato di un’attenzione internazionale in quanto patria di un’eccellente tradizione gastronomica. Per quanto vi siano pietanze regionali diffuse in gran parte del Paese, vi è anche una cucina nazionale distinta. Ad elevare lo status di questa cucina nazionale ha contribuito la crescente popolarità di una sua pietanza particolarmente piccante conosciuta come wäṭ, che ha ora notorietà internazionale grazie al turismo e ai ristoranti etiopici in Europa e Nord-America. Gli Etiopi non hanno mai dubitato dello status elevato della loro alimentazione, ma non c’è ancora un autentico e compiuto testo di ricette etiopiche che promuova le pietanze del Paese. Per quanto la loro cucina si diffonda in più continenti, lo studio dell'alimentazione etiopica è agli inizi senza che si registrino apporti significativi che contribuiscano a una migliore conoscenza scientifica. Questo articolo esamina alcuni dei processi che sono implicati nell'alimentazione etiopica come cucina nazionale e internazionale, rievocando le radici storiche della sua tradizione gastronomica e i fattori che ne influenzano lo sviluppo come cucina trans-nazionale"

  10. Teorie del tutto la ricerca della spiegazione ultima

    CERN Document Server

    Barrow, John D

    1992-01-01

    «Come, quando e perché l’universo ha avuto origine? Questi interrogativi di carattere fondamentale sono stati fuori moda per secoli: gli scienziati ne diffidavano, teologi e filosofi se ne erano stancati. Poi, d’improvviso, gli scienziati hanno cominciato a porseli con la massima serietà, e i teologi si sono trovati, scavalcati, a dover tenere dietro alle teorizzazioni matematiche della nuova generazione di scienziati... Oggi i fisici credono di essersi imbattuti in una chiave capace di guidarci al segreto matematico che sta al cuore dell’universo: una scoperta che punta verso una “teoria del tutto”, una sorta di quadro onnicomprensivo di tutte le leggi di natura dal quale deve derivare, in modo logicamente ineccepibile, l’inevitabilità di tutto ciò che ci circonda. Una volta in possesso di questa stele di Rosetta cosmica, potremmo leggere il libro della natura in tutta la sua estensione temporale, e intendere ogni cosa che sia stata, che è e che sarà. Di questa possibilità si è sempre fa...

  11. William Franke, Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura William Franke, On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Interpretation of Literature

    Directory of Open Access Journals (Sweden)

    Laura Lucia Rossi

    2010-06-01

    Full Text Available

    In this article we propose the translation of William Franke’s paper On the Poetic Truth that is Higher than History: Porphyry and the Philosophical Criticism of Literature, in which the American scholar presents the hermeneutic method of the ancient commentators of Homer, with particular reference to the critic practice applied by the Neoplatonic Porphyry in his De Antro Nympharum. With this treatment Franke proposes and hopes for the return to an interpretive method, called philosophical or speculative, also for contemporary criticism.

    In questo articolo è presentata la traduzione del saggio di William Franke Sulla verità poetica che è superiore alla Storia: Porfirio e la critica filosofica della letteratura, in cui lo studioso americano presenta il metodo ermeneutico degli antichi commentatori di Omero, con particolare riferimento alla critica praticata dal neoplatonico Porfirio, proponendo e auspicando il ritorno ad una modalità interpretativa, detta filosofica o speculativa, anche per la critica contemporanea.

  12. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    tardi, nel V libro dei Discorsi del poema eroico. 5, il Tasso, dopo aver affermato che non solo Dante ha innalzato il livello di reputazione dell'allegoria, ma che tutta la Commedia poggia su basi allegoriche (“non è parte che non sia allegorica”)6 ribadisca il concetto della medesima postilla: “Ma egli non dechiara se stesso ...

  13. Con le galoches, Basaglia e Don Milani, a spasso per la Via Lattea: cooperazione educativa, pedagogia del Cielo e politica dell’esperienza

    Directory of Open Access Journals (Sweden)

    Anna Barracco

    2017-08-01

    Full Text Available L'articolo riporta, a caldo, i pensieri, le riflessioni e le emozioni della psicoanalista e past president del Cipra, Anna Barracco, che scaturiscono dopo aver preso parte a un'esperienza di aggiornamento professionale sperimentale, rivolto agli insegnanti e promosso dal Movimento per la Cooperazione Educativa, svoltasi a Gubbio, dal 21 al 23 Aprile 2017. Il progetto è volutamente interdisciplinare e aperto a tutti, ma per lo più accoglie insegnanti della scuola dell'infanzia e della primaria. L'autrice mette in valore l'eredità spirituale e filosofica di Don Milani e della Scuola di Barbiana, eredità che appare molto viva nei gesti e negli stili che caratterizzano il seminario. Barracco ritrova, non senza un velo di malinconia, la forza e il respiro utopistico di un approccio che scavalca la dissimmetria fra discente e docente, dove tutti sono in qualche modo allievi - o ricercatori - del Cielo, cioè della materia che si vuole osservare, ma della quale siamo parte: il Cielo come sfondo integratore, in senso didattico, certamente, ma in senso anche esistenziale e filosofico. Un’esperienza di apprendimento e di comunità, che l'autrice mette in tensione con le esperienze basagliane e con la necessità di ritrovare un più fattivo dialogo fra le professioni umanistiche della cura e dell'educazione, indicando come strumento la messa in gioco del proprio desiderio di apprendere dall'esperienza, di guardare alle cose e alle persone, senza che lo schermo di tutto quello che crediamo di sapere ci impedisca di vedere.

  14. Chelerythrine induced cell death through ROS-dependent ER stress in human prostate cancer cells

    Directory of Open Access Journals (Sweden)

    Wu S

    2018-05-01

    Full Text Available Songjiang Wu, Yanying Yang, Feiping Li, Lifu Huang, Zihua Han, Guanfu Wang, Hongyuan Yu, Haiping Li Department of Urology, Enze Hospital of Taizhou Enze Medical Center (Group, Taizhou, China Introduction: Prostate cancer is the most common noncutaneous cancer and the second leading cause of cancer-related mortality worldwide and the third in USA in 2017. Chelerythrine (CHE, a naturalbenzo[c]phenanthridine alkaloid, formerly identified as a protein kinase C inhibitor, has also shown anticancer effect through a number of mechanisms. Herein, effect and mechanism of the CHE-induced apoptosis via reactive oxygen species (ROS-mediated endoplasmic reticulum (ER stress in prostate cancer cells were studied for the first time. Methods: In our present study, we investigated whether CHE induced cell viability decrease, colony formation inhibition, and apoptosis in a dose-dependent manner in PC-3 cells. In addition, we showed that CHE increases intracellular ROS and leads to ROS-dependent ER stress and cell apoptosis. Results: Pre-treatment with N-acetyl cysteine, an ROS scavenger, totally reversed the CHE-induced cancer cell apoptosis as well as ER stress activation, suggesting that the ROS generation was responsible for the anticancer effects of CHE. Conclusion: Taken together, our findings support one of the anticancer mechanisms by which CHE increased ROS accumulation in prostate cancer cells, thereby leading to ER stress and caused intrinsic apoptotic signaling. The study reveals that CHE could be a potential candidate for application in the treatment of prostate cancer. Keywords: chelerythrine, reactive oxygen species, endoplasmic reticulum stress, apoptosis, prostate cancer

  15. Modelli di previsione della domanda merci in area urbana e metropolitana

    Directory of Open Access Journals (Sweden)

    Agostino Nuzzolo

    2010-07-01

    Full Text Available In questa nota viene presentato lo stato dell’arte più recente dei modelli di simulazione della distribuzione urbana delle merci che consentono una valutazione ex-ante di scenari di misure che la Pubblica Amministrazione può adottare per la riduzione delle criticità del settore. Partendo dalla struttura organizzativa della distribuzione delle merci e dalle relative criticità, vengono individuati i decisori le cui scelte possono essere influenzate dalle misure in questione e vengono classificate le misure stesse in funzione degli obiettivi strategici che l’Amministrazione vuole raggiungere. È possibile in questo modo individuare in funzione delle misure, quali sono i processi decisionali che è necessario simulare con i modelli. Il sistema di modelli presentato consente di arrivare ai flussi di veicoli merci tra le zone dell’area di studio e si compone di due sottosistemi: quello di domanda che fornisce le matrici OD in consegne tra le zone, e quello logistico che permette di passare alla OD in veicoli. Il sottosistema di domanda è specificato come un modello ad aliquote parziali che partendo dai dati socio-economici dell’area di studio permette la ricostruzione delle matrici OD per tipologia di servizio di trasporto e le matrici OD in consegne per intervallo temporale e per tipologia di veicolo. Il sottosistema logistico permette di stimare i flussi OD di veicoli congruentemente ai flussi di consegne determinate precedentemente, mediante una sequenza di due modelli che forniscono la distribuzione dei tour per numero di consegne e la scelta della zona successiva di consegna.

  16. Efficiency of utilization of heat of moisture from exhaust gases of heat HRSG of CCGT

    Directory of Open Access Journals (Sweden)

    Galashov Nikolay

    2017-01-01

    Full Text Available The paper discusses the technology of utilizing the heat of exhaust gas moisture from heat recovery steam gases (HRSG of combined-cycle gas turbine (CCGT. Particular attention focused on the influence of the excess air factor on the trapping of the moisture of the exhaust gases, as in the HRSG of the CCGT its value varies over a wider range than in the steam boilers of the TPP. For the research, has been developed a mathematical model that allows to determine the volumes of combustion products and the amount of water vapor produced according to a given composition of the burned gas and determine the amount of moisture that will be obtained as a result of condensation at a given temperature of the flue gases at the outlet of the condensation heat exchanger (CHE. To calculate the efficiency of the HRSG taking into account the heat of condensation of moisture in the CHE an equation is derived.

  17. Emozione e somatizzazione

    Directory of Open Access Journals (Sweden)

    Sabine Parmentelot

    2004-09-01

    Full Text Available Consacreremo la prima parte di quest'articolo alle manifestazioni corporee dell'emozione. La psicologia sperimentale, insieme alla neuro-biologia, hanno evidenziato le differenti risposte corporee più o meno percettibili. Ma al di là di queste manifestazioni puramente oggettive le cui percentuali e oscillazioni possono essere valutate, misurate ... E' l'aspetto soggettivo e le loro ripercussioni che c'interessa. Quali significati possono avere le emozioni per la persona che le prova? Questi temi saranno l'oggetto della seconda parte. Ci situiamo in quanto ricercatori che interrogano altri soggetti, ma è evidente che non possiamo fare astrazione delle nostre passioni.

  18. Il razzismo: il riconoscimento negato (Renate Siebert

    Directory of Open Access Journals (Sweden)

    Francesco Bachis

    2004-12-01

    Full Text Available Consacreremo la prima parte di quest'articolo alle manifestazioni corporee dell'emozione. La psicologia sperimentale, insieme alla neuro-biologia, hanno evidenziato le differenti risposte corporee più o meno percettibili. Ma al di là di queste manifestazioni puramente oggettive le cui percentuali e oscillazioni possono essere valutate, misurate ... E' l'aspetto soggettivo e le loro ripercussioni che c'interessa. Quali significati possono avere le emozioni per la persona che le prova? Questi temi saranno l'oggetto della seconda parte. Ci situiamo in quanto ricercatori che interrogano altri soggetti, ma è evidente che non possiamo fare astrazione delle nostre passioni.

  19. 10 volti per la Liberazione. Una mostra per le strade della città

    Directory of Open Access Journals (Sweden)

    Margherita Becchetti

    2013-09-01

    Full Text Available Nel saggio si dà conto delle vicende che hanno segnato “10 volti per la Liberazione”, mostra diffusa nelle strade di Parma, allestita in occasione del 25 aprile 2013 dal Centro studi movimenti con sagome a grandezza naturale di alcuni protagonisti della lotta partigiana. L’autrice affronta i problemi incontrati nel corso dell’allestimento e le reazioni che l’iniziativa ha suscitato, elementi che investono direttamente la riflessione storiografica avendo a che vedere con l’uso pubblico della storia, con il rapporto tra memoria pubblica e privata e con il ruolo rivestito dagli storici nella costruzione della memoria collettiva.

  20. L'evoluzione del WEB GIS la filiera postgis-mapserver-geoext- openlayers per sviluppare piattaforme GIS complete, agili ed economiche

    Directory of Open Access Journals (Sweden)

    Francesco Mariucci

    2012-04-01

    Full Text Available Spesso, nel nostro ambito, ci si sente dire che il GIS è un bene di lusso, dal quale, soprattutto in epoca di crisi economica, le piccole entità (sia in ambito pubblico che privato possono facilmente prescindere. Questo articolo vuole segnalare la presenzadi tecnologie non nuove ma consolidate che unite insieme possono costituire una base informatica flessibile e di costi ridotti per l'implementazione di piattaforme GIS dedicate che siano di supporto anche per le piccole realtà nella gestione di dati ed attività territoriali, con notevoli vantaggi sulla produttività e sull'immagine

  1. Catalytic heat exchangers - a long-term evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Silversand, Fredrik A. [CATATOR AB, Lund (Sweden)

    2003-10-01

    A long-term evaluation concerning catalytic heat exchangers (CHEs) has been performed. The idea concerning CHEs was originally described in a number of reports issued by Catator almost a decade ago. The general idea with CHEs is to combust a fuel with a catalyst inside a heat exchanger to enable an effective heat transfer. The first design approaches demonstrated the function and the possibilities with CHEs but were defective concerning the heat exchanger design. Consequently, a heat exchanger company (SWEP International AB), which was specialised on brazed plate-type heat exchangers, joined the continued development project. Indeed, the new design approach containing Catator's wire-mesh catalysts and SWEP's plate-type heat exchangers enabled us to improve the concept considerably. The new design complied with a number of relevant technical demands, e.g.: Simplicity; Compactness and integration (few parts); High thermal efficiency; Low pressure drop; Excellent emissions; High turn-down ratio; Reasonable production cost. Spurred by the technical progresses, the importance of a long-term test under realistic conditions was clear. A long-term evaluation was initialised at Sydkraft Gas premises in Aastorp. The CHE was installed on a specially designed rig to enable accelerated testing with respect to the number of transients. The rig was operated continuously for 5000 hours and emission mapping was carried out at certain time intervals. Following some problems during the initial phase of the long-term evaluation, which unfortunately also delayed the project, the results indicated very stable conditions of operation. The emissions have been rather constant during the course of the test and we cannot see any tendencies to decreased performances. Indeed, the test verifies the function, operability and reliability of the CHE-concept. Apart from domestic boilers we foresee a number of interesting and relevant applications in heating and process technology. Since

  2. Il mondo in un giardino (e in un labirinto, in un tappeto, in un romanzo illimitato

    Directory of Open Access Journals (Sweden)

    Guido Laino

    2011-06-01

    Full Text Available Per Michel Foucault il giardino è il più antico esempio di un’eterotopia che “ha il potere di giustapporre, in un unico luogo reale, diversi spazi, diversi luoghi che sono tra loro incompatibili” (Foucault 1994, 16; è un luogo sacro di tradizione millenaria che, in Oriente, rappresenta simbolicamente un microcosmo, “la più piccola particella del mondo e […] anche la totalità del mondo” (ibid. 18. Il giardino è un’eterotopia che Foucault pone in parallelo allo spazio teatrale e al cinema, che nella propria cornice pure riproducono il mondo nella sua sostanza eterogenea: nell’opera d’arte, come nel giardino, convivono diversi luoghi, le distanze sono ridotte alla geometria della propria rappresentazione, il tempo si comprime o si espande all’interno di un ordine narrativo funzionale alla rilettura dell’artista.

  3. Interaction of Chelerythrine with Keyhole Limpet Hemocyanin: a Fluorescence Spectroscopy and Molecular Docking Study

    Science.gov (United States)

    Zhong, M.; Long, R. Q.; Wang, Y. H.; Chen, C. L.

    2018-05-01

    The quenching mechanism between chelerythrine (CHE) and keyhole limpet hemocyanin (KLH) was investigated using fluorescence spectroscopy and molecular docking. The experiments were conducted at three different temperatures (293, 298, and 303 K). The results revealed that the intrinsic fluorescence of KLH was strongly quenched by CHE through a static quenching mechanism. The thermodynamic parameters (ΔG, ΔH, and ΔS) of the interaction were calculated, indicating that the interaction between CHE and KLH was spontaneous and that van der Waals forces and hydrogen bond formation played major roles in the binding process. The intrinsic fluorescence of the tyrosine and tryptophan residues in KLH was studied by synchronous fluorescence, which suggested that CHE changed the conformation of KLH. Finally, molecular docking was used to obtain detailed information on the binding sites and binding affinities between CHE and KLH.

  4. Una valigia caduta in mare: Jaume Serra Hunter e la "Scuola di Barcellona"

    Directory of Open Access Journals (Sweden)

    Nazzareno Fioraso

    2014-12-01

    Full Text Available Nella storiografia filosofica spagnola non esiste, probabilmente, una definizione ambigua e problematica come quella che riguarda la cosiddetta "Scuola di Barcellona". La tesi principale di questo articolo è che tale scuola non giunse mai a nascere, ma ne esistette soltanto una forma embrionale che non poté maturare perché, in conseguenza della situazione politica venutasi a creare con la guerra civile (1936-1939, i suoi componenti si dispersero nell'esilio. Ciò nonostante, è possibile riconoscere alcuni tratti comuni, seppur labili e (forse non sostanziali, nella diaspora degli intellettuali catalani che rendono possibile definirla, con le dovute cautele, "Scuola di Barcellona". Tali caratteristiche comuni si possono far risalire a colui che, in un certo senso, fu il fondatore della scuola, essendo il principale maestro delle nuove leve filosofiche della Catalogna all'inizio del XX secolo: Jaume Serra Hunter.

  5. Pratiche dei migranti e processi di ri-significazione dello spazio pubblico

    Directory of Open Access Journals (Sweden)

    Daniela Panariello

    2014-11-01

    Full Text Available Nella città multiculturale le domande di città aumentano, i vari piani che caratterizzano e che intrecciandosi costruiscono e reinventano quotidianamente gli spazi urbani si moltiplicano e si fanno sempre più portatori di nuovi bisogni e domande di città che nascono dai cittadini che vivono gli spazi urbani. Nella letteratura sociologica si parla spesso della fine e della morte degli spazi pubblici nella città postmoderna, abbandonati, svuotati del loro significato e funzioni iniziali: quella dell’incontro e della socializzazione tra persone aventi status e biografie diverse. In realtà, gli spazi pubblici delle metropoli postmoderne non sono morti, si stanno trasformando e il loro significato e senso sono in continua evoluzione. Lo spazio della città è da sempre rappresentativo della società e del periodo storico che una popolazione sta attraversando e più che mai oggi ciò è vero con i vari flussi migratori che hanno abbattuto il vecchio concetto di confine, tipico dello Stato-Nazione, costruendone uno più ampio, fluido, aperto, poroso, simbolico e applicabile ad ogni visione in scala della città. Vediamo allora come gli spazi pubblici urbani sono tuttora molto frequentati, non più dagli autoctoni ma soprattutto dai migranti li riempiono con significati nuovi attraverso processi lunghi e densi di socialità.

  6. Why human being cannot be like a worm? Wilfred Bion and the transindividual

    Directory of Open Access Journals (Sweden)

    Felice Cimatti

    2015-02-01

    Full Text Available Domanda. Se il paziente sa quello che sta facendo, e lei sa perché lo sta facendo, perché interpretare quello che sta facendo anziché chiedergli perché lo fa? Bion. Questo è un altro mistero. Perché non trasferirlo direttamente da lui stesso a lui stesso? Perché è necessaria una persona esterna? Perché l’essere umano non può essere come un lombrico? Perché avere un partner? Perché non avere una vita sessuale con sé stessi senza altre seccature? Perché non si può avere una relazione direttamente con sé stessi senza l’intervento di una specie di levatrice mentale o fisica? Pare che abbiamo bisogno di “rimbalzare” su un’altra persona, di avere qualcosa che rifletta indietro quello che diciamo prima che esso possa diventare comprensibile (Bion, 1984b, p. 59. Per sapere chi sono io devo chiederlo a te. Quindi la mia essenza è fuori di me. Tu, gli altri, siete il ‘mio’ segreto. La natura eccentrica dell’animale umano viene percorsa attraverso una riflessione sull’opera dello psicoanalista Wilfred Bion. Avendo in mente una domanda finale: se io sono tu, l’Io – propriamente - non esiste. Allora è un impostore? C’è un modo per essere io che non sia fittizio?

  7. Direct Correlation between Motile Behavior and Protein Abundance in Single Cells.

    Directory of Open Access Journals (Sweden)

    Yann S Dufour

    2016-09-01

    Full Text Available Understanding how stochastic molecular fluctuations affect cell behavior requires the quantification of both behavior and protein numbers in the same cells. Here, we combine automated microscopy with in situ hydrogel polymerization to measure single-cell protein expression after tracking swimming behavior. We characterized the distribution of non-genetic phenotypic diversity in Escherichia coli motility, which affects single-cell exploration. By expressing fluorescently tagged chemotaxis proteins (CheR and CheB at different levels, we quantitatively mapped motile phenotype (tumble bias to protein numbers using thousands of single-cell measurements. Our results disagreed with established models until we incorporated the role of CheB in receptor deamidation and the slow fluctuations in receptor methylation. Beyond refining models, our central finding is that changes in numbers of CheR and CheB affect the population mean tumble bias and its variance independently. Therefore, it is possible to adjust the degree of phenotypic diversity of a population by adjusting the global level of expression of CheR and CheB while keeping their ratio constant, which, as shown in previous studies, confers functional robustness to the system. Since genetic control of protein expression is heritable, our results suggest that non-genetic diversity in motile behavior is selectable, supporting earlier hypotheses that such diversity confers a selective advantage.

  8. Protein Connectivity in Chemotaxis Receptor Complexes.

    Directory of Open Access Journals (Sweden)

    Stephan Eismann

    2015-12-01

    Full Text Available The chemotaxis sensory system allows bacteria such as Escherichia coli to swim towards nutrients and away from repellents. The underlying pathway is remarkably sensitive in detecting chemical gradients over a wide range of ambient concentrations. Interactions among receptors, which are predominantly clustered at the cell poles, are crucial to this sensitivity. Although it has been suggested that the kinase CheA and the adapter protein CheW are integral for receptor connectivity, the exact coupling mechanism remains unclear. Here, we present a statistical-mechanics approach to model the receptor linkage mechanism itself, building on nanodisc and electron cryotomography experiments. Specifically, we investigate how the sensing behavior of mixed receptor clusters is affected by variations in the expression levels of CheA and CheW at a constant receptor density in the membrane. Our model compares favorably with dose-response curves from in vivo Förster resonance energy transfer (FRET measurements, demonstrating that the receptor-methylation level has only minor effects on receptor cooperativity. Importantly, our model provides an explanation for the non-intuitive conclusion that the receptor cooperativity decreases with increasing levels of CheA, a core signaling protein associated with the receptors, whereas the receptor cooperativity increases with increasing levels of CheW, a key adapter protein. Finally, we propose an evolutionary advantage as explanation for the recently suggested CheW-only linker structures.

  9. Conformational coupling between receptor and kinase binding sites through a conserved salt bridge in a signaling complex scaffold protein.

    Directory of Open Access Journals (Sweden)

    Davi R Ortega

    Full Text Available Bacterial chemotaxis is one of the best studied signal transduction pathways. CheW is a scaffold protein that mediates the association of the chemoreceptors and the CheA kinase in a ternary signaling complex. The effects of replacing conserved Arg62 of CheW with other residues suggested that the scaffold protein plays a more complex role than simply binding its partner proteins. Although R62A CheW had essentially the same affinity for chemoreceptors and CheA, cells expressing the mutant protein are impaired in chemotaxis. Using a combination of molecular dynamics simulations (MD, NMR spectroscopy, and circular dichroism (CD, we addressed the role of Arg62. Here we show that Arg62 forms a salt bridge with another highly conserved residue, Glu38. Although this interaction is unimportant for overall protein stability, it is essential to maintain the correct alignment of the chemoreceptor and kinase binding sites of CheW. Computational and experimental data suggest that the role of the salt bridge in maintaining the alignment of the two partner binding sites is fundamental to the function of the signaling complex but not to its assembly. We conclude that a key feature of CheW is to maintain the specific geometry between the two interaction sites required for its function as a scaffold.

  10. La certezza della pena tra lavoro nero e problematiche di integrazione / La certitude de la sanction entre travail au noir et problèmes d'intégration / Sanction Certainty between Illegal Work and Immigration Problems

    Directory of Open Access Journals (Sweden)

    Bisi Roberta

    2010-07-01

    Full Text Available L’immissione di nuove popolazioni in una società provoca inevitabilmente sfide a carattere sociale. Affrontare i problemi che la popolazione immigrata pone significa, tra l’altro, considerare che si tratta di un attore sociale che, con i propri comportamenti, le proprie scelte, i propri orientamenti mette in continua discussione i meccanismi logici e le politiche presenti nelle società.

  11. Gregory Crane e i cittadini della repubblica delle lettere

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2012-05-01

    Full Text Available Chi studia l’antichità conosce Gregory Crane anche quando non ne rammenta il nome, non per quello che ha scritto ma per quello che ha reso possibile scrivere. Crane è il direttore del Perseus Project, una biblioteca digitale che libera gli studiosi dal microcosmo chiuso e inaccessibile della monografia accademica, permettendo loro di lavorare sui classici [...

  12. Unità di conto di bilancio.

    Directory of Open Access Journals (Sweden)

    R. VALCAMONICI

    2014-09-01

    Full Text Available La principale conclusione che si ricava dall’articolo mostra che l’aggravio che deriverebbe ai paesi a moneta debole dalla introduzione dell’UCE e, alternativamente, il vantaggio in favore dei paesi a moneta forte, sono destinati a livellarsi a partire dal 1978 in conseguenza dell’applicazione integrale del sistema delle risorse proprie e della maggiore partecipazione dei nuovi Stati menbri.

  13. Legami 2.0. Il genere alla prova della contemporaneità

    Directory of Open Access Journals (Sweden)

    Redazione Camera blu

    2016-12-01

    Full Text Available Numero a cura di Anna Gargiulo. Il numero guarda alle trasformazioni che attengono al genere femminile che vanno oggi configurandosi nel virtuale, nei media, nelle sfide della società contemporanea rivolte ai corpi, alle famiglie, ai sistemi accademici. Si parte dai legami, dai link, che tanto possono connettere paesi e generazioni quanto legare oppressivamente l’altro a sé.

  14. Human Bioresponse to Low-Frequency Underwater Sound

    Science.gov (United States)

    2009-02-02

    the influential educators in my life. I think I have managed to learn something from every teacher and professor I have ever had, and I am greatly...that vibration dose values of 15 will usually cause severe discomfort, and increased exposure will cause increased risk of injury Figure 2.5 shows a...the axisymmetric geometry shown in Figure A.l is p=’£AnPn( cosO )hn(kr)e iut, n=0 (A.2) where Pn is the n th order Legendre polynomial, hn is the n th

  15. Temporal Trends in Antimicrobial Resistance and Virulence-Associated Traits within the Escherichia coli Sequence Type 131 Clonal Group and Its H30 and H30-Rx Subclones, 1968 to 2012

    DEFF Research Database (Denmark)

    Olesen, Bente; Frimodt-Møller, Jakob; Leihof, Rikke Fleron

    2014-01-01

    occurred only after 2000 and 2002, respectively, in association with the H30 and H30-Rx subclones, which were characterized by multidrug resistance (including extended-spectrum-beta-lactamase [ESBL] production: H30-Rx) and absence of biofilm production. Capsular antigen K100 occurred exclusively among H30......-Rx ST131 subclones, rather than representing acquisition of resistance by diverse ST131 strains. Distinctive characteristics of the H30-Rx subclone-including specific virulence genes (iutA, afa and dra, kpsII), the K100 capsule, multidrug resistance, and ESBL production-possibly contributed...

  16. User’s Manual for the AFSATCOM Terminal Upgrades Life Cycle Cost Model. Volume I.

    Science.gov (United States)

    1981-10-01

    EFAIL (I,NS)*TNB(NS) NS *I[LRU(I) + RTS(NHI(I))]*NRTS(I)*DRCT(LO(NS)) + NRTS(NHI(I))*(l - COND(I))*DAD) where TNB(NS) = total number of bases within the...required anywhere in the ATU logistics system, i.e., if it ever fails, and equals 0 otherwise. Computed by: IUT(I) = U( EFAIL (I,NS)) NS IMC = initial depot...I)*XFPR*BRCT + CIMF(NS)* EFAIL (I,B)*NBC(B)LRU(I)*FINC*FPR(I)*XFPR*CRCT B NHB(B)=NS The terms in the equation for TDFPR(I) above account for increases

  17. Serum Total Cholinesterase Activity on Admission Is Associated with Disease Severity and Outcome in Patients with Traumatic Brain Injury.

    Directory of Open Access Journals (Sweden)

    Qing-Hong Zhang

    Full Text Available Traumatic brain injury (TBI is one of the leading causes of neurological disability. In this retrospective study, serum total cholinesterase (ChE activities were analyzed in 188 patients for diagnostic as well as predictive values for mortality.Within 72 hours after injury, serum ChE activities including both acetylcholinesterase and butyrylcholinesterase were measured. Disease severity was evaluated with Acute Physiology and Chronic Health Evaluation (APACHE II score, Glasgow Coma Score, length of coma, post-traumatic amnesia and injury feature. Neurocognitive and functional scores were assessed using clinical records. Of 188 patients, 146 (77.7% survived and 42 (22.3% died within 90 days. Lower ChE activities were noted in the non-survivors vs. survivors (5.94±2.19 vs. 7.04±2.16 kU/L, p=0.023, in septic vs. non-infected patients (5.93±1.89 vs. 7.31±2.45 kU/L, p=0.0005 and in patients with extremely severe injury vs. mild injury (6.3±1.98 vs. 7.57±2.48 kU/L, p=0.049. The trajectories of serum ChE levels were also different between non-survivors and survivors, septic and non-infected patients, mild and severely injured patients, respectively. Admission ChE activities were closely correlated with blood cell counts, neurocognitive and functional scores both on admission and at discharge. Receiver operating characteristic analysis showed that the area under the curve for ChE was inferior to that for either APACHE II or white blood cell (WBC count. However, at the optimal cutoff value of 5 kU/L, the sensitivity of ChE for correct prediction of 90-day mortality was 65.5% and the specificity was 86.4%. Kaplan-Meier analysis showed that lower ChE activity (5 kU/L (p=0.04. After adjusting for other variables, ChE was identified as a borderline independent predictor for mortality as analyzed by Binary logistic regression (P=0.078.Lowered ChE activity measured on admission appears to be associated with disease severity and outcome for TBI patients.

  18. Architettura e arte pubblica in Italia dopo il 1945. About and Context

    Directory of Open Access Journals (Sweden)

    Paola Valenti

    2017-05-01

    - Lisa Parola, storica dell’arte, curatrice, membro dell’Associazione culturale a.titolo, Arte e sfera pubblica: l’esperienza di Nuovi Committenti in Italia. - Cesare Viel, artista, docente presso l’Accademia Ligustica di Belle Arti di Genova, Spazi di pubblica riflessione. I mutevoli confini della relazione tra intimo e collettivo, provvisorio e durevole, latente e manifesto nella pratica artistica contemporanea. Al fine di restituire la complessità dei temi affrontati e la ricchezza del dibattito che ha accompagnato le relazioni, per il numero della rivista “on the w@terfront” si è deciso di operare una selezione degli interventi presentati al convegno riferiti al contesto italiano (Claudia Collina, Alessandra Barbuto, Lisa Parola, Cesare Viel e di integrarla con alcuni saggi, affidati ai giovani studiosi che hanno collaborato alla redazione del volume Arte negli edifici pubblici. L’applicazione della “legge del 2%” in Liguria dal 1949 ad oggi, che illustrano la metodologia seguita nell’ambito della ricerca sulla applicazione della legge del 2% in Liguria (Rocco Spigno, che presentano i più importanti interventi e progetti culturali che hanno interessato la città di Genova dal 1992, anno dell’Esposizione Colombiana che ha segnato una inversione di rotta per il capoluogo ligure, ad oggi (Alessandra Piatti, che riflettono su come l’arte pubblica abbia trovato, in Italia, un terreno di controcultura nel World Wide Web (Francesca Bulian. Il contributo di Paola Valenti, che apre la raccolta di saggi, si propone di presentare al lettore la realtà del capoluogo ligure da un punto di vista storico, architettonico, urbanistico e culturale, evidenziando soprattutto la sua peculiare condizione di città policentrica e in costante evoluzione.

  19. Dispositivi formativi e forme di vita

    Directory of Open Access Journals (Sweden)

    Francesco Cappa

    2016-02-01

    Full Text Available Il dibattito pedagogico che ha caratterizzato gli ultimi anni ha spesso insistito sull’importanza del nesso tra sviluppo tecnologico e modelli formativi. Questa relazione, però, troppo spesso non valorizza i modi in cui l’esperienza educativa e formativa dovrebbe essere sempre più accuratamente pensata, progettata e predisposta se vista dalla prospettiva delle buone pratiche tecnologiche. Tale valorizzazione dell’istanza formativa deve prendere avvio da una riflessione critica e approfondita sui modelli impliciti ed espliciti che caratterizzano le pratiche educative e formative, valorizzando l’uso e l’interpretazione che i soggetti rendono attuali.Per consentire tale riflessione è necessario pensare un dispositivo pedagogico che non perda di vista la complessità delle dimensioni che agiscono nell’accadere educativo, capace di creare nuovi percorsi di sperimentazione delle conoscenze e nuove ipotesi di formazione di sé e degli altri. La formazione interpretata alla luce dei dispositivi pedagogici può offrire un valido strumento teorico e pratico per immaginare, progettare e valutare gli effetti che ogni azione formativa produce legati alla trasformazione dei saperi, alla vita delle forme e alle forme di vita contemporanee.

  20. How much OOO in your MOOC?

    Directory of Open Access Journals (Sweden)

    Maja Kuna

    2014-04-01

    Full Text Available Il formato MOOC (Massive Open Online Course continua a creare numerose riflessioni, soprattutto in merito alla sua capacità di raggiungere tanti utenti contemporaneamente e all’uso innovativo delle nuove tecnologie. Questo articolo esamina il rapporto di simultanea attrazione e repulsione che la comunità educativa attualmente rivela verso i MOOC, un’ambivalenza che sembra sorgere a causa della qualità di apertura (openness. Le recenti implementazioni di MOOC divergono dalla radice connettivista. Un modo per comprendere le loro differenze può essere tramite l’osservazione di come vengano applicati i sette tipi di apertura. L’openness è ritenuta la dimensione più significativa perché è quella che definisce meglio la qualità dei MOOC, anche se, al contempo, è quella che crea le maggiori sfide.Questo articolo esplora le tendenze attuali nelle offerte di MOOC, mettendo in discussione il valore pedagogico delle nuove implementazioni, ma anche apprezzando la loro rapida crescita e il loro potenziale impatto. L’articolo suggerisce che il formato MOOC debba essere adottato con un cosciente e deliberato intento di utilizzare l’apertura che offre, e non semplicemente perché aiuta a raggiungere un numero decisamente più ampio di studenti.

  1. Keith E. Karlsson, Syntax and Affixation, The Evolution of MENTE in Latin and Romance, Beihefte zur Zeitschrift für roma­ nische Philologie, Band 182, M. Niemeyer Verlag, Tübingen 1981,

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1983-01-01

    Full Text Available La linguistica romanza, "scienza-pilota" delle discipline sorelle, vanta ormai una tradizione tanto lunga e ricca che i singoli studi non  si contano più; eppure ci sono ancora domi­ ni che consentono ricerche ulteriori e conclusioni nuove (si pensi ad esempio alla monografia di H. J. Izzo sulla gorgia toscana o agli studi di P. A. Gaeng sulle iscrizioni latine cristiane - per citare solo due recenti autori fra i tanti che si possono elencare. Alla folta serie delle monografie romanze si è venuta ad aggiungere recentemente quella che qui intendia­mo recensire. L'autore, docente all'Università di Knoxville (Tennessee, USA, dedica la sua monografia ad un dominic che e da tempo nato e studiato, che dunque potrebbe parere risolto, mentre e invece ben lantana dall'essere Chiaro in tutti i Suoi aspetti. Si tratta della genesi (in latina e dell'evoluzione (negli idiomi romanzi degli avverbi formati con il morfema MENTE. L'opera di K. E. Karlsson rappresenta un contribute di notevole importanza allo studio del problema, cosa visibile anche dalla sua pubblicazione nella collana dei Beihefte alla ZrPh.

  2. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    Directory of Open Access Journals (Sweden)

    Vera Matarese

    2014-03-01

    Full Text Available Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molto problematico, quello della località, che sarebbe esploso nell’esperimento prima concettuale di Bohm e poi sperimentale di Aspect. Ciò che questo articolo vuole delineare è lo sviluppo del problema della nonlocalità, dai suoi albori fino alla prova della sua effettiva esistenza nel mondo quantistico, dove, come ben ha dimostrato Bell, nulla possono fare le variabili nascoste per dissolvere la realtà nonlocale di alcuni fenomeni.

  3. Identità interinale: perché ne dobbiamo parlare

    Directory of Open Access Journals (Sweden)

    Augusto Debernardi

    2005-12-01

    Full Text Available Parigi e le sue banlieues stanno bruciando (... si assiste al fatto che le parole "inserimento e integrazione" sono vuote: ideologiche e rassicuranti le false coscienze all'opera. Eppure, paradossalmente, le rivolte francesi che cominciano ad estendersi ad altre città europee hanno molto a che fare con questa integrazione, con un benessere della società dei consumi e dello spettacolo (... queste operazioni danno identità a chi le fa ma anche a chi le subisce. Così l'identità di "uomo" come avversario/nemico (non di cittadino ritorna indietro a chi la lancia sia come neo-cittadino dimostrando che non c’è identità senza cittadinanza attiva, sia come neo-identità quando si definisce ad esempio "musulmano" e che non è, allora, francese! L’identità diventa interinale, provvisoria su tutta la linea di caratterizzazione, scivolando su qualsiasi crinale.

  4. Idraulica dei sistemi fognari dalla teoria alla pratica

    CERN Document Server

    Gisonni, Corrado

    2012-01-01

    La progettazione dei sistemi fognari e dei manufatti in essi presenti richiede un’attenta conoscenza delle leggi che regolano i fenomeni idraulici, con particolare riferimento alle correnti idriche a superficie libera. Partendo dalle nozioni fondamentali dell’Idraulica, il testo intende colmare alcune importanti lacune che ancora caratterizzano la letteratura italiana nel settore e che spesso sono alla base di errori progettuali, con ovvie conseguenze sulla sicurezza dei centri abitati (come testimoniato dai frequenti fenomeni di allagamento che sono stati registrati negli ultimi anni). Il libro è rivolto agli allievi dei corsi di studio nel settore dell’ingegneria Civile ed Ambientale. Particolare interesse è rivolto ai professionisti operanti nel settore della ingegneria idraulica e della pianificazione urbana, per i quali è forte l’esigenza di testi che contengano indicazioni di carattere sia teorico sia pratico, finalizzate alla progettazione di sistemi di drenaggio nei centri abitati.

  5. Da Rabelais a Zola, da Erasmo a Camus: la psicologia del processo, le intuizioni dei grandi autori, la conferma delle scienze cognitive

    Directory of Open Access Journals (Sweden)

    Carlo Bona

    2012-06-01

    Full Text Available Rabelais, Zola, Camus hanno intuito che le sentenze spesso si reggono su complessi meccanismi psicologici, oltre che sulla razionalità giuridica. Ci si chiede se queste intuizioni trovino conferma nelle più recenti acquisizioni della psicologia della decisione e delle scienze cognitive. Per rispondere al quesito si analizzano passi del Gargantua e Pantagruele, di Thérèse Raquin, de Lo straniero, mettendoli a confronto con alcuni esperimenti condotti in ambito psicologico. Si dimostra come Rabelais abbia correttamente intuito quanto rilevino le euristiche nella decisione, come Zola abbia colto il ruolo delle aspettative nella percezione da parte dei testi, come Camus abbia descritto le distorsioni che si possono produrre nella fase narrativa della testimonianza. Se ne conclude che a volte la materia della giustizia si intende meglio esplorando le opere dei grandi autori che non, per dirla con Erasmo, ammucchiando glosse su glosse.

  6. Strategie militari e strategie narrative in Tucidide : la Grecia occidentale nella guerra archidamica

    Directory of Open Access Journals (Sweden)

    Ugo Fantasia

    2010-04-01

    Full Text Available I. Una guerra più complessa delle altreL’altisonante affermazione che leggiamo in apertura della ξυγγραφή, che la guerra di cui Tucidide ha scritto la storia « fu certamente il più grande sconvolgimento che abbia interessato i Greci e una parte dei Barbari e che si sia esteso, per così dire, alla maggior parte dell’umanità » (I, 1, 2, può apparire a prima vista, e in parte sicuramente è, uno degli strumenti retorici di cui Tucidide si serve per dimostrare l’assunto di fondo della archaiologi...

  7. Immigrants and the US Army: A Study in Readiness and the American Dream

    Science.gov (United States)

    2016-05-26

    Immigrants and the US Army: A Study in Readiness and the American Dream A Monograph by LTC Che T. Arosemena...Approval Page Name of Candidate: LTC Che T. Arosemena Monograph Title: Immigrants and the US Army: A Study in Readiness and the American Dream Approved by...Abstract Immigrants and the US Army: A Study in Readiness and the American Dream , by LTC Che T. Arosemena, USA, 71

  8. La figura di Maria Maddalena nella tradizione agostiniana del XII secolo e l'allegoria nuziale in Bernardo di ClairvauxUn'ipotesi di interpretazione alla luce di categorie di ordine psicoanalitico

    Directory of Open Access Journals (Sweden)

    Elena Cartotto

    2008-07-01

    La lettura viene condotta sulla base di categorie concettuali di carattere psicoanalitico, in quanto tali categorie trovano la propria origine, prima ancora che nel pensiero, nella più concreta e profonda esperienza umana. Ed è proprio il collocarsi all'interno di questa viva esperienza umana che consente di cogliere in modo più diretto la dimensione antropologica che pare emergere dagli scrittori monastici di questo periodo.

  9. The Study of Productivity Measurement and Incentive Methodology (Phase III - Paper Test). Volume 1

    Science.gov (United States)

    1986-03-14

    8). Readily available measuremencs are used Co monicor Che performance of modernizacion projects (Table 3). Shared savings for any given year are...UUP is Co be pursued. That buying office becomes Che IMIP focal point for Che contractor Co accommodate modernizacion projeces chac cue across...coordinacing group - ehe Induscrial ModernizaCion Group, is responsible for assuring uniformicy of sysCem applicacion and on-going system

  10. Catastrophic Health Expenditure After the Implementation of Health Sector Evolution Plan: A Case Study in the West of Iran

    Directory of Open Access Journals (Sweden)

    Bakhtiar Piroozi

    2016-07-01

    Full Text Available Background: One of the main objectives of health systems is the financial protection against out-of-pocket (OOP health expenditures. OOP health expenditures can lead to catastrophic payments, impoverishment or poverty among households. In Iran, health sector evolution plan (HSEP has been implemented since 2014 in order to achieve universal health coverage and reduce the OOP health expenditures as a percentage of total health expenditures. This study aimed to explore the percentage of households facing catastrophic health expenditures (CHE after the implementation of HSEP and the factors that determine CHE. Methods: A total of 663 households were selected through a cluster sampling based on the census framework of Sanandaj Health Center in July 2015. Data were gathered using face-to-face interviews based on the household section of the World Health Survey questionnaire. In this study, according to the World Health Organization (WHO definition, if household health expenditures were equal to or more than 40% of the household capacity to pay, household was considered to be facing CHE. The determinants of CHE were analyzed using logistic regression model. Results: The rates of households facing CHE were 4.8%. The key determinants of CHE were household economic status, presence of elderly or disabled members in the household and utilization of inpatient or rehabilitation services. Conclusion: The comparison of our findings and those of other studies carried out using a methodology comparable with ours in different parts of Iran before the implementation of HSEP suggests that the implementation of recent reforms has reduced CHE at the household level. Utilization of inpatient and rehabilitation services, the presence of elderly or disabled members in the household and the low economic status of the household would increase the likelihood of facing CHE. These variables should be considered by health policy-makers in order to review and revise content of

  11. Identification of a novel alternative splicing variant of hemocyanin from shrimp Litopenaeus vannamei.

    Science.gov (United States)

    Zhao, Shan; Lu, Xin; Zhang, Yueling; Zhao, Xianliang; Zhong, Mingqi; Li, Shengkang; Lun, Jingsheng

    2013-01-01

    Recent evidences suggest that invertebrates express families of immune molecules with high levels of sequence diversity. Hemocyanin is an important non-specific immune molecule present in the hemolymph of both mollusks and arthropods. In the present study, we characterized a novel alternative splicing variant of hemocyanin (cHE1) from Litopenaeus vannamei that produced mRNA transcript of 2579 bp in length. The isoform contained two additional sequences of 296 and 267 bp in the 5'- and 3'-terminus respectively, in comparison to that of wild type hemocyanin (cHE). Sequence of cHE1 shows 100% identity to that of hemocyanin genomic DNA (HE, which does not form an open reading frame), suggesting that cHE1 might be an alternative splicing variant due to intron retention. Moreover, cHE1 could be detected by RT-PCR from five tissues (heart, gill, stomach, intestine and brain), and from shrimps at stages from nauplius to mysis larva. Further, cHE1 mRNA transcripts were significantly increased in hearts after 12h of infection with Vibrio parahemolyticus or poly I: C, while no significant difference in the transcript levels of hepatopancreas cHE was detected in the pathogen-treated shrimps during the period. In summary, these studies suggested a novel splicing variant of hemocyanin in shrimp, which might be involved in shrimp resistance to pathogenic infection. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Informative management system for administrative management; Il sistema informativo per il reporting e il controllo di gestione di un ente complesso. Realizzazione di un prototipo

    Energy Technology Data Exchange (ETDEWEB)

    D' Onofrio, M G; Minelle, F [Rome Univ. La Sapienza, Rome (Italy). Fac. di Scienze Matematiche, Fisiche e Naturali; Di Marco, R A [ENEA, Sede Centrale, Rome (Italy). Funzione Centrale Informatica

    1999-07-01

    The need to optimate the total functionality of the firm, introducing suitable Control System of inherit and merit evaluation concerning the administrative-management results, strengthens the assumption of responsibility from the managerial staff and promotes the operative and management decentralization. In this context assumes a remarkable importance the function of the Informative Management System which has got to assure, in a realistic, qualified and effectual way, a good support to all activities it can make easy, not only the standard working but also the achievement of the programmatic targets. In the present context, where the development of technology often exceeds that one of the organization structures, it is right to redesign the Informative Management System, considering that often the management informatics procedures are obsolete. The statement of the carried out work bases itself on the observation of the business management process: in order to achieve its targets, the firm transform some resources, each one with its own cycle of life, through stages of management classifiable in merit evaluation, decision, execution and control. These stages are carried out by treatment of the Information that represent the link among them, the main resource of the whole organization and the basis of the Informative Management System. Considering the information as an element characterizing the firm, in that it comes from a complicated system which permits to assert that the fulfilment of on effective and efficient management depends largely from its capacity to use the Information. [Italian] La necessita' di ottimizzare la funzionalita' complessiva dell'azienda, introducendo adeguati sistemi di controllo di merito e di valutazione dei risultati a livello amministrativo-gestionale rafforza l'assunzione di responsabilita' da parte della struttura dirigenziale e favorisce il decentramento gestionale e operativo. In questo contesto assume notevole importanza la

  13. Introduzione ai frattali in fisica

    CERN Document Server

    Ratti, Sergio Peppino

    2011-01-01

    La geometria frattale permette di caratterizzare le strutture complesse e irregolari che godono della proprietà di invarianza di scala. Introdotta da Mandelbrot nel 1975, spiega in modo convincente che la natura ci pone di fronte a molti esempi di strutture complesse che godono di proprietà peculiari: è un fatto che in natura l’irregolarità sia molto comune, come dimostrano le strutture di piante, montagne, nuvole e fulmini. Il volume nasce dall’esperienza didattica sviluppata dall’autore in oltre un decennio di insegnamento di Istituzioni di Fisica Superiore presso l’Università di Pavia e intende colmare la lacuna nel panorama italiano di testi didattici su tematiche frattali. Parte dalla definizione di oggetti e di funzioni frattali, introducendo la dimensione “non intera” e la “codimensione” di un insieme, di una figura geometrica e la sua estensione a una funzione matematica irregolare. Segue l’introduzione dei frattali stocastici che tengono conto della natura parzialmente caotica ...

  14. Regional cholinesterase activity in white-throated sparrow brain is differentially affected by acephate (Orthene®)

    Science.gov (United States)

    Vyas, N.B.; Kuenzel, W.J.; Hill, E.F.; Romo, G.A.; Komaragiri, M.V.S.

    1996-01-01

    Effects of a 14-day dietary exposure to an organophosphorus pesticide, acephate (acetylphosphoramidothioic acid O,S-dimethyl ester), were determined on cholinesterase activity in three regions (basal ganglia, hippocampus, and hypothalamus) of the white-throated sparrow, Zonotrichia albicollis, brain. All three regions experienced depressed cholinesterase activity between 0.5–2 ppm acephate. The regions exhibited cholinesterase recovery at 2–16 ppm acephate; however, cholinesterase activity dropped and showed no recovery at higher dietary levels (>16 ppm acephate). Evidence indicates that the recovery is initiated by the magnitude of depression, not the duration. In general, as acephate concentration increased, differences in ChE activity among brain regions decreased. Three terms are introduced to describe ChE response to acephate exposure: 1) ChE resistance threshold, 2) ChE compensation threshold, and 3) ChE depression threshold. It is hypothesized that adverse effects to birds in the field may occur at pesticide exposure levels customarily considered negligible.

  15. Lo sfondo filosofico della fisica moderna

    CERN Document Server

    Heisenberg, Werner

    1999-01-01

    Questa raccolta di saggi, inedita nella sua composizione e nuova in senso assoluto per l'Italia, presenta il pensiero di Heisenberg in tutta la sua articolazione e completezza: le riflessioni filosofiche fondamentali, le originali considerazioni epistemologiche, il credo etico-religioso, la visione della realtà e le due memorie scientifiche nelle quali venne elaborata la meccanica delle matrici, che fissò la nascita della cosiddetta «seconda quantistica», determinando la crisi della fisica classica e delineando l'orizzonte di senso da cui è derivato il successivo principio di indeterminazione. Emerge un pensatore che ha fornito contributi essenziali sia alla storia del pensiero filosofico che a quello scientifico del Novecento, e che ha rappresentato un vero e proprio «punto di svolta» della cultura contemporanea. Un punto di svolta che ha condotto il «metodo» della scienza dal gretto riduzionismo dell'epoca classica a una sua più concreta elaborazione in senso storicistico e complesso. Werner Heise...

  16. La fisica dell'immortalità Dio, la cosmologia e la resurrezione dei morti

    CERN Document Server

    Tipler, Frank J

    1995-01-01

    “Questo libro descrive la teoria del Punto Omega: la teoria fisica e sperimentale di un Dio onnipresente onniscente e onnipotente, che in un giorno del futuro remoto farà risorgere ciascuno di noi alla vita eterna in una dimora che per ogni aspetto fondamentale è il paradiso della tradizione ebraico-cristiana. I singoli termini delle teoria – per esempio i concetti di onnipresenza, onniscienza, onnipotenza, corpo (spirituale) risuscitato, paradiso – saranno presentati come principi della fisica pura. In questo libro non farò mai appello alla rivelazione; mi appellerò, invece, ai risultati concreti della scienza moderna e alla ragione del lettore. Descriverò il meccanismo fisico della risurrezione universale. Mostrerò con estrema precisione come la fisica consenta la risurrezione alla vita eterna di tutti coloro che sono vissuti, che vivano o che vivranno. E mostrerò anche perché, nel futuro remoto, tale facoltà di risuscitare esisterà davvero e perché sarà effettivamente usata. A chi ha perd...

  17. La dematerializzazione contemporanea delle superfici: da elementi di delimitazione a membrane di commutazione.

    Directory of Open Access Journals (Sweden)

    Cristina Mattiucci

    2008-06-01

    Full Text Available Quattro anni fa Paul Virilio scriveva "Città panico" definendo la città contemporanea come “la più grande catastrofe del ventesimo secolo”. La sua analisi fa riferimento alle conseguenze sia politiche che spaziali di una velocità del progresso tecnologico e scientifico che aveva raggiunto ritmi così elevati da vanificare il senso stesso di quella sovranità territoriale che dava consistenza e materia allo stato di diritto. Lo stato sarebbe ora sospeso in una sorta di alla massa e all’energia – della materia. In un processo di continua dematerializzazione della “assenza di gravità”cinematica dominata dall’informazione, quale terza dimensione – oltre sostanza urbana sotto l’effetto dei nuovi media, sostiene Virilio, la prevalenza della natura effimera dell’informazione sconvolge i nostri stessi parametri di percezione del mondo, presentato, piuttosto che rappresentato, attraverso le interfacce che accessoriano le nostre vite, secondo riferimenti alterati da una vera e propria guerra al reale ad opera della comunicazione audiovisiva.

  18. E-books for Italian school, between Law Requirements and Publishers' Choices

    Directory of Open Access Journals (Sweden)

    Maria Vincelli

    2011-11-01

    Full Text Available Il saggio presenta un'analisi del quadro legislativo italiano sulla transizione dei libri di testo dal formato cartaceo a quello digitale, oltre a una panoramica sull'offerta dei maggiori editori a riguardo, prendendo come esempio i libri di testo di Latino per le scuole superiori. Il concetto di libro digitale viene declinato oggi principalmente in due forme: il libro "on-line", digitale (generalmente in PDF o Epub, equivalente ai testi tradizionali a stampa per struttura e tipo di utilizzo; il libro che integra le caratteristiche del libro sia digitale che a stampa con una serie di materiali digitali supplementari. L'opinione dell'autrice è che l'offerta di pubblicazioni scolastiche in formato digitale si attiene a un'interpretazione limitata della legge italiana, e che dunque si prospettano nuove ipotesi che possano unire in modo efficace l'autorevolezza e il valore culturale dei libri di testo con le soluzioni più avanzate del digitale.

  19. Sculpture and Life. The Relation Between Form of Sculpture and Musical Character in the Sound Stone by Pinuccio Sciola

    Directory of Open Access Journals (Sweden)

    Rita Ladogana

    2015-07-01

    Full Text Available L’intervento si propone di illustrare i risultati più significativi e originali che lo scultore sardo Pinuccio Sciola ha raggiunto in anni di impegno e di ricerca artistica infaticabile. Dai grandi monoliti ai semi della pace, fino alla sorprendente scoperta dei litofoni, il percorso rivela esiti complessi che contemplano, con particolare insistenza nella produzione degli ultimi anni, una stretta connessione tra scultura, musica e architettura. Da quando Sciola scopre che i grossi blocchi di basalto e di calcare, da lui sempre trattati con lo scalpello o col disco dello smeriglio, custodiscono un’anima musicale, l’atto creativo si concentra unicamente nella ricerca di una giusta sintesi tra oggetto scultoreo dalla chiara valenza estetica e potenzialità acustico-sonore dello scolpire. La voce della materia emana suoni di straordinaria complessità condizionati, oltre che dall’azione dell’artista, dall’interazione con gli elementi della natura, con gli elementi atmosferici, con la realtà tutta che li circonda.

  20. Atomi, molecole e solidi esercizi risolti

    CERN Document Server

    Balzarotti, Adalberto; Fanfoni, Massimo

    2015-01-01

    Questo eserciziario nasce dalla raccolta di problemi d'esame assegnati agli studenti del corso di Struttura della Materia, che si colloca al confine fra il Corso Triennale e quello Magistrale. Alla fine di ciascun capitolo si trova un riepilogo ragionato di formule utili, e l’ultima parte del volume è dedicata alle unità di misura, alle formule di Meccanica Quantistica e alle tecniche per manipolare il momento angolare, i metodi variazionale e quello perturbativo elementare. Quasi tutti i problemi sono applicazioni della Meccanica Quantistica, anche se si utilizzano nozioni di Termodinamica, Meccanica ed Elettromagnetismo. I problemi di questo manuale differiscono rispetto a quelli che caratterizzano libri di Fisica Teorica (che possono anche essere astratti o rilevanti per l'Astrofisica o le Interazioni Deboli, soprattutto nel fatto che) soprattutto nel fatto che questi devono alla fine determinare dei valori realistici di misure standard su atomi molecole o solidi. In Fisica, la conoscenza di ogni argom...

  1. Un test di confronto fra carte catastali e cartografia tecnica

    Directory of Open Access Journals (Sweden)

    Giorgio Bezoari

    2006-06-01

    Full Text Available Uno dei problemi più gravi che affligge l’Italia (peraltro madre di cartografi, topografi e geodeti è la dubbia qualità delle mappe catastali che purtoppo ad oggi versano in uno stato ancora lontano dal poter essere classificata come cartografia di base, sconfinando invece in una sorta di cartografia tematica che affronta appunto il tema della proprietà e dei tributi connessi. Il problema è sentito da decenni e già nel 1945 il CNR aveva proposto l’intera riorganizzazione del servizio geografico dello stato proponendo che gli sforzi deivari enti cartografici (IGM, Catasto, Aeronautica, Marina eGeologico venissero uniti sotto un’unica egida per la realizzazione della Cartografia dello Stato. Purtroppo abbiamo visto che questo non è successo e i problemi sono oggi venuti tutti al pettine così come vengono evidenziati nel presente articolo.

  2. La liberazione del tempo

    CERN Document Server

    Selleri, Franco

    2003-01-01

    Negli ultimi dieci anni ho lavorato alla descrizione dei fenomeni naturali da parte di osservatori in movimento. E' un problema che molti credono risolto una volta per tutte dalle trasformazioni di Lorentz della teoria della relatività speciale (TRS nel seguito), ma che in realtà era rimasto aperto per una serie di ragioni che esporrò. Sento di dover dire che ho trovato risultati molto importanti, anche se il giudizio finale sul loro valore non può certo essere il mio. Infatti la conclusione di questa ricerca è duplice: una spiegazione dei dati empirici migliore di quella relativistica, e l'eliminazione di quegli aspetti della TRS che fanno a pugni con il buon senso; il tutto grazie alla liberazione del tempo dall'asservimento alle coordinate spaziali cui era stato costretto nello spazio a quattro dimensioni di Minkowski. La faccenda è raccontata con dovizia di particolari in un libro recente [FS]. Nel presente articolo espongo gli aspetti salienti della ricerca lasciando da parte quelli matematici.

  3. Excellence in clinical laboratories: the standard ISO 15189:2007

    Directory of Open Access Journals (Sweden)

    Antonio Scipioni

    2010-06-01

    Full Text Available I laboratori clinici operano in stretto contatto con i pazienti e collaborano direttamente alla loro cura, in modo corresponsabile con i medici e i reparti ospedalieri. L’importanza della loro attività per la salute pubblica rende obbligatoria l’esplicitazione di alcuni punti finora spesso considerati ovvii. Ai pazienti dev’essere infatti garantito che: - i metodi di analisi utilizzati siano stati preliminarmente valutati, per confermare la loro rispondenza agli obiettivi dell’analisi stessa, verificati, per controllarne l’effettiva efficacia e, se necessario, validati per garantire che siano appropriati allo scopo; - il personale che esegue le analisi sia stato adeguatamente formato e quindi tecnicamente competente; - il laboratorio assicuri un’adeguata consulenza allo staff clinico che richiede le analisi, allo scopo di ottenere una sinergia tra il laboratorio e il clinico che ha in cura il paziente, sia nella fase di prelievo di materiale biologico, sia nella fase di interpretazione dei risultati. Tutto ciò è necessario per dimostrare ai pazienti

  4. Emozione, discorso e politiche della vita quotidiana

    Directory of Open Access Journals (Sweden)

    Lila Abu-Lughod

    2013-07-01

    Full Text Available Le emozioni sono una di quelle nozioni considerate scontate sia dalla conoscenza specialistica che dal discorso quotidiano, che stanno ora diventando parte del dominio della ricerca antropologica. Nonostante che siano ancora principalmente appannaggio della filosofia e della psicologia all’interno delle discipline accademiche, le emozioni sono anche questioni ordinarie del discorso culturale popolare americano,la cui relazione con questi discorsi professionali è complessa e solo parzialmente indagata.

  5. Mondi possibili

    CERN Document Server

    Dyson, Freeman

    1998-01-01

    Scienza, fantascienza, storia. Freeman Dyson percorre con sicurezza, acume e spirito critico i sentieri che conducono al futuro del nostro mondo ; ci fa scorgere i pericoli e le insidie del progresso scientifico e tecnologico, ci narra le vicende che hanno caratterizzato la scienza e la cultura del nostro secolo e si misura con le grandi questioni che gli scienziati e l'umanita dovranno affrontare agli inizi di un nuovo millenio.

  6. L'Epitafio inedito di Nicasia scolastica rinvenuto a Rihana

    OpenAIRE

    Ibba, Antonio

    1997-01-01

    L'epitafio inedito di Nicasia scolastica è verosimilmente una nuova testimonianza epigrafica perlomeno del basso impero, con grande probabilità di ambito cristiano, un dato che concorda con la circostanza che ad Uchi Maius abbiamo testimonianza sia di iscrizioni che di una basilica paleocristiana; viene qui ricordata uan donna morta ad appena venti anni, Nicasia, secondo l'uso allora corrnte del nome unico al posto dei tria nomina.

  7. La mente nuova dell'imperatore

    CERN Document Server

    Penrose, Roger

    1992-01-01

    Mente umana e intelligenza artificiale: si tratta di due realtà comparabili? A quali leggi della fisica (classica o quantistica) obbedisce la nostra mente? Un giorno i computer potranno ragionare esattamente come noi? In questo libro di divulgazione scientifica, che al suo apparire ha provocato vivaci polemiche, l'autore afferma che la "mente nuova", che l'intelligenza artificiale sostiene di poterci dare, è qualcosa di profondamente diverso dalla mente dell'uomo.

  8. Health services financing and delivery: analysis of policy options for Dubai, United Arab Emirates

    Science.gov (United States)

    Hamidi, Samer

    2015-01-01

    Introduction A national health account (NHA) provides a systematic approach to mapping the flow of health sector funds within a specified health system over a defined time period. This article attempts to present a profile of health system financing in Dubai, United Arab Emirates using data from NHAs, and to compare the functional structures of financing schemes in Dubai with schemes in Qatar and selected member countries of the Organization for Economic Cooperation and Development (OECD). Methods The author analyzed secondary data published in NHAs of Dubai and Qatar and data collected by the OECD countries and publicly available from Eurostat (Statistical Office of the European Union) of 25 OECD countries for comparative analysis. All health financing indicators used were as defined in the international System of Health Accounts (SHA). Results In Dubai, spending on inpatient care was the highest-costing component, with 30% of current health expenditures (CHE). Spending on outpatient care was the second highest-costing component and accounted for about 23% of the CHE. Household spending accounted for about 22% of CHE (equivalent to US$187 per capita), compared to an average of 20% of CHE of OECD countries. Dubai spent 0.02% of CHE on long-term care, compared to an average of 11% of CHE of OECD countries. Dubai spent about 6% of CHE on prevention and public health services, compared to an average of 3.2% of CHE of OECD countries. Conclusion The findings point to potential opportunities for growth and improvement in several health policy issues in Dubai, including increasing focus and funding of preventive services; shifting from inpatient care to day surgery, outpatient, and home-based services and strengthening long-term care; and introducing cost-containment measures for pharmaceuticals. More investment in the translation of NHA data into policy is suggested for future researchers. PMID:25750545

  9. Health services financing and delivery: analysis of policy options for Dubai, United Arab Emirates.

    Science.gov (United States)

    Hamidi, Samer

    2015-01-01

    A national health account (NHA) provides a systematic approach to mapping the flow of health sector funds within a specified health system over a defined time period. This article attempts to present a profile of health system financing in Dubai, United Arab Emirates using data from NHAs, and to compare the functional structures of financing schemes in Dubai with schemes in Qatar and selected member countries of the Organization for Economic Cooperation and Development (OECD). The author analyzed secondary data published in NHAs of Dubai and Qatar and data collected by the OECD countries and publicly available from Eurostat (Statistical Office of the European Union) of 25 OECD countries for comparative analysis. All health financing indicators used were as defined in the international System of Health Accounts (SHA). In Dubai, spending on inpatient care was the highest-costing component, with 30% of current health expenditures (CHE). Spending on outpatient care was the second highest-costing component and accounted for about 23% of the CHE. Household spending accounted for about 22% of CHE (equivalent to US$187 per capita), compared to an average of 20% of CHE of OECD countries. Dubai spent 0.02% of CHE on long-term care, compared to an average of 11% of CHE of OECD countries. Dubai spent about 6% of CHE on prevention and public health services, compared to an average of 3.2% of CHE of OECD countries. The findings point to potential opportunities for growth and improvement in several health policy issues in Dubai, including increasing focus and funding of preventive services; shifting from inpatient care to day surgery, outpatient, and home-based services and strengthening long-term care; and introducing cost-containment measures for pharmaceuticals. More investment in the translation of NHA data into policy is suggested for future researchers.

  10. Electron microscopical study of non-specific cholinesterase activity in simple lamellar corpuscles of glabrous skin from cat rhinarium: a histochemical evidence for the presence of collagenase-sensitive molecular forms and their secretion.

    Science.gov (United States)

    Dubový, P

    1989-01-01

    The distribution of nCHE activity was studied histochemically in simple lamellar corpuscles (SLCs) of glabrous skin from cat rhinarium. The Schwann cells forming myelin sheaths in preterminal part of SCLs exhibited no positive reaction for nCHE activity. Prevalent reaction product was localized extracellularly in the inne core enveloping terminal portion of unmyelinated sensory axon. A dot-like shaped reaction product was deposited in the basal lamina of the inner core cells and their cytoplasmic lamellae or was scattered in enlarged interlamellar spaces. Only small amount of fine end product was found to be associated with the plasma membrane of inner core lamellae. Fine reaction product for nCHE activity was consistently localized in perinuclear and rER cisternae and saccules of the Golgi apparatus of inner core cells. Some vesicles around rER and the Golgi apparatus, ones beneath the plasma membrane, and tubular-like cisternal profiles oriented towards the surface contained nCHE end product, as well. The intracellular and extracellular localization of nCHE reaction product suggests that this enzyme behaves in cat SLCs as a secreted rather than as an integral membrane protein. A large amount of dot-like reaction product in the interlamellar spaces disappeared if the skin sections were treated with collagenase before incubation in the medium for histochemical detection of nCHE activity. The decrease of nCHE end product in SLCs of the skin sections after collagenase digestion was corroborated by means of light microdensitometer and electrometrical measurement. The histochemical detection and electrometrical measurement revealed that the majority of the reaction product in the interlamellar spaces of inner core corresponds with the nCHE molecules sensitive to collagenase treatment and they are probably counted among asymmetrical molecular forms.

  11. Quantum rewinding via phase estimation

    Science.gov (United States)

    Tabia, Gelo Noel

    2015-03-01

    In cryptography, the notion of a zero-knowledge proof was introduced by Goldwasser, Micali, and Rackoff. An interactive proof system is said to be zero-knowledge if any verifier interacting with an honest prover learns nothing beyond the validity of the statement being proven. With recent advances in quantum information technologies, it has become interesting to ask if classical zero-knowledge proof systems remain secure against adversaries with quantum computers. The standard approach to show the zero-knowledge property involves constructing a simulator for a malicious verifier that can be rewinded to a previous step when the simulation fails. In the quantum setting, the simulator can be described by a quantum circuit that takes an arbitrary quantum state as auxiliary input but rewinding becomes a nontrivial issue. Watrous proposed a quantum rewinding technique in the case where the simulation's success probability is independent of the auxiliary input. Here I present a more general quantum rewinding scheme that employs the quantum phase estimation algorithm. This work was funded by institutional research grant IUT2-1 from the Estonian Research Council and by the European Union through the European Regional Development Fund.

  12. Il ‘volontariato’ dei richiedenti asilo in Italia

    Directory of Open Access Journals (Sweden)

    Martina Pasqualetto

    Full Text Available Riassunto L'articolo analizza la politica pubblica italiana che prevede il coinvolgimento dei richiedenti asilo in attività di 'volontariato' a favore delle amministrazioni locali per calmare il malcontento popolare causato dalla loro presunta inattività. In primo luogo l'autrice mette in discussione l'efficacia di tale policy e ne destruttura il discorso governativo mettendone in luce le mistificazioni. Mediante una ricerca esplorativa ispirata alla grounded theory si dimostra inoltre che la reale natura delle attività promosse risiede nel lavoro gratuito e che esse veicolano un messaggio di simbolica e percepita utilità dei profughi che impatta negativamente sull'immaginario collettivo rispetto al tema del diritto d'asilo.

  13. Il punto di vista dell’orecchio

    Directory of Open Access Journals (Sweden)

    Renato Rinaldi

    2008-12-01

    Full Text Available Queste brevi note sul suono e sul paesaggio nascono da un lungo lavoro di ricerca sulle trasformazioni del paesaggio alpino contemporaneo condotto assieme al fotografo e filmaker Armin Linke . All’inizio si trattava di indagare sul piano visivo lo scarto esistente tra i cosiddetti “bei paesaggi” delle Alpi e le realtà fisiche che oggi li accompagnano e circondano: da un lato, infatti, ci sono le Alpi come territorio, centrale per l’Europa, che ha vissuto e vive trasformazioni profonde; dall’altro c’è l’immagine delle Alpi, come icona che, grazie all’immaginario che può mobilitare, rimane fedele a sé stessa al di là di qualunque trasformazione.

  14. Vibrant cities: declinazioni di un’atmosfera discursive Vibrant cities: variations of a discursive atmosphere

    Directory of Open Access Journals (Sweden)

    Tania Rossetto

    2012-09-01

    Full Text Available La voce vibrant (“full of life and energy” dell’Oxford Advanced Learner’s Dictionary viene prioritariamente esemplificata quale attributo del sostantivo città (“a vibrant city”, confermando in tal modo il consolidato nesso tra tale aggettivo e l’evocazione di una determinata – e al tempo stesso vaga – atmosfera urbana. Vibrant è parola d’ordine del marketing territoriale e del design urbano, termine protagonista dell’ormai più che trentennale storia del neoliberismo che ha coinciso con la promozione della città post-industriale. A tal punto che la parola sembra oggi evocare, ancor prima che un’atmosfera urbana, una sorta di “atmosfera discorsiva”.

  15. Fonologia etrusaa fonetiaa toscana, Il problema del sostra­ to, Atti della Giornata di Studi organizzata dal Gruppo Archeo­ logico Colligiano, Colle di Val d'Elsa, 4 aprile 1982; a cura di L. Agostiniani e L. Giannelli, Biblioteca dell' "Archivum Romanicu

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1983-01-01

    Full Text Available Che cosa sia la gorgia tosaana lo sanno probabilmente tutti i cultori della linguistica romanza nel mondo; ed è risaputo anche che, dopo poco meno di un secolo di discussioni, il volume di H. J. Izzo Tuscan and Etruscan, Toronto 1972 sembrò dare il colpo di grazia alla tesi sostratista: "La gorgia etru­sca è morta!" si credette di pater dire, adattando la prima par­te del celebre detto francese. Perciò sorprenderà non poco che, a distanza di dieci anni dal libra di Izzo, si veda risuscitare l'ipotesi dell'origine preromana della gorgia; ossia, che forse si debba dire - continuando il citato detto - "viva la gorgia etrusca!". Si, il richiamo alla nota formula francese non è senza una sua giustificazione, perché l'ipotesi della gorgia etrusca - oltre ad essere sostenuta da una netta minoranza de­ glistudiosi- ci si presenta semmai in una veste nueva. Chi vorrà leggere i contributi nel ricco ed interessante volume che qui recensiamo, potrà convincersi che la discussione sul possi­bile influsso del sostrato etrusco nella gorgia toscana non è per niente esaurita rna continua, con argomenti nuovi basati su ricerche recenti.

  16. Characterization of Cell Surface and EPS Remodeling of Azospirillum brasilense Chemotaxis-like 1 Signal Transduction Pathway mutants by Atomic Force Microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Billings, Amanda N [ORNL; Siuti, Piro [ORNL; Bible, Amber [University of Tennessee, Knoxville (UTK); Alexandre, Gladys [University of Tennessee, Knoxville (UTK); Retterer, Scott T [ORNL; Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must quickly sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the modulation of multiple cellular responses, including motility, EPS production, and cell-to-cell interactions. Recently, the Che1 chemotaxis-like pathway from Azospirillum brasilense was shown to modulate flocculation. In A. brasilense, cell surface properties, including EPS production, are thought to play a direct role in promoting flocculation. Using atomic force microscopy (AFM), we have detected distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains that are absent in the wild type strain. Whereas the wild type strain produces a smooth mucosal extracellular matrix, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition and lectin-binding assays suggest that the composition of EPS components in the extracellular matrix differs between the cheA1 and cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that mutations in the Che1 pathway that result in increased flocculation are correlated with distinctive changes in the extracellular matrix structure produced by the mutants, including likely changes in the EPS structure and/or composition.

  17. A new LIFE: oltre la didattica d'aula.

    Directory of Open Access Journals (Sweden)

    Simona Scarsella

    2009-10-01

    Full Text Available A partire dal dibattito che oggi contrappone i Personal Learning Environment (PLE ai Virtual Learning Environment (VLE e le pratiche del cosidetto Learning 2.0 alle 'vecchie' pratiche educative on-line, il tutorial introdurrà€ gli uditori al Design di processi e ambienti educativi ispirati dall'idea che l'apprendimento è 'esperienza che si nutre di esperienze', nell'ambito delle quali deve essere possibile valorizzare sia le potenzialità€ della collettività€ che le caratteristiche del singolo.I partecipanti verranno altresì€ introdotti ad alcuni principi e metodiche del Design e del Co-Design che - secondo la filosofia del 'Person in Place Centered Design' - possono ispirare la trasformazione degli attuali 'learning space', spesso non-luoghi dell'apprendimento, in 'learning place', che in prospettiva potrebbero delocalizzarsi sino a diluirsi negli ambienti e nelle pratiche del vivere quotidiano assumendo caratteristiche di adattabilità€ e responsività€ tali da renderli 'place' ideali anche per trasformare e rendere più€ motivante l'attuale didattica d'aula.Il tutorial verrà€ sviluppato utilizzando LIFE (Learning in Interactive Framework to Experience, un ambiente di formazione on-line, open-source, il cui design è€ stato ispirato dai principi sopra descritti.

  18. Characterization of cell surface and extracellular matrix remodeling of Azospirillum brasilense chemotaxis-like 1 signal transduction pathway mutants by atomic force microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Doktycz, Mitchel John [ORNL; Morrell-Falvey, Jennifer L [ORNL

    2011-01-01

    To compete in complex microbial communities, bacteria must sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the regulation of multiple behaviors in response to changes in the environment, including motility patterns, exopolysaccharide production, and cell-to-cell interactions. In Azospirillum brasilense, cell surface properties, including exopolysaccharide production, are thought to play a direct role in promoting flocculation. Recently, the Che1 chemotaxis-like pathway from A. brasilense was shown to modulate flocculation, suggesting an associated modulation of cell surface properties. Using atomic force microscopy, distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains were detected. Whereas the wild-type strain produces a smooth mucosal extracellular matrix after 24 h, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition, lectin-binding assays, and comparison of lipopolysaccharides profiles suggest that the extracellular matrix differs between the cheA1 and the cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that disruption of the Che1 pathway is correlated with distinctive changes in the extracellular matrix, which likely result from changes in surface polysaccharides structure and/or composition.

  19. La teoria del ciclo vitale del risparmio di Modigliani cinquant’anni dopo

    Directory of Open Access Journals (Sweden)

    Mauro Baranzini

    2005-06-01

    Full Text Available Nei primi anni ’50 Franco Modigliani, insieme a Richard Brumberg e ad Albert Ando, formulò lateoria del ciclo vitale del consumo e del risparmio, che ha riscosso un enorme e indiscussosuccesso per almeno tre decenni. Tuttavia, a partire dai primi anni ’80 la teoria del ciclo vitale èstata criticata in modo sempre più serrato, per almeno quattro ragioni. La prima consistenell’esistenza di una significativa trasmissione intergenerazionale della ricchezza, da ricondurre acause esogene al modello del ciclo vitale. La seconda ragione è rappresentata dalla crescenteevidenza che i ricchi continuano a risparmiare in misura maggiore rispetto ai meno fortunati,come, in effetti, Keynes sosteneva. Il terzo motivo è che vi sono prove sempre più evidenti,almeno nell’Europa occidentale e in Giappone, che le famiglie giovani, durante i venti e i trentaanni di età, risparmiano una quota positiva e crescente del proprio reddito, e ciò si pone indeciso contrasto con la versione originaria della teoria del ciclo vitale. Infine, numerosi lavoriempirici hanno rilevato che i pensionati accantonano una parte elevata del proprio reddito. Ciòimpone un serio ripensamento dell’approccio della teoria del ciclo vitale, che interessa sia l’analisieconomica sia la politica economica.

  20. Trois anciens directeurs régionaux font part d'effets durables de l ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    19 janv. 2011 ... Il s'est acquitté de cette tâche en oeuvrant sur la scène internationale, au sein de tribunes telles que le Groupe d'experts du G8 sur l'accès aux nouvelles technologies, mis sur pied à l'occasion du sommet du G8 qui s'est déroulé à Okinawa, au Japon, en 2001, et le Sommet mondial sur la société de ...

  1. La lingua2 nel Web. Prospettive digitali per la didattica dell’italiano a stranieri

    Directory of Open Access Journals (Sweden)

    Roberto Quaggia

    2013-07-01

    Full Text Available L'articolo si compone di due parti. Nella prima si espongono alcuni punti focali del dibattito sul rapporto tra glottodidattica e tecnologie digitali (dai dispositivi mobili ai software per la comunicazione, fino agli attuali socialnetwork. In particolare l’attenzione è rivolta sul fatto che la lingua della comunicazione digitale costituisce una varietà linguistica dal confronto con la quale l’insegnamento di una L2 non può ormai prescindere, e che le tecnologie digitali della comunicazione, se correttamente adottate fuori e dentro la classe, consentono di ridurre il confine tra apprendimento guidato e acquisizione spontanea di una lingua seconda. Filo conduttore della riflessione è il concetto di “competenza comunicativa digitale”, che si aggiunge alle componenti della competenza linguistico-comunicativa indicate dal Quadro Comune Europeo di Riferimento per le Lingue. Nella seconda parte del lavoro, dal taglio più didattico, si presenta una serie di strumenti e di esperienze di insegnamento/apprendimento della L2 con l’uso delle tecnologie digitali. In particolare ci si sofferma sulle opportunità offerte dal Web 2.0, simulando la creazione di una piattaforma per l’insegnamento/apprendimento dell’italiano L2 completamente online. Non si tratta di una semplice piattaforma per l’e-learning (o d-learning, ma di una vera e propria rete per l’insegnamento, l’apprendimento, la comunicazione e la formazione che trasforma il modo in cui si usa, si apprende e si insegna una L2. L2 on the Web. Digital perspectives for teaching italian to foreignersThe article consists of two parts. In the first we illustrate some focal points in the debate on the relationship between language teaching and digital technologies (from mobile devices to communication software and current social networks. In particular, we focus on the fact that the language of digital communication is a linguistic variety which L2 teaching can no longer ignore, and

  2. Immagine contro natura

    Directory of Open Access Journals (Sweden)

    Paolo D'Angelo

    2015-11-01

    Full Text Available Qual è il rapporto tra immagine e natura nella cultura contemporanea? Poche vicende sono in grado di riassumere, in breve, la parabola percorsa nella modernità di questo rapporto come quella cui è andata incontro la parola panorama. Oggi, anche se molti continuano ad usare questo termine come equivalente di paesaggio, pochi sanno che il ‘panorama’ nacque, alla fine del Settecento, per indicare uno «spettacolo ottico» destinato a riscuotere grande successo lungo tutto il secolo seguente: il ‘panorama’ era, in origine, una grande tela dipinta, disposta a trecentosessanta gradi intorno a uno spettatore. Nel corso dell’Ottocento, le foto presero gradatamente il posto della pittura, nei panorami, fino a che, all’inizio del Novecento, le nuove forme di riproduzione dell’immagine, come il cinema, resero obsoleto questo tipo di spettacolo. Ma non la parola, che era già transitata a indicare la cosa naturale osservata e non più l’apparecchio destinato a riprodurla, la realtà e non la rappresentazione. Ed è proprio questo passaggio, per cui l’immagine soppianta la natura, la sostituisce, si pone al suo posto, ed impedisce un rapporto reale con la cosa rappresentata, ciò che si impone a chi prende a considerare il rapporto tra immagine e natura nel mondo contemporaneo. A partire dalla seconda metà del Novecento, molti artisti hanno cercato di dare attraverso le loro opere delle esperienze del nostro rapporto con la natura, o, per meglio dire, di trasformare in opera la propria esperienza della natura. Un tratto accomuna le esperienze dei land artist americani degli anni Sessanta con quelle dell’arte ambientale europea dei decenni successivi: il fatto che entrambe hanno compreso che il patto mimetico che legava l’arte alla natura è andato in pezzi e che nulla è più vano che cercare di ricomporlo, ragione per cui l’arte non potrà recuperare un legame con la natura riproducendola, ma solo operando all’interno di essa

  3. Pono tibi istam: “Tu curris”.Uno sguardo alla teoria medievale delle obbligazioni

    Directory of Open Access Journals (Sweden)

    Riccardo Strobino

    2008-12-01

    Full Text Available La teoria delle obbligazioni rappresenta un significativo esempio di come un insieme di tecniche logiche possa essere applicato, in maniera feconda, a contesti disputazionali in cui la dimensione dialogica e l’interazione tra soggetti coinvolti in un confronto dialettico hanno un ruolo di primo piano. L’attenzione che numerosi studiosi hanno manifestato nei confronti di questa parte della logica modernorum negli ultimi quarat’anni testimonia la profondità e la difficoltà dei problemi teorici che stanno alla base della teoria. Molte interpretazioni sono state avanzate circa le motivazioni che spingono i logici medievali a scrivere trattati in cui il portato delle loro dottrine logiche – come, ad esempio, la teoria delle consequentiae - viene declinato ed elaboratamente applicato al gioco dialettico tra due disputanti. La gamma di tali letture comprende differenti ipotesi: la teoria delle obbligazioni potrebbe fornire un nucleo di regole per l’impostazione di un metodo assiomatico rudimentale così come rappresentare un tentativo di elaborare esercizi volti a valutare le capacità logiche degli studenti o, ancora, un gioco teorico, svincolato dall’effettiva applicazione a contesti concreti, la cui finalità sarebbe il mantenimento della coerenza logica. E’ stata sostenuta da più interpreti la funzione pedagogica svolta dalla teoria, al di là del fatto che si tratti o meno di un metodo per la conduzione effettiva di dispute reali. Un’altra linea interpretativa collega la teoria delle obbligazioni al contesto della letteratura dei sophismata e degli insolubilia, dal cui repertorio, in effetti, sono spesso tratti molti degli esempi che si incontrano nella lettura dei trattati de obligationibus. In questo senso, la teoria offrirebbe regole e schemi di risposta che un interlocutore deve utilizzare per risolvere o rispondere a enunciati problematici o paradossali. Non si può escludere, inoltre, che nella teoria si realizzi un

  4. T. A. Sebeok e i congegni di modellazione del mondo: strumenti teorici al servizio delle pratiche professionali

    Directory of Open Access Journals (Sweden)

    Giorgio Maggi

    2005-06-01

    Full Text Available L'elaborato si compone di una parte che comprende l'illustrazione delle linee generali del pensiero teorico di T. A. Sebeok e nello specif ico della sua teoria dei "sistemi di modellazione", e l'altra che include le riflessioni circa la possibilità di adoperare l'approccio biosemiotico alla realtà sociale e costruire, in tale direzione, un professionalismo ideal-tipico che sia capace di rispondere alle esigenze pratiche della vita quotidiana.

  5. Il fuoco della fusione termonucleare controllata

    CERN Document Server

    Caldirola, Piero; Sindoni, Elio

    1984-01-01

    Per realizzare la fusione termonucleare controllata, cioè catturare e dominare il fuoco che accende gli astri, e ottenere così una nuova fonte di energia praticamente illimitata e a basso costo, si richiede uno sforzo collettivo e unitario globale: non esiste infatti nazione al mondo che sia in grado, singolarmente presa, di affrontare il problema, sia per le risorse finanziarie necessarie all'impresa sia per il numero dei ricercatori che dovranno dedicarvisi.

  6. Pencil and mouse. Drawing in the digital era

    Directory of Open Access Journals (Sweden)

    Giovanni Federle

    2010-12-01

    Full Text Available In questo contributo si considera il ruolo che ha oggi, nella scuola secondaria dopo la riforma, l’insegnamento del disegno a mano libera e con strumenti e i problemi che si pongono nel passaggio dal disegno analogico al disegno digitale. Dalla sintesi delle ricerche sviluppate nell’ultimo decennio si possono cogliere alcune indicazioni per la didattica del disegno. Rimane aperta la questione di un insegnamento laboratoriale che non sia istruzionale.

  7. Le forze della natura il nuovo orizzonte della fisica

    CERN Document Server

    Davies, Paul C W

    1990-01-01

    Vero "cavallo di razza" della divulgazione scientifica, Paul Davies è uno dei rari fisici che sanno farsi seguire dal lettore comune anche quando affrontano argomenti difficili. Ne è una prova il presente volume, una delle migliori illustrazioni disponibili del microcosmo atomico e dell'incredibile fauna che lo abita : non solo la familiare triade protone-elettrone-neutrone, ma le ben più intriganti realtà che vanno sotto il nome di "colore", "incanto", stranezza".

  8. 1916-IJBCS-Article-Traoré Mohamed

    African Journals Online (AJOL)

    hp

    paramètres agrophysiologiques et de sensibilité à l'encoche sèche d'Hevea brasiliensis au sud-est de la Côte d'Ivoire : cas des clones PB 235 et PB 260 de la classe d'activité ...... (1985), ce type d'encoche sèche est dit encoche sèche induite par ... la coagulation du latex au sein des laticifères, entraîne l'arrêt de ...

  9. Sadomasochism in the filmic element: Eros melancholy and versification

    Directory of Open Access Journals (Sweden)

    Chiara Bille

    2011-06-01

    Full Text Available Le perversioni che albergano nell’animo umano sono insidiate lì comodamente nel profondo e inconsciamente si manifestano con una veste di crudeltà seducente nel reale, seguendo la trama di un sottile e raffinato ricamo che mai nessuno osa ri- conoscere, bensì solo confondere in un lussurioso giuoco di dominio morboso che con l’ausilio di un agire anancastico è proteso verso la ricerca del paradiso perduto.

  10. Catastrophic health expenditure and its determinants in Kenya slum communities.

    Science.gov (United States)

    Buigut, Steven; Ettarh, Remare; Amendah, Djesika D

    2015-05-14

    In Kenya, where 60 to 80% of the urban residents live in informal settlements (frequently referred to as slums), out-of-pocket (OOP) payments account for more than a third of national health expenditures. However, little is known on the extent to which these OOP payments are associated with personal or household financial catastrophe in the slums. This paper seeks to examine the incidence and determinants of catastrophic health expenditure among urban slum communities in Kenya. We use a unique dataset on informal settlement residents in Kenya and various approaches that relate households OOP payments for healthcare to total expenditures adjusted for subsistence, or income. We classified households whose OOP was in excess of a predefined threshold as facing catastrophic health expenditures (CHE), and identified the determinants of CHE using multivariate logistic regression analysis. The results indicate that the proportion of households facing CHE varies widely between 1.52% and 28.38% depending on the method and the threshold used. A core set of variables were found to be key determinants of CHE. The number of working adults in a household and membership in a social safety net appear to reduce the risk of catastrophic expenditure. Conversely, seeking care in a public or private hospital increases the risk of CHE. This study suggests that a substantial proportion of residents of informal settlements in Kenya face CHE and would likely forgo health care they need but cannot afford. Mechanisms that pool risk and cost (insurance) are needed to protect slum residents from CHE and improve equity in health care access and payment.

  11. Black-bellied whistling duck (Dendrocygna autumnalis) brain cholinesterase characterization and diagnosis of anticholinesterase pesticide exposure in wild populations from Mexico.

    Science.gov (United States)

    Osten, Jaime Rendón-von; Soares, Amadeu M V M; Guilhermino, Lucia

    2005-02-01

    Rice is the main crop in the subbasin of the fluvial lagoon system of Palizada River (FLSPR) in the state of Campeche, Mexico. The pesticides used to control pests of this crop mainly are carbofuran, chlorpyrifos, and glyphosate. Black-bellied whistling duck (Dendrocygna autumnalis) is an ecologically and economically important species in the area. This duck is consumed by local inhabitants throughout the year, despite its potential exposure to pesticides. Due to its feeding habits, abundance, and nutritional value, D. autumnalis is a good indicator of environmental contamination and a potential route of human exposure to organophosphate and carbamate pesticides. In this study, the brain cholinesterase (ChE) in the frontal cerebral cortex of autochthonous ducks was characterized. In addition, the potential of the three locally used pesticides and mixtures to inhibit ChE activity was investigated and the exposure of the wild duck population during intensive pesticide applications in rice fields was evaluated. We found that acetylcholinesterase (AChE) seems to be the predominant ChE form in the biological fraction analyzed. Carbofuran was the most potent ChE inhibitor of D. autumnalis brain ChE activity from the three pesticides analyzed. Cholinesterase inhibition after exposure to pesticide mixtures predominantly was due to carbofuran. A decrease (p 30%) was apparent in wild ducks compared to reference ducks, with recovery of ChE inhibition in wild ducks occurring months later when no pesticides were applied in the field. Dendrocygna autumnalis brain ChE is a suitable parameter for inclusion in biomonitoring programs for both environmental protection and human safety.

  12. Fetal thrombocytopenia in pregnancies with fetal human parvovirus-B19 infection.

    Science.gov (United States)

    Melamed, Nir; Whittle, Wendy; Kelly, Edmond N; Windrim, Rory; Seaward, P Gareth R; Keunen, Johannes; Keating, Sarah; Ryan, Greg

    2015-06-01

    Fetal infection with human parvovirus B19 (hParvo-B19) has been associated mainly with fetal anemia, although data regarding other fetal hematologic effects are limited. Our aim was to assess the rate and consequences of severe fetal thrombocytopenia after fetal hParvo-B19 infection. We conducted a retrospective study of pregnancies that were complicated by fetal hParvo-B19 infection that underwent fetal blood sampling (FBS). The characteristics and outcomes of fetuses with severe thrombocytopenia (B19 infection. A total of 37 pregnancies that were affected by fetal hParvo-B19 infection were identified. Of the 29 cases that underwent FBS and had information regarding fetal platelets, 11 cases (38%) were complicated by severe fetal thrombocytopenia. Severely thrombocytopenic fetuses were characterized by a lower hemoglobin concentration (2.6 ± 0.9 g/dL vs 5.5 ± 3.6 g/dL; P = .01), lower reticulocyte count (9.1% ± 2.8% vs 17.3% ± 10.6%; P = .02), and lower gestational age at the time of diagnosis (21.4 ± 3.1 wk vs 23.6 ± 2.2 wk; P = .03). Both the fetal death rate within 48 hours of FBS (27.3% vs 0%; P = .02) and the risk of prematurity (100.0% vs 13.3%; P B19 infection, can be further worsened by IUT, and may be associated with an increased risk of procedure-related fetal loss after either FBS or IUT. Copyright © 2015. Published by Elsevier Inc.

  13. The proportion of in utero transfers (IUT) significantly influences outcome among a preterm delivery population

    LENUS (Irish Health Repository)

    Wall, V

    2011-02-01

    Institute of Obstetricians & Gynaecologists, RCPI Four Provinces Meeting, Junior Obstetrics & Gynaecology Society Annual Scientific Meeting, Royal Academy of Medicine in Ireland Dublin Maternity Hospitals Reports Meeting, Nov 2010

  14. Il dialogo nell’opera del primo Maeterlinck

    Directory of Open Access Journals (Sweden)

    Giuliana Altamura

    2010-04-01

    Full Text Available Il saggio, dopo essersi soffermato sulla poetica del silenzio del drammaturgo belga, si propone di approfondire l’analisi del dialogo nell’opera del primo Maeterlinck. Al rifiuto della mimesi classica corrisponde un discorso che ricalca le dinamiche dell’inconscio per arricchirsi di un ulteriore livello di lettura che trascende la comunicazione superficiale necessitata dalla situazione, assumendo un significato universale. Si rileva come la parola recuperi una dimensione prima e si avvalga del non-detto per esprimere ciò che l’insufficienza del linguaggio non può carpire. Ne deriva un dialogo spersonalizzato e monologico, pregno di ripetizioni ed echi, logicamente sconnesso e frammentario, punteggiato da esclamazioni e sospensioni che ne evidenziano l’inquietudine e la di dinamismo.

  15. La trama del cosmo spazio, tempo, realtà

    CERN Document Server

    Greene, Brian

    2004-01-01

    Dal regno immutabile di Newton, dove lo spazio e il tempo sono assoluti, alla concezione fluida dello spazio-tempo di Einstein, alle tesi della meccanica quantistica, il fisico americano mostra come il mondo sia molto diverso da quello che l'esperienza comune potrebbe far pensare. Concentrandosi sull'enigma del tempo, Greene stabilisce che nessuna regola fisica conferma l'idea che esso scorra in una particolare direzione. Attraverso l'analisi della teoria del big bang, dimostra quanto le recenti teorie delle superstringhe e la M-teoria possano conciliare ogni cosa, dalla più piccola particella al più grande buco nero. Una visione che culmina in un "multiverso" dove spazio e tempo possono dissolversi in entità più sottili e fondamentali.

  16. Book review. Rapporto Nomisma 2014: La professione medico veterinaria - Prospettive future. FNOVI, Autori Vari

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2014-09-01

    Full Text Available Il presidente della Federazione Nazionale degli Ordini Veterinari Italiani (FNOVI, Gaetano Penocchio, si pone alcune domande: "Chi siamo per il "mondo del lavoro"? Quanto ha bisogno di noi? Siamo preparati a rispondere o a stimolare la domanda di professionalità veterinarie? Come restare competitivi e come garantire nuovi sbocchi occupazionali?". Il nuovo Rapporto sulla professione medico veterinaria, che esce a 4 anni di distanza dal precedente ed è ancora curato da Nomisma, nasce proprio per dare risposta agli interrogativi di cui sopra, proponendosi come strumento informativo aggiornato per il mondo veterinario e per le Istituzioni, nonché come strumento di approfondimento su cui fondare ulteriori riflessioni. Il volume si focalizza soprattutto sui diversi ambiti occupazionali del medico veterinario e sulla dimensione prospettica al 2030 dei possibili scenari evolutivi della professione. Lo "sguardo demoscopico" del Rapporto non prescinde da un dato che deve far riflettere, ovvero che in Italia il rapporto fra popolazione e medici veterinari è (ancora il più alto d'Europa. In vent'anni i veterinari sono raddoppiati fino agli attuali 30.415 di cui il 77% liberi professionisti, quindi esposti al rischio di non avere una continuità lavorativa. Tutto questo, peraltro, nel pieno di spinte recessive che ciclicamente colpiscono il Paese e nel quadro di una crisi globale che si protrae dal 2007. Eppure il Rapporto mette in luce che il 27% delle esportazioni italiane è rappresentato da prodotti alimentari di origine animale e che il comparto della filiera agroalimentare, strettamente connesso alla professione medico veterinaria, ha tenuto contenendo il calo dei consumi alimentari. Una chiave per rilanciare la professione potrebbe essere, ad esempio, quella della specializzazione nell'ambito della sicurezza alimentare: un settore poco curato soprattutto in ambito universitario, come afferma il presidente della FNOVI che chiosa così: "La

  17. IL DUELLO NEL RINASCIMENTO E IL RIPENSAMENTO ETICO SUL DUELLO DI FRANCESCO PATRIZI

    Directory of Open Access Journals (Sweden)

    Fulvio Šuran

    2012-01-01

    Full Text Available In questa prima parte del saggio ci soff ermeremo in modo particolare al periodo che intercorre tra la seconda metà del XV secolo e la prima metà del XVI secolo, in quanto è in questo lasso di tempo che si trovano serie e chiare testimonianze riguardanti la questione del duello. E questo sia nelle opere letterarie che in quelle riguardanti la precettistica. Per quanto riguarda quelle di precettistica, oltre al gran numero di trattati, è da tener presente anche il gran numero delle loro riedizioni, specialmente di quelli più famosi. Dove, oltre all'immancabile comunanza d’interessi fra poeti epici e trattatisti del duello, si noterà anche una sostanziale identità terminologica - per esempio sia i poeti sia i trattatisti ritengono che il duello sia una ‘prova’ di giudizio fi nale. Questo non comporta, nel contempo, una convergenza di convinzioni fi losofi che, in quanto, come si vedrà, il duello letterario diff erisce da quello reale proprio per la sua diversa comprensione fi losofi ca del combattere. Pertanto con la presente relazione si cercherà di dispiegare la problematica che questo istituto di per sé ha comportato nel periodo storico preso in considerazione. Il duello infatti si configurava come una questione sociale tutt'altro che irrilevante per la sua connotazione ambivalente di ordalia – quale forma particolare di rapporto fra uomo e sacro – e di inculpata tutela – quale forma particolare di ricorso alla violenza privata a tutela di un fondamentale diritto naturale. In tutti e due i casi si tratta di una forma di onore, sia individuale sia nobiliare, del quale il Patrizi ne discuterà la fondatezza interpretandolo specialmente in qualità di virtù. In questa defi nizione dell'onore – che il Patrizi aff ronta con un gusto platonico – si possono scorgere questioni di alta portata politica, che ponevano sotto varia forma la questione dei rapporti tra individuo e Stato. In tal modo il duello d’onore assumeva un

  18. DALL’«ARTICOLO EPR» AGLI ESPERIMENTI DI ALAIN ASPECT: IL LUNGO CAMMINO DEL PROBLEMA DELLA NONLOCALITÀ IN MECCANICA QUANTISTICA

    OpenAIRE

    Matarese, Vera

    2014-01-01

    Quando, nel 1935, venne pubblicato il famoso articolo chiamato poi “EPR Paper” per le iniziali dei suoi autori - Einstein, Podolsky, Rosen -, la comunità scientifica dovette confrontarsi non solo con le manifeste provocazioni che il suo argomento voleva mostrare, ma anche con latenti problemi che sarebbero sbocciati più avanti in tutti i loro stridenti contrasti. L’incompletezza della meccanica quantistica, che l’“articolo EPR” si proponeva di dimostrare, poggiava infatti su un principio molt...

  19. Bewässerung in Sachsen

    OpenAIRE

    Gramm, Marina

    2014-01-01

    Der Bericht gibt einen Überblick über den Umfang der bewässerten landwirtschaftlichen Fläche in Sachsen und die bewässerten Kulturarten. Verschiedene Bewässerungsverfahren und -techniken sowie Steuerungsmodelle werden vorgestellt und bewertet. Weiterhin sind die Ergebnisse von Wirtschaftlichkeitsuntersuchungen dargestellt. Die Bewässerungsfläche in der sächsischen Landwirtschaft entspricht nur 0,4 % der landwirtschaftlichen Nutzfläche, zeigt aber auf Grund verstärkter Frühsommertrockenhe...

  20. Questo bizzarro universo

    CERN Document Server

    Sciama, Dennis William

    1998-01-01

    La moderna astronomia ha posto una serie di problemi bizzarri, per la varietà e per la stravaganza dei fenomeni e dei problemi studiati. Per esempio : esiste un solo universo o infiniti universi ? "Naturalmente non avrei mai posto una tale domanda - dice l'Autore - se non pensassi che ci sono valide ragioni per credere che esistano molti universi" ; e il Lettore si accorgerà che le argomentazioni di Sciama sono fondamentali, per ragioni scientifiche e anche filosofiche.

  1. O stilu i kulturnom značenju Marulićeve Poslanice papi Adrijanu VI.

    OpenAIRE

    Cattaneo, Ruggero

    2008-01-01

    Nella comunicazione quotidiana assistiamo oggi a un singolare rinnovamento del genere epistolografico, tutte le volte che scriviamo (digitiamo) e scambiamo messaggi di posta elettronica (e-mail) privati o ufficiali, o anche, a un più basso ma non meno vitale livello stilistico, messaggi SMS, che somigliano talora a mini-lettere, o più spesso a epigrammi. Sono le nuove, ma ormai onnipresenti forme della comunicazione elettronica, che danno spazio anche a una parola più intima e confidenziale, ...

  2. Antoine Hatzenberger, Rousseau et l’utopie. De l’état insulaire aux cosmotopies

    OpenAIRE

    Todesco, Francesca

    2016-01-01

    Il saggio di Hatzenberger propone un’ampia riflessione sul tema dell’utopia, affrontato nella sua complessità percorrendo l’opera di Rousseau dai primi scritti alle pubblicazioni postume. «Rousseau était-il utopiste?» (p. 7): è un interrogativo relativo alla storia della ricezione, centrale nel dibattito interpretativo sull’opera di Rousseau. Ma è anche una questione che interessa la storia delle idee e domanda che si consideri, oltre ai motivi utopici che percorrono il pensiero di Rousseau, ...

  3. Cronache dell'universo fisica moderna e cosmologia

    CERN Document Server

    Regge, Tullio

    1981-01-01

    Dall'infinitamente piccolo all'infinitamente grande: è il viaggio che ci propone Tullio Regge, che oltre ad essere uno dei massimi fisici contemporanei, ha rivelato un talento eccezionale per la divulgazione.

  4. Phenomena of Blowup and Global Existence of the Solution to a Nonlinear Schrödinger Equation

    Directory of Open Access Journals (Sweden)

    Xiaowei An

    2013-01-01

    Full Text Available We consider the following Cauchy problem: -iut=Δu-V(xu+f(x,|u|2u+(W(x⋆|u|2u, x∈ℝN,t>0, u(x, 0=u0(x,x∈ℝN, where V(x and W(x are real-valued potentials and V(x≥0 and W(x is even, f(x,|u|2 is measurable in x and continuous in |u|2, and u0(x is a complex-valued function of x. We obtain some sufficient conditions and establish two sharp thresholds for the blowup and global existence of the solution to the problem.

  5. Le « CV multilingue automatisé » The « Automated Multilingual Resume Builder »

    OpenAIRE

    Mathilde Arino; Christine Vaillant Sirdey; Linda Terrier

    2012-01-01

    De par leur mission d’insertion professionnelle, les IUT ont depuis longtemps inscrit dans leurs programmes pédagogiques nationaux l’élaboration du curriculum vitae en langue(s) étrangère(s). La politique de mobilité internationale encourage aujourd’hui toutes les formations universitaires du secteur LANSAD à intégrer la création d’un CV dans leur formation en langue.La rédaction d’un CV, déjà complexe en langue maternelle, réclame pour d’autres langues la maîtrise de savoir-faire spécifiques...

  6. Le « CV multilingue automatisé »

    OpenAIRE

    Terrier, Linda; Vaillant Sirdey, Christine; Arino, Mathilde

    2014-01-01

    De par leur mission d’insertion professionnelle, les IUT ont depuis longtemps inscrit dans leurs programmes pédagogiques nationaux l’élaboration du curriculum vitae en langue(s) étrangère(s). La politique de mobilité internationale encourage aujourd’hui toutes les formations universitaires du secteur LANSAD à intégrer la création d’un CV dans leur formation en langue.La rédaction d’un CV, déjà complexe en langue maternelle, réclame pour d’autres langues la maîtrise de savoir-faire spécifiques...

  7. Organizational models for new economy in the public and the private one; Modelli organizzativi per la new economy nel pubblico e nel privato

    Energy Technology Data Exchange (ETDEWEB)

    Amicucci, F.; Battaglia, F. [Rome Univ., Rome (Italy). Facolta' di Economia Aziendale; Di Marco, R.A. [ENEA, Funzione Centrale Informatica, Sede Centrale, Rome (Italy)

    2001-07-01

    globalization in progress has created numerous opportunities thanks to strong growth in the commerce and in the investments with the consequent increase of the income and prosperity. This amazing conjuncture has brought some economists to speak of a new economic model: an economy that is able use the resources of the innovation and the increases of productivity to give place to an economic development that him grows in the time. The explosion of the technological information represents the fulcrum of the increase of productivity that have fed the economic expansion of these last ten years. The optimization in the use of the resources and the continuous rationalization of the operations they are been able to happen thanks to the new solutions in net, to the easiest access to information through the use of Internet and to the exploitation of these new means of communications particularly in the transactions business to business. Technology and the economy of the nets therefore they are imposing like one of the most powerful drivers for economic growth, for the ability to create new places of employment and new professions to strengthen the ability to compete on the global markets. Arriving to the appointment late with the economy on line often means to not succeed in entering at all or to lose occasions that will be exploited without hesitation from more ready competitors to gather these new opportunities. To the enterprises therefore he requires to undertake the road of this change hocking resources in the organizational restructuring and in the technological adjustment. [Italian] Storicamente i modelli organizzativi hanno seguito una evoluzione che ha evidenziato un trend parallelo alla complessita' del mercato, presentando via via diversi meccanismi di coordinamento. Fino a ieri il modello vincente era quello gerarchico che pero' non e' di certo immune da limiti. A partire dall'Ottocento e soprattutto nel Novecento esperti di organizzazione hanno studiato

  8. Organizational models for new economy in the public and the private one; Modelli organizzativi per la new economy nel pubblico e nel privato

    Energy Technology Data Exchange (ETDEWEB)

    Amicucci, F; Battaglia, F [Rome Univ., Rome (Italy). Facolta' di Economia Aziendale; Di Marco, R A [ENEA, Funzione Centrale Informatica, Sede Centrale, Rome (Italy)

    2001-07-01

    globalization in progress has created numerous opportunities thanks to strong growth in the commerce and in the investments with the consequent increase of the income and prosperity. This amazing conjuncture has brought some economists to speak of a new economic model: an economy that is able use the resources of the innovation and the increases of productivity to give place to an economic development that him grows in the time. The explosion of the technological information represents the fulcrum of the increase of productivity that have fed the economic expansion of these last ten years. The optimization in the use of the resources and the continuous rationalization of the operations they are been able to happen thanks to the new solutions in net, to the easiest access to information through the use of Internet and to the exploitation of these new means of communications particularly in the transactions business to business. Technology and the economy of the nets therefore they are imposing like one of the most powerful drivers for economic growth, for the ability to create new places of employment and new professions to strengthen the ability to compete on the global markets. Arriving to the appointment late with the economy on line often means to not succeed in entering at all or to lose occasions that will be exploited without hesitation from more ready competitors to gather these new opportunities. To the enterprises therefore he requires to undertake the road of this change hocking resources in the organizational restructuring and in the technological adjustment. [Italian] Storicamente i modelli organizzativi hanno seguito una evoluzione che ha evidenziato un trend parallelo alla complessita' del mercato, presentando via via diversi meccanismi di coordinamento. Fino a ieri il modello vincente era quello gerarchico che pero' non e' di certo immune da limiti. A partire dall'Ottocento e soprattutto nel Novecento esperti di organizzazione hanno studiato un modello

  9. Margaret Atwood's The handmaid's tale and The heart goes last. A comparative study on two dystopian cities

    Directory of Open Access Journals (Sweden)

    Barbara Miceli

    2018-01-01

    Full Text Available Il saggio è l’analisi di due romanzi di Margaret Atwood ambientati in due città/società con un funzionamento apparentemente perfetto che le rende sicure, pulite, prive di crimine e disciplinate. I romanzi, The Handmaid’s Tale (1985 e The Heart Goes Last (2015, sono ambientati nelle città fittizie di Gilead e Consilience, situate negli Stati Uniti. Tali società condividono alcune caratteristiche, e applicano i principi della prigione studiati da Foucault nel saggio Discipline and Punish, in particolare per ciò che riguarda il controllo sul corpo delle persone per renderle “docili” e utili, l’isolamento dal mondo esterno e le punizioni (torture ed esecuzioni che rendono le persone soggiogate al potere. L’apparente perfezione di Gilead e di Consilience nasconde elementi distopici che, secondo l’autrice, potrebbero rappresentare il futuro delle nostre città, e una misura estrema che suscita dibattiti e riflessioni su quanto una simile gestione della società possa essere peggiore di quella in cui viviamo.

  10. Infertilità, procreazione medicalmente assistita, prematurità

    Directory of Open Access Journals (Sweden)

    Francesca Natascia Vasta

    2016-08-01

    Full Text Available Il lavoro descrive il filo rosso che collega l’esperienza della coppia che riceve una diagnosi di sterilità o infertilità, il percorso relativo alla procreazione medicalmente assistita e il possibile esito di questo percorso in un parto pretermine, con conseguente ricovero del neonato in un reparto di Terapia Intensiva Neonatale. Il vertice da cui viene esaminato questo filo conduttore è quello della sofferenza identitaria femminile, vissuta dalla donna prima del concepimento e dalla madre del piccolo ricoverato poi. Viene evidenziato il ruolo che può svolgere lo psicoterapeuta con esperienza specifica sul campo in un apposito spazio di prevenzione e cura di tali ferite identitarie e di come questa funzione psicologica a sostegno della funzione genitoriale possa assumere maggiore efficacia se in concomitanza sussiste un’équipe di cura integrata che veda i medici e il personale sanitario formato a un dialogo empatico e competente sul piano della relazione con la coppia che li incontra prima e dopo il concepimento. Un caso clinico esemplifica il discorso.

  11. Il dottor Freud a proposito dell'arte (1925

    Directory of Open Access Journals (Sweden)

    Clive Bell

    2010-12-01

    Full Text Available Clive Bell (1881-1964, critico d’arte inglese appartenente al Gruppo di Bloomsbury, fu tra i fautori più decisi del formalismo in estetica. In questo articolo critica qui con ironica asprezza, la concezione dell’arte espressa da Freud in un noto passo dell’Introduzione alla Psicoanalisi, in cui l’artista viene descritto come una persona insoddisfatta che compensa attraverso l’arte i suoi bisogni pulsionali. Secondo Clive Bell il piacere dell’arte non nasce dall’appagamento di desiderio ma da una speciale emozione che riguarda solo la “Forma Significante”. “L’artista– scrive – non è alle prese… con la “sublimazione” delle sue normali brame, perché è alle prese con un problema totalmente al di fuori dell’esperienza normale. Il suo obbiettivo è creare una forma che debba corrispondere a un’idea estetica, non creare una forma che debba soddisfare le voglie inappagate del dottor Freud.” Conclude poi dicendo: “A me pare che il dottor Freud possa essere un eccellente psicoanalista; ma l’arte, sono certo, farebbe meglio a lasciarla stare.”

  12. Inhibition, recovery and oxime-induced reactivation of muscle esterases following chlorpyrifos exposure in the earthworm Lumbricus terrestris

    International Nuclear Information System (INIS)

    Collange, B.; Wheelock, C.E.; Rault, M.; Mazzia, C.; Capowiez, Y.; Sanchez-Hernandez, J.C.

    2010-01-01

    Assessment of wildlife exposure to organophosphorus (OP) pesticides generally involves the measurement of cholinesterase (ChE) inhibition, and complementary biomarkers (or related endpoints) are rarely included. Herein, we investigated the time course inhibition and recovery of ChE and carboxylesterase (CE) activities in the earthworm Lumbricus terrestris exposed to chlorpyrifos, and the ability of oximes to reactivate the phosphorylated ChE activity. Results indicated that these esterase activities are a suitable multibiomarker scheme for monitoring OP exposure due to their high sensitivity to OP inhibition and slow recovery to full activity levels following pesticide exposure. Moreover, oximes reactivated the inhibited ChE activity of the earthworms exposed to 12 and 48 mg kg -1 chlorpyrifos during the first week following pesticide exposure. This methodology is useful for providing evidence for OP-mediated ChE inhibition in individuals with a short history of OP exposure (≤1 week); resulting a valuable approach for assessing multiple OP exposure episodes in the field. - Esterase inhibition combined with oxime reactivation methods is a suitable approach for monitoring organophosphate contamination

  13. Inhibition, recovery and oxime-induced reactivation of muscle esterases following chlorpyrifos exposure in the earthworm Lumbricus terrestris

    Energy Technology Data Exchange (ETDEWEB)

    Collange, B. [Universite d' Avignon et des Pays de Vaucluse, UMR 406 Abeilles et Environnement, Site AGROPARC, F-84914, Avignon Cede 09 (France); Wheelock, C.E. [Division of Physiological Chemistry II, Department of Medical Biochemistry and Biophysics, Karolinska Institutet, SE 171 77, Stockholm (Sweden); Rault, M.; Mazzia, C. [Universite d' Avignon et des Pays de Vaucluse, UMR 406 Abeilles et Environnement, Site AGROPARC, F-84914, Avignon Cede 09 (France); Capowiez, Y. [INRA, Unite PSH, Site AGROPARC, F-84914 Avignon Cedex 09 (France); Sanchez-Hernandez, J.C., E-mail: juancarlos.sanchez@uclm.e [Laboratory of Ecotoxicology, Faculty of Environmental Science, University of Castilla-La Mancha, Avda. Carlos III s/n, 45071, Toledo (Spain)

    2010-06-15

    Assessment of wildlife exposure to organophosphorus (OP) pesticides generally involves the measurement of cholinesterase (ChE) inhibition, and complementary biomarkers (or related endpoints) are rarely included. Herein, we investigated the time course inhibition and recovery of ChE and carboxylesterase (CE) activities in the earthworm Lumbricus terrestris exposed to chlorpyrifos, and the ability of oximes to reactivate the phosphorylated ChE activity. Results indicated that these esterase activities are a suitable multibiomarker scheme for monitoring OP exposure due to their high sensitivity to OP inhibition and slow recovery to full activity levels following pesticide exposure. Moreover, oximes reactivated the inhibited ChE activity of the earthworms exposed to 12 and 48 mg kg{sup -1} chlorpyrifos during the first week following pesticide exposure. This methodology is useful for providing evidence for OP-mediated ChE inhibition in individuals with a short history of OP exposure (<=1 week); resulting a valuable approach for assessing multiple OP exposure episodes in the field. - Esterase inhibition combined with oxime reactivation methods is a suitable approach for monitoring organophosphate contamination

  14. Protein phosphorylation and bacterial chemotaxis

    International Nuclear Information System (INIS)

    Hess, J.F.; Bourret, R.B.; Oosawa, K.; Simon, M.I.; Matsumura, P.

    1988-01-01

    Bacteria are able to respond to changes in concentration of a large variety of chemicals and to changes in physical parameters, including viscosity, osmolarity, and temperature, by swimming toward a more favorable location (for review, see Stewart and Dahlquist 1987). Most chemotactic responses are mediated by a series of transmembrane receptor proteins that interact with or bind specific chemicals and thus monitor environmental conditions. Over the past 10 years, work in a number of laboratories has resulted in the identification and characterization of many of the genes and proteins required for the signal transduction process. The authors postulated that rapid and transient covalent modification of the chemotaxis gene products could function to transmit information from the receptor by regulating protein-protein interaction between the chemotaxis gene products. To test this idea, the authors purified the proteins corresponding to the cheA, cheY, cheZ, cheW, and cheB genes and tested the purified polypeptides to determine whether they could be covalently modified and whether they would interact with each other in vitro

  15. La misurazione dei processi di regolazione cognitiva e metacognitiva durante lo studio con gli ipermedia

    Directory of Open Access Journals (Sweden)

    Roger Azevedo

    2010-01-01

    Full Text Available L’apprendimento autoregolato rappresenta una modalità di apprendimento di fondamentale importanza quando ci si avvale del supporto di ambienti ipermediali. Obiettivo di questo articolo è presentare quattro assunzioni chiave che consentono la misurazione dei processi cognitivi e metacognitivi attivati durante l’apprendimento tramite ipermedia. Innanzi tutto, assumiamo che sia possibile individuare, tracciare, modellare e favorire processi di apprendimento auto-regolato durante lo studio con gli ipermedia. La seconda assunzione si focalizza sul comprendere come la complessità dei processi regolatori che avvengono durante l’apprendimento mediato da sistemi ipermediali sia importante per determinare il perché alcuni processi vengono messi in atto durante l’esecuzione di un compito. Le terza assunzione è relativa al considerare che l’utilizzo di processi di apprendimento auto-regolato possa dinamicamente cambiare nel tempo e che tali processi sono di natura ciclica (influenzati dalle condizioni interne ed esterne e da meccanismi di feedback. Infine, l’identificazione, raccolta e classificazione dei processi di apprendimento autoregolato utilizzati durante lo studio con sistemi ipermediali, può risultare un compito alquanto difficoltoso.

  16. Autobiografia di un fisico

    CERN Document Server

    Born, Max

    1980-01-01

    Questa non è solo un'autobiografia scientifica. Il ritratto che Max Born ci offre di se stesso va oltre il profilo dell'uomo di scienza, che pure è stato tra i maggiori del nostro secolo. Di lui veniamo a sapere tutto ciò che occorre per accostarsi alle teorie che gli valsero il premio Nobel, ma anche i tratti di una normale vita borghese nella quale si intrecciavano le influenze dell'ambiente intellettuale e commerciale. Il tono è quello di una rievocazione piana e distesa che ci accompagna per le varie fasi della carriera dello studente, del docente, dello scienziato, nelle università tedesche e inglesi, negli anni delle persecuzioni naziste, alle quali l'ebreo Max Born ebbe la fortuna di sopravvivere, e nel dopoguerra, quando egli tornò in Germania e seppe dare un contributo di idee e di iniziative ai movimenti pacifisti. E' la lunga e operosa vita di un uomo di genio, del quale si ricorda la profonda umanità, la vastità degli interessi culturali, l'acutezza dei giudizi sulle persone, sulle vicend...

  17. Le narrazioni come metodo di indagine sociologica

    Directory of Open Access Journals (Sweden)

    Rita Bichi

    2012-04-01

    Full Text Available L'incontro trentino ha dimostrato l'interesse crescente dei giovani sociologi per lo sviluppo dei metodi narrativi e la capacità che questi hanno di essere efficaci nell'analisi di svariati temi, dai racconti di malattia alle narrazioni identitarie, dallo studio di lavoro e organizzazioni a quello delle migrazioni, di genere e memoria. Tuttavia, l'interesse della sociologia italiana va visto in un quadro di sviluppo più ampio a livello europeo e americano dove, a partire dagli anni '90, l'intervento di alcuni autori come Lyotard, Bruner e Macintyre, ha sancito quella che alcuni autori hanno definito svolta narrativa. La sociologia, infatti, tende sempre più a valorizzare la narrazione come processo di conoscenza peculiare che è attivato costantemente nella vita quotidiana; la "rivoluzione" risiede nel fatto che la narrazione diventa oggetto della sociologia e la disciplina stessa valorizza il suo uso sia come strumento di indagine scientifica, sia come modo di conoscere che come modo di comunicare, rivendicando la legittimità scientifica all'ascolto della parola diretta degli individui coinvolti all'interno delle ricerche di stampo sociologico.

  18. I nomi del tempo la seconda rivoluzione scientifica e il mito della freccia temporale

    CERN Document Server

    Bellone, Enrico

    1989-01-01

    Ogni persona colloca i fatti ordinandoli lungo una freccia psicologica del tempo e così distingue tra il passato e il futuro. La distinzione è netta, poiché i fatti disposti nel passato non sono modificabili, mentre quelli che si verificheranno sono, in linea di massima, solo prevedibili: non possiamo esercitare alcuna influenza sugli eventi passati, ma possiamo nutrire la speranza di condizionare, almeno in parte, quelli che non si sono ancora verificati. La questione della freccia psicologica è collegata alla circostanza per cui l'individuo ha coscienza d'essere sempre situato in un «qui e ora», così da ricordare solo certi fatti del passato e da non avere alcuna memoria del futuro. Questo stato di cose, pur manifestandosi in modo del tutto naturale, presenta però analogie con quel particolare stato di cose grazie al quale ciascuno di noi parla di oggetti che si trovano «in alto» o «in basso», sulla base di una distinzione che non è poi dissimile da quella che riguarda il «prima» e il «dopo�...

  19. Ricerca della Supersimmetria ad ATLAS nel canale h->bb

    CERN Document Server

    Di Sipio, Riccardo

    Il Modello Standard (MS), fino ad una scala di energie di circa 100GeV, e' attualmente la teoria che descrive con il migliore accordo sperimentale il mondo delle particelle elementari e le loro interazioni. Tuttavia, e' ampiamente riconosciuto che questa non pu`o essere considerata una “teoria ultima” per diverse ragioni. Ci si aspetta quindi che che il MS sia valido fino ad una scala energetica di cutoff MW ∼100GeV, oltre la quale bisogna ricorrere ad una “Nuova Fisica”. Questa scala di energie viene spesso identificata con quella delle Grand Unified Theories (GUT), in cui sono unificate le interazioni Forte ed Elettrodebole, ed e' nell’ordine di MGUT ∼ 10^15 GeV. L’unico aspetto non ancora verificato sperimentalmente del MS e' il settore di Higgs. La supersimmetria fornisce una soluzione al problema della gerarchia perch ́e implica un ugual numero di gradi di libert`a bosonici e fermionici, i quali danno contributi di segno opposto nelle correzioni a loop che cancellano esattamente le diver...

  20. Architecture of buried reverse fault zone in the sedimentary basin: A case study from the Hong-Che Fault Zone of the Junggar Basin

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Liu, Bo; Guo, Jianxun; Du, Yannan

    2017-12-01

    It is widely accepted that the faults can act as the conduits or the barrier for oil and gas migration. Years of studies suggested that the internal architecture of a fault zone is complicated and composed of distinct components with different physical features, which can highly influence the migration of oil and gas along the fault. The field observation is the most useful methods of observing the fault zone architecture, however, in the petroleum exploration, what should be concerned is the buried faults in the sedimentary basin. Meanwhile, most of the studies put more attention on the strike-slip or normal faults, but the architecture of the reverse faults attracts less attention. In order to solve these questions, the Hong-Che Fault Zone in the northwest margin of the Junggar Basin, Xinjiang Province, is chosen for an example. Combining with the seismic data, well logs and drill core data, we put forward a comprehensive method to recognize the internal architectures of buried faults. High-precision seismic data reflect that the fault zone shows up as a disturbed seismic reflection belt. Four types of well logs, which are sensitive to the fractures, and a comprehensive discriminated parameter, named fault zone index are used in identifying the fault zone architecture. Drill core provides a direct way to identify different components of the fault zone, the fault core is composed of breccia, gouge, and serpentinized or foliated fault rocks and the damage zone develops multiphase of fractures, which are usually cemented. Based on the recognition results, we found that there is an obvious positive relationship between the width of the fault zone and the displacement, and the power-law relationship also exists between the width of the fault core and damage zone. The width of the damage zone in the hanging wall is not apparently larger than that in the footwall in the reverse fault, showing different characteristics with the normal fault. This study provides a

  1. Possible mechanisms for sensitivity to organophosphorus and carbamate insecticides in eastern screech-owls and American kestrels

    Science.gov (United States)

    Vyas, N.B.; Thiele, L.A.; Garland, S.C.

    1998-01-01

    Effects of a single dietary exposure to fenthion and carbofuran on the survival, feeding behavior and brain ChE activity of eastern screech-owls, Otus asio and American kestrels, Falco sparverius, were evaluated. Birds were exposed to fenthion (23.6–189.0 ppm) or carbofuran (31.7–253.6 ppm) via meatballs. Carbofuran-exposed owls ate either ≤10% or ≥80% of the meatball whereas all kestrels ate ≤10% of the meatball before exhibiting acute signs of toxicity. Fenthion-exposed owls and kestrels displayed a wide spectrum of meatball consumption (<10–100%). Significant brain ChE inhibition was observed in dead and surviving kestrels exposed to fenthion and carbofuran and dead owls exposed to fenthion (P<0.0001). Brain ChE activity of owls exposed to carbofuran that survived was not different from that of controls (P=0.25). Data suggest: (1) slow feeding on a carbamate-contaminated item may provide limited protection from the toxicity of the chemical at certain rates of exposure; (2) the degree of ChE inhibition at neuromuscular junctions may be critical in determining the sensitivity of a species to a carbamate insecticide; (3) sensitivity may be a function of the ChE affinity for the carbamate inhibitor; and (4) the importance of neuromuscular junction ChE depression in determining the sensitivity of an animal may be species-specific.

  2. Possible mechanisms for sensitivity to organophosphorus and carbamate insecticides in eastern screech-owls and American kestrels.

    Science.gov (United States)

    Vyas, N B; Thiele, L A; Garland, S C

    1998-07-01

    Effects of a single dietary exposure to fenthion and carbofuran on the survival, feeding behavior and brain ChE activity of eastern screech-owls, Otus asio and American kestrels, Falco sparverius, were evaluated. Birds were exposed to fenthion (23.6-189.0 ppm) or carbofuran (31.7-253.6 ppm) via meatballs. Carbofuran-exposed owls ate either or = 80% of the meatball whereas all kestrels ate meatball before exhibiting acute signs of toxicity. Fenthion-exposed owls and kestrels displayed a wide spectrum of meatball consumption (< 10-100%). Significant brain ChE inhibition was observed in dead and surviving kestrels exposed to fenthion and carbofuran and dead owls exposed to fenthion (P < 0.0001). Brain ChE activity of owls exposed to carbofuran that survived was not different from that of controls (P = 0.25). Data suggest: (1) slow feeding on a carbamate-contaminated item may provide limited protection from the toxicity of the chemical at certain rates of exposure; (2) the degree of ChE inhibition at neuromuscular junctions may be critical in determining the sensitivity of a species to a carbamate insecticide; (3) sensitivity may be a function of the ChE affinity for the carbamate inhibitor; and (4) the importance of neuromuscular junction ChE depression in determining the sensitivity of an animal may be species-specific.

  3. Ateliers dell'Immaginario Autobiografico: quarto ciclo seminari di formazione

    Directory of Open Access Journals (Sweden)

    Maria Immacolata Macioti

    2012-07-01

    Full Text Available Un numero di Magma dedicato al tema “Memoria, Autobiografia e Immaginario” non può che essere vario e molteplice nei contenuti e nella forma. Non può che presentare contributi che chiamano in causa realtà locali e internazionali, tempi complessi: ieri ed oggi, ieri e domani. Abbiamo messo in evidenza, nella prima sezione di questo numero, due temi fondamentali e trasversali: le memorie ed il loro contesto, l’immaginazione e l’immaginario. Le memorie risentono del tempo, del luogo e del contesto nel quale sono elaborate e raccolte, e il ruolo della politica e del potere ne condiziona il loro vissuto e la loro stessa rielaborazione e interpretazione. L’immaginazione come particolare forma di rappresentazione della realtà, di conoscenza riproduttiva e ri-costruttiva, è anche reinterpretazione creativa nel processo della narrazione della storia individuale e sociale. L’immaginario individuale, sociale e sacrale, come forma estetica delle narrazioni individuali e collettive, è parte costitutiva del pensiero e della coscienza delle donne e degli uomini, e ci svela a capacità di evocare e di creare dei soggetti, di rappresentarsi il mondo, attraverso la funzione dell’immaginazione simbolica. I contributi che abbiamo selezionato e che compaiono in questo numero all’interno delle altre sezioni, sviluppano questi due temi chiave tra spazi angusti e ampie distese che travalicano confini; confini tra terre abitate, confini tra discipline.

  4. Prima la musica: insegnare il melodramma a Oxford negli Anni 2000

    Directory of Open Access Journals (Sweden)

    Emanuele Senici

    2011-04-01

    Full Text Available La tavola rotonda ‘L’opera monta in cattedra: didattica del melodramma’, coordinata da Lorenzo Bianconi e Annamaria Cecconi nel novembre 2007 in occasione dell’XI Colloquio di Musicologia del «Saggiatore musicale», includeva un mio breve intervento sull’esperienza didattica maturata in moduli d’argomento operistico nell’Università di Oxford, dove ho insegnato dal 1998 al 2008. L’intento era di fornire dati utili a un esercizio comparativo, il quale permettesse d’osservare le esperienze di docenti sia d’università sia di conservatorii italiani dalla prospettiva d’un sistema universitario molto diverso da ambo le istituzioni e che però, come vedremo, per le sue caratteristiche pare collocarsi a cavallo tra le due. Le pagine che seguono costituiscono un ripensamento sistematico di quelle riflessioni, nella speranza che esse possano tuttora risultare di qualche interesse a chi riflette sulla didattica del melodramma in Italia. Dopo aver delineato in breve il contesto istituzionale, presenterò un questionario proposto a due gruppi di studenti; sui risultati esporrò poi qualche riflessione conclusiva, tenendo presenti i temi proposti dal testo-base della tavola rotonda e la discussione che ebbe luogo a Bologna. Avverto infine che, benché io scriva quasi sempre al presente, ciò che dico si riferisce al periodo del mio insegnamento oxoniense: dal 2008 alcune cose possono essere cambiate.

  5. Characterization of cell surface and extracellular matrix remodeling of Azospirillum brasilense chemotaxis-like 1 signal transduction pathway mutants by atomic force microscopy.

    Science.gov (United States)

    Edwards, Amanda Nicole; Siuti, Piro; Bible, Amber N; Alexandre, Gladys; Retterer, Scott T; Doktycz, Mitchel J; Morrell-Falvey, Jennifer L

    2011-01-01

    To compete in complex microbial communities, bacteria must sense environmental changes and adjust cellular functions for optimal growth. Chemotaxis-like signal transduction pathways are implicated in the regulation of multiple behaviors in response to changes in the environment, including motility patterns, exopolysaccharide production, and cell-to-cell interactions. In Azospirillum brasilense, cell surface properties, including exopolysaccharide production, are thought to play a direct role in promoting flocculation. Recently, the Che1 chemotaxis-like pathway from A. brasilense was shown to modulate flocculation, suggesting an associated modulation of cell surface properties. Using atomic force microscopy, distinct changes in the surface morphology of flocculating A. brasilense Che1 mutant strains were detected. Whereas the wild-type strain produces a smooth mucosal extracellular matrix after 24 h, the flocculating Che1 mutant strains produce distinctive extracellular fibril structures. Further analyses using flocculation inhibition, lectin-binding assays, and comparison of lipopolysaccharides profiles suggest that the extracellular matrix differs between the cheA1 and the cheY1 mutants, despite an apparent similarity in the macroscopic floc structures. Collectively, these data indicate that disruption of the Che1 pathway is correlated with distinctive changes in the extracellular matrix, which likely result from changes in surface polysaccharides structure and/or composition. FEMS Microbiology Letters © 2010 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. No claim to original US government works.

  6. Alcune considerazioni sulla relazione insegnante e allievo disabile: Analisi di un’esperienza

    Directory of Open Access Journals (Sweden)

    Anna Maria Disanto

    2015-12-01

    Full Text Available Obiettivo principale del nostro contributo è individuare e qualificare, all’interno della relazione educativa con l’allievo portatore di handicap, l’insieme di contenuti non immediatamente accessibili alla coscienza, che si rivelano solo una volta superate delle resistenze. Il rilievo di questi aspetti è stato possibile attraverso la elaborazione di un questionario cui ognuno ha risposto liberamente, garantito dal più assoluto anonimato. La significatività numerica del materiale a nostra disposizione (134 questionari, ci ha permesso di proporre delle considerazioni che, senza avere la pretesa di essere esaustive, risultano valide per introdurre delle riflessioni sull’argomento.Le riflessioni che presentiamo hanno avuto come occasione di stimolo e di riflessione un corso di formazione per insegnanti di sostegno della scuola dell’obbligo, nella cui impostazione si è cercato di integrare elementi presenti su un piano di realtà con aspetti relativi ad un livello inconscio. Quella che presentiamo è l’elaborazione finale di dati che analizzeremo non quantitativamente ma sul piano dei contenuti, attraverso il riconoscimento dei meccanismi di identificazione che intervengono nella relazione dell’insegnante con il bambino portatore di handicap: come si specifichi, cioè, il processo psicologico per cui si fanno propri elementi caratteristici, attributi di un’altra persona e ci si trasforma, totalmente o parzialmente, sul modello di quest’ultima.

  7. [The activity of blood cholinesterase in rats exposed to dimethypo after drug intervention].

    Science.gov (United States)

    Wan, Weiguo; Xu, Mailing; Zou, Hejian; Lu, Ailing; Shen, Xinyu; Chen, Yuming

    2002-12-01

    To investigate the activity of ChE in rats poisoned by dimehypo and then treated with pralidoxime methylchloride or unithiol. Rats were divided into control group (dimehypo); intervention groups [dimehypo plus pralidoxime methylchloride or dimehypo plus unithiol (sodium dimercaptopropanesulphonate)]. Rats were dosed with 4 different doses of dimehypo: 1/16, 1/8, 1/4 and 1/2 of LD50 respectively(the LD50 of dimehypo is 342 mg/kg). After being poisoned with dimehypo orally, rats were immediately injected intramuscularly with pralidoxime methylchloride or unithiol. The activity of ChE in blood was detected before and 1/2, 1, 2, 4 and 24 h after poisoning in dimehypo and intervention groups. The ChE activity of four dose subgroups at 1 h after poisoning were (1.04 +/- 0.21), (0.84 +/- 0.12), (0.71 +/- 0.12), (0.66 +/- 0.07) U/ml respectively; the ChE activity of pralidoxime methylchloride intervention groups were (1.01 +/- 0.18), (1.17 +/- 0.11), (1.01 +/- 0.04), (1.03 +/- 0.12) U/ml respectively; and the ChE activity of unithiol intervention groups were (1.15 +/- 0.15), (1.26 +/- 0.27), (1.08 +/- 0.08), (1.04 +/- 0.12) U/ml respectively. The inhibited ChE in blood was recovered by either treatment with pyraldoxime methylchloride or unithiol. These two drugs had similar effects of recovering the activity of ChE(P > 0.05), but at higher doses(1/4 and 1/2 of LD50) the effects of both were not so good. Pralidoxime methylchloride and unithiol could partly recover the activity of ChE inhibited by dimehypo.

  8. tecnologico. Le “contraddizioni” delle lavagne interattive

    Directory of Open Access Journals (Sweden)

    Francesco Pisanu

    2010-09-01

    Full Text Available “We can be inspired by new technology like the IWB and we can use it to enhance classes and engage pupils on a level previously unattainable. We can also look to the future for new innovations for the classroom, so we can look forward to taking things to the next level entirely”. Questa la sostanziosa promessa che gli insegnanti di ogni ordine e grado possono trovare in un sito web specializzato in marketing dell’innovazione tecnologica in ambito educativo.

  9. La sociologia oltre la globalizzazione

    OpenAIRE

    Ceri, Paolo

    2017-01-01

    Gli esiti di una riflessione collettiva sul rapporto tra la sociologia e la globalizzazione, che qui cerchiamo di avviare, sono tutt’altro che scontati e ancor meno certi nella loro utilità. Si tratta, infatti, di mettere in relazione una pratica conoscitiva – la sociologia – e una fenomenologia – la globalizzazione – che si presentano all’incontro nel modo più asimmetrico. L’una, la sociologia, debilitata e frammentata; l’altra, la globalizzazione, invadente e ubiqua. L’una, incerta nella pr...

  10. Il Teatro Shakespeariano di Danzica. L'Alato / Gdansk Shakespearian Theatre. The Winged

    OpenAIRE

    Renato Rizzi

    2014-01-01

    Il 23 aprile, giorno della nascita e della morte di William Shakespeare, è stato inaugurato il tetto apribile del nuovo Teatro Elisabettiano, che sarà inaugurato il prossimo settembre a Danzica. L'evento diventa l'occasione per celebrare allo stesso tempo le potenze plastiche del simbolo, che, disseminate nella metafisica dei luoghi (e della memoria), guidano le forze alla 'forma' e i valori e gli ideali che hanno sostenuto il tormentato processo storico della città baltica e della nazione p...

  11. Tutto (o quasi) sulle onde

    CERN Document Server

    Pierce, John R

    1977-01-01

    Molti dei fenomeni in cui s'imbatte quotidianamente possono essere interpretati in modo semplice alla luce di quello che è uno dei concetti unificanti della fisica, il concetto di onda: dalle onde acustiche che si propagano nell'aria a quelle luminose, dalle onde radio alle onde meccaniche dei cristalli di quarzo impiegati per controllare la frequenza dei radiotrasmettitori, dalle onde sismiche alle onde di probabilità studiate dalla meccanica quantistica, fino alle onde del linguaggio comune, quelle che muovono la superficie dell'acqua.

  12. Butyryl-cholinesterase is related to muscle mass and strength. A new biomarker to identify elderly subjects at risk of sarcopenia.

    Science.gov (United States)

    Cacciatore, Francesco; Della-Morte, David; Basile, Claudia; Curcio, Francesco; Liguori, Ilaria; Roselli, Mario; Gargiulo, Gaetano; Galizia, Gianluigi; Bonaduce, Domenico; Abete, Pasquale

    2015-01-01

    To determine the relationship between Butyryl-cholinesterase (α-glycoprotein synthesized in the liver, b-CHE) and muscle mass and strength. Muscle mass by bioimpedentiometer and muscle strength by grip strength were evaluated in 337 elderly subjects (mean age: 76.2 ± 6.7 years) admitted to comprehensive geriatric assessment. b-CHE levels were lower in sarcopenic than in nonsarcopenic elderly subjects (p elderly subjects. Thus, b-CHE may be considered to be a fair biomarker for identifying elderly subjects at risk of sarcopenia.

  13. Al peggio non c'è mai fine

    Directory of Open Access Journals (Sweden)

    Attilio Selvini

    2015-02-01

    Full Text Available Alcune considerazioni sulle problematiche della formazione geomatica in Italia che si trova essenzialmente nelle scuole per geometri, ora prossime all’estinzione, e negli insegnamenti delle facoltà di ingegneria, due realtà agli antipodi oggi anche per arretratezza da una parte e forzatura dall’altra, che ci propongono una riflessione che il nostro MIUR dovrebbe prendere seriamente in esame.In this article, Professor Attilio Selvini expresses its views on various issues related to the qualifying examination of Surveyors. 

  14. Estimation of plasma tacrine concentrations using an in vitro cholinesterase inhibition assay

    International Nuclear Information System (INIS)

    Moriearty, P.L.; Kenny, W.; Kumar, V.

    1989-01-01

    THA (9-amino, 1,2,3,4-tetrahydroacridine; tacrine) is currently under study as a cholinesterase (ChE) inhibitor in Alzheimer disease. In this study, a sensitive radiometric assay for THA inhibition of human plasma ChE, suitable for detection of effects of orally administered drug, is described. The assay is sensitive in a range of 4-50 ng/ml plasma. Reversibility of the inhibition permits distinguishing of drug effects on ChE from changes in amount of enzyme synthesized during treatment

  15. Una metropolitana chiamata "tram"

    Directory of Open Access Journals (Sweden)

    Mariella Zoppi

    2012-08-01

    Full Text Available Perché il caso-Firenze della tramvia ha avuto un rilievo così forte sui media nazionali? Perché la tramvia (se vogliamo continuare a chiamare così una metropolitana di superficie è parte di un sovvertimento dei valori storici, estetici ed economici della città di cui il sistema di trasporto è solo un frammento. La grande operazione di trasformazione, come viene chiamata dall’Amministrazione comunale, passa per il cambiamento di destinazione e la nuova edificazione di molte aree urbane: dall’area Fiat e da quella dell’ex-officine ferroviarie di Porta a Prato (ormai in fase conclusiva, dall’avvio dell’edificazione privata a Castello (vicenda nota negli anni Ottanta come “Fondiaria” a quelle di aree di minori dimensioni che interessano ex-cinema o teatri (è di questi giorni il destino dell’attuale Teatro comunale che si mutano in abitazioni pregiate o di fabbriche dismesse che si trasformano, con il loro carico volumetrico pressoché intatto (a pareggiare i conti ci pensa la “perequazione”, in parcheggi in struttura (semi-vuoti perché mal collocati, residenze, uffici, alberghi e quant’altro possa essere “utile” ad una città invecchiata che ha perso, centomila abitanti fra il 1971 ed il 2001, passando da una popolazione di 457.803 a una di 356.118. Come nel resto del Paese, anche a Firenze, non esiste più un dibattito pubblico che riporti gli umori della città all’interno delle vicende politiche e amministrative, e dunque tutto avviene fra l’indifferenza delle cronache locali che sembrano più interessate alle dichiarazioni di questo o quel personaggio che alla effettiva trasmissione delle informazioni. Le notizie circolano sulla rete, veicolate dai comitati (ormai c’è un comitato di cittadini per ogni strada o problema, che vive separatamente dagli amministratori e diventano patrimonio di quanti abbiano una sia pur minima alfabetizzazione informatica.

  16. Health services financing and delivery: analysis of policy options for Dubai, United Arab Emirates

    Directory of Open Access Journals (Sweden)

    Hamidi S

    2015-02-01

    Full Text Available Samer Hamidi School of Health and Environmental Studies, Hamdan Bin Mohammed Smart University, Dubai, United Arab Emirates Introduction: A national health account (NHA provides a systematic approach to mapping the flow of health sector funds within a specified health system over a defined time period. This article attempts to present a profile of health system financing in Dubai, United Arab Emirates using data from NHAs, and to compare the functional structures of financing schemes in Dubai with schemes in Qatar and selected member countries of the Organization for Economic Cooperation and Development (OECD. Methods: The author analyzed secondary data published in NHAs of Dubai and Qatar and data collected by the OECD countries and publicly available from Eurostat (Statistical Office of the European Union of 25 OECD countries for comparative analysis. All health financing indicators used were as defined in the international System of Health Accounts (SHA. Results: In Dubai, spending on inpatient care was the highest-costing component, with 30% of current health expenditures (CHE. Spending on outpatient care was the second highest-costing component and accounted for about 23% of the CHE. Household spending accounted for about 22% of CHE (equivalent to US$187 per capita, compared to an average of 20% of CHE of OECD countries. Dubai spent 0.02% of CHE on long-term care, compared to an average of 11% of CHE of OECD countries. Dubai spent about 6% of CHE on prevention and public health services, compared to an average of 3.2% of CHE of OECD countries. Conclusion: The findings point to potential opportunities for growth and improvement in several health policy issues in Dubai, including increasing focus and funding of preventive services; shifting from inpatient care to day surgery, outpatient, and home-based services and strengthening long-term care; and introducing cost-containment measures for pharmaceuticals. More investment in the translation of

  17. Nuovo realismo FAQ

    Directory of Open Access Journals (Sweden)

    Maurizio Ferraris

    2011-11-01

    Full Text Available Il vero punto, nel confronto tra realisti e postmodernisti, non è ovviamente l’affermazione o negazione dell’esistenza del mondo esterno, ma il costruzionismo: quanto incidono gli schemi concettuali nella costruzione della realtà naturale e sociale? Infatti nessun realista negherebbe che l’IVA dipenda da schemi concettuali (il che non significa ancora sostenere che siano puramente soggettivi: l’IVA vale – in linea di principio – per chiunque faccia acquisti in Italia. Quello che il realista si chiede è, appunto, fin dove si spinge l’azione degli schemi concettuali, ed è qui che si manifesta il dissidio tra realisti e postmodernisti. Questi ultimi sono molto più generosi nella lista delle parti di realtà che sono socialmente costruite, al punto da affermare, in taluni casi, che noi non abbiamo mai accesso a un mondo "là fuori”, ma solo con ciò che viene costruito dai nostri schemi concettuali. New Realism FAQ The actual issue at stake, in the confrontation between realists and postmodernists, is not whether you should accept or deny the existence of the external world, but the scope of constructionism: how far conceptual schemes bear on the construction of natural and social reality? Indeed, no realist would deny that the VAT depends on our conceptual schemes, which does not mean that it is purely subjective: you don’t decide whether (or to which country you have to pay the VAT, it depends on where the purchase takes places. The realist just asks where the sphere of influence of conceptual schemes stops, and here the disagreement with the postmodernists begins. The latter are much more generous in listing the parts of reality that they consider socially constructed, up to maintaining (the most extreme ones that we do not have any access to the world “out there”, but only to what our conceptual schemes construct.

  18. Scegliere la musica nell’era di Internet

    Directory of Open Access Journals (Sweden)

    Marco Russo

    2014-01-01

    Full Text Available La diffusione della musica su Internet è sorta solo dopo l’avvento di due specifiche tecnologie. La prima è relativa ai sistemi di compressione (soprattutto MP3 che ha permesso di ridurre le dimensioni di ciascun file, la seconda al progressivo ampliamento della banda disponibile agli utenti casalinghi (ADSL che ha drasticamente velocizzato i tempi di trasferimento dei dati. La nascita di Napster e dei successive sistemi peer to peer [Merriden 2001] ha reso infine la pratica di ricerca di brani musicali su Internet una prassi diffusa e stabilizzata [Mari 1999], tanto da soppiantare gran parte dei tradizionali media musicali ed ingenerare nuove forme di commercializzazione e gestione dei dati sonori [Prato 1995; Silva-Ramello 1999]. Senza entrare nel dettaglio legale dell’irruzione di Internet nella diffusione di materiali [Darias de las Heras 2003], aspetto che è tutt’altro dall’apparire chiaramente definito anche a causa di rapide trasformazioni normative locali rispetto ad un evento di dimensione assolutamente internazionale, certo è che le iniziali, e primitive, modalità di raccolta di brani su Internet si sono progressivamente evolute sino ad assumere rilevanti connotati tecnologici e commerciali [Di Carlo 2000] che rendono possibile individuare e effettuare il download di pressoché qualsiasi brano si desideri. Il rilievo principale che sorge da queste considerazioni impone dunque una nuova modalità di fruizione della musica rispetto a quella diffusa dai tradizionali media, poiché questi ultimi, al contrario di Internet, non permettono alcuna interazione ed è quindi essenzialmente passiva. Con l’avvento di Internet e tutti i suoi corollari il problema del fruitore di musica cambia profondamente, spostando l’attenzione principalmente verso quello della “scelta” della musica, indipendentemente, spesso, dall’uso che se ne potrà fare o delle modalità di ascolto che saranno messe in atto. Con questo intervento

  19. Characterization of the In Vitro Kinetic Interaction of Chlorpyrifos-Oxon with Rat Salivary Cholinesterase: A Potential Biomonitoring Matrix

    Energy Technology Data Exchange (ETDEWEB)

    Kousba, Ahmed A.(BATTELLE (PACIFIC NW LAB)); Poet, Torka S.(BATTELLE (PACIFIC NW LAB)); Timchalk, Charles (Pacific Northwest National Laboratory)

    2003-02-12

    Chlorpyrifos (CPF) is a commonly used organophosphate insecticide (OP). The primary mechanism of action for CPF involves the inhibition of acetylcholinesterase (AChE) by the active metabolite, CPF-oxon, with subsequent accumulation of acetylcholine (ACh) resulting in a wide range of neutotoxicity. CPF-oxon, can likewise inhibit other non-target cholinesterases (ChE) such as butyrylcholinesterase (BuChE), which represents a detoxification mechanism and a potential biomarker of exposure/response. Biological monitoring for OPs has focused on measuring parent chemical or metabolite in blood and urine or blood ChE inhibition. Salivary biomonitoring has recently been explored as a practical method for examination of chemical exposure; however, there are a limited number of studies exploring its use for OPs. To evaluate the use of salivary ChE as a biological monitor for OP exposure, the current study characterized salivary ChE activity in Sprague-Dawley rats through its comparison with brain and plasma ChE using BW284C51 and iso-OMPA as selective inhibitors of AChE and BuChE, respectively. The study also estimated the kinetic constants describing BuChE interaction with CPF-oxon. A modified Ellman assay in conjunction with pharmacodynamic (PD) modeling was used to characterize the in vitro titration of diluted rat salivary ChE enzyme with CPF-oxon. The results indicated that, more than 95% of rat salivary ChE activity was associated with BuChE activity, total BuChE active site concentration was 0.0012 0.00013 nmol/ml saliva, reactivation rate constant (Kr) was 0.068 0.008 h-1 and inhibitory (Ki) rate constant of 8.825 and 9.80 nM-1h-1 determined experimentally and using model optimization respectively. These study results would be helpful for further evaluating the potential utility of salivary ChE as a practical tool for biological monitor of OP exposures.

  20. Informative management system for administrative management; Il sistema informativo per il reporting e il controllo di gestione di un ente complesso. Realizzazione di un prototipo

    Energy Technology Data Exchange (ETDEWEB)

    D' Onofrio, M.G.; Minelle, F. [Rome Univ. La Sapienza, Rome (Italy). Fac. di Scienze Matematiche, Fisiche e Naturali; Di Marco, R.A. [ENEA, Sede Centrale, Rome (Italy). Funzione Centrale Informatica

    1999-07-01

    The need to optimate the total functionality of the firm, introducing suitable Control System of inherit and merit evaluation concerning the administrative-management results, strengthens the assumption of responsibility from the managerial staff and promotes the operative and management decentralization. In this context assumes a remarkable importance the function of the Informative Management System which has got to assure, in a realistic, qualified and effectual way, a good support to all activities it can make easy, not only the standard working but also the achievement of the programmatic targets. In the present context, where the development of technology often exceeds that one of the organization structures, it is right to redesign the Informative Management System, considering that often the management informatics procedures are obsolete. The statement of the carried out work bases itself on the observation of the business management process: in order to achieve its targets, the firm transform some resources, each one with its own cycle of life, through stages of management classifiable in merit evaluation, decision, execution and control. These stages are carried out by treatment of the Information that represent the link among them, the main resource of the whole organization and the basis of the Informative Management System. Considering the information as an element characterizing the firm, in that it comes from a complicated system which permits to assert that the fulfilment of on effective and efficient management depends largely from its capacity to use the Information. [Italian] La necessita' di ottimizzare la funzionalita' complessiva dell'azienda, introducendo adeguati sistemi di controllo di merito e di valutazione dei risultati a livello amministrativo-gestionale rafforza l'assunzione di responsabilita' da parte della struttura dirigenziale e favorisce il decentramento gestionale e operativo. In questo contesto assume

  1. CONTRIBUTO AL DIBATTITO SUL PRINCIPIO DI EGUAGLIANZA DEI MEZZI PROCESSUALI

    Directory of Open Access Journals (Sweden)

    Dejan Bodul

    2017-01-01

    Full Text Available Il principio di eguaglianza dei mezzi processuali presuppone l’esistenza di una ragionevole possibilità in capo ad entrambe le parti di esporre e comprovare i fatti, in un modo che non metta alcuna delle parti in posizione sfavorevole rispetto alla controparte (caso LB INTERFINANZ A.G. v. Croazia, sentenza del 27.03.2008, riscorso n. 29549/04.. Un tanto rappresenta, nella sua espressione di equilibrio tra le parti processuali, uno degli elementi costitutivi del diritto ad un giusto processo. Tuttavia, con l’entrata in vigore della (nuova legge fallimentare (GU, n. 71/15. in avanti LF la questione dell’eguaglianza sul piano processuale diviene nuovamente di attualità. Precisamene, la LF ha mantenuto una soluzione in base alla quale il creditore ha la possibilità di instaurare il procedimento fallimentare qualora renda probabile l’esistenza del proprio credito e la sussistenza del fondamento fallimentare così che è trattenuto ed eccepito il provvedimento in base al quale la probabilità della sussistenza del credito non può venire dimostrata dal creditore sulla base di una decisione dell’autorità giudiziale o amministrativa che non sia passata in giudicato. Posto che esistono diverse soluzioni con riguardo alle questioni illustrate, gli autori si limiteranno a delle constatazioni di carattere generale sulla base di esperienze comparate, senza una dettagliata disamina delle variegate e peculiari soluzioni giuridiche straniere. Nel lavoro si disaminano sia le implicazioni pratiche che quelle teoriche della soluzione giuridica di diritto positivo, analizzando la giurisprudenza della Corte europea dei diritti dell’uomo nei procedimenti in base all’art. 6 (diritto ad un giusto processo della Convenzione europea per la salvaguardia dei diritti dell’uomo e delle libertà fondamentali, poiché partiamo dal presupposto che le conoscenze sul punto possono essere fondamentali per la comprensione dell’oggetto dell’indagine condotta

  2. Plasma B-esterase activities in European raptors.

    Science.gov (United States)

    Roy, Claudie; Grolleau, Gérard; Chamoulaud, Serge; Rivière, Jean-Louis

    2005-01-01

    B-esterases are serine hydrolases composed of cholinesterases, including acetylcholinesterase (AChE) and butyrylcholinesterase (BChE), and carboxylesterase (CbE). These esterases, found in blood plasma, are inhibited by organophosphorus (OP) and carbamate (CB) insecticides and can be used as nondestructive biomarkers of exposure to anticholinesterase insecticides. Furthermore, B-esterases are involved in detoxification of these insecticides. In order to establish the level of these enzymes and to have reference values for their normal activities, total plasma cholinesterase (ChE), AChE and BChE activities, and plasma CbE activity were determined in 729 European raptors representing 20 species, four families, and two orders. The diurnal families of the Falconiforme order were represented by Accipitridae and Falconidae and the nocturnal families of the Strigiforme order by Tytonidae and Strigidae. Intraspecies differences in cholinesterase activities according to sex and/or age were investigated in buzzards (Buteo buteo), sparrowhawks (Accipiter nisus), kestrels (Falco tinnunculus), barn owls (Tyto alba), and tawny owls (Strix aluco). Sex-related differences affecting ChE and AChE activities were observed in young kestrels (2-3-mo-old) and age-related differences in kestrels (ChE and AChE), sparrowhawks (AChE), and tawny owls (ChE, AChE, and BChE). The interspecies analysis yielded a negative correlation between ChE activity and body mass taking into account the relative contribution of AChE and BChE to ChE activity, with the exception of the honey buzzard (Pernis apivorus). The lowest ChE activities were found in the two largest species, Bonelli's eagle (Hieraaetus fasciatus) and Egyptian vulture (Neophron percnopterus) belonging to the Accipitridae family. The highest ChE activities were found in the relatively small species belonging to the Tytonidae and Strigidae families and in honey buzzard of the Accipitridae family. Species of the Accipitridae, Tytonidae, and

  3. Relatività esposizione divulgativa : e scritti classici di Descartes, Newton, Lobacevskij, Riemann, Helmholtz, Maxwell, Poincaré, Einstein su spazio, geometria, fisica

    CERN Document Server

    Einstein, Albert

    1967-01-01

    Nello stato magmatico della fisica novecentesca Albert Einstein è il nucleo solido, la roccia stabilmente configurata che sta al centro. Di qui la sua posizione di "classico", come testimonia al più alto livello questa esposizione della teoria della relatività. Una teoria che ha segnato un vero mutamento di paradigma, non solo in campo scientifico: la potenza teorica dell'equivalenza relativistica massa-energia ha trovato, come sappiamo, la sua tragica verifica a Hiroshima, nel terrificante potenziale distruttivo della bomba atomica. Oggi, a oltre un secolo dalla originaria formulazione einsteiniana, è la comprensione della "relatività della relatività" che vuol essere perseguita. A introdurre il lettore a questa nuova dimensione provvede un'antologia di scritti di quegli autori che fondarono la scienza fisico-matematica classica e ne avviarono l'evoluzione in senso relativistico.

  4. Comporre conoscenza: il collage come strategia meta-riflessiva

    Directory of Open Access Journals (Sweden)

    Elisabetta Biffi

    2015-09-01

    Full Text Available Il presente contributo intende riflettere sull’utilizzo di una tecnica artistica, il collage, all’interno della formazione degli insegnanti e degli educatori. Si tratta di una differente modalità di azione da parte dei formatori che è inserita nell’ambito dell’art-based research (McNiff, 2008, e dell’arts-informed research (Cole & Knowles, 2008. Per comprendere in modo approfondito questa scelta è necessario conoscere la nascita di questa tecnica e l’utilizzo che di questa hanno fatto vari artisti. Questo consente di delineare alcuni processi cognitivi riflessivi connessi alla pratica del collage che lo rendono strumento efficace in contesti formativi, soprattutto quando rivolti a insegnanti ed educatori. In chiusura, pertanto, si andranno presentando alcuni esempi di esperienze formative che hanno visto il ricorso al collage come strategia riflessiva.

  5. L'arte della vita: biotecnologie e bioetica

    Directory of Open Access Journals (Sweden)

    Rosangela Maria Barcaro

    2014-11-01

    Full Text Available La bioarte è un’esperienza artistica che pone in relazione arte, scienza e  biotecnologie esaminando da un nuovo punto di vista i concetti di vita, evoluzione, natura. L’idea rivoluzionaria alla base di tale esperienza è l’uso della materia organica vivente come mezzo espressivo, o medium, trattata con tecniche rese possibili dalle scoperte scientifico-tecnologiche più recenti.La bioarte si propone di avvicinare l’opinione pubblica alle problematiche generate da attività che plasmano il rapporto dell’uomo con le biotecnologie e di esplorare i timori che tali attività suscitano nella società.L’articolo descrive alcune opere realizzate da bioartisti internazionali, con l’intento di fornire un’analisi bioetica e non estetica di un fenomeno culturale che mostra numerose contraddizioni. 

  6. Use of lambda pMu bacteriophages to isolate lambda specialized transducing bacteriophages carrying genes for bacterial chemotaxis.

    Science.gov (United States)

    Kondoh, H; Paul, B R; Howe, M M

    1980-09-01

    A general method for constructing lambda specialized transducing phages is described. The method, which is potentially applicable to any gene of Escherichia coli, is based on using Mu DNA homology to direct the integration of a lambda pMu phage near the genes whose transduction is desired. With this method we isolated a lambda transducing phage carrying all 10 genes in the che gene cluster (map location, 41.5 to 42.5 min). The products of the cheA and tar genes were identified by using transducing phages with amber mutations in these genes. It was established that tar codes for methyl-accepting chemotaxis protein II (molecular weight, 62,000) and that cheA codes for two polypeptides (molecular weights, 76,000 and 66,000). Possible origins of the two cheA polypeptides are discussed.

  7. Sicurezza e crisi economica. Alcune considerazioni

    Directory of Open Access Journals (Sweden)

    Carlo Giannone

    2013-07-01

    Full Text Available Il saggio indaga gli eventuali legami tra l’attuale situazione di crisi economica, con l’incombente spettro della recessione, e il forte diffuso senso d’insicurezza che sembra accomunare i cittadini di diversi paesi del pianeta. Si passano in rassegna alcuni studi internazionali che hanno indagato sulle principali fonti di “felicità” reale e percepita (reddito, lavoro, vita familiare, rapporti con la propria comunità, la salute, ecc. cercando di comprendere i caratteri strutturali e contingenti dell’insicurezza sociale. L’autore esprime il fermo convincimento che si imponga un risoluto segno di  riscatto. Affinché questo si realizzi, vanno stimolati i rapporti che accrescono il capitale sociale, come la fiducia e la adesione attiva ad associazioni volontarie, di soggetti d’identità simili, anche multiple.

  8. Primo Levi and Ivan Denisovič: The Literary Act between Representation and Expressive Capacity

    Directory of Open Access Journals (Sweden)

    Pietro Tosco

    2011-11-01

    Full Text Available Se questo è un uomo di Primo Levi e Una giornata di Ivan Denisovič di Aleksandr Solženicyn sono due “atti letterari” che hanno contribuito in modo significativo alla conoscenza storica del XX secolo: il primo nell’Occidente dei campi di concentramento nazisti, il secondo nell’Oriente del Gulag. Perché sono così famosi? C’è qualcosa che li accomuna? Questo saggio si propone di analizzare la forza della letteratura come luogo di conoscenza e autocoscienza. Se le opere di Levi e Solženicyn hanno un grande valore come testimonianze, in esse la forza della testimonianza è data dal “gesto letterario” che le ha create, un gesto che produce una conoscenza sintetica in cui gli universali esistono solo nel particolare.

  9. Utopia economica. Uno studio genealogico del neoliberalismo di Gary Becker in relazione al pensiero di Jeremy Bentham

    Directory of Open Access Journals (Sweden)

    Eleonora Buono

    2016-12-01

    Full Text Available L’Autrice si propone di tracciare la genealogia della posizione neoliberale, partendo soprattutto dai testi di Gary Becker. Il pensiero economico neoliberale è posto in relazione con la rivoluzione scientifica e l’operazione di matematizzazione della natura che da essa scaturisce. Questo percorso porterà poi a Jeremy Bentham, il cui sistema è spesso visto come antesignano degli studiosi neoliberali. Secondo la tesi sostenuta dall’Autrice, il neoliberalismo presenta il proprio sguardo come una neutra e scientifica descrizione del reale, sennonché in tale mossa si annida pur sempre una tendenza normativa. È così che gli economisti neoliberali elaborano un sistema che è altresì prescrittivo, proponendo un modello che si pone sul piano politico; modello il quale viene qui designato con il nome di «utopia economica».

  10. Il dito di Galileo le dieci grandi idee della scienza

    CERN Document Server

    Atkins, Peter

    2004-01-01

    Domande e risposte per dieci idee che hanno plasmato il mondo di oggi. Possiamo rintracciare l'origine e il divenire del cosmo? Perché spazio e tempo formano una cosa sola? Che cosa significa l'evoluzione del vivente? Perché il DNA è così importante? Perché il mondo ha bisogno di energia? E com'è che l'aumento dell'entropia scandisce il cambiamento dell'intero universo? Cosa sono gli atomi e cosa c'è di più piccolo di essi? Perché la simmetria della natura e dell'arte cattura il nostro senso della bellezza? Cosa sono quegli elusivi quanti alla base della fisica contemporanea? Siamo sicuri che l'aritmetica non ci inganni? Peter Atkins offre una guida chiara e completa all'impresa scientifica, seguendo la via indicata dal dito di Galileo.

  11. Space of exposure. Brevi note per un urbanistica verticale

    Directory of Open Access Journals (Sweden)

    Lorenzo Tripodi

    2008-06-01

    Full Text Available Solo qualche anno fa, all’apice della più radicale visione modernista, il discorso comune dava per spacciata la città, quanto meno nella sua tradizionale connotazione di centralità che organizza il territorio, superata dalla suburbanizzazione diffusa ed informe, riassorbita in una supercittà distribuita ovunque e senza luoghi. Se è vero che la tendenza allo sprawl urbano non si è certo arrestata e che la produzione di spazi suburbani continua ad essere parte consistente dei processi di strutturazione del territorio, gli ultimi decenni sono stati indubbia- mente quelli della rivincita urbana: una urban renaissance annunciata e compiuta attraverso programmi di riqualificazione, riconversione e marketing che ha ritrovato il centro – quello storico quanto quello di nuovo sviluppo – quale elemento ordinatore del paesaggio globale e catalizzatore delle nuove economie.

  12. Impact of environmental pollution on the incidence of malignant neoplasms of upper respiratory tract in the population of Mysłowice, Imielin and Chełm Śląski

    Directory of Open Access Journals (Sweden)

    Jerzy Stockfisch

    2014-03-01

    Full Text Available Background. The paper presents a retrospective analysis of cases of the upper respiratory tract malignant tumors in the settlement: Mysłowice, Imielin, Chełm Śląski based on the patients’ medical history treated in a hospital laryngological ward in Mysłowice between 1995 and 2004. The inspiration to write the paper was the significant frequency of the upper respiratory tract malignant tumor cases in the main areas of Mysłowice; Piasek and Rymera estate. The aim of the study was the assessment of relationship between environmental pollution and territorial diversity in the morbidity of head and neck cancer. Material and methods. The study involved a group of 130 patients with cancer of the upper respiratory tract and a control group of 145 healthy subjects of similar age and sex, living in the different regions of the surveyed towns in the comparable proportions and in the group of patients. The paper aimed to assess the relationship between territorial diversity of the upper respiratory tract cancers, and environmental risk factors. Results. The analysis was based on environmental pollution data. It was confirmed that the geographic picture of the incidence of the upper airways malignant tumors showed that Mysłowice central districts: Piasek and estate Rymera, indicated this region to be particularly critical one. Conclusions. The increased number of morbidity cases in these districts may be associated with: environmental risk factors, increased consumption of high percentage alcohol, excessive amount of smoked cigarette and low socio-economic status of the patients.

  13. Determinação das perdas endógenas e da digestibilidade ileal da proteína e dos aminoácidos em suínos utilizando-se duas técnicas Use of different techniques to determine endogenous losses and ileal digestibility of protein and amino acids for swine

    Directory of Open Access Journals (Sweden)

    Leidimara Feregueti Costa

    2008-07-01

    Full Text Available Objetivou-se neste estudo determinar os coeficientes de digestibilidade ileal verdadeira da proteína e dos aminoácidos digestíveis de um extrato protéico de levedura utilizando-se duas técnicas - dieta isenta de proteína (DIP e dieta com caseína hidrolisada enzimaticamente (CHE - para determinação das perdas endógenas de proteína, aminoácidos e nitrogênio. Foram utilizados 12 suínos mestiços, machos castrados, com peso médio de 35 kg, submetidos previamente a cirurgia para implantação da cânula T simples. O delineamento experimental foi o inteiramente casualizado com três tratamentos (dieta com CHE; dieta isenta de proteína (DIP; e dieta com 23% do extrato protéico de levedura - ingrediente teste, quatro repetições e um animal por unidade experimental. As perdas endógenas de ácido glutâmico, ácido aspártico, lisina, arginina e serina diferiram entre as dietas; os maiores valores foram obtidos nos animais que receberam a dieta com CHE. O maior valor de perda endógena do aminoácido glicina foi determinado nos animais alimentados com a dieta DIP. Os coeficientes de digestibilidade ileal verdadeira de metionina, treonina, triptofano e serina determinados pelas perdas endógenas utilizando-se a dieta CHE foram superiores àqueles determinados utilizando a dieta DIP. As quantidades das secreções protéicas e de aminoácidos obtidas pela técnica da CHE foram maiores que as determinadas pela técnica da DIP. Os coeficientes de digestibilidade verdadeira da proteína foram menores e os dos aminoácidos, maiores, quando determinados pela técnica CHE.The objective of this study was to determine the true ileal digestibility coefficients of the protein and digestible amino acid of a yeast protein extract using two techniques - diet without protein (DIP and diet with enzime-hydrolysed casein (CHE - for the determination of protein amino acid and nitrogen losses. Twelve half-breed barrows were used, with average weight of 35

  14. Parigi, Quai Branly. Il dialogo delle nature e delle culture Quai Branly, Paris: The dialogue between natures and cultures

    Directory of Open Access Journals (Sweden)

    Isabella Pezzini

    2012-01-01

    Full Text Available Quai Branly (Museo Nazionale delle Arti e Civilt dAfrica, dAsia, dOceania e delle Americhe a Parigi, inaugurato nel 2006, analizzato da un punto di vista semiotico come un grande dispositivo di riconoscimento e di comunicazione culturale, nelle sue diverse componenti: architettonica, paesaggistica, di allestimento. Si tratta di uno spazio che si vuole fortemente innovativo, e che investe nellintegrazione fra la collezione e le nuove tecnologie della comunicazione. Il museo vuole affermare il valore della diversit delle culture, e costruire uno spazio di possibile dialogo fra di loro, oltre che di esposizione esemplare di artefatti eccezionali. Non solo museo ma anche centro per linsegnamento e la ricerca, nonch spazio a disposizione di diversi pubblici potenziali, compreso quello alla ricerca di intrattenimento: dunque un nuovo museo nel pieno senso del termine.Quai Branly (Africa, Asia, Oceania and Americas Arts and Civilization National Museum in Paris, opened in 2006 is analyzed from a semiotic point of view as a great device for cultural recognition and communication in its different components - architectural, landscape and exhibitions display. Its about a space that builds itself as innovative and that invests on the integration among collections and new communication technologies. The museum aims to state the value of cultures diversity and build a space for possible dialogues among them - besides the exhibition of exceptional artifacts copies. Not only the museum - but also a center for teaching and researching, - the space is available for several potential audiences, including that one that searches for entertainment: therefore, a new museum on its definitions strict sense.

  15. Filosofia della fisica

    CERN Document Server

    1997-01-01

    Un libro che mancava : attraverso i contributi dei maggiori specialisti italiani, la definizione rigorosa di una disciplina, la filosofia della fisica, che si pone nel punto d'incontro tra la cultura scientifica e quella umanistica.

  16. Genesis and classification of the soils developed from the sediments of the former Oleszek mill pond basin (the Chełmińskie Lakeland, N Poland / Geneza i pozycja systematyczna gleb wykształconych z osadów niecki dawnego stawu młyńskiego Oleszek (Pojezierze Chełmińskie

    Directory of Open Access Journals (Sweden)

    Mendyk Łukasz

    2015-03-01

    Full Text Available Budowa i funkcjonowanie młynów wodnych znacznie wpłynęły na przekształcenie środowiska przyrodniczego w ich otoczeniu, przede wszystkim na zmiany rzeźby terenu i warunków wodnych. Obszar badañ obejmuje nieckę dawnego stawu młyńskiego Oleszek w okolicach wsi Borówno, w zachodniej części Pojezierza Chełmińskiego, około 20 km na północny wschód od Torunia. Celem badañ było określenie genezy gleb wykształconych z osadów zakumulowanych w niecce dawnego stawu młyńskiego Oleszek. Pięć profili glebowych w transekcie o długości około 550 m zlokalizowanym wzdłuż Strugi Rychnowskiej stanowiącej oś podłużną niecki. Wszystkie przeanalizowane gleby zbudowane są z osadów wypełniających nieckę dawnego stawu młyńskiego. Gleby w opisywanej niecce powstały w wyniku wielu nakładających się procesów, takich jak: proces mułotwórczy, aluwialny, koluwialny oraz glejowy. Dwa z analizowanych profili glebowych (profile 3 i 4 spełniaj¹ kryteria wydzielania gleb organicznych limnowych typowych (Systematyka gleb Polski 2011. Jako pozycję systematyczną kolejnych dwóch gleb (profile 2 i 5 zaproponowano gleby mułowate. W związku z problemami klasyfikacyjnymi dotyczącymi tego typu gleb, przy opracowaniu aktualizacji Systematyki gleb Polski należałoby wprowadzić w typie gleb glejowych podtyp gleb mułowatych lub mułowato-glejowych, obejmuj¹cy gleby wytworzone z mineralno-organicznych utworów aluwialno-mułowych. Cztery wymienione powyżej profile zostały zaklasyfikowane jako Histosols (3 i 4 i Gleysols (2 i 5 według klasyfikacji WRB (2014. Jednostki glebowe wykształcone z osadów aluwialnych (mady wg SgP 2011 lub Fluvic Phaeozems wg WRB 2014 występują w proksymalnej części stawu (cofce.

  17. Dal ricordo al racconto. Origine e alterazione della memoria in Tristano muore

    Directory of Open Access Journals (Sweden)

    Alessandro Ceteroni

    2013-06-01

    Full Text Available Quando in un romanzo il materiale narrativo coincide interamente con la memoria del personaggio, diviene necessario chiedersi come si stabilisca il grado di verità della sua testimonianza. In questo articolo cercheremo di ricostruire i processi psichici che determinano la percezione e la rielaborazione dell’esperienza da parte di Tristano, cercando di spiegare in che modo i ricordi si originino, si alterino e si organizzino in quel racconto orale, che lo scrittore/testimone avrà il compito di tradurre in forma scritta.

  18. disegnare con ... Alberto Pratelli

    Directory of Open Access Journals (Sweden)

    Roberto Mingucci

    2017-12-01

    Full Text Available Con questa breve intervista ad Alberto Pratelli, (non a caso scelto per aprire questa nuova rubrica intendia-mo inaugurare un dialogo con personalità significati-ve del Disegno di Architettura, che consenta riflessioni dedicate alle sue varie dimensioni, oggi più che mai da approfondire. La suggestione a farlo, viene da un’idea di Pablo Rodri-guez Navarro ed abbiamo quindi pensato di avviarla proprio in questo numero, che Pablo ha accettato di curare su un tema a lui particolarmente caro.

  19. 23 000 000 a.C. - 2014 d.C.Natura e architetture nell’arcipelago di La Maddalena

    Directory of Open Access Journals (Sweden)

    Andrea Grippo

    2014-12-01

    Full Text Available Esistono zone d’indeterminazione concettuale, percettiva, emozionale che l’uomo traduce spontaneamente in articolazioni spaziali dialettiche. Per renderle più comprensibili e al tempo stesso più ambigue, le carica d’immagini che sono tanto più forti quanto più sono sganciate da una diegesi riconoscibile. Questo le fa galleggiare nel senso senza che debbano sforzarsi di produrre senso, disarticolate, neutralizzanti. E proprio per questo riescono ad attivare nell’uomo una condizione di sospensione estatica, dentro il tempo e fuori dalla storia.

  20. Deborah Cadbury, Princes at War: The British Royal Family’s Private Battle in the Second World War

    OpenAIRE

    Baldoli, Claudia; Petrella, Luigi

    2017-01-01

    Le vicende della famiglia reale inglese durante la Seconda guerra mondiale sono al centro del libro di Deborah Cadbury, scrittrice di storia pluripremiata e per trent’anni producer della BBC. Il suo lavoro parte dalla crisi che condusse nel 1936 all’abdicazione di Edoardo VIII, che rinunciò al trono per sposare Wallis Simpson, e si snoda negli anni della crescente minaccia nazista in Europa. Il fratello minore Albert, che divenne re con il nome di Giorgio VI, pur afflitto dalla balbuzie e da ...

  1. “Patti di morte”. Internet, suicidi e la spettacolarità del crimine / "Pactes de mort." Internet, suicides et spectacularité du crime / “Pact of death”: Web, Suicides and the Crime Show

    OpenAIRE

    Mason C.

    2010-01-01

    Il Web è diventato davvero uno specchio per vanitosi? Giovani e adulti si cimentano in bravate, oscenità, per poi filmarsi e pubblicare il video. Anche il suicidio può venire facilitato dal Web: mentre in Giappone si sottoscrivono patti di morte con sconosciuti, in occidente ci si toglie la vita di fronte la webcam nella solitudine della propria stanza. Se nel paese orientale le persone cercano di fuggire da una società che le rifiuta, che accetta solo la maschera che mostrano in pubblico e n...

  2. Period Drama Men e altri oggetti del desiderio. Fanvidding 2.0

    Directory of Open Access Journals (Sweden)

    Donata Meneghelli

    2016-10-01

    Full Text Available Il saggio analizza una delle manifestazioni più diffuse e interessanti del media fandom, il remix audiovisivo, e i suoi rapporti con la serialità. Si tratta di una forma di appropriazione da parte dei fan che consiste – nella maggioranza dei casi – nel prelevare e (rimontare brevi sequenze tratte da fonti audiovisive mainstream (film, serie televisive, spesso accompagnandole con uno o più brani musicali. I video che scaturiscono da questa pratica, e che vengono condivisi su piattaforme di videosharing come YouTube o Vimeo, esplorano la fonte o le fonti in modi inediti.  Dopo una ricognizione che mette in luce il carattere strutturalmente seriale della pratica del fanvidding, ricostruendone la genesi e mostrandone gli sviluppi più recenti, in parallelo alle trasformazioni che negli ultimi anni hanno investito tanto la fisionomia del fandom quanto le tecnologie digitali, il saggio prende come corpus di riferimento i video prodotti nell’ambito delle comunità o da utenti/produttori che gravitano intorno al period drama. A partire da una discussione di alcune delle classificazioni e tipologie correnti (fake/fan trailer, redub, supercut…, e basandosi in parte sulle categorie proposte da Gérard Genette in Palimpsestes, vengono proposti tre criteri – relazione con la fonte, regime, logica – attraverso i quali analizzare i video prodotti dai fan. Tali criteri consentono di mettere a fuoco alcune questioni cruciali come l’atteggiamento degli utenti/produttori nei confronti della fonte, del materiale ri-assemblato, i potenziali effetti di ricezione, la funzione del commento musicale nell’ibridazione di generi e forme, la ripetizione come modalità fondamentale di espressione del desiderio ma anche come strumento di lettura critica, le implicazioni (e le contraddizioni di quella che è stata definita da Kristina Busse «estetica [meta] affettiva».

  3. Long term exposure to low dose neurotoxic pesticides affects hatching, viability and cholinesterase activity of Artemia sp.

    Science.gov (United States)

    Gambardella, Chiara; Nichino, Daniela; Iacometti, Camillo; Ferrando, Sara; Falugi, Carla; Faimali, Marco

    2018-03-01

    The brine shrimp Artemia was used as a model organism to test toxicity of several neuroactive pesticides (chlorpyrifos (CLP), chlorpyrifos oxon (CLP ox), diazinon (DZN), carbaryl (CBR)) following exposure to far below than lethal doses. Cysts were exposed to the pesticides in order to test a scenario similar to actual coastal environment contamination, by analyzing different responses. Cysts were rehydrated in water containing the pesticides at concentrations ranging from 10 -11 to 10 -5  M, for 72, 96 and 192 h, respectively. For these exposure times, morpho-functional and biochemical parameters, such as hatching speed and viability were investigated in the larvae together with cholinesterase (ChE) activity quantification and histochemical localization. Finally, ChE inhibition was also compared with conventional selective ChE inhibitors. Results showed that CLP ox and CBR caused a significant dose-dependent decrease in hatching speed, followed by high percentages of larval death, while CLP and DZN were responsible for irregular hatching patterns. In addition, the pesticides mostly caused larval death some days post-hatching, whereas this effect was negligible for the specific ChE inhibitors, suggesting that part of pesticide toxicity may be due to molecules other than the primary target. ChE activity was observed in the protocerebrum lobes, linked to the development of pair eyes. Such activity was inhibited in larvae exposed to all pesticides. When compared to conventional selective inhibitors of ChE activities, this inhibition demonstrated that the selected pesticides mainly affect acetylcholinesterase and, to a lesser extent, pseudocholinesterases. In conclusion, the brine shrimp is a good model to test the environmental toxicity of long term exposure to cholinergic pesticides, since changes in hatching speed, viability and ChE activity were observed. Copyright © 2018 Elsevier B.V. All rights reserved.

  4. Trasformazione urbana verso la mobilità dolce: il caso di Istanbul

    Directory of Open Access Journals (Sweden)

    Emilia Giovanna Trifiletti

    2008-12-01

    Full Text Available Nell’articolo si descrivono le recenti trasformazioni urbane della città di Istanbul in Turchia in relazione all’implementazione di aree pedonali e all’utilizzo di mobilità dolce. Il sistema trasportistico è stato ampliato ed integrato di recente ed in tempi molto brevi: nei soli ultimi due anni è stata potenziata la linea tranviaria, sono state inaugurate una funicolare ed una teleferica ed è stata realizzata una stazione di interscambio gomma-ferro, ponendo grande attenzione all’integrazione del trasporto su ferro e/o gomma con la mobilità pedonale. Allo stesso modo sono state implementate le linee marittime che collegano le diverse sponde della città ed integrate alle linee su ferro e su gomma. Lo sviluppo e la riqualificazione della città sono dunque stati guidati dalla trasformazione del sistema trasportistico che ha rappresentato il vero motore della riqualificazione urbana. L’antico quartiere di Sultanahmet è stato interamente riqualificato e collegato, attraverso la linea tranviaria veloce che lo attraversa interamente, al resto della città fino ai quartieri più periferici. Allo stesso modo nel quartiere di Beyoglu che, dopo l’indipendenza era caduto in totale rovina, ha riacquistato l’antica eleganza che lo connotava. Il viale dell’Indipendenza (antica Rue De Pera che attraversa tutto il quartiere è stato reso pedonale e con un tram vintage che percorre tutto il viale sono stati collegati il nodo di interscambio Taksim, dotato di metropolitana e funicolare, con il nodo di interscambio Tünel, dotato di tram veloce e trasporto su gomma. Nell’articolo si è inteso evidenziare come la riqualificazione urbana della città sia stata guidata da interventi integrati trasporto/territorio e come i risultati ottenuti, nel caso-studio, siano stati anche il frutto di politiche attente alla sicurezza sociale.

  5. Impact of the New Cooperative Medical Scheme on the trend of catastrophic health expenditure in Chinese rural households: results from nationally representative surveys from 2003 to 2013.

    Science.gov (United States)

    Xie, Biao; Huo, Minghe; Wang, Zhiqiang; Chen, Yongjie; Fu, Rong; Liu, Meina; Meng, Qun

    2018-02-08

    To evaluate the trend of catastrophic health expenses (CHE) for inpatient care in relation to the commencement of the New Cooperative Medical Scheme (NCMS) in rural China from 2003 to 2013, and the roles of NCMS in protecting affected households from CHE. We assessed the 10-year trend of the incidence and severity of CHE in rural households with hospitalised members using data from the Chinese National Health Services Survey. Generalised estimating equations were used to estimate the OR and 95% CI of the association between incidence rates of CHE ([Formula: see text]) and NCMS reimbursement. The incidence and severity of CHE after NCMS reimbursement both decreased and their changes increased rapidly from 2003 to 2013. After adjustment of the covariates, [Formula: see text] before reimbursement was significantly higher than that after reimbursement, and the OR (95% CI) was 1.50 (1.24 to 1.81), 1.79 (1.69 to 1.90) and 2.94 (2.77 to 3.11) in 2003, 2008 and 2013, respectively. The incidence and severity of CHE both reduced after NCMS reimbursements in each year. Excluding some confounding factors, [Formula: see text] was significantly associated with NCMS reimbursement. NCMS partly protected the rural households with hospitalised members from CHE. However, the inequalities between different income groups still existed. [Formula: see text] in rural households with hospitalised members was still rather high in 2003, 2008 and 2013 even though they were covered by NCMS. This study will provide suggestions for further reforms in China and guidance for other low-income/middle-income countries. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  6. Characterizing biological variability in livestock blood cholinesterase activity for biomonitoring organophosphate nerve agent exposure

    Energy Technology Data Exchange (ETDEWEB)

    Halbrook, R.S.; Shugart, L.R.; Watson, A.P.; Munro, N.B.; Linnabary, R.D. (Environmental Sciences Division, Oak Ridge National Laboratory, TN (United States))

    1992-09-01

    A biomonitoring protocol, using blood cholinesterase (ChE) activity in livestock as a monitor of potential organophosphate nerve agent exposure during the planned destruction of US unitary chemical warfare agent stockpiles, is described. The experimental design included analysis of blood ChE activity in individual healthy sheep, horses, and dairy and beef cattle during a 10- to 12-month period. Castrated and sexually intact males, pregnant and lactating females, and adult and immature animals were examined through at least one reproductive cycle. The same animals were used throughout the period of observation and were not exposed to ChE-inhibiting organophosphate or carbamate compounds. A framework for an effective biomonitoring protocol within a monitoring area includes establishing individual baseline blood ChE activity for a sentinel group of 6 animals on the bases of blood samples collected over a 6-month period, monthly collection of blood samples for ChE-activity determination during monitoring, and selection of adult animals as sentinels. Exposure to ChE-inhibiting compounds would be suspected when all blood ChE activity of all animals within the sentinel group are decreased greater than 20% from their own baseline value. Sentinel species selection is primarily a logistical and operational concern; however, sheep appear to be the species of choice because within-individual baseline ChE activity and among age and gender group ChE activity in sheep had the least variability, compared with data from other species. This protocol provides an effective and efficient means for detecting abnormal depressions in blood ChE activity in livestock and can serve as a valuable indicator of the extent of actual plume movement and/or deposition in the event of organophosphate nerve agent release.

  7. Ethos, persona e autorità

    Directory of Open Access Journals (Sweden)

    Christian Plantin

    2012-11-01

    Full Text Available Che cosa è l’ethos e che ruolo ha nell’argomentazione? al di là delle rilevanti relazioni tra i concetti di ethos e logos (l’ethos consiste principalmente di un processo discorsivo che costruisce la persona e tra ethos e pathos (l’ethos necessariamente muove, il contributo prende le mosse dagli usi polisemici della parola ethos, che sembra aver sostituito la parola personalità nel lessico dell’argomentazione. La ‘persona’ viene analizzata da tre punti di vista: in primo luogo, in quanto origine del discorso, l’ethos può avere il ruolo di prova ed essere persuasivo nella misura in cui la persona appare esperta e onesta. Quindi si analizza la distinzione tra ethos tecnico (un risultato del discorso ed extra-tecnico (il carisma. In secondo luogo, la persona è l’oggetto del discorso che condiziona l’esistenza di determinate linee (tematiche nella costruzione testuale. Infine, la persona è il destinatario del discorso: il tipo di ascoltatore determina premesse e argomenti. I modelli critici rifiutano l’autorità come se fosse una contaminazione: qui si accoglierà la sfida di pensare l’argomentazione quale attività in contesto al fine di determinare le condizioni di un uso accettabile dell’autorità. Per fare questo, si argomenterà contro un ethos invasivo dal punto di vista retorico, quindi contro l’autoritarismo. Il contesto ci indica le condizioni sociali specifiche, come le norme legali, che vincolano attraverso la forza di istituzioni convenzionali.

  8. La portata etica della tragedia tra Bernard Williams e Martha Nussbaum

    Directory of Open Access Journals (Sweden)

    Francesco Testini

    2015-11-01

    Full Text Available Questo breve scritto si propone di ripercorrere sinteticamente alcuni nodi fondamentali del dibattito filosofico tra Bernard Williams e Martha Nussbaum sul significato e sul valore etico della rappresentazione tragica non tanto all’interno del mondo greco quanto per la contemporaneità. Il campo su cui questa analisi intende muoversi è delimitato principalmente da due testi fondamentali come Vergogna e Necessità e l’introduzione alla nuova edizione del 2001, insieme alla prima parte, de La fragilità del bene. Si cercherà di mostrare lo scarto tra queste due diverse concezioni riconducendo ad ognuna il particolare atteggiamento etico che sostiene; di questi diversi punti di vista si cercherà di ricostruire il nesso con le differenti interpretazioni che i due autori forniscono dell’Agamennone di Eschilo e con le diverse reazioni che motivano nei confronti del protagonista e della sua vicenda. Gli obiettivi delle argomentazioni che seguono sono principalmente due: innanzitutto evidenziare come in alcune delle critiche mosse dalla filosofa americana al collega britannico siano rinvenibili spunti fondamentali per quella che si ritiene una più completa comprensione della tragedia come caso limite del conflitto tra soggetto etico e mondo e, in secondo luogo, produrre una giustificazione filosofica ulteriore della reazione motivata da Nussbaum davanti alla condotta di Agamennone che sia compatibile con l’approccio di Williams attraverso una riproposizione del conflitto di valori in termini di conflitto di ruoli.

  9. Hip, cool, edgy, ovvero la logica culturale dominante del capitalismo neoliberista

    Directory of Open Access Journals (Sweden)

    Timothy Taylor

    2017-05-01

    Full Text Available Nel 1984 Fredric Jameson ha pubblicato il saggio Postmodernismo, ovvero la logica culturale del tardo capitalismo, che ha esercitato un’enorme influenza nel dibattito contemporaneo e che propone una chiave di lettura della produzione culturale nell’era del tardo capitalismo. La sua interpretazione del postmodernismo come “logica culturale dominante” è stata ampiamente citata e ripresa, ma in ultima analisi è stata anche depotenziata dall’uso eccessivo del termine “postmoderno”, che ha relegato in secondo piano la portata originaria del pensiero di Jameson. Oggi, la logica culturale dominante viene descritta attraverso i termini “hip” e “cool”: due aggettivi onnipresenti nell’industria culturale, ma che raramente vengono definiti con precisione. Mentre il termine “hip” sembra avere una storia più lunga e una connotazione ironica, il termine “cool” suggerisce significati simili, ma più strettamente legati alla generazione dei giovani. Negli Stati Uniti, l’egemonia di questa logica culturale è il risultato del predominio delle industrie pubblicitarie e del marketing, che negli anni Sessanta si sono appropriate di questi termini a partire dalla generazione dei baby-boomers. La pratica del coolhunting (“caccia al cool” oggi è diventata un’industria dominante che si riflette nella produzione e nel consumo di qualunque merce, e dunque anche dei beni culturali come la musica. Questo articolo vuole offrire alcuni spunti iniziali per una teorizzazione delle categorie di “hip” e “cool”, intese come elementi dominanti della logica culturale del capitalismo neoliberista.

  10. Disturbi mentali come complex network : Un’ introduzione e una panoramica all’ approccio network in psicopatologia

    NARCIS (Netherlands)

    Nuijten, M.B.; Deserno, Marie K.; Cramer, A.O.J.; Costantini, Giulio; Borsboom, Denny

    2016-01-01

    I disturbi mentali sono stati tradizionalmente concepiti come variabili latenti, che hanno un impatto sulla sintomatologia osservabile. Approcci alternativi proposti più recentemente invece concepiscono i disturbi mentali come sistemi di sintomi che si rinforzano vicendevolmente. Tali approcci

  11. RMQ13 – Commedia Quantistica Relativistica: un Teatro per la Scienza

    Directory of Open Access Journals (Sweden)

    Carlo Cosmelli

    2014-12-01

    Full Text Available Nel presente articolo si vogliono discutere brevemente le caratteristiche dei ‘prodotti’ che si possono trovare e che vengono catalogati usualmente come ‘Teatro Scienza’. In particolare ci si soffermerà sul tipo di spettacolo che esula dal semplice excursus storico di un fatto di rilevanza scientifica, o dalle vicende personali di una persona di scienza, così come dagli spettacoli che si dichiarano specificatamente didattici. Lo spettacolo tipo di cui si parlerà sarà uno spettacolo che, tralasciando le esemplificazioni formali, vuole trasmettere emozioni e idee scientifiche. Nello specifico verrà analizzato un esperimento in corso da due anni alla Sapienza nell’ambito del Corso di Laurea in Arti e Scienze dello Spettacolo. This article aims at analysing the features of works that come under the label of ‘Science Theatre’, not only in terms of plays that depict a scientific event or a scientist’s biography, but especially the ones that try to convey scientific emotions and ideas. The case study will focus on an experiment that has been carried for two years as part of BA course in Performing Arts at Sapienza Università di Roma.

  12. Com'è andata? Raccontami

    Directory of Open Access Journals (Sweden)

    Paola Frezza

    2006-09-01

    Full Text Available La narrazione di sé ha a che fare con la ricerca della propria identità e con l’insolubile paradosso del “sono sempre lo stesso ma sono anche diverso”. E’ attraverso il confronto fra il mio “essere oggi” e “ l’essere stato nel passato” che può rinascere una soggettività nuova. Il discorso che si esprime a questo punto spesso è un discorso fatto di frammenti, di accenni di eventi che non hanno collocazione, di emozioni non filtrate al pensiero, di azioni inconsapevoli, di necessità impellenti. Inizia così un discorso, non più un monologo, in cui si incontrano narrazione, l’analisi delle ragioni, degli obiettivi, degli strumenti e soprattutto della molteplicità delle esperienze per costruire e ricostruire il filo delle esperienze che sono generatrici di identità personali sociali lavorative e proiettarle così in futuro possibile. Tutto questo si verifica se si innesca il processo di autoapprendimento, in cui l’utente impara a riposizionare autonomamente le sue esperienze, creando interconnessioni tra ieri ed oggi e coniugando la dimensione soggettiva con la realtà esterna.

  13. Conversioni mitobiografiche: l’esperienza del mondo nella narrazione di sé e dell’altro

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2011-04-01

    Full Text Available L’autobiografia come processo di evocazione e messa in scena della vita (bíos nel movimento della scrittura (gráphein che prende forma a partire da noi stessi (autos, è desiderio di creazione (poiein di sé (autos, processo di creazione di ordine mitobiografico. Proponendo questa definizione per collegare il movimento della scrittura di sé con il processo di creazione di sé, vorrei ricordare il celebre motto inciso sul tempio dell’Oracolo di Delfi: “In te si trova occulto il tesoro degli Dei. Oh Uomo, conosci te stesso e conoscerai l’Universo e gli Dei”. Valorizzando il movimento vitale della vita degli individui attraverso le biografie dell’antica Grecia, l’arte della maieutica manifesta una conoscenza che dispiega l’individuo nella coscienza del mondo e delle sue divinità. Questa riflessione ci permette di considerare le scritture di persone ordinarie come organizzazione metaforica del movimento della scrittura di sé, un movimento che instaura una coscienza mitica nell’organizzazione omologica di pensieri e sentimenti che ci rivelano il flusso del fondo dell’immaginario di un’epoca che prende forma.

  14. Gazes and Bodies in the Pornographies of Desire

    Directory of Open Access Journals (Sweden)

    Mirko Lino

    2013-06-01

    Full Text Available Il saggio propone una lettura sociale della pornografia cinematografica usando la categoria dello sguardo e le sue declinazioni di genere. Partendo dal famoso saggio di Laura Mulvey, Visual Pleasure and Narrative Cinema (1975, si sposterà il centro dell’analisi dal cinema narrativo tradizionale al cinema pornografico, considerando quest’ultimo un modello che fa contrappunto al voyeurismo dello sguardo maschile (male gaze che la Mulvey riscontrava in alcuni film di Sternberg e di Hitckcock. Per dimostrare la natura contrappuntistica del cinema pornografico si metterà a confronto la medesima messa in scena di uno sguardo che desidera in due film molto differenti tra loro, Rear Window (1954 di Hitchcock e Behind the Green Door (1972 dei fratelli Mitchell. La natura contrappuntistica del porn movie si rintraccia anche nel dialogo che instaura con il cinema mainstream riguardo ai limiti del visibile in materia sessuale. Infine, la pornografia soddisfa la rappresentazione del desiderio delle altre identità di genere, mettendo in scena tipologie di sguardo adeguate – female gaze e queer gaze –, che diventano presto strumenti per una affermazione sociale della diversità sessuali.

  15. Mediamorfosi del romanzo popolare: dal 'feuilleton' al serial TV

    Directory of Open Access Journals (Sweden)

    Emanuela Piga

    2014-12-01

    Full Text Available Nel 1964, in Apocalittici e integrati Umberto Eco affermava che se l’errore degli apologeti della cultura di massa era di ritenere che la moltiplicazione dei prodotti dell’industria fosse di per sé buona, al contrario, “l’errore degli apocalittici-aristocratici” era di pensare che la cultura di massa fosse radicalmente cattiva proprio per la sua natura di “fatto industriale”, come se si potesse dare cultura al di fuori del condizionamento industriale. In una prospettiva che guarda all’evoluzione storica dei supporti mediali che accolgono e formano l’espressione dell’immaginazione, l’intento qui è di soffermarsi su un’analogia, da più parti riscontrata, tra le forme narrative del romanzo ottocentesco e alcune contemporanee serie televisive. Senza mirare a definire integralmente il rapporto tra le diverse sfere del letterario e del televisivo, lo scopo di questo contributo è  di riflettere sulle trasformazioni del romanzo popolare attraverso epoche e media, a partire dal romanzo ottocentesco Les Mystères de Paris (Eugène Sue e dal contemporaneo Serial TV Lost (J.J. Abrams, D. Lindelof, J. Lieber, C. Cuse.

  16. Serum cholinesterase activity in infantile and juvenile spinal muscular atrophy.

    Science.gov (United States)

    Niebroj-Dobosz, I; Hausmanowa-Petrusewicz, I

    1989-09-01

    Serum acetylcholinesterase (AChE) and pseudocholinesterase (ChE) activity in infantile and juvenile spinal muscular atrophy (SMA) was determined. The total AChE activity was either normal or decreased in the childhood SMA (Type 1), the other SMA groups and disease controls (ALS, X-linked SMA). In the majority of SMA Type 1 cases (6/7 tested) an absence of the asymmetric A12 form was found. This was accompanied by changes in the other asymmetric and globular forms. The latter was, however, not specific for SMA Type 1 cases. The ChE activity was increased in the majority of SMA cases as well as disease controls. The asymmetric A12 ChE form was increased in all SMA Type 3 cases, the values of this form in SMA Type 1 was variable. A change in the ChE globular forms in SMA Type 1 and SMA Type 2 was a frequent finding. It is suggested that the absence of the asymmetric A12 AChE form in SMA Type 1 arises because of muscle cell immaturity and undeveloped muscle-nerve interactions. The reason of ChE changes is obscure.

  17. Evaluation the protective effect of diphenhydramine against acute toxicity induced by levamisole in male mice

    Directory of Open Access Journals (Sweden)

    M.Y. Matti

    2015-06-01

    Full Text Available The aim of this study was to evaluate the protective effect of different doses of diphenhydramine against acute toxicosis with Levamisole. The Mechanism of levamisole induced acute toxicity and that of protective effect of diphenhydramine against Levamisole toxicosis also examined on the level of cholinesterase (ChE activity. Subcutanous injection of 100mg/kg levamisole in male mice with induced cholinergic over stimulation and death in 100% of animals. The Toxicosis was not related to the significantly decreased in plasma, red blood cells and brain ChE activity. Injection low dose of diphenhydramin 2.5mg/kg S.C. 15 min before levamisole produced protective effect against acute toxicity with levamisole. Significantly decreased the severity of toxicosis and increased survival rates to 100%. Diphenhydramine at low dose alone or with acute dose of levamisole did not Produced Significantly inhibition in ChE activity.The data suggested that the toxic effect of Levamisole was not related to inhibition of ChE. The low dose of diphenhydramine protected mice from Levamisole toxicity. The antidoatal effect of diphenhydramine not at the level of protection from ChE inhibition. There was no adverse interaction between two drugs.

  18. Tangible Earth: Information design and “natural” disasters

    Directory of Open Access Journals (Sweden)

    Mara Benadusi

    2017-01-01

    Full Text Available L’articolo analizza i processi di visualizzazione dei rischi che contraddistinguono le politiche globali di riduzione dei disastri, in particolare i manufatti digitali attraverso cui il mondo internazionale coinvolto nella gestione delle catastrofi cerca di visualizzare e rendere esperibile le minacce che incombono sul pianeta. Tali manufatti sono costruiti per facilitare esperienze capaci di offrire al tempo stesso evidenza quantitativa e corpo sociale alla natura dei rischi globali. Tangible Earth, il primo globo digitale interattivo, è il più sofisticato di simili artefatti perché ha l’ambizione di catturare un vasto ed eterogeneo pubblico di umani, chiamati a ricoprire il ruolo di coproduttori dei rischi che investono la Terra. Varie ontologie sono messe a confronto per sondare l’esperienza del globo terrestre mediata dalle apparecchiature digitali: da un lato, un’ontologia naturalista, che rappresenta la natura nella sua discontinuità rispetto al sociale, come forza sempre insorgente e imprevedibile nonostante gli sforzi di catturarla quantitativamente con la strumentazione di monitoraggio terrestre e il calcolo probabilistico; dall’altro, un’ontologia analogista in cui la natura diventa invece indistinguibile dal sociale in nome di una comune propensione alla resilienza tanto dei collettivi umani che dei non umani.

  19. Photon technology. Hard photon technology; Photon technology. Hard photon gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    Research results of hard photon technology have been summarized as a part of novel technology development highly utilizing the quantum nature of photon. Hard photon technology refers to photon beam technologies which use photon in the 0.1 to 200 nm wavelength region. Hard photon has not been used in industry due to the lack of suitable photon sources and optical devices. However, hard photon in this wavelength region is expected to bring about innovations in such areas as ultrafine processing and material synthesis due to its atom selective reaction, inner shell excitation reaction, and spatially high resolution. Then, technological themes and possibility have been surveyed. Although there are principle proposes and their verification of individual technologies for the technologies of hard photon generation, regulation and utilization, they are still far from the practical applications. For the photon source technology, the laser diode pumped driver laser technology, laser plasma photon source technology, synchrotron radiation photon source technology, and vacuum ultraviolet photon source technology are presented. For the optical device technology, the multi-layer film technology for beam mirrors and the non-spherical lens processing technology are introduced. Also are described the reduction lithography technology, hard photon excitation process, and methods of analysis and measurement. 430 refs., 165 figs., 23 tabs.

  20. Enzo Croatto, Vocabolario ampezzano, Cortina d'Ampezzo, 1986; XXX + 426 pagine.Enzo Croatto, Vocabolario ampezzano, Cortina d'Ampezzo, 1986; XXX + 426 pagine

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    1997-12-01

    Full Text Available Il  prof. Enzo Croatto si dichiara solo coordinatore di questo vocabolario, ma i  suoi meriti non sono pochi. E' vero che ha raccolto oltre alle inchieste dirette anche fonti già pubblicate, soprattutto il vocabolario di Angelo Majoni, pubblicato nel lontano 1929, che ottenne delle lodi da parte del grande conoscitore del lessico e della vita nelle Dolomiti che fu Carlo Battisti; però ha arricchito il vocabolario aggiungendo le inchieste dirette e anche i materiali dell'AIS e del (mai pubblicato ALI, nonché il materiale che contiene il Vocabolario provvisorio della parlata ampezzana, pubblicato nei fascicoli tra il 1974 e il 1977. Il vocabolario fornisce anche informazioni grammaticali, ad es. sulla formazione del plurale dei nomi o sulle forme verbali le quali, per i così detti verbi irregolari, appaiono per intero

  1. L'espressione del passato nei quotidiani delle lungue balcaniche*

    Directory of Open Access Journals (Sweden)

    Momčilo D. Savić

    1974-12-01

    Full Text Available È inutile sottolineare che le lingue parlate dai popoli della Penisola balca­ nica vanno d'accordo in molti punti, pur non avendo la stessa origine. Le affinita in questione sono dovute tanto alla simbiosi quanto alia convivenza prolungatasi a un periodo plurisecolare. Però se non è sempre possibile de­ terminare i confini etnici di un popolo balcanico (cosa che trova riscontro anche altrove, non è neanche meno facile segnarne i rispettivi limiti linguistici. Senza dubbio, possi.amo supporre chela situazione in questo campo fosse molto piu complicata nei secoli scorSii, essendosi costituite le nazioni vere e proplie appena con le rivoluzioni borghesi, e specialmente se ricordiamo che in certe zone dei Balcani continuano ad essere applicate più lingue e che vi incontriamo oggi stesso un numero non insignificante di persone bilingui ovvero plurilingui.

  2. Socialmedia in formal and informal education between potentialities and reality

    Directory of Open Access Journals (Sweden)

    Neil Selwyn

    2012-04-01

    Full Text Available Negli ultimi dieci anni lo sviluppo dei social media ha trasformato i modi in cui la maggior parte delle persone usa Internet. Di conseguenza molte istituzioni educative (ed educatori si ritrovano a doversi mettere al passo con questo mondo e con i suoi utenti. Dato il pressante ed esagerato interesse che circonda quest’area della tecnologia, è importante che gli educatori siano in grado di avvicinarsi ai social media in modo consapevole e competente. Le domande che questo articolo di apertura solleva sono necessariamente dirette: quali sono le caratteristiche chiave dei social media e che importanza questi rivestono oggi per l’educazione e l’apprendimento? Quali limiti impongono e quali opportunità offrono? Quali cambiamenti devono subire i processi educativi per mantenere la propria rilevanza in un’era digitale in apparente rapida evoluzione?

  3. 'Mind and Body Walls’ in Goliarda Sapienza, Pina Bausch and Francesca Woodman's works

    Directory of Open Access Journals (Sweden)

    Alessandra Trevisan

    2017-12-01

    Full Text Available Un itinerario tematico che propone un tracciato innovativo fra letteratura, teatrodanza e fotografia. Alcune peculiarità pertinenti alle tre autrici coinvolte saranno dimostrate intersecando più arti in dialogo fra loro: oltre alle citate, anche il cinema, la filosofia e l’architettura. Cogliendo gli aspetti più salienti del contesto culturale in cui Bausch, Sapienza e Woodman si trovarono a vivere e a operare, ricomponendo e talvolta oltrepassando ciò che soggiace al loro “sistema”, guardando alla biografia e all’autobiografia oltre che alla loro opera, servendosi quindi di interpretazioni che aprono a possibilità nuove e mai esplorate, si ricostruisce l’anatomia di un “corpo tragico” – nucleo centrale dell’articolo – allo stesso tempo singolare e plurale. Esso rivela, infatti, in ogni campo di azione, specificità intertestuali inedite.

  4. Funzioni del tempo presente nella strategia narrativa

    Directory of Open Access Journals (Sweden)

    Aleksandra Koman

    2017-08-01

    Full Text Available La scelta del tempo verbale adatto a una determinata situazione dipende dal rapporto tra il momento dell’avvenimento e quello dell’enunciazione. Se coincidono abbiamo a che fare con il tempo presente (Bertinetto. È necessario, però, ricordare che il presente è in grado di riferirsi agli eventi passati come accade spesso nei testi narrativi. Per capire lo scopo di questa scelta si sono analizzati diversi tipi di scrittura comprovanti che il presente nella narrativa può servire a sottolineare la posizione temporale del narratore (Il fu Mattia Pascal; a evidenziare un momento importante dal punto di vista dello svolgimento dell’azione (Se questo è un uomo; a costruire descrizioni (Vita oppure far entrare il lettore nel vivo del racconto (Gli Italiani in Polonia nei secoli, dando l’impressione che egli sia un testimone diretto degli eventi raccontati.

  5. Afterword: A view from African cities

    Directory of Open Access Journals (Sweden)

    Pino Schirripa

    2016-08-01

    Full Text Available La diffusione del pentecostalismo e la crescita degli aderenti ha assunto negli ultimi decenni dimensioni considerevoli che ne hanno fatto il movimento cristiano a più altro tasso di crescita a livello mondiale. Sebbene conosca una sua diffusione anche nelle aree rurali, è in quelle urbani che conosce uno sviluppo maggiore. Tra i fattori che ne hanno favorito la diffusione vi è certamente la flessibilità dell'idioma pentecostale che permette di adattarsi ai vari contesti locali. Diversi studiosi hanno evidenziato come versioni oggi più in crescita del pentecostalismo presentino nella dottrina, nelle predicazioni e nelle pratiche elementi coerenti con la prospettiva neoliberista oggi egemonica in larga parte del pianeta. Partendo dagli articoli presenti in questa sezione, il contributo intende riflettere su queste questioni, concentrandosi principalmente sul fenomeno per come si presenta nelle aree urbane.

  6. RICERCHE DI STATISTICA METEOROLOGICA

    Directory of Open Access Journals (Sweden)

    EZIO ROSINI

    1956-06-01

    Full Text Available statistica
    non ha goduto di buona stampa nel passato anche recente; particolarmente
    poco apprezzata è stata la statistica meteorologica e climatologica.
    Occorre riconoscere che tale atteggiamento era almeno in
    parte frutto di un preconcetto errato sul significato della statistica, ma
    che d'altra parte la natura dei lavori di tal genere che venivano alla
    luce sembrava a volte confermare la giustezza del preconcetto. Il fatto
    è che una parte degli studiosi di meteorologia avvertiva più di altri,
    probabilmente per la propria stessa costituzione mentale, l'astrattezza
    dei metodi fisico-matematici applicati alla grandiosa e al tempo stesso
    minuta complessità dei fenomeni meteorologici, sentendo dunque maggiormente
    la necessità di far costante ricorso alla realtà delle osservazioni
    effettivamente eseguite.

  7. Il modello parametrico in architettura: la tecnologia B.I.M. di Autodesk Revit

    Directory of Open Access Journals (Sweden)

    Simone Garagnani

    2011-06-01

    Full Text Available Revit è il software di Autodesk destinato al mondo delle costruzioni, che permette ad architetti, progettisti e ingegneri di produrre e documentare in maniera coerente e coordinata un edificio, dalla fase concettuale alla realizzazione esecutiva. In questo contributo verranno analizzate le peculiarità che fanno di Revit un modellatore B.I.M., attraverso cui è possibile generare il modello virtuale di una costruzione per mezzo di “elementi intelligenti” che interagiscono con l’ambiente di progetto. La maturità raggiunta da Revit negli ultimi anni ha permesso ad un numero sempre maggiore di studi professionali di abbandonare ambienti CAD più generalisti, paragonabili ai classici tecnigrafi tradizionali, in favore di un contesto integrato che agevola l’interscambio informativo tra le discipline coinvolte nel processo edilizio, seppure con alcune criticità ancora da superare.

  8. Il concetto di storia della lingua nell'opera grammaticale di Benedetto Buommattei

    Directory of Open Access Journals (Sweden)

    Gunver Skytte

    1991-12-01

    Full Text Available Che la storia della lingua sia una disciplina linguistica di data recente, fondata nell'800, soprattutto grazie alle ricerche pionieristiche di insigni filologi tedeschi, è un'opinione comunemente accettata, ed essa è probabilmente anche giustificata attraverso la classificazione datane di disciplina. A questo dato di fatto si deve senz'altro l'opinione altrettanto estesa che prima dell'800 non esistesse il concetto di linguistica diacronica o cambiamento linguistico in senso scientifico, come pure quella non meno erronea che la linguistica, come scienza, sia stata fondata solo nell'800.

  9. Playware e robotica modulare per il gioco

    Directory of Open Access Journals (Sweden)

    Henrik H. Lund

    2009-01-01

    Full Text Available In questo contributo presentiamo e usiamo il concetto di building block robotico per la creazione di playware. Il concetto tecnologico di building block programmabili e dotati di input e output (ivi inclusa la comunicazione e dell'intelligenza artificiale embodied, che enfatizza la relazione fra morfologia e controllo.Per dare un esempio concreto del concetto di building block robotico, proponiamo le mattonelle che abbiamo creato, come elementi che compongono un nuovo tipo di campo giochi sul quale i bambini possono sperimentare un feedback immediato ai loro movimenti.

  10. Capitolo IV. Socialismo utopico?

    OpenAIRE

    Gatto, Marco

    2016-01-01

    Io devo stare nell’isolamento. È assolutamente assurdo credere che uno come me possa tanto facilmente rinunciare a tutto ciò che è e scomparire tra la massa. La massa riconosce ben presto queste balordaggini e ti distrugge o cerca comunque di distruggerti. La massa espelle una persona come me che si è messa nelle sue mani al cento per cento, senza pietà, come un corpo estraneo. Il mio posto non è tra la massa, se do retta alla massa il mio posto è dentro di me, se do retta a me stesso. Visto ...

  11. D. Felini (a cura di, Video game education. Studi e percorsi di formazione

    Directory of Open Access Journals (Sweden)

    Alex Tribelli

    2013-03-01

    Full Text Available Nei confronti di una trattazione scientifica dei videogame c’è tuttora qualche scetticismo. I pregiudizi, più volte denunciati, ancora hanno qualche sussistenza: persiste qualche analisi sociale che considera i videogame oggetti diabolici che provocano isolamento e comportamenti violenti nei teenager. Pur constatando una progressiva inversione di tendenza, Video game education. Studi e percorsi di formazione, curato da Damiano Felini, si propone di sgretolare la concezione che la società contemporanea ha dei videogame, dimostrando come questi oggetti mediali possono addirittura divenire uno strumento di formazione e crescita delle persone.

  12. Animali, uomini, mostri : tenerezze e orrori per un’anima sulla soglia

    OpenAIRE

    Maranini, Anna

    2010-01-01

    A partire dal simbolo dell’anima come raffi gurato in un’edizione cinquecentesca de l’Acerba di Cecco d’Ascoli, si offrono qui alcune testimonianze di ‘esseri volanti’ che si sono prestati a rappresentare l’anima che oltrepassa un limes, una soglia, a volte nella loro bona pars, a volte nella loro mala pars. Oltre ad associare l’anima ad animali che possiedono ali per natura o ad esseri alati immaginari, la letteratura medievale e rinascimentale ha dotato l’anima di ali anche quando l’ha raff...

  13. La spazialità dell’ascolto

    Directory of Open Access Journals (Sweden)

    Cristina Mattiucci

    2008-12-01

    Full Text Available Hanno sistemato il mio computer da una settimana... finalmente l’audio funziona di nuovo! Ora sì che va meglio. Arrivo e mi metto le cuffie, ancora prima di scorrere l’archivio sul mio desktop. È un gesto che fanno quasi tutti intorno a me. È come se cercassero un’altra stanza all’interno di questa grande stanza che condividiamo. Ognuno si ritaglia nello spazio delle proprie orecchie il posto dove vorrebbe essere, più congeniale al lavoro quotidiano o dove, più semplicemente, ci si concentri meglio.

  14. Il romanzo paterno in adolescenza: Laio dimenticato dalla psicoanalisi

    Directory of Open Access Journals (Sweden)

    Arturo Casoni

    2015-12-01

    Full Text Available Il Complesso di Edipo ha ricevuto dal movimento psicoanalitico, sempre o quasi, una declinazione che sceglieva come attori principali il figlio maschio e la madre, con l’intervento successivo del padre. Si è così costruita una sorta di mitologia eterosessuale di quel triangolo, lasciando aperto il lato che collega il figlio al padre. Si tenta qui di saldare la parte mancante, a partire dalla narrazione del mito e arrivando alle dinamiche psichiche che caratterizzano le famiglie contemporanee, con particolare attenzione alla clinica dell’adolescenza contemporanea. 

  15. Pubblica Amministrazione Direttore e Geomatica

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-03-01

    Full Text Available Topografo, rilevatore, fotogrammetrista, foto interprete, cartografo e non solo. Questi ed altri sono gli appellativi di specializzazioni e competenze professionali che ricadono nel campo della Geomatica il cui percorso formativo però, in Italia, non è ben chiaro. Si segue un corso da Geometra? Oppure una Laurea in Ingegneria e poi si segue un Master specialistico? E quali di questi corsi danno accesso a quella professione che nei termini anglosassoni viene identificata con la parola Surveyor? Domande che trovano difficile risposta nel quadro formativo attuale.

  16. Pubblica Amministrazione e Geomatica

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2007-03-01

    Full Text Available Topografo, rilevatore, fotogrammetrista, foto interprete, cartografo e non solo. Questi ed altri sono gli appellativi di specializzazioni e competenze professionali che ricadono nel campo della Geomatica il cui percorso formativo però, in Italia, non è ben chiaro. Si segue un corso da Geometra? Oppure una Laurea in Ingegneria e poi si segue un Master specialistico? E quali di questi corsi danno accesso a quella professione che nei termini anglosassoni viene identificata con la parola Surveyor? Domande che trovano difficile risposta nel quadro formativo attuale.

  17. Salts of Dodecamethylcarba-closo-dodecaborate(-) Anion, CB11Me12-, and the Radical Dodecamethylcarba-closo-dodecaboranyl, CB11Me12

    Czech Academy of Sciences Publication Activity Database

    Clayton, J. R.; King, B. T.; Zharov, I.; Fete, M. G.; Volkis, V.; Douvris, C.; Valášek, Michal; Michl, Josef

    2010-01-01

    Roč. 35, - (2010), s. 56-63 ISSN 0073-8077 Grant - others:NSF(US) CHE0446688; NSF(US) CHE0848477 Institutional research plan: CEZ:AV0Z40550506 Keywords : boron clusters * methylation * stable free radical Subject RIV: CF - Physical ; Theoretical Chemistry

  18. Virulence gene profiles of avian pathogenic Escherichia coli isolated from chickens with colibacillosis in Bulawayo, Zimbabwe

    Directory of Open Access Journals (Sweden)

    Joshua Mbanga

    2015-04-01

    Full Text Available Colibacillosis, a disease caused by avian pathogenic Escherichia coli (APEC, is one of the main causes of economic losses in the poultry industry worldwide. This study was carried out in order to determine the APEC-associated virulence genes contained by E. coli isolates causing colibacillosis in chickens. A total of 45 E. coli isolates were obtained from the diagnostics and research branch of the Central Veterinary Laboratories, Bulawayo, Zimbabwe. These isolates were obtained from chickens with confirmed cases of colibacillosis after postmortem examination. The presence of the iutA, hlyF, ompT, frz, sitD, fimH, kpsM, sitA, sopB, uvrY, pstB and vat genes were investigated by multiplex polymerase chain reaction (PCR assay. Of the 45 isolates, 93% were positive for the presence of at least one virulence gene. The three most prevalent virulence genes were iutA (80%, fimH (33.3% and hlyF (24.4%. The kpsM, pstB and ompT genes had the lowest prevalence, having been detected in only 2.2% of the isolates. All 12 virulence genes studied were detected in the 45 APEC isolates. Virulence gene profiles were constructed for each APEC isolate from the multiplex data. The APEC isolates were profiled as 62.2% fitting profile A, 31.1% profile B and 6.7% profile C. None of the isolates had more than seven virulence genes. Virulence profiles of Zimbabwean APEC isolates are different from those previously reported. Zimbabwean APEC isolates appear to be less pathogenic and may rely on environmental factors and stress in hosts to establish infection.

  19. Smart Parking Pricing: procedure per una sosta perequativa

    Directory of Open Access Journals (Sweden)

    Romano Fistola

    2009-05-01

    Full Text Available Il rapporto fra città e auto è in crisi da tempo e la difficile relazione è ancor più enfatizzata dalle difficoltà “respiratorie” che le moderne concentrazioni urbane manifestano quotidianamente. Secondo il IV Rapporto APAT sulla qualità dell’ambiente urbano in 13 aree urbane (sulle 18 monitorate si verifica un superamento delle soglie di PM10 e NO2 ammessi dalla legge. Come è noto il trasporto veicolare su strada rappresenta la principale fonte emissiva dei due pericolo di inquinanti. Considerando i livelli di inquinamento integrato (aria, rumore, OEM raggiunti dalle maggiori città italiane risulta chiaro come si debba concretamente ripensare il rapporto fra città e auto e pensare a scindere il connubio. Gran parte dell’esposione urbana è riconducibile al ridisegno del tessuto che, dalla rivoluzione industriale in poi, ha posto il veicolo a motore, eccezionale interprete della cultura futurista degli anni ‘30, Le politiche di contrasto e/o scoraggiamento messe in essere sono oramai consolidate in molte città mondiali. Il crescente ricorso al Road Pricing, in particolare nelle forme anglosassoni di Congestion Charge, evidenzia una diffusa tendenza ad avversare la penetrazione veicolare al centro urbano ed a respingere i flussi in aree di corona. Il convincimento che nella città, o perlomeno nelle sue parti centrali, si debba limitare fino a tentare di escludere la circolazione veicolare privata, è oramai convincimento diffuso anche degli amministratori. Va tuttavia considerato il rovescio della medaglia che riguarda la domanda insoddisfatta di mobilità da parte del Trasporto Pupplico Locale (TPL di molte città italiane. Per prefigurare qualche possibile soluzione appare quindi necessario ragionare in un’ottica nuova che consideri elementi quali: la polarizzazione effettiva dei flussi di mobilità da parte delle funzioni urbane, la disponibilità di sistemi di TPL in sede propria che rappresentino un

  20. Il popolo tra realtà politica e finzione ideologica

    Directory of Open Access Journals (Sweden)

    Roberto Gatti

    2012-10-01

    Full Text Available Ci si può chiedere quale sia il motivo che spinge ad affrontare la non facile prova consistente nel delineare un percorso di riflessione in chiave filosofica intorno al concetto di “popolo” prendendo in esame il periodo che va dalla prima alla tarda modernità, sino a sfiorare (almeno l’epoca della quale noi, uomini e donne del presente, siamo protagonisti, il più delle volte molto perplessi e parecchio disorientati.Il perché sta nel tentativo di mostrare che, per quanto questo lungo periodo sia, a proposito del nostro argomento, parecchio complesso e contraddistinto da un esteso pluralismo di punti di vista, presenta però, a mio avviso, almeno una caratteristica unitaria. Si tratta della difficoltà di articolare teoreticamente un concetto di “popolo” sul quale non gravino quei limiti sui quali vorrei concentrare l’attenzione: limiti ovviamente non secondari, ma tali da compromettere gravemente il concetto in questione.In tutto il tragitto che proverò a tracciare, non vorrei semplicemente procedere prendendo nota dei punti oscuri rinvenibili in questa o quella concezione di “popolo”, e così mettere in atto una sorta d’incolore e, tutto sommato, ridondante elenco che collochi uno dopo l’altro gli autori come in una galleria dei nobili fallimenti della filosofia politica dal ‘500 a oggi. La posta in gioco è ben diversa. La presento, per ora molto concisamente, come segue.Nel De republica di Cicerone – importante sintesi di una già consolidata tradizione – è evidente la corrispondenza concettuale tra “res publica” e “populus”: la società politica si dà solo in presenza di un’associazione tenuta insieme “per accordo nell’osservare la giustizia” e “per comunanza di interessi”. Il popolo, che si forma a causa della “naturale inclinazione a vivere bene” presente in ogni essere umano, esprime, nella sua unità etico-giuridica, il senso propriamente politico insito nel condurre un

  1. Catastrophic healthcare expenditure and poverty related to out-of-pocket payments for healthcare in Bangladesh-an estimation of financial risk protection of universal health coverage.

    Science.gov (United States)

    Khan, Jahangir A M; Ahmed, Sayem; Evans, Timothy G

    2017-10-01

    The Sustainable Development Goals target to achieve Universal Health Coverage (UHC), including financial risk protection (FRP) among other dimensions. There are four indicators of FRP, namely incidence of catastrophic health expenditure (CHE), mean positive catastrophic overshoot, incidence of impoverishment and increase in the depth of poverty occur for high out-of-pocket (OOP) healthcare spending. OOP spending is the major payment strategy for healthcare in most low-and-middle-income countries, such as Bangladesh. Large and unpredictable health payments can expose households to substantial financial risk and, at their most extreme, can result in poverty. The aim of this study was to estimate the impact of OOP spending on CHE and poverty, i.e. status of FRP for UHC in Bangladesh. A nationally representative Household Income and Expenditure Survey 2010 was used to determine household consumption expenditure and health-related spending in the last 30 days. Mean CHE headcount and its concentration indices (CI) were calculated. The propensity of facing CHE for households was predicted by demographic and socioeconomic characteristics. The poverty headcount was estimated using 'total household consumption expenditure' and such expenditure without OOP payments for health in comparison with the poverty-line measured by cost of basic need. In absolute values, a pro-rich distribution of OOP payment for healthcare was found in urban and rural Bangladesh. At the 10%-threshold level, in total 14.2% of households faced CHE with 1.9% overshoot. 16.5% of the poorest and 9.2% of the richest households faced CHE. An overall pro-poor distribution was found for CHE (CI = -0.064) in both urban and rural households, while the former had higher CHE incidences. The poverty headcount increased by 3.5% (5.1 million individuals) due to OOP payments. Reliance on OOP payments for healthcare in Bangladesh should be reduced for poverty alleviation in urban and rural Bangladesh in order to

  2. Book review. La forma degli animali. Adolf Portmann

    Directory of Open Access Journals (Sweden)

    Manuel Graziani

    2013-09-01

    Full Text Available Nel 1931 il biologo Adolf Portmann era già talmente noto a livello internazionale per le sue ricerche da guadagnarsi la cattedra in zoologia nell'università della sua città natale, Basilea, all'età di appena 34 anni. All'attività di docente universitario ha sempre affiancato un'originale riflessione sul significato delle scienze della vita, imponendosi come una delle figure chiave nel dibattito tra biologia teoretica, estetica e antropologia filosofica. La forma degli animali, la sua opera più celebre, si pone al confine tra varie discipline e conserva un grande interesse ancora oggi che il dialogo tra estetica e biologia si è fatto nuovamente intenso. Pubblicata nel 1948 e in forma ampliata nel 1960 (da cui deriva questa prima edizione italiana a cura di Pietro Conte l'opera rappresenta il frutto più maturo delle sue ricerche "interdisciplinari".Un saggio che nasce dall'insoddisfazione nei confronti dei paradigmi scientifici consolidati e che ripropone l'idea morfologica in biologia sulla scorta del pensiero di J. W. Goethe il quale affermava che "tutto ciò che è deve anche dar cenno di sé e mostrarsi". Adolf Portmann è un convinto sostenitore che dalla forma si possano dedurne le complessive caratteristiche interne ed esterne degli animali. Secondo questa prospettiva la peculiare fisionomia dell'organismo dipende dalla congiunzione delle sue parti e dalle loro reciproche funzioni. Tuttavia l'autore non vede nello studio della forma l'alternativa al funzionalismo quanto, piuttosto, il suo necessario bilanciamento come dichiara nell'introduzione: "… per giungere alla conoscenza della vita animale di strade ce ne sono molte, e tutte possono contribuire ad arricchire la nostra esperienza. Questo lavoro si occupa della forma degli animali e si propone di mettere in luce la peculiare natura dell'aspetto visibile. Ci sono persone che si dedicano allo studio degli animali, conoscono moltissime specie, hanno imparato centinaia di nomi e

  3. L'EPOPEA DELLA SARDEGNA IN MILLANT'ANNI DI GIULIO ANGIONI

    African Journals Online (AJOL)

    User

    mostrato dal padre in occasione della battaglia di Lepanto, da cui era tornato zoppo e .... antistoriche di attribuzioni di colpe o di valori positivi non toglie che da essa ... terrorismo islamico, che ogni tipo di azione volta a contrastarlo è diventata ...

  4. nel cinema italiano contemporaneo

    African Journals Online (AJOL)

    italiano come era rappresentato nel cinema italiano del passato, per esempio in Rocco e i suoi ..... parole che Michele rivolge a Ioan ad un certo punto del film, “Si può .... temporaneo equilibrio e supporto in una inusuale relazione che va.

  5. The role of teachers on the online training platform run by INDIRE (BDP

    Directory of Open Access Journals (Sweden)

    Raffaele Mazzella

    2002-01-01

    Full Text Available Una esperienza di supporto alla formazione in rete, con caratteristiche peculiari. Si e' trattato di un intervento molto vasto, che ha riguardato tutte le scuole italiane e ha coinvolto insegnanti che non avevano scelto di utilizzare gli strumenti di rete.

  6. Il Simposio di Platone

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2013-01-01

    Full Text Available Pensate che i testi antichi siano semplicemente vecchi? Che l’amore platonico non vada mai  al sodo? Leggere il Simposio di Platone confrontandosi direttamente col testo, com’è possibile fare grazie al Perseus Project, vi farà cambiare idea.

  7. Advanced Aircrew Display Symposium Proceedings (5th) Held at the Naval Air Test Center, Patuxent, Maryland on 15-16 September 1981

    Science.gov (United States)

    1981-01-01

    neaiy* ~ rly a l wayn Wi. lit. 111TN ul . designl leadl~ll, alid th11c illiOet.Vý~iii;tIy l~ess warrurital- le assumiption tha t the pilot is aidaptive...iThe !I.Vl iHornet txpandL; tue( concept oil the AV-8B ’rid fur the firzt tim hant Urinchieved q re( verr .-al ill the trendl toward: toroe tnd more...ti-i a1 t e Iut i. t t Il I t le thea uprighlt. paul ition inl (J.05 ’ocl-. Thiti in h:o;rLa~vaelt~ (barnad upon the eonýtraivitiu wand in I he .Lt a

  8. "Etica ed Estetica sono tutt’uno" Riflessioni su TLP 6.421

    Directory of Open Access Journals (Sweden)

    Gabriele Tomasi

    2011-01-01

    Full Text Available Per il primo Wittgenstein etica ed estetica erano tutt’uno. Scopo del saggio è fornire un’interpretazione di questa concezione. Esaminando il modo in cui è proposta nel Tractatus e considerando alcune annotazioni dei Quaderni 1914-1916 si evidenzia che l’unità di etica ed estetica è in un modo di vedere il mondo per cui esso non appare come fonte di limitazione. L’etica è un’estensione al mondo - alla vita - della capacità di conferire significato che nell’arte si realizza nei riguardi di oggetti particolari. Affermando l’unità di etica ed estetica Wittgenstein attira l’attenzione sul fatto che la radice dell’etica è in un certo modo di vedere le cose, in un atteggiamento verso la vita. Si tratta della prospettiva di un valore non connesso a come il mondo è e che è evocato dalla meraviglia per l’esistenza del mondo.

  9. Centers for permanent healthcare education: an analysis on the experience of social players in the north of the state of Paraná¹

    Directory of Open Access Journals (Sweden)

    Sônia Cristina Stefano Nicoletto

    2010-01-01

    Full Text Available The policy of continuing healthcare education (CHE aims to develop healthcare workers. With the objective of analyzing the process of implementing and developing the policy in Paraná, a qualitative study involving the six regions of this state is being concluded. This paper relates to the results from the northern region, focusing on the "experiencing CHE" category. In December 2006, two focus groups were conducted involving representatives from management, training, attendance and participation. The data underwent thematic content analysis. The first CHE encounters aroused feelings of mistrust and resistance, and the center was understood as a means of enabling courses and funding sources. There was a diversity of interests and little negotiating capacity. During the process, the study participants began to talk, reflect and participate. Their teamwork was a positive experience. This experience allowed them to recognize the power of CHE for linking and mobilizing different players.

  10. Il problem solving aritmetico: analisi dei processi cognitivi e metacognitivi e illustrazione del software "Risolvere problemi aritmetici"

    Directory of Open Access Journals (Sweden)

    Antonella D'Amico

    2010-01-01

    Full Text Available Il presente contributo esamina la letteratura relativa al problem solving matematico ed illustra uno strumento multimediale per la soluzione dei problemi aritmetici in bambini del secondo ciclo della scuola primaria e in bambini che presentano difficoltà in tale area. Il software presenta sia un modulo test, in cui vengono presentati problemi aritmetici di livello di difficoltà crescente, che un modulo di training. Il training è stato elaborato in base alle più recenti ricerche nell’area del problem solving matematico e prevede attività sulla comprensione, rappresentazione, categorizzazione e pianificazione del problema. Il training prevede inoltre particolari attività che stimolano l’uso della memoria di lavoro nella soluzione dei problemi. Il training si presenta come metacognitivamente orientato, in quanto i personaggi guida dell’ambientazione si configurano come compagni di studio che stimolano la riflessione metacognitiva rispetto alle attività affrontate.

  11. Immanenza assoluta

    Directory of Open Access Journals (Sweden)

    Rocco Ronchi

    2015-02-01

    Full Text Available La tesi che viene avanzata è quella della immanenza assoluta come via per la fondazione di una prassi effettivamente materialistica.  Tale via è stata aperta nel pensiero novecentesco grazie ad un ripensamento complessivo dell’empirismo (empirismo radicale o trascendentale che ha visto come protagonisti filosofi e indirizza di ricerca che, in alcuni casi, si esiterebbe a definire propriamente “materialisti”, ma che sono accomunati da una critica condivisa del “periplo” metafisico dell’idealismo e del dualismo costituito da:  1 affermazione della contingenza dell’ente,  2 tesi della finitezza come fondamento,  3 intenzionalità della coscienza e  4 da una antropologia filosofica basata sulla dimensione della mancanza e del  lavoro.  L’immanenza assoluta comporta una destituzione della tesi della “eccezione umana” ed una integrale naturalizzazione dell’uomo in un senso, però, non obiettivistico.

  12. Politica bancaria e sviluppo economico: rileggendo l'era menichelliana e quella attuale

    Directory of Open Access Journals (Sweden)

    Mario Sarcinelli

    2005-03-01

    Full Text Available Il basso tasso di crescita dell’Italia, anche nel contesto internazionale ed europeo, ha spinto a confrontare gli anni ’50 con gli ultimi dieci o quindici. Dall’analisi emerge che, se si esclude l’iniziale liberalizzazione del commercio internazionale, il periodo che vide la più vigorosa crescita dell’Italia fu caratterizzato dall’economia mista, da monopoli pubblici e posizioni private dominanti, da una politica monetaria e bancaria basata su controlli diretti ed esercizi di persuasione morale individuale, tutte condizioni oggi ritenute sfavorevoli alla crescita. Al contrario, nella fase attuale l’enfasi è stata sul modello di economia liberale, con liberalizzazioni, privatizzazioni di imprese produttive e di banche, politiche incentrate sugli incentivi e sul mercato. Purtroppo, la scienza economica non ha ancora trovato il paradigma generale che spiega la ricchezza delle nazioni a prescindere dal contesto e dagli uomini che lo animano.

  13. Rita Felski, The Limits of Critique

    Directory of Open Access Journals (Sweden)

    Corrado Confalonieri

    2017-05-01

    Full Text Available Professore di Letteratura inglese presso la University of Virginia – e dal 2016 Niels Bohr Professor alla University of Southern Denmark per un progetto quinquennale dedicato agli usi sociali della letteratura –, Rita Felski non è, all’interno del gruppo di studiosi che lavorano negli Stati Uniti, tra quelli più noti al pubblico italiano, e ciò non soltanto perché mancano traduzioni dei suoi libri, ma per il fatto che diversi tra questi sono rivolti a un contesto piuttosto specificamente americano. Non fa eccezione The Limits of Critique, il libro che qui si presenta e che dovrebbe costituire la seconda uscita di una trilogia avviata nel 2008 con Uses of Literature (Wiley-Blackwell e destinata a concludersi con un volume ora in fase di elaborazione dedicato al coinvolgimento estetico e alle ragioni per cui, come lettori o spettatori, siamo affascinati da un’opera d’arte.

  14. Meccanica razionale

    CERN Document Server

    Biscari, Paolo; Saccomandi, Giuseppe; Vianello, Maurizio Stefano

    2016-01-01

    Questo testo, che giunge ora alla Terza Edizione, è stato concepito principalmente per le necessità delle Scuole di Ingegneria, dove la Meccanica Razionale ha il duplice ruolo di introdurre sia alla modellizzazione fisico-matematica rigorosa che a specifiche applicazioni sviluppate poi in altri insegnamenti. La trattazione che qui proponiamo vuole presentare i concetti fondamentali mantenendo sempre l'attenzione rivolta alle applicazioni, a volte comuni ad altre discipline, in vista di sinergie didattiche favorite dalla presenza di corsi integrati. Abbiamo cercato di dare al libro una impostazione il più possibile coerente con questa finalità, soprattutto in alcune sezioni tradizionalmente caratterizzate da una trattazione più astratta: dai vincoli al Principio dei lavori virtuali, dal Principio di d'Alembert alla Meccanica Analitica. Abbiamo comunque mantenuto la tradizionale e, a nostro parere, irrinunciabile struttura ipotetico-deduttiva nello svolgimento delle argomentazioni, che fa ancora della Mecc...

  15. La nuova fisica che ci aspetta

    CERN Multimedia

    Shiga, David

    2007-01-01

    The big accelerator that will enter in function at CERN at the end of the year will have the hard task to verify the relevance of the string theory, today the better candiddate to be the famous "theory of everything" that physicists are looking for since decades. (1 page)

  16. Zur chemie der marsoberfläche

    Science.gov (United States)

    Keil, Klaus; Clark, Benton C.; Baird, A.K.; Toulmin, Priestley; Rose, Harry J.

    1978-01-01

    Analyses of 13 samples of Martian surface materials with the Viking X-ray fluorescence spectrometers show SiO2 similar to that of terrestrial mafic rocks, whereas Fe2O3, Cl, and S are higher and Al2O3, K2O, Rb, Sr, Y, and Zr are lower. Low totals suggest presence of CO2, H2O, and Na2O. Duricrust fragments are higher in S than fines, but samples from both landing sites are surprisingly similar. We suggest that Martian surface materials are aeolian deposits of complex mixtures of weathering products of maficultramafic rocks, possibly consisting of iron-rich clays, sulfates, iron oxides, carbonates, and chlorides.

  17. Using Screencasts in ChE Courses

    Science.gov (United States)

    Falconer, John L.; deGrazia, Janet; Medlin, J. Will; Holmberg, Michael P.

    2009-01-01

    Screencasts are digital recordings of the output from a computer monitor, including narration. Their use was piloted in five chemical engineering courses and the feedback from students was overwhelmingly positive. The screencasts were produced on Tablet PCs using Camtasia Studio software and were posted to the Blackboard classroom management…

  18. à l'encoche sèche

    African Journals Online (AJOL)

    naturel est une matière première importante en industrie. Il intervient à 70% dans la ... caoutchouc naturel de cette région est en constante progression, due au .... L'analyse a été effectuée avec le test statistique de Duncan au risque alpha = 5 % avec les valeurs de LEM transformées en Arc Sinus. Racine carrée de LEM ...

  19. ‘The political deadlock is life’: Boris and the satire of contemporary Italian media and cultural industries

    Directory of Open Access Journals (Sweden)

    Giacomo Boitani

    2014-12-01

    Full Text Available ‘Il pareggio elettorale è la vita’: Boris e la satira dei mass media italiani e dell’industria culturale odierni  Nel 2007 il network satellitare Fox Italia ha cominciato la produzione di Boris, una serie comica del genere mockumentary messa in onda sui canali Sky Italia dal 2007 al 2010. La trama di Boris narra le peripezie di una troupe televisiva alle prese con la produzione di una soap-opera per la RAI. In Italia la serie è presto diventata un prodotto ‘cult’. Nella serie Boris i pigri e opportunisti membri della troupe televisiva fittizia sono rappresentati come succubi delle ripercussioni che gli sviluppi politici nel Paese hanno sul servile network per il quale lavorano. Gli attori nella soap-opera fittizia vengono rimpiazzati e la trama stessa della soap-opera viene riscritta a seconda delle nuove coalizioni che vengono formate in Parlamento e i membri della troupe sono costantemente alla ricerca di raccomandazioni e protezione politica. Per quanto satirizza lo stato del Paese, Boris mette anche in discussione il fatto stesso che l’industria culturale Italiana corrente possa produrre un discorso significativo. Con riferimento alla teorizzazione della ‘parodia’ da parte di Linda Hutcheon, questo articolo discute la rappresentazione che Boris ha tratteggiato dell’industria culturale, analizza il rapporto esistente tra la serie e tradizioni comiche Italiane che l’hanno preceduta (la ‘commedia all’italiana’ e il modo in cui l’ironia implementata dalla serie ricalca e/o diverge da quella tipica delle serie mockumentary estere che l’hanno ispirata (Arrested Development e The Larry Sanders Show.

  20. Appello Roma – sezione lavoro Sent.15-29 gennaio 2013 n. 377 Pres. Rel. Torrice - S. srl contro G.

    Directory of Open Access Journals (Sweden)

    Calogero Massimo Cammalleri

    2013-07-01

    Full Text Available Lavoro (controversie – Appello – novella art. 434 del c.p.c. – motivazione dell'appello – contenuto – specificazione dei singoli segmenti o sottocapi che la compongono la motivazione – necessità - violazione – conseguenze – nullità dell'appello – esclusione - inammissibilità dell'appello - sussiste.* Lavoro (controversie – Appello – novella art. 434 del c.p.c. – motivazione dell'appello – contenuto – indicazione delle modifiche da apportare al provvedimento – indicazione dei profili di causalità tra violazione di legge ed esito della lite – necessità - violazione – – conseguenze – nullità dell'appello – esclusione - inammissibilità dell'appello – sussiste.* La nuova formulazione dell'art. 434 c.p.c. impone precisi oneri di forma dell'appello che deve essere redatto quasi come una sentenza e occorrerà: articolare le modifiche che il giudice di appello deve apportare, anche di quelle formulate in via subordinata; indicare espressamente le parti del provvedimento che vuole impugnare (profilo volitivo; suggerire le modifiche che dovrebbero essere apportate al provvedimento con riguardo alla ricostruzione del fatto (profilo argomentativo; specificare il rapporto di causa ad effetto fra la violazione di legge che è denunciata e l'esito della lite (profilo di causalità; individuare il testo di una nuova pronuncia volta a modificare le argomentazioni del giudice di prime cure. Allorché siano contestati in quantum della condanna l'assolvimento dei suddetti precetti ricavabili dall'art. 434 c.p.c. deve altresì estrinsecarsi nella produzione di prospetti contabili alternativi rispetto posti a base della decisione impugnata

  1. Scienza dei servizi

    Science.gov (United States)

    Cavenago, Dario; Mezzanzanica, Mario

    I servizi sono oramai centrali nella vita sociale di ogni Paese. L'aspettativa di ogni attore sociale, sia esso cittadino/utente e/o istituzione, è quella di ricevere da uno scambio che ha alla base un servizio un contributo che si caratterizza per una qualità intrinseca. Il mantenimento di tale promessa richiede all'azienda erogatrice un forte coinvolgimento, nel disegno del servizio, degli utenti ed una capacità di gestione della conoscenza; ciò è particolarmente significativo per quei servizi che si caratterizzano per una forte personalizzazione o complessità progettuale. Disegnare un servizio, metterlo in produzione e gestirne l'erogazione ha una complessità variabile in base al grado di coinvolgimento dei destinati ed alle dimensioni critiche che esprimono le condizioni di fattibilità di un servizio di qualità appropriato alle attese degli utilizzatori. Ugualmente la globalizzazione dell'economia e la scarsità delle risorse ha portato l'attenzione, ai fini della sostenibilità delle condizioni sopra richiamate, di una ricerca di modelli e strumenti che permettano una valutazione e una standardizzazione dei processi di produzione ed erogazione secondo condizioni di economicità. Tali primi e sintetici elementi hanno condotto diversi attori istituzionali, grandi imprese ed università attraverso i loro centri di ricerca, ad una azione di riflessione sul grado di "ingegnerizzazione" dei processi sottesi alla erogazione dei servizi ed in particolare ai servizi che attuano le politiche dei grandi settori di base dell'economia di una Nazione: educazione, sanità, sociale, sviluppo infrastrutture ecc.

  2. Lo sport come filosofia educativa e sociale: una prospettiva decostruzionista

    Directory of Open Access Journals (Sweden)

    Emanuele Isidori

    2013-04-01

    Full Text Available Lo scopo del presente articolo è quello di procedere, utilizzando un approccio filosofico decostruzionista, ad una disamina dello sport come oggetto filosofico, mostrandone le contraddizioni interne, i paradossi e le aporie che lo caratterizzano in quanto concetto educativo-culturale e fenomeno sociale. L’analisi si svilupperà riflettendo su tre temi tipici del dibattito decostruzionista: quello del phármakon, dell’identità e dell’ospitalità, tema quest’ultimo tipico anche del pensiero debole che presenta forti interconnessioni con il pensiero decostruzionista e postmoderno. Lo studio, che utilizzerà il tipico approccio teoretico-prassico della filosofia dell’educazione, evidenzierà sia i meccanismi concettuali che talvolta impediscono allo sport di essere pensato come pratica realmente educativa ed in grado di generare l’inclusione sociale, sia quelli che invece ne permettono la teorizzazione e l’implementazione in questa prospettiva. Lo studio si concluderà mostrando come per concepire realmente lo sport nella prospettiva di un autentico strumento educativo e di miglioramento della vita sociale sia necessaria una vera e propria rivoluzione etica e culturale della nostra società. Lo sport, infatti, in quanto sottosistema della società, rappresenta lo specchio dei valori di quest’ultima e non solo ne incarna i difetti, le contraddizioni ma anche le sue buone prassi. Questa rivoluzione deve necessariamente passare attraverso l’educazione; soltanto così, infatti, sarà possibile costruire quella società nuova, fondata sulla paidéia sportiva, che De Coubertin sognava per l’umanità futura.

  3. Azospirillum brasilense Chemotaxis Depends on Two Signaling Pathways Regulating Distinct Motility Parameters.

    Science.gov (United States)

    Mukherjee, Tanmoy; Kumar, Dhivya; Burriss, Nathan; Xie, Zhihong; Alexandre, Gladys

    2016-06-15

    The genomes of most motile bacteria encode two or more chemotaxis (Che) systems, but their functions have been characterized in only a few model systems. Azospirillum brasilense is a motile soil alphaproteobacterium able to colonize the rhizosphere of cereals. In response to an attractant, motile A. brasilense cells transiently increase swimming speed and suppress reversals. The Che1 chemotaxis pathway was previously shown to regulate changes in the swimming speed, but it has a minor role in chemotaxis and root surface colonization. Here, we show that a second chemotaxis system, named Che4, regulates the probability of swimming reversals and is the major signaling pathway for chemotaxis and wheat root surface colonization. Experimental evidence indicates that Che1 and Che4 are functionally linked to coordinate changes in the swimming motility pattern in response to attractants. The effect of Che1 on swimming speed is shown to enhance the aerotactic response of A. brasilense in gradients, likely providing the cells with a competitive advantage in the rhizosphere. Together, the results illustrate a novel mechanism by which motile bacteria utilize two chemotaxis pathways regulating distinct motility parameters to alter movement in gradients and enhance the chemotactic advantage. Chemotaxis provides motile bacteria with a competitive advantage in the colonization of diverse niches and is a function enriched in rhizosphere bacterial communities, with most species possessing at least two chemotaxis systems. Here, we identify the mechanism by which cells may derive a significant chemotactic advantage using two chemotaxis pathways that ultimately regulate distinct motility parameters. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  4. Conservazione e problematiche sociali: l'esempio del progetto di reintroduzione dell'orso bruno

    Directory of Open Access Journals (Sweden)

    Andrea Mustoni

    2003-10-01

    Full Text Available La biologia della conservazione è una disciplina di sintesi, che si è affermata negli ultimi 20 anni per fornire risposte concrete all'allarmante perdita di diversità biologica che si sta verificando in tutto il mondo. Tale disciplina è andata quindi nel tempo a completare le materie di carattere applicativo sviluppate nel passato, fornendo loro un quadro teorico generale, finalizzato allo studio e al mantenimento delle condizioni di stabilità delle popolazioni animali e vegetali. Tra le azioni di conservazione più efficaci, si sono andate affermando le reintroduzioni intese, oltre che come mezzo per la tutela diretta di una specie animale, anche come strumento per favorire la comunicazione in campo ambientale ed innalzare il livello di sensibilità della comunità. Entrambe questi obiettivi sono stati posti alla base del progetto di reintroduzione di orso bruno (Ursus arctos realizzato dal Parco Naturale Adamello Brenta (Life Ursus e che ha portato tra il 1999 e il 2002 alla liberazione di 10 individui provenienti dalla Repubblica Slovena. Il progetto, iniziato principalmente per tutelare la popolazione di orso presente sulle Dolomiti di Brenta, ormai considerata "biologicamente estinta", si è progressivamente arricchito di iniziative di comunicazione e divulgazione, rivolte a rivestire l'iniziativa di importanti significati culturali. Va peraltro considerato che, sebbene il contesto socio economico che ha favorito l'estinzione della specie nei secoli passati sia radicalmente cambiato, esistono ancora potenziali fattori di conflitto tra la presenza dell'orso e le popolazioni umane. In particolare l'esperienza del progetto Life Ursus ha evidenziato le difficoltà crescenti nella gestione delle informazioni a livello di mass media. A questo proposito basti pensare al notevole aumento del numero di articoli sui quotidiani locali, che sono passati dai 49 nel 1999 (anno di inizio del progetto, ai 250 del 2002, con

  5. Information systems planning in public administration; Definizione di una metodologia per la pianificazione dei sistemi informativi in un ente pubblico di ricerca con elevato livello di decentramento

    Energy Technology Data Exchange (ETDEWEB)

    Minelle, F [Rome, Univ. ` La Sapienza` (Italy). Fac. di Scienze Matematiche, Fisiche e Naturali; Di Marco, R A [ENEA, Rome (Italy). Funzione Centrale Informatica; Bottini, M

    1997-02-01

    Since before the Ninety the common experience of the different of the divisions of the Public Administration, it was to proceed on the way of insertion and the utility of technology informer in shed order. It was evident how it could not operate in the best way, without wright descriptions of the general and sectors reference. In terminus of efficiency, efficacy and transparency of services offered and the investment made were inadequate. And so in this way the operation was not good enough to pay attention to a valuation of the cost, beneficial of the investment made, that was growing up. It is today getting important to entrust the planning of the information system, that was to be done every year when we talk about a plan with an average limit. So they can be oriented and checked, the choice of the single Administration. In the following work it has been started from the analysis of the italian situation, which expect the use of a specific methodology produced by the AIPA for the planning of informative system in the public administration. The new experimental part of the thesis aims to the adjustment of this methodology to a reality which is the ENEA, that differs for example from that of a Ministry (for that reality on the contrary the proposal of AIPA is optimal), as the institutional aims and the following modalities of administration change, as the corporation is characterised by a strong decentralisation and above all as it has lacked a cognitive research about the different work processes, introduction to the application of AIPA`s proposal. [Italiano] E` stata fino da prima degli anni `90 esperienza comune che nei vari comparti della Pubblica Amministrazione, si procedesse sulla strada dell`inserimento e dell`utilizzo delle tecnologie ifnormatiche in ordine sparso. E` stato evidente come non si potessero operare scelte ottimali nell`assenza di quadri di riferimento generali e settoriali; che i ritorni, in termini di efficenza, efficacia e trasparenza dei

  6. Photon technology. Laser process technology; Photon technology. Laser process gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-03-01

    For developing laser process technology by interaction between substance and photon, the present state, system, R and D issues and proposal of such technology were summarized. Development of the photon technology aims at the modification of bonding conditions of substances by quantum energy of photon, and the new process technology for generating ultra- high temperature and pressure fields by concentrating photon on a minute region. Photon technology contributes to not only the conventional mechanical and thermal forming and removal machining but also function added machining (photon machining) in quantum level and new machining technology ranging from macro- to micro-machining, creating a new industrial field. This technology extends various fields from the basis of physics and chemistry to new bonding technology. Development of a compact high-quality high-power high-efficiency photon source, and advanced photon transmission technology are necessary. The basic explication of an unsolved physicochemical phenomenon related to photon and substance, and development of related application technologies are essential. 328 refs., 147 figs., 13 tabs.

  7. Atmospheric lidar: legislative, scientific and technological aspects; Lidar atmosferico. Aspetti legislativi, scientifici e tecnologici

    Energy Technology Data Exchange (ETDEWEB)

    Barbini, R.; Colao, F.; Fiorani, L.; Palucci, A. [ENEA, Divisione Fisica Applicata, Centro Ricerche Frascati, Frascati, RM (Italy)

    2000-07-01

    The Atmospheric Lidar is one of the systems of the Mobile Laboratory of Laser Remote Sensing under development at the ENEA Research Center of Frascati. This technical report addresses the legislative, scientific and technological aspects that are the basis for the identification of the requirements, the definition of the architecture and the fixation of the specifications of the Atmospheric Lidar. The problems of air pollution are introduced in section 2. A summary of the Italian laws on that topic is then given. Section 4 provides a survey of the atmospheric measurements that can be achieved with the lidar. The sensitivity in the monitoring of pollutants is discussed in section 5. The other systems of the Mobile Laboratory of Laser Remote Sensing are shortly described in section 6. The last section is devoted to conclusions and perspectives. [Italian] Il lidar atmosferico e' uno dei sistemi del Laboratorio Mobile di Telerilevamento Laser in corso di realizzazione presso il Centro Ricerche di Frascati dell'ENEA. Questo rapporto tecnico discute gli aspetti legislativi, scientifici, tecnologici che sono alla base dell'individuazione dei requisiti, della definizione dell'architettura e della fissazione delle specifiche del Lidar atmosferico. La problematica dell'inquinamento dell'aria e' introdotta nella sezione 2. Segue un riassunto della legislazione italiana su tale tematica. La sezione 4 offre una panoramica delle misure atmosferiche realizzabili con il Lidar. La sensibilita' nel monitoraggio di inquinanti e' discussa nella sezione 5. Gli altri sistemi del Laboratorio Mobile di Telerilevamento Laser sono descritti brevemente nella sezione 6. L'ultima sezione e' dedicata alle conclusioni e alle prospettive.

  8. Programmable gaming environments for four year olds

    OpenAIRE

    Edith K. Ackermann

    2002-01-01

    Apprendere a programmare alla scuola dell'infanzia? Perche'? Che cosa ci puo' essere di interessante in questo per un bambino? Che cosa si puo' imparare? Questo articolo e' rivolto ai ricercatori, ai progettisti, agli educatori e ai genitori; tutti questi hanno buone ragioni per interrogarsi.

  9. Antonio Catalfamo, Frammenti di memoria. Nicola Teti Editore ...

    African Journals Online (AJOL)

    User

    altro canto, c'è da chiedersi se la stessa affermazione non trovi una sua giustificazione davanti alle deformità sociali del mondo moderno. Si pensi a ciò che significa vivere nel presente nell'ambito di un consumismo che tutto ingoia e per cui ...

  10. Apprendimento collaborativo in linea: comunità di ricerca e di pratiche (Intervista a Christian Bois

    Directory of Open Access Journals (Sweden)

    Orazio Maria Valastro

    2003-09-01

    Full Text Available Il sapere deriva per prima cosa dal fatto che si "nominano" le dinamiche che emergono dalla situazione analitica e dai discorsi dei protagonisti. Deriva inoltre da quello che s'identifica nelle rassomiglianze di contenuto e/o nelle forme tra un segno attuale e un fatto passato. O ancora deriva dalla creatività dell'analizzante per predisporre il suo posto nella giungla dei desideri, dei territori, delle gelosie e delle invidie. Deriva infine dal sottile gioco tra il reale, l'immaginario ed il simbolico. Nella comunità di ricerca e di pratiche ci sono anche delle dinamiche sottili da identificare.

  11. Social software e multitasking: un virus o una risorsa?

    Directory of Open Access Journals (Sweden)

    Gisella Paoletti

    2013-03-01

    Full Text Available Il multitasking è una strategia di gestione delle risorse cognitive; consiste nello svolgere più di un compito contemporaneamente. In alcuni casi è inevitabile, altre volte no, ma sempre più spesso ci sentiamo costretti a cercare di fare più cose simultaneamente. Possiamo veramente dividere la nostra attenzione conscia tra due compiti impegnativi, come leggere e scrivere? In questo articolo si riportano risultati sperimentali che hanno dimostrato che il risparmio di tempo può essere illusorio e che la performance ha un decadimento rispetto alle situazioni in cui è possibile svolgere i compiti in sequenza.

  12. L’immaginario collettivo nell’era biomediatica

    Directory of Open Access Journals (Sweden)

    Massimiliano Valerii

    2017-12-01

    Full Text Available Grazie alla diffusione delle tecnologie digitali, nel giro di un decennio la grande trasformazione dei media ha determinato una rivoluzione copernicana, che ha posto l’io-utente al centro del sistema. Questo lavoro prende spunto dal 14° Rapporto sulla comunicazione del Censis per analizzare i processi in corso. In particolare, ci si focalizza sull’ingresso nella cosiddetta era biomediatica, caratterizzata dalla trascrizione virtuale e dalla condivisione telematica in tempo reale delle biografie personali attraverso i social network, che sanciscono il primato dell’io-utente, produttore esso stesso – oltre che fruitore – di contenuti.

  13. Il muro come galleria

    Directory of Open Access Journals (Sweden)

    Duccio Dogheria

    2008-06-01

    Full Text Available Il muro, nel suo grigio rigore formale, nella sua fredda geometria, nel suo intento divisorio, nasconde spesso il cielo. Sovente il linguaggio dell’arte, ma non di meno quello della comunicazione, hanno interferito con le sue algide barriere. In molti casi, beninteso, non è che il potere in altre forme, che interferisce con se stesso: pensiamo ai bandi affissi agli angoli delle città, o le lettere d’indulgenza papali -spesso impreziosite da miniature al punto da poterle considerare antenate dal manifesto- che nel corso del medioevo venivano affisse sulle porte delle chiese.

  14. Una finestra sul polo

    Directory of Open Access Journals (Sweden)

    Graziella Busso

    2015-07-01

    Full Text Available Rabbia, dolore, incredulità si mescolano in un turbinio di emozioni quando, dalle affissioni che quasi quotidianamente si danno il cambio, si legge il necrologio di un “qualcuno” che sappiamo ucciso dal cancro. E pensiamo che, ancora e forse per tanto tempo, potremmo essere più fortunati. E non c’è pace, non c’è consolazione per quei giorni di vita vissuta, strappata, stropicciata, rubata da un mostro che non sempre è possibile sconfiggere finché non subentra la stanchezza, la rassegnazione, la secchezza delle ghiandole lacrimali. Unico strumento per cercare di “cambiare le cose”, per quanto difficile possa sembrare farlo, è combattere, perché la lotta per un ambiente più vivibile sarà una conquista per noi e per i nostri figli, un’eredità che non ha prezzo. La voglia di “gridare” la sofferenza di chi vive la realtà di uno sviluppo insostenibile si è da tempo trasformata ad Augusta in una battaglia di sensibilizzazione alla ormai annosa problematica e nel profondo desiderio di raccontare, far conoscere, testimoniare emozioni, desideri, sogni di chi vive in prima persona o ha vissuto la malattia di un proprio caro perché tutto questo possa servire a spingere verso quel mutamento culturale, storico, ambientale a cui tutti noi agogniamo.

  15. Marsiglia, una terra a Sud di nessun nord. La presenza dei gruppi criminali nella ville méditerranée

    Directory of Open Access Journals (Sweden)

    Rosaria Anghelone

    2015-07-01

    Full Text Available Il lavoro si propone di affrontare la presenza dei gruppi criminali a Marsiglia, dagli anni delle grandi migrazioni di inizio secolo scorso, in cui il porto Mediterraneo è stato il cuore di scambi commerciali e culturali, sino agli anni recenti, in cui la città ha tirato fuori, costruendola, la sua faccia europea. Lungo tutto quest’arco temporale, confronteremo le vicende e le figure che emergeranno nel contesto, che si determinerà di fase in fase, con la concettualizzazione del fenomeno mafioso italiano; quest’ultima, come cartina al tornasole, ci permetterà di cogliere le caratteristiche del milieu marsigliese, i suoi tratti specifici e quelli che lo accomunano, sia nella logica che nell’esplicazione del suo potere, alla mafia. Marsiglia, incarnando tutte le contraddizioni delle terre del Sud, farà da palcoscenico per la riflessione sui fattori che favoriscono la nascita e rafforzano la crescita dei gruppi criminali. L’intento, oltre l’analisi del singolo caso marsigliese, è, altresì, quello di constatare quanto la Francia sia ancora impreparata in tema di contrasto alla criminalità organizzata di stampo mafioso, sottovalutandone gli effetti, e quanto, ancor di più, sia ormai imprescindibile un intervento europeo su questo versante, tendente all’armonizzazione delle legislazioni nazionali.

  16. La mafia russa in Italia. Lavori in corso

    Directory of Open Access Journals (Sweden)

    Ombretta Ingrascì

    2015-07-01

    Full Text Available Il saggio riporta parte dei risultati di una ricerca sulla presenza della mafia russa in Italia condotta nel 2013, e in corso di aggiornamento, che si è avvalsa di materiale investigativo e giudiziario. Dopo aver affrontato i problemi di definizione posti dalla locuzione “mafia russa”, il saggio si concentra sull’invisibilità dei capitali illeciti provenienti dai Paesi dell’ex Unione Sovietica, le cui tracce, ben presenti in Italia, non sono sufficienti a provare il reato di riciclaggio, che richiede l’identificazione a monte del reato che li ha generati. Successivamente prende in considerazione la componente georgiana della mafia russa ricostruendone le caratteristiche e le attività criminali svolte in Italia dai componenti dell’ultimo livello della struttura organizzativa. Infine, il saggio si occupa della variante ucraina della mafia russa, dedita a pratiche estorsive, favoreggiamento all’immigrazione e sfruttamento alla prostituzione nei confronti di connazionali, interpretandola come espressione di un modello di semi-radicamento.  Nelle conclusioni si sostiene che lo sviluppo di organizzazioni criminali riconducibili alla mafia russa in Italia sia caratterizzato da tratti che ne mostrano un orientamento tipicamente mafioso e al contempo non rientrano nelle tipiche manifestazioni di colonizzazione del territorio, così come sono state realizzate dalle mafie autoctone in territori non tradizionalmente mafiosi.

  17. Hydroalcoholic extract of Carum carvi L. in oral mucositis: a clinical trial in male golden hamsters.

    Science.gov (United States)

    Mardani, M; Afra, S M; Tanideh, N; Tadbir, A Andisheh; Modarresi, F; Koohi-Hosseinabadi, O; Iraji, A; Sepehrimanesh, M

    2016-01-01

    Several studies have attempted to prevent or improve oral mucositis (OM) but have not produced a qualified treatment yet. This study evaluates the effects of Carum carvi L. (caraway) hydroalcoholic extract (CHE) as one of the traditional medicinal plants in 5-fluorouracil (5-FU)-induced OM in golden hamsters. OM was induced in 54 male golden hamsters by 5-FU and cheek pouch scratching. Starting from day 12, 500 and 1000 mg kg(-1) per day topical CHE were administered. Pouch histopathology score, malondialdehyde and reduced glutathione contents, and activity of myeloperoxidase plus microbial cultures of cheek pouch, antimicrobial properties of CHE, and essential oil constituents were evaluated. Lower histopathology score (0, 1, and 2) and malondialdehyde level, higher reduced glutathione level and activities of myeloperoxidase were detected in 1000 and 500 mg kg(-1) per day topical CHE and control groups, respectively (P epidermidis and Streptococcus intermedius. γ-Terpinene (37.2%) was identified as the main constituent of essential oil. The use of CHE in topical form may be associated with reduced intensity of OM. This may be due to appropriate antibacterial activity and terpinene contents. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. Work life balance tra limiti istituzionali e pratiche innovative

    Directory of Open Access Journals (Sweden)

    Giovanna Campanella

    2017-12-01

    Full Text Available Come rispondono le politiche di conciliazione cura-lavoro alle esigenze delle lavoratrici e dei lavoratori di nuova generazione: sempre più precari, poveri e instabili dal punto di vista reddituale e/o professionale? Con un sostanziale immobilismo politico.  Questo è il quadro che viene fuori da una rassegna delle principali politiche sociali italiane volte a supporto della genitorialità e alla garanzia dell’occupazione femminile. Il contributo mette in luce i limiti di tali politiche e coglie gli aspetti innovativi di pratiche che si sviluppano dal basso.  Al contempo, una riflessione al margine lascia aperta una importante questione sul rapporto tra flessibilità e conciliazione, ovvero tra organizzazione del lavoro e tempi di cura per la famiglia. Nell’era della rivoluzione digitale,  individuamo forti resistenze al cambiamento, sia da parte delle istituzioni, ma anche e soprattutto dal mondo produttivo, che vanta si modelli “agili” di forme di lavoro da un punto di vista formale (vedi il lavoro agile/ smart working ma che dal punto di vista sostanziale rimane radicato a modelli di contrattazione standar che non agevola né la condizioine lavorativa da un punto di vista di tutele né la conciliaizone cura lavoro e quindi l’occupazione femminile.

  19. Lo Sport e le sue storie: l'esperienza aquilana, quando lo sport supera l'emergenza

    Directory of Open Access Journals (Sweden)

    Marco Pasini

    2013-04-01

    Full Text Available Tale progetto di ricerca, della durata di 12 mesi (da luglio 2010 a luglio 2011 e commissionato dal Ministero del Lavoro e delle Politiche Sociali , intende ricostruire il tessuto sociale di 400 giovani delle scuole secondarie di I e II livello de L’Aquila e provincia attraverso lo sport. Tessuto sociale leso e sfaldato in seguito all’evento sismico che il 6 aprile 2009 colpì il capoluogo abruzzese, in cui oltre all’improvvisa e immediata perdita di tutti i beni materiali sono venuti meno anche i canali di socializzazione primari e secondari. Una quotidianità da ricostruire anche e soprattutto attraverso il concetto di attività sportiva volta, in questo caso più che mai, alla realizzazione di cittadinanza, partecipazione, formazione umana, integrazione e coesione sociale. Con particolare attenzione agli sport di squadra che permettono uno sviluppo affettivo, cognitivo, relazionale e una maggiore comprensione/costruzione della propria personalità. Dunque lo sport come strumento principe per l’inclusione sociale, in quanto gioco che esalta l’armonia e le dinamiche di cooperazione. Lo sport, in generale, va considerato un fatto sociale; è un fenomeno sociale, un sistema culturale - che agisce tra comunicazione, economia e politica - e si presenta come una costruzione sociale. Costruzione generata da significati e rappresentazioni collettive.

  20. Noi e loro. L’integrazione psicologica nell’emigrazione

    Directory of Open Access Journals (Sweden)

    Alberto Ghilardi

    2009-06-01

    Full Text Available Gli studi in psicologia clinica e sociale evidenziano come l’incontro tra popolazioni provenienti da contesti etnici, sociali, culturali e psicologici molto diversi attivi una serie di meccanismi di tipo prevalentemente difensivo. E’ illusorio ritenere che l’incontro fra tali diversità, come nel caso dei fenomeni emigratori, si risolva attraverso processi d’integrazione che avvengano quasi “per natura”, al contrario vi sia sempre la necessità di una modifica di equilibri precedenti, analogamente a quanto avviene per consimili eventi sul piano biologico.L’articolo evidenzia come l’incontro con il fenomeno dell’emigrazione vada psicologicamente affrontato anche sul fronte della popolazione che riceve i nuovi individui, inclusi gli operatori e i clinici che si occupano in prima persona del fenomeno, aiutandoli ad adattare i propri confini geografici come modifica, sul piano psicologico, di confini interni, poiché questi ultimi sono i mezzi che identificano e riconoscono le differenze.Saranno utilizzate alcune esemplificazioni tratte da esperienze d’intervento psicologico clinico e sociale nei campi della consulenza educativa degli adulti, della medicina e della psicoterapia per mostrare a quali difficoltà interpretative siano sottoposti i propri abituali modelli culturali, clinici e operativi nell’incontro con realtà differenti e quali modalità possano facilitare osmosi e integrazione tra persone e culture.