WorldWideScience

Sample records for technology iut che

  1. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...

  2. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  3. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    it as comparable to the Cuban government he fought in the 1950s Cuban revolution, and one can see that Bolivia was fertile ground to Che and his... bean failure in resupply, especially during unforeseen circumstances.89 The establishment of the critical logistics network was prevented first of all...5. Macias, Counter Guerrilla Operations in Bolivia 1967, 4, and Saldana, Fertile Ground: Che Guevara and Bolivia, 40. 6. Saldana, Fertile Ground

  4. Che cos’è la filosofia

    Directory of Open Access Journals (Sweden)

    Maria Chiara Pievatolo

    2011-09-01

    Full Text Available Ecco una risposta che arriva dagli antipodi, tramite il blog di John Wilkins: filosofia è quello che si fa quando i fatti non assicurano una soluzione. Wilkins usa tutta la ricchezza di riferimenti che ci può aspettare da una disciplina con una bibliografia millenaria. Ma la finezza della definizione sta nel suo carattere elementare: se [...

  5. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  6. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  7. The Pedagogy of Ernesto Che Guevara

    Science.gov (United States)

    Holst, John D.

    2009-01-01

    This article identifies and describes the major principles and themes that emerge from an analysis of the revolutionary pedagogical practice and ideas of Ernesto Che Guevara. The principles and themes outlined in this article are based on a thematic investigation of the approximately 2000 pages of Guevara's writings, speeches and interviews…

  8. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  9. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  10. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  11. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  12. E-LEARNING: A CHE PUNTO SIAMO?

    OpenAIRE

    Contessa, Sergio

    2009-01-01

    Apprendimento a distanza con l’uso delle nuove tecnologie informatiche è in genere la traduzione del termine e-learnig che da un po’ di anni interessa anche il nostro Paese. L’uso delle nuove tecnologie ha ormai permeato quasi ogni aspetto della nostra vita e le aziende private ne fanno massiccio utilizzo perché oltre a facilitarne la gestione e l’organizzazione, anche se non in modo immediato, comporta un grande risparmio di denaro. Per l’Unione europea l’utilizzo delle nuove tecnologie rapp...

  13. Antibiotic resistance is linked to carriage of papC and iutA virulence genes and phylogenetic group D background in commensal and uropathogenic Escherichia coli from infants and young children.

    Science.gov (United States)

    Karami, N; Wold, A E; Adlerberth, I

    2017-04-01

    P fimbriae, enabling adherence to colonic and urinary epithelium, and aerobactin, an iron sequestering system, are both colonization factors in the human colon and virulence factors for urinary tract infection. The colonic microbiota is suggested to be a site suitable for the transfer of antibiotic resistance genes. We investigated whether phenotypic resistance to antibiotics in commensal and uropathogenic Escherichia coli from infants and young children is associated with carriage of virulence genes and to phylogenetic group origin and, in the case of fecal strains, to persistence in the gut and fecal population levels. The commensal strains (n = 272) were derived from a birth cohort study, while the urinary isolates (n = 205) were derived from outpatient clinics. Each strain was assessed for phenotypic antibiotic resistance and for carriage of virulence genes (fimA, papC, sfaD/E, hlyA, iutA, kfiC, and neuB), phylogenetic group (A, B1, B2, or D), and markers of particular virulent clones (CGA-D-ST69, O15:H1-D-ST393, and O25b:H4-B2-ST131). Resistance to ampicillin, tetracycline, and trimethoprim was most prevalent. Multivariate analysis showed that resistance to any antibiotic was significantly associated with carriage of genes encoding P fimbriae (papC) and aerobactin (iutA), and a phylogenetic group D origin. Neither fecal population numbers nor the capacity for long-term persistence in the gut were related to antibiotic resistance among fecal strains. Our study confirms the importance of phylogenetic group D origin for antibiotic resistance in E. coli and identifies the virulence genes papC and iutA as determinants of antibiotic resistance. The reason for the latter association is currently unclear.

  14. Improved technology for manufacture of carbon electrodes

    Indian Academy of Sciences (India)

    Improved technology for manufacture of carbon electrodes. A PLATON, A DUMBRAVA*,+, N IUTES-PETRESCU and. LUIZA SIMIONESCU. National Research Institute for Petroleum Processing and Petrochemistry. (INCERP), Boulevard Republicii no. 291A, 2000 Ploiesti, Romania. +Present address: 205, 1039-13 Avenue, ...

  15. Attention deficit hyperactivity disorder and the behavior of "Che" Guevara.

    Science.gov (United States)

    Teive, Hélio A G; Zavala, Jorge A; Munhoz, Renato P; Lara, Diogo R; Lima, Pedro; Palmini, André

    2009-09-01

    Attention deficit hyperactivity disorder (ADHD) is a childhood onset neuropsychiatric disorder characterized by inattention, hyperactivity and impulsivity. ADHD is related to several co-morbidities, such as opposition defiant disorder, conduct disorder, mood and anxiety disturbances, as well as tics and Tourette's syndrome. The objective of this report is to shed an alternative light on the personality of Ernesto "Che" Guevara, discussing whether he might have had ADHD. Several published biographies of Che Guevara were reviewed. Established ADHD criteria (Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition), were used as a framework to evaluate Che's behaviour. In addition, we compared the main features of Che's reported behaviour to the set of abnormalities leading to the diagnosis of ADHD in adults proposed by Wender and colleagues and known as the UTAH ADHD criteria. Analysis of the most renowned biographies of Ernesto "Che" Guevara suggests that he may have had ADHD.

  16. Kui Che on reklaami(kunsti) ikooniks / Andres Laasik

    Index Scriptorium Estoniae

    Laasik, Andres, 1960-2016

    1999-01-01

    Eestis tehtud reklaamid on kahtlaselt sarnased välismaistega. Saksa ajakirjas "Spiegel" oleva ameerika fotoaparaadi Leica reklaam, millel on Che Guevara nägu, on sarnane internetikaubamaja "Osta" reklaamiga.

  17. Crystal Structures of Beryllium Fluoride-Free and Beryllium Fluoride-Bound CheY in Complex with the Conserved C-Terminal Peptide of CheZ Reveal Dual Binding Modes Specific to CheY Conformation

    Energy Technology Data Exchange (ETDEWEB)

    Guhaniyogi,J.; Robinson, V.; Stock, A.

    2006-01-01

    Chemotaxis, the environment-specific swimming behavior of a bacterial cell is controlled by flagellar rotation. The steady-state level of the phosphorylated or activated form of the response regulator CheY dictates the direction of flagellar rotation. CheY phosphorylation is regulated by a fine equilibrium of three phosphotransfer activities: phosphorylation by the kinase CheA, its auto-dephosphorylation and dephosphorylation by its phosphatase CheZ. Efficient dephosphorylation of CheY by CheZ requires two spatially distinct protein-protein contacts: tethering of the two proteins to each other and formation of an active site for dephosphorylation. The former involves interaction of phosphorylated CheY with the small highly conserved C-terminal helix of CheZ (CheZ{sub C}), an indispensable structural component of the functional CheZ protein. To understand how the CheZ{sub C} helix, representing less than 10% of the full-length protein, ascertains molecular specificity of binding to CheY, we have determined crystal structures of CheY in complex with a synthetic peptide corresponding to 15 C-terminal residues of CheZ (CheZ{sub 200-214}) at resolutions ranging from 2.0 Angstroms to 2.3 Angstroms. These structures provide a detailed view of the CheZC peptide interaction both in the presence and absence of the phosphoryl analog, BeF{sub 3}{sup -}. Our studies reveal that two different modes of binding the CheZ{sub 200-214} peptide are dictated by the conformational state of CheY in the complex. Our structures suggest that the CheZ{sub C} helix binds to a 'meta-active' conformation of inactive CheY and it does so in an orientation that is distinct from the one in which it binds activated CheY. Our dual binding mode hypothesis provides implications for reverse information flow in CheY and extends previous observations on inherent resilience in CheY-like signaling domains.

  18. Helicobacter pylori CheZ(HP) and ChePep form a novel chemotaxis-regulatory complex distinct from the core chemotaxis signaling proteins and the flagellar motor.

    Science.gov (United States)

    Lertsethtakarn, Paphavee; Howitt, Michael R; Castellon, Juan; Amieva, Manuel R; Ottemann, Karen M

    2015-09-01

    Chemotaxis is important for Helicobacter pylori to colonize the stomach. Like other bacteria, H. pylori uses chemoreceptors and conserved chemotaxis proteins to phosphorylate the flagellar rotational response regulator, CheY, and modulate the flagellar rotational direction. Phosphorylated CheY is returned to its non-phosphorylated state by phosphatases such as CheZ. In previously studied cases, chemotaxis phosphatases localize to the cellular poles by interactions with either the CheA chemotaxis kinase or flagellar motor proteins. We report here that the H. pylori CheZ, CheZ(HP), localizes to the poles independently of the flagellar motor, CheA, and all typical chemotaxis proteins. Instead, CheZ(HP) localization depends on the chemotaxis regulatory protein ChePep, and reciprocally, ChePep requires CheZ(HP) for its polar localization. We furthermore show that these proteins interact directly. Functional domain mapping of CheZ(HP) determined the polar localization motif lies within the central domain of the protein and that the protein has regions outside of the active site that participate in chemotaxis. Our results suggest that CheZ(HP) and ChePep form a distinct complex. These results therefore suggest the intriguing idea that some phosphatases localize independently of the other chemotaxis and motility proteins, possibly to confer unique regulation on these proteins' activities. © 2015 John Wiley & Sons Ltd.

  19. An Insight into the Interaction Mode Between CheB and Chemoreceptor from Two Crystal Structures of CheB Methylesterase Catalytic Domain

    Energy Technology Data Exchange (ETDEWEB)

    K Cho; B Crane; S Park

    2011-12-31

    We have determined 2.2 {angstrom} resolution crystal structure of Thermotoga maritima CheB methylesterase domain to provide insight into the interaction mode between CheB and chemoreceptors. T. maritima CheB methylesterase domain has identical topology of a modified doubly-wound {alpha}/{beta} fold that was observed from the previously reported Salmonella typhimurium counterpart, but the analysis of the electrostatic potential surface near the catalytic triad indicated considerable charge distribution difference. As the CheB demethylation consensus sites of the chemoreceptors, the CheB substrate, are not uniquely conserved between T. maritima and S. typhimurium, such surfaces with differing electrostatic properties may reflect CheB regions that mediate protein-protein interaction. Via the computational docking of the two T. maritima and S. typhimurium CheB structures to the respective T. maritima and Escherichia coli chemoreceptors, we propose a CheB:chemoreceptor interaction mode.

  20. Investigating the role of CheA-3 in Dusulfovibrio Vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Ray, Jayashee; Keller, Kimberley; Krierim, Bernhard; Auer, Manfred; Keasling, Jay; Wall, Judy; Mukhopadhyay, Aindrila

    2010-05-22

    Multiple sets of chemotaxis genes including three cheA homologs were identified in the genome sequence of the anaerobic bacterium Desulfovibrio vulgaris Hildenborough. Each CheA is a histidine kinase (HK) and part of a two component signal transduction system. Knock out mutants in the three cheA genes were created using single cross-over homologous recombination insertion. We studied the phenotypes of the cheA mutants in detail and discovered that ?cheA-3 has a non swarming/swimming phenotype both in the soft agar plates and Palleroni chamber assays. CheA-3 shows similarity to the Shewanella oneidensis CheA-3 and the Vibrio cholerae CheA-2 that are responsible for chemotaxis in the respective organisms. We did not find any morphological or structural differences between the three Delta cheA mutants and the wild type cells in electron microscopy. Our results from these studies are presented.

  1. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  2. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  3. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    in generale, educativo che affronteremo nei paragrafi successivi. 7 ...... Comparison country. Countries whose mean score is NOT significantly different from the comparison country. 296. Japan. 288. Finland. 284. Netherlands. 280 .... potrebbero non perdere le competenze alfabetiche se il sistema educativo nazionale.

  4. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  5. Jacobo Machover, La face cachée du Che

    OpenAIRE

    Boisard, Stéphane

    2013-01-01

    S’attaquer aux mythes est une tâche prométhéenne et Jacobo Machover, dans son livre sur La face cachée du Che, en fait la cruelle expérience. S’il faut savoir gré à cet auteur de porter un regard sans complaisance sur la figure emblématique d’Ernesto Guevara de la Serna, il faut aussi s’interroger sur l’échec de son entreprise. À sa décharge et comme le confirme les commentaires – ou bien laudateurs ou bien injurieux – suscités par ce livre, il n’est pas aisé de proposer une lecture critique ...

  6. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  7. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  8. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  9. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  10. Donne che legano uomini. Quando gli uomini diventano vittime e le donne carnefici

    OpenAIRE

    Manuel M. (Marco Marsili)

    2012-01-01

    Dopo il fortunato successo di Gli uomini che sfigati, le donne che stronze, Manuel M. torna con le sue analisi al vetriolo sui rapporti tra i due sessi. In Donne che legano uomini l’autore mette a nudo lo spaccato femminile fatto di apparenza legata alla moda, alla chirurgia estetica, agli psicofarmaci. Come nel precedente pamphlet, anche qui la donna esce devastata, non tanto dagli interventi di chirurgia estetica, ma per i non-valori che rincorre: soldi, ancora soldi e solamente soldi. L’ob...

  11. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  12. Che-1 affects cell growth by interfering with the recruitment of HDAC1 by Rb.

    Science.gov (United States)

    Bruno, Tiziana; De Angelis, Roberta; De Nicola, Francesca; Barbato, Christian; Di Padova, Monica; Corbi, Nicoletta; Libri, Valentina; Benassi, Barbara; Mattei, Elisabetta; Chersi, Alberto; Soddu, Silvia; Floridi, Aristide; Passananti, Claudio; Fanciulli, Maurizio

    2002-11-01

    DNA tumor virus oncoproteins bind and inactivate Rb by interfering with the Rb/HDAC1 interaction. Che-1 is a recently identified human Rb binding protein that inhibits the Rb growth suppressing function. Here we show that Che-1 contacts the Rb pocket region and competes with HDAC1 for Rb binding site, removing HDAC1 from the Rb/E2F complex in vitro and from the E2F target promoters in vivo. Che-1 overexpression activates DNA synthesis in quiescent NIH-3T3 cells through HDAC1 displacement. Consistently, Che-1-specific RNA interference affects E2F activity and cell proliferation in human fibroblasts but not in the pocket protein-defective 293 cells. These findings indicate the existence of a pathway of Rb regulation supporting Che-1 as the cellular counterpart of DNA tumor virus oncoproteins.

  13. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  14. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  15. Revolutionary Leadership and Pedagogical Praxis: Revisiting the Legacy of Che Guevara.

    Science.gov (United States)

    McLaren, Peter

    1999-01-01

    Describes pedagogical foundations of Ernesto "Che" Guevara's revolutionary praxis, situating Guevara within a redemptive educational leadership model. Articulates Guevarian leadership within a historical materialist framework; presents a leadership model that addresses resistance to and transformation of global capitalist social…

  16. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  17. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  18. Production, characterization, and assessment of a stable analog of the response regulator CheY-phosphate from Thermotoga maritima.

    Science.gov (United States)

    Beyersdorf, Matthew S; Sircar, Ria; Lookadoo, Daniel B; Bottone, Cory J; Lynch, Michael J; Crane, Brian R; Halkides, Christopher J

    2017-08-01

    Phosphorylation of CheY promotes association with the flagellar motor and ultimately controls the directional bias of the motor. However, biochemical studies of activated CheY-phosphate have been challenging due to the rapid hydrolysis of the aspartyl-phosphate in vitro. An inert analog of Tm CheY-phosphate, phosphono-CheY, was synthesized by chemical modification and purified by cation-exchange chromatography. Changes in HPLC retention times, chemical assays for phosphate and free thiol, and mass spectrometry experiments demonstrate modification of Cys54 with a phosphonomethyl group. Additionally, a crystal structure showed electron density for the phosphonomethyl group at Cys54, consistent with a modification at that position. Subsequent biochemical experiments confirmed that protein crystals were phosphono-CheY. Isothermal titration calorimetry and fluorescence polarization binding assays demonstrated that phosphono-CheY bound a peptide derived from FliM, a native partner of CheY-phosphate, with a dissociation constant of ∼29 µM, at least sixfold more tightly than unmodified CheY. Taken together these results suggest that Tm phosphono-CheY is a useful and unique analog of Tm CheY-phosphate. © 2017 The Protein Society.

  19. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  20. The Azospirillum brasilense Che1 Chemotaxis Pathway Controls Swimming Velocity, Which Affects Transient Cell-to-Cell Clumping

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H.

    2012-01-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche. PMID:22522896

  1. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  2. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  3. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each data collected with the CheMin instrument.

  4. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  5. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  6. A crèche for CERN staff The Staff Association project

    CERN Document Server

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  7. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  8. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  9. Ranking goes international : Piloting the CHE ranking of study programmes in Flanders and the Netherlands

    NARCIS (Netherlands)

    Westerheijden, Donald F.; Federkeil, Gero; Cremonini, Leon; Kaiser, Franciscus; Beerkens-Soo, M.; Rostan, Michele; Vaira, Massimiliano

    2011-01-01

    The basic idea underlying the pilot project ‘CHE Ranking of European Universities’ is that the evolution of a common European Higher Education Area in the context of the Bologna process and a common European Research Area in the Lisbon strategy will lead to growing European mobility of students and

  10. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  11. Writing "Che" Writing: Apocryphal Diaries and the Deconstruction of Guevara's Myth

    Science.gov (United States)

    Weiser, Frans

    2013-01-01

    Ernesto "Che" Guevara's iconic photograph has taken on mythical proportions since his death. Though his image has ironically been exploited by the apparatus of capitalism against which he fought, his translation into a symbol has assured that his foothold within popular culture remains largely unassailable. While recent films and…

  12. [Construction and characterization of a recombinant mutant homolog of the CheW protein from Thermotoga petrophila RKU-1].

    Science.gov (United States)

    Grishin, D V; Zhdanov, D D; Gladilina, Ju A; Pokrovsky, V S; Podobed, O V; Pokrovskaya, M V; Aleksandrova, S S; Milyushkina, A L; Vigovskiy, M A; Sokolov, N N

    2018-01-01

    In the work a recombinant chemotaxis protein CheW from Thermotoga petrophila RKU-1 (TpeCheW) and its mutant homolog (TpeCheW-mut) were created. It was shown that, despite the low homology with CheW prototypes from intestinal bacteria, these proteins didn't cause metabolic overload and were well expressed by cells of E. coli laboratory strains. We have discovered a broad spectrum of industrial valuable properties of the TpeCheW-mut protein such as stability in a wide range of temperatures and pH, high expression level, solubility and possibility of the application of a simple low-stage purification methodology with the use of preliminary heat treatment. Possible directions of the scientific and industrial application of this protein were claimed.

  13. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  14. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  15. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  16. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  17. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  18. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  19. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  20. The 3.2 Å resolution structure of a receptor: CheA:CheW signaling complex defines overlapping binding sites and key residue interactions within bacterial chemosensory arrays.

    Science.gov (United States)

    Li, Xiaoxiao; Fleetwood, Aaron D; Bayas, Camille; Bilwes, Alexandrine M; Ortega, Davi R; Falke, Joseph J; Zhulin, Igor B; Crane, Brian R

    2013-06-04

    Bacterial chemosensory arrays are composed of extended networks of chemoreceptors (also known as methyl-accepting chemotaxis proteins, MCPs), the histidine kinase CheA, and the adaptor protein CheW. Models of these arrays have been developed from cryoelectron microscopy, crystal structures of binary and ternary complexes, NMR spectroscopy, mutational, data and biochemical studies. A new 3.2 Å resolution crystal structure of a Thermotoga maritima MCP protein interaction region in complex with the CheA kinase-regulatory module (P4-P5) and adaptor protein CheW provides sufficient detail to define residue contacts at the interfaces formed among the three proteins. As in a previous 4.5 Å resolution structure, CheA-P5 and CheW interact through conserved hydrophobic surfaces at the ends of their β-barrels to form pseudo 6-fold symmetric rings in which the two proteins alternate around the circumference. The interface between P5 subdomain 1 and CheW subdomain 2 was anticipated from previous studies, whereas the related interface between CheW subdomain 1 and P5 subdomain 2 has only been observed in these ring assemblies. The receptor forms an unexpected structure in that the helical hairpin tip of each subunit has "unzipped" into a continuous α-helix; four such helices associate into a bundle, and the tetramers bridge adjacent P5-CheW rings in the lattice through interactions with both P5 and CheW. P5 and CheW each bind a receptor helix with a groove of conserved hydrophobic residues between subdomains 1 and 2. P5 binds the receptor helix N-terminal to the tip region (lower site), whereas CheW binds the same helix with inverted polarity near the bundle end (upper site). Sequence comparisons among different evolutionary classes of chemotaxis proteins show that the binding partners undergo correlated changes at key residue positions that involve the lower site. Such evolutionary analyses argue that both CheW and P5 bind to the receptor tip at overlapping positions

  1. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  2. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  3. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  4. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  5. CheS-Mapper - Chemical Space Mapping and Visualization in 3D

    Directory of Open Access Journals (Sweden)

    Gütlein Martin

    2012-03-01

    Full Text Available Abstract Analyzing chemical datasets is a challenging task for scientific researchers in the field of chemoinformatics. It is important, yet difficult to understand the relationship between the structure of chemical compounds, their physico-chemical properties, and biological or toxic effects. To that respect, visualization tools can help to better comprehend the underlying correlations. Our recently developed 3D molecular viewer CheS-Mapper (Chemical Space Mapper divides large datasets into clusters of similar compounds and consequently arranges them in 3D space, such that their spatial proximity reflects their similarity. The user can indirectly determine similarity, by selecting which features to employ in the process. The tool can use and calculate different kind of features, like structural fragments as well as quantitative chemical descriptors. These features can be highlighted within CheS-Mapper, which aids the chemist to better understand patterns and regularities and relate the observations to established scientific knowledge. As a final function, the tool can also be used to select and export specific subsets of a given dataset for further analysis.

  6. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  7. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  8. Che-1 phosphorylation by ATM/ATR and Chk2 kinases activates p53 transcription and the G2/M checkpoint.

    Science.gov (United States)

    Bruno, Tiziana; De Nicola, Francesca; Iezzi, Simona; Lecis, Daniele; D'Angelo, Carmen; Di Padova, Monica; Corbi, Nicoletta; Dimiziani, Leopoldo; Zannini, Laura; Jekimovs, Christian; Scarsella, Marco; Porrello, Alessandro; Chersi, Alberto; Crescenzi, Marco; Leonetti, Carlo; Khanna, Kum Kum; Soddu, Silvia; Floridi, Aristide; Passananti, Claudio; Delia, Domenico; Fanciulli, Maurizio

    2006-12-01

    Che-1 is a RNA polymerase II-binding protein involved in the transcription of E2F target genes and induction of cell proliferation. Here we show that Che-1 contributes to DNA damage response and that its depletion sensitizes cells to anticancer agents. The checkpoint kinases ATM/ATR and Chk2 interact with Che-1 and promote its phosphorylation and accumulation in response to DNA damage. These Che-1 modifications induce a specific recruitment of Che-1 on the TP53 and p21 promoters. Interestingly, it has a profound effect on the basal expression of p53, which is preserved following DNA damage. Notably, Che-1 contributes to the maintenance of the G2/M checkpoint induced by DNA damage. These findings identify a mechanism by which checkpoint kinases regulate responses to DNA damage.

  9. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  10. Using Games To Teach Chemistry. 2. CHeMoVEr Board Game

    Science.gov (United States)

    Russell, Jeanne V.

    1999-04-01

    A board game similar to Sorry or Parcheesi was developed. Students must answer chemistry questions correctly to move their game piece around the board. As in most board games, the winner is the person who gets his or her piece to the center first. The game is currently being used in the laboratory about a month and a half into the General Chemistry course. While one student group works with nomenclature exercises on the computer, the other group plays CheMoVEr using two different card decks. The first deck contains questions on balancing equations and identifying the types of equations. The second contains questions on predicting products from given reactants. The questions are designed to have short answers to keep the game active and interesting. Three other decks have been developed and are available for student use throughout the semester; they contain questions on element symbols, polyatomic ions, and inorganic nomenclature.

  11. Cold fusion. A continuing discussion; Fusione fredda. Un dibattito che prosegue

    Energy Technology Data Exchange (ETDEWEB)

    Stremmenos, C. [Bologna Univ. (Italy). Dipt. di Chimica e Fisica Inorganica

    1999-04-01

    In this paper is briefly report on one of the many investigations concerning the interaction process in hydrogen/deuterium-transition metal system and it is discuss the existence and nature of the various surprising effects occasionally observed. The origin of the lack of reproducibility of these effects is attributed to the complexity of the phenomena involved. The possibility of an experimental approach aiming to remove the static and dynamic structural instabilities of the system in also examined. [Italian] Oltre al breve rapporto su una delle tante ricerche riguardanti i processi di interazione nei sistemi di idrogeno/deuterio-metalli di transizione, nell'articolo, viene valutata l'esistenza e la natura dei vari inattesi effetti sporadicamante osservati. Vengono inoltre attribuite alla complessita' del fenomeno, le cause principali della non riproducibilita' di questi effetti e si discutono possibili interventi di carattere sperimentale che rimuoverebbero le incertezze strutturali sia statiche sia dinamiche del sistema.

  12. Communication: The formation of CHe{sup 2+} by radiative association

    Energy Technology Data Exchange (ETDEWEB)

    Zicler, E.; Pauzat, F.; Chaquin, P.; Ellinger, Y., E-mail: ellinger@lct.jussieu.fr [Laboratoire de Chimie Théorique, Sorbonne Universités, UPMC Univ. Paris 06, UMR - CNRS 7616, F-75005 Paris (France); Bacchus-Montabonel, M.-C. [Institut Lumière Matière, UMR5306 Université Lyon1-CNRS, Université de Lyon, F-69622 Villeurbanne Cedex (France)

    2016-03-21

    The detection of ArH{sup +} has revived the interest in the search for noble gas containing species. Despite helium being the second most abundant element in the universe (He/H ∼ 1/10), it has never been observed in any other form than that of a neutral/ionized atom in the interstellar medium. Because He is the “most noble” gas, its non-observation as part of neutral molecular systems is understandable. It is more surprising for charged species, especially HeH{sup +} whose spectral signatures are well documented in the laboratory. The purpose of this work was to find a simple positive ion containing He, and likely to be observed as an alternative to undetected HeH{sup +}. Among the HeX{sup 2+} diatomics formed with first row atoms, we focused on X = C because of both its relative abundance and the magnitude of its ionization potentials with respect to He. The formation of CHe{sup 2+} by radiative association is the center of this study. The question was addressed by means of numerical simulations using high level ab initio calculations of the CHe{sup 2+} potential surface, followed by a quantum chemical determination of the rate coefficients for the corresponding radiative association in the range of 10 to 1000K. The radiative association path shows a potential well deep enough to accommodate 20 vibrational levels, and no barrier to oppose the reaction. The rate coefficient varies from ∼4.5 × 10{sup −20} cm{sup 3}s{sup −1} to ∼2.5 × 10{sup −22} cm{sup 3}s{sup −1} for the temperatures considered. The present study suggests that the existence of this species has to be searched for mainly in highly irradiated regions.

  13. CHeCS (Crew Health Care Systems): International Space Station (ISS) Medical Hardware Catalog. Version 10.0

    Science.gov (United States)

    2011-01-01

    The purpose of this catalog is to provide a detailed description of each piece of hardware in the Crew Health Care System (CHeCS), including subpacks associated with the hardware, and to briefly describe the interfaces between the hardware and the ISS. The primary user of this document is the Space Medicine/Medical Operations ISS Biomedical Flight Controllers (ISS BMEs).

  14. Travel as a Ritual toward Transformative Consciousness: Juxtaposing Che Guevara's Biography and Teacher Candidates' Narratives

    Science.gov (United States)

    Lea, YiShan

    2013-01-01

    This article discusses the development of critical consciousness by examining the biographical-narratives in relationship to the experiential accounts on travel. Biographical narratives are important cultural texts filled with history and cultural nuances. The biography of Ernesto Che Guevara has resonated with readers and viewers from around the…

  15. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  16. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  17. 14th EuCheMS International Conference on Chemistry and the Environment ICCE 2013: IEC-WTC, Barcelona, Spain, 25-28 June 2013.

    Science.gov (United States)

    Luis, Santiago V; Jover, Eric

    2014-10-01

    The 14th European Association of Chemical and Molecular Sciences (EuCheMS) International Conference on Chemistry and the Environment (ICCE 2013) took place on 25-28 June 2013 at the IEC and the WTC in Barcelona, Spain. The ICCE is a well-established biannual conference organized by the Division of Chemistry and the EuCheMS.

  18. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  19. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  20. Nutritional status of orang asli (che wong tribe) adults in krau wildlife reserve, pahang.

    Science.gov (United States)

    Haemamalar, K; Zalilah, M S; Neng Azhanie, A

    2010-04-01

    This is a descriptive study on nutritional status of Orang Asli (Che Wong tribe) adults in Krau Wildlife Reserve. Twenty-six households, comprising 29 men and 28 women,participated in the study. Dietary diversity was assessed using food frequency questionnaire with 37 food groups. Weight, height and waist circumference were measured using standard instruments. The mean age for men and women was 39.9 ± 17.1 years and 33.7 ± 16.1 years, respectively. Most (89.5%) of the adults had no formal education and about 89.5% of households were categorised as poor. There were 13.8% underweight, 72.4% normal, 10.3% overweight and 3.3% obese men. For women, 25.0%, 46.4%, and 28.6% were underweight, normal and overweight, respectively. While none of the men had at-risk waist circumference (men >90 cm), about 21.4% of women had waist circumference of >80 cm. The mean dietary diversity score was 9.47 ± 4.15 with men (9.48 ± 3.70) and women (9.46 ± 4.63) having similar scores. There was a significant correlation between waist circumference and household income (r=0.36, pOrang Asli community undergoing nutrition transition especially among the females.

  1. Autre légume, autres lieux. La mâche dans le bassin maraîcher nantais

    OpenAIRE

    Jousseaume, Valérie; Margetic, Christine

    2009-01-01

    Cet article vise à montrer comment la spécialisation du bassin maraîcher nantais vers la mâche rend possible une modification de la zone de culture. On pourrait parler ici de la fin du terroir maraîcher au sens agronomique. Dans le même temps, cet essor de la production de mâche, associé à un contexte de reprise de l’étalement résidentiel issu de l’agglomération nantaise, produit une faim de terres maraîchères et des conflits d’usage entre agriculteurs. Ces stratégies territoriales, fortes ve...

  2. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  3. CheNER: a tool for the identification of chemical entities and their classes in biomedical literature.

    Science.gov (United States)

    Usié, Anabel; Cruz, Joaquim; Comas, Jorge; Solsona, Francesc; Alves, Rui

    2015-01-01

    Small chemical molecules regulate biological processes at the molecular level. Those molecules are often involved in causing or treating pathological states. Automatically identifying such molecules in biomedical text is difficult due to both, the diverse morphology of chemical names and the alternative types of nomenclature that are simultaneously used to describe them. To address these issues, the last BioCreAtIvE challenge proposed a CHEMDNER task, which is a Named Entity Recognition (NER) challenge that aims at labelling different types of chemical names in biomedical text. To address this challenge we tested various approaches to recognizing chemical entities in biomedical documents. These approaches range from linear Conditional Random Fields (CRFs) to a combination of CRFs with regular expression and dictionary matching, followed by a post-processing step to tag those chemical names in a corpus of Medline abstracts. We named our best performing systems CheNER. We evaluate the performance of the various approaches using the F-score statistics. Higher F-scores indicate better performance. The highest F-score we obtain in identifying unique chemical entities is 72.88%. The highest F-score we obtain in identifying all chemical entities is 73.07%. We also evaluate the F-Score of combining our system with ChemSpot, and find an increase from 72.88% to 73.83%. CheNER presents a valid alternative for automated annotation of chemical entities in biomedical documents. In addition, CheNER may be used to derive new features to train newer methods for tagging chemical entities. CheNER can be downloaded from http://metres.udl.cat and included in text annotation pipelines.

  4. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  5. Characteristics of cyclones causing extreme sea levels in the northern Baltic Sea** The study was supported by the Estonian Ministry of Education and Research (IUT20-11 and Grant ETF9134 and by the EU Regional Development Foundation, Environmental Conservation and Environmental Technology R&D Programme Project No. 3.2.0801.12-0044.

    Directory of Open Access Journals (Sweden)

    Piia Post

    2014-01-01

    Full Text Available The basic parameters of extra-tropical cyclones in the northern Baltic are examined in relation to extreme sea level events at Estonian coastal stations between 1948 and 2010. The hypothesis that extreme sea level events might be caused not by one intense extra-tropical cyclone, as suggested by earlier researchers, but by the temporal clustering of cyclones in a certain trajectory corridor, is tested. More detailed analysis of atmospheric conditions at the time of the two most extreme cases support this concept: the sequence of 5 cyclones building up the extreme sea level within about 10 days was very similar in structure and periodicity.

  6. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  7. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  8. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  9. Coordinated Analyses of Antarctic Sediments as Mars Analog Materials Using Reflectance Spectroscopy and Current Flight-Like Instruments for CheMin, SAM and MOMA

    Science.gov (United States)

    Bishop, Janice L.; Franz, Heather B.; Goetz, Walter; Blake, David F.; Freissinet, Caroline; Steininger, Harald; Goesmann, Fred; Brinckerhoff, William B.; Getty, Stephanie; Pinnick, Veronica T.; hide

    2013-01-01

    Coordinated analyses of mineralogy and chemistry of sediments from the Antarctic Dry Valleys illustrate how data obtained using flight-ready technology of current NASA and ESA missions can be combined for greater understanding of the samples. Mineralogy was measured by X-ray diffraction (XRD) and visible/ near-infrared (VNIR) reflectance spectroscopy. Chemical analyses utilized a quadrupole mass spectrometer (QMS) to perform pyrolysis-evolved gas analysis (EGA) and gas chromatography-mass spectrometry (GC/MS) both with and without derivatization, as well as laser desorption-mass spectrometry (LD/MS) techniques. These analyses are designed to demonstrate some of the capabilities of near-term landed Mars missions, to provide ground truthing of VNIR reflectance data acquired from orbit by the Compact Reconnaissance Imaging Spectrometer for Mars (CRISM) on MRO and to provide detection limits for surface- operated instruments: the Chemistry and Mineralogy (CheMin) and Sample Analysis at Mars (SAM) instrument suites onboard Mars Science Laboratory (MSL) and the Mars Organic Molecule Analyzer (MOMA) onboard ExoMars-2018. The new data from this study are compared with previous analyses of the sediments performed with other techniques. Tremolite was found in the oxic region samples for the first time using the CheMin-like XRD instrument. The NIR spectral features of tremolite are consistent with those observed in these samples. Although the tremolite bands are weak in spectra of these samples, spectral features near 2.32 and 2.39 micrometers could be detected by CRISM if tremolite is present on the martian surface. Allophane was found to be a good match to weak NIR features at 1.37-1.41, 1.92, and 2.19 micrometers in spectra of the oxic region sediments and is a common component of immature volcanic soils. Biogenic methane was found to be associated with calcite in the oxic region samples by the SAM/EGA instrument and a phosphoric acid derivative was found in the anoxic

  10. Technology.

    Science.gov (United States)

    Online-Offline, 1998

    1998-01-01

    Focuses on technology, on advances in such areas as aeronautics, electronics, physics, the space sciences, as well as computers and the attendant progress in medicine, robotics, and artificial intelligence. Describes educational resources for elementary and middle school students, including Web sites, CD-ROMs and software, videotapes, books,…

  11. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Document Server

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  12. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  13. “Altrove che nella verità?”. Filosofia, scienza e vita nel pensiero di Georges Canguilhem

    Directory of Open Access Journals (Sweden)

    Daniele Poccia

    2011-10-01

    Full Text Available Secondo Georges Canguilhem non c’è verità se non quella prodotta e non scoperta dalla scienza. È il valore stesso della filosofia ad essere “altrove che nella verità”. Questo valore non veritativo risiede forse, per il pensatore francese, in qualcosa che egli definisce come un senso o un concetto iscritto materialmente nella vita. È il vivente stesso, quel vivente di cui la scienza in quanto ricerca della verità è a sua volta una semplice espressione, a contenere il concetto, o meglio, ad essere il movimento stesso della concettualizzazione. “Elsewherethan in the truth?” Philosophy, science and life in Georges Canguilhem'sthought. Accordingto Georges Canguilhem thereis no truththan the oneyieldedbutnotdiscoveredby science. Being “Elsewherethan in the truth” is the valueitselfofphilosophy”. For the Frenchthinker, this no truthfulvaluemaylie in somethinghedefines a sense or conceptmateriallywritten in the life. It's the living phenomenaitself, ofwhich science assearchfor the truthis at sametime a simpleexpression, thatcontains the concept or evenbetter, thatis the movementofconceptualization.

  14. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  15. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  16. Del posto dialettometrico che spetta ai punti galloitalici Aidone, Sperlinga e San Fratello nel sistema della rete dell'AIS

    Directory of Open Access Journals (Sweden)

    Hans Goebl

    2010-12-01

    Full Text Available La rete dell’atlante italo-svizzero AIS comprende sette isole linguistiche tra cui tre sono di natu- ra alloglotta (relative cioè al greco ed all’albanese mentre cinque sono di origine romanza. In tre delle isole linguistiche romanze, tutte ubicate in Sicilia, si parlano ancora dialetti galloitalici: si tratta delle località di Aidone (P.-AIS 865, San Fratello (P.-AIS 817 e Sperlinga (P.-AIS 836. è ben risaputo che l’origine storica di queste isole risale all’Alto Medioevo (XII–XIII secoli e che la patria dei rispettivi coloni alto-medievali si trovava nella zona di contatto situata tra il Piemonte meridionale, la Liguria settentrionale e la contigua Emilia occidentale. Nel corso della dialettometrizzazione della totalità dei dati dell’AIS – svoltasi a Salisburgo negli anni 2005–2009 – si è presentata l’opportunità di esaminare, tramite tutti gli strumenti dialettometrici attualmente a disposizione, tanto la posizione (quantitativa relazionale dei dialetti galloitalici delle suddette tre località nella rete dell’AIS, quanto quella di alcuni dialetti siciliani limitrofi. I risultati delle rispettive analisi sono molto sfumati e dimostrano chiaramente la comples- sità dell’inserzione delle parlate galloitaliche nel diasistema siciliano: vengono presentati tra- mite 16 carte dialettometriche a colore, ciascuna delle quali è accompagnata di appositi spiega- zioni e commenti dialettometrici e linguistici.

  17. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  18. Technology

    Directory of Open Access Journals (Sweden)

    Xu Jing

    2016-01-01

    Full Text Available The traditional answer card reading method using OMR (Optical Mark Reader, most commonly, OMR special card special use, less versatile, high cost, aiming at the existing problems proposed a method based on pattern recognition of the answer card identification method. Using the method based on Line Segment Detector to detect the tilt of the image, the existence of tilt image rotation correction, and eventually achieve positioning and detection of answers to the answer sheet .Pattern recognition technology for automatic reading, high accuracy, detect faster

  19. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  20. Che cosa comporta introdurre nuove tecnologie didattiche a scuola : un modello

    Directory of Open Access Journals (Sweden)

    Alessandro Antonietti

    2009-01-01

    Full Text Available This article discusses a model on the set of factors that come into play in seguitodell'introduzione to school for a new educational technology. The model regards the relations between gliobiettivi or needs that motivate the adoption of a new educational tool, the choice of this instrument, the way it is impiegatoe the effects it produces. The model also takes into account the relationship between the individual and social representations sisviluppano about the needs and objectives of the technological tool, its use and changes induce.Vengono discussed the implications of the model for the management of these complex relationships in the school context.

  1. [Textual research on Han-Chinese formulae collected in Tubo medical manuscript unearthed in 'Bum-pa-Che Tower].

    Science.gov (United States)

    Liu, Y H; Nong, H C

    2016-11-28

    A Tibetan manuscript with title of Sman - dpyad gces - pa grub - pa kun -' dus - pa in the Collection of Practiced Medical Quintessence , was found in the basement of a Buddhist tower named ' Bum - pa - che in Lhokha (Shannan), Tibet. It contains a purgative recipe of TCM with its title "Powder of Han Region" and several ingredients in Chinese transliteration. Based upon the rule of medieval Chinese system of pronunciation with reference of related texts and studies, a textual research identifies it as a kind of Maren (seed of Cannabis sativa L. ) wan in TCM. Although no identical formulae of its kind has been found in extant literature of TCM prior to the Song Dynasty(960 AD), yet its ingredients, pharmaceutical preparation and efficacy are very similar to the Modified maren wan , the variant formulae of Maren wan in Wai tai mi yao ( Arcane Essentials from the Imperial Library ) of the Tang Dynasty.

  2. The Huguenot identity in 19th century music: The "Sechs Sprüche zum Kirchenjahr" by Felix Mendelssohn

    Directory of Open Access Journals (Sweden)

    Robert Weeda

    2012-01-01

    Full Text Available Hierdie artikel gaan oor die komponiste Felix Mendelssohn en Giacomo Meyerbeer. Meyerbeer die komponis van die opera Les Huguenots, en Mendelssohn, 'n Jood wat 'n "Calvinis" geword het. Meyerbeer vertel in die opera (1836, geanker aan die Lutherse melodie "'n Vaste Burg is onse God" die verhaal van die Bartolomeusnagmoorde. Mendelssohn, 'n bekeerling tot die sg Hugenote-religie, verwoord sy opregte geloof gedurende die jare 1843-1846 in die voortreflike musikaleuitdrukkings Sechs Sprüche zum Kirchenjahr (Ses Spreuke vir die Kerkjaar wat opgeneem is in die gereformeerde liturgie vir die Brandenburg gemeente. Op 'n bepaalde manier vertel albei komponiste ons iets van die Hugenote-identiteit in die negentiende-eeuse musiek.

  3. Retóricas del Che muerto: entre la información y significación

    Directory of Open Access Journals (Sweden)

    Cossia, Lautaro

    2012-01-01

    Full Text Available [es] Este trabajo propone comparar el uso de una misma imagen como estrategias de cierre organizadas sobre diferentes materias significantes: el rostro congelado de Ernesto Che Guevara con que culmina la película “La hora de los hornos”, obra de Octavio Getino y Fernando Solanas estrenada en Italia en 1968, y la imagen del guerrillero asesinado en la viñeta final de la historieta “La vida del Che”, biografía dibujada de Héctor Oesterheld y Alberto Breccia publicada ese mismo año. Dicho recorte analítico tiene el propósito de observar las gramáticas visuales puestas en juego en el marco de un proceso histórico que reconoce nuevos modos de socialización del arte y un contorno político que carga de significados la resolución de ambas obras. [en] This paper proposes to compare the use of the same image as strategies of closure organized on different “significant materials”: the frozen face of Ernesto Che Guevara with which the film “The Hour of the Furnaces” ends, movie of Fernando Solanas and Octavio Getino that was released in Italy in 1968, and the image of the murdered “guerrillero” in the final vignette of the comic “The life of Che”, biography drawn by Hector Oesterheld and Alberto Breccia and published the same year. This selection in the analysis proposes to observe the “visual grammars” that have played in the framework of one historical process which recognizes new manners of socialization of art and a political outline that charge of meanings the resolution of both works.

  4. L'immagine visibile di un Dio che può essere: Michel Henry e Richard Kearney in dialogo

    Directory of Open Access Journals (Sweden)

    Jonah M. Ford

    2015-07-01

    Full Text Available   This article attempts an exploration of Michel Henry’s I Am the Truth and Richard Kearney’s The God Who May Be, as each appropriate the Husserlian critique of Kantian epistemology. Although Henry and Kearney both develop a Christian theology rooted in this Husserlian inheritance, their explication of the truths Christianity asserts is strikingly different. It is the assertion of this essay that this difference is primarily a textual one; or, to put it another way, it is conditioned first by their scriptural gaze.Cet article se propose de reprendre le contenu de Michel Henry, C’est moi, la vérité et Richard Kearney The God Who May Be, dans lesquels les auteurs analysent la critique husserlienne de l’épistémologie kantienne. Bien que Henry et Kearney tous les deux développent une théologie chrétienne enracinée dans cet héritage husserlien, leur explication des vérités affirmées du Christianisme est très différente. Pour nous, la différence entre eux est de type textuel, c’est à dire qu’elle dépend de l’analyse qu’ils font de la Sainte Écriture.Questo articolo si propone di riprendere il contenuto dei testi Io sono la verità di Michel Henry e The God Who May Be di Richard Kearney, nei quali i rispettivi autori analizzano la critica husserliana dell'epistemologia di Kant. Sebbene entrambi sviluppano una "teologia" cristiana radicata in questa eredità husserliana, la loro spiegazione delle verità cristiane è alquanto differente. Per noi, la differenza tra essi è di tipo testuale, vale a dire che dipende dall'analisi che essi fanno del testo biblico.

  5. Préparation galénique d'une forme sèche d'un antianémique à base ...

    African Journals Online (AJOL)

    Préparation galénique d'une forme sèche d'un antianémique à base d'une plante médicinale camerounaise: Alchorneacordifolia (EUPHORBIACEAE). EN Nga, EM Mpondo, SD Dibong, A Tchienda, G Agbor, M Messi, S Kaltjob ...

  6. Extraction assistée par enzyme du jus de la pulpe fraîche du rônier ...

    African Journals Online (AJOL)

    Extraction assistée par enzyme du jus de la pulpe fraîche du rônier (Borassus aethiopum Mart.) acclimaté au Benin : caractérisation physico-chimique et microbiologique. ES Adjou, H Amamion, FP Tchobo, VM Aissi, MM Soumanou ...

  7. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  8. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  9. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  10. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  11. In che modo abbiamo bisogno della popular music? Riflessioni su interstizi e spazi disciplinari, in luogo di un'introduzione

    Directory of Open Access Journals (Sweden)

    Alessandro Bratus

    2017-05-01

    Full Text Available L’obiettivo di questo numero monografico è esaminare l’area di significati evocata dall’espressione "popular music", mostrandone i risvolti e i sottintesi negli studi musicali attuali. Si tratta di un’esigenza particolarmente urgente in un momento come quello presente, nel quale i cambiamenti nelle modalità di produzione e circolazione della musica causate dalla diffusione delle tecnologie digitali hanno accelerato il processo di convergenza tra istanze originariamente autonome. Per illustrare il taglio e presentare i contributi proposti nel volume, in questo testo introduttivo vorrei delineare le linee di sviluppo della discussione riguardante due questioni tra loro correlate: da un lato lo statuto interdisciplinare degli studi sulla popular music, e dall’altro lato la possibilità che questi possano definire un’unità disciplinare identificabile come popular music studies, separata dagli altri ambiti degli studi musicali. Se infatti la locuzione "popular music", intesa come «terzo tipo di musica» [Scott 2009, 4], è una formazione discorsiva storicamente determinata, e conseguente alle mutate condizioni di produzione alla fine del XIX secolo, non si vede ragione per non provare a definire quali pratiche musicali siano incluse al suo interno dopo le trasformazioni radicali avvenute tra la fine del XX e l’inizio del XXI secolo, e quali strumenti concettuali e metodologici siano più appropriati per affrontarle.

  12. Estágio de doutorando (sanduíche em enfermagem: uma experiência em Portugal

    Directory of Open Access Journals (Sweden)

    Karla Maria Carneiro

    2007-04-01

    Full Text Available Durante o transcorrer do nosso aprimoramento científico, pessoal e profissional, no curso de Doutorado fomos contempladas pela Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES, por meio de concurso nacional, com um Estágio de Doutorando (Sanduíche na cidade do Porto, em Portugal. O desenvolvimento do Projeto O Cuidado Humanístico de Enfermagem ao Recém-Nascido na Unidade de Internação Neonatal: experiência de intercâmbio em Portugal, ocorreu no período de setembro a dezembro de 2005 e constou de uma observação participante junto a 10 enfermeiros de Unidades de Cuidados Intensivos Neonatais, atuantes em duas instituições hospitalares da cidade do Porto, quanto aos cuidados ao recém-nascido, sob a perspectiva humanística à luz da Teoria Humanística de Enfermagem, de Paterson e Zderad (1976. Ressaltamos a importância deste intercâmbio para a ampliação da Enfermagem Neonatal e o crescimento humano e profissional dos enfermeiros como capazes de repensar o fazer e o ser e participar, com todos os envolvidos, de uma nova maneira de cuidar de forma humanizada em Enfermagem, na pesquisa e no ensino.

  13. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    Science.gov (United States)

    Shi, Jade; Nobrega, R. Paul; Schwantes, Christian; Kathuria, Sagar V.; Bilsel, Osman; Matthews, C. Robert; Lane, T. J.; Pande, Vijay S.

    2017-03-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. Here, we report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. This prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. Using these results, we then predict incisive single molecule FRET experiments as a means of model validation. This study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  14. Un'aggiunta autografa per la cronologia di "Arechisi iudex cibitatis Capuane" [luglio 936: la più antica sottoscrizione del giudice che emise il celeberrimo placito capuano del 960

    OpenAIRE

    Dell'Omo, Mariano

    1998-01-01

    L'esame dei documenti compresi nel fondo pergamenaceo del monastero di S. Liberatore alla Maiella, che fu una delle più grandi prepositure dipendenti da Montecassino, ha offerto la possibilità di rilevare un intervento autografo e un dato cronologico il cui valore è finora sfuggito sia agli studiosi che hanno conosciuto il documento originale qui illustrato, sia alla più ampia schiera di coloro che, a partire dalla prima edizione datane dall'archivista cassinese Erasmo Gattola, hanno rivolto ...

  15. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  16. Valutazione dell'efficacia terapeutica di agenti che regolano il processo epigenetico di controllo dell'espressione genica nei sarcomi ossei

    OpenAIRE

    Cristalli, Camilla

    2017-01-01

    L'identificazione di nuove strategie terapeutiche contro i sarcomi ossei rappresenta un obiettivo primario per il trattamento dei pazienti refrattari ai comuni agenti chemioterapici. Sia l’osteosarcoma (OS) che il sarcoma di Ewing (EWS), due fra i più comuni tumori ossei primari, derivano dalla trasformazione di cellule staminali mesenchimali (MSC) e/o progenitori osteoblastici in qualsiasi fase del differenziamento. La perdita del differenziamento è una caratteristica biologica specifica di ...

  17. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  18. X-Ray Diffraction Reference Intensity Ratios of Amorphous and Poorly Crystalline Phases: Implications for CheMin on the Mars Science Laboratory

    Science.gov (United States)

    Morris, R. V.; Achilles, C. N.; Chipera, S. J.; Ming, D. W.; Rampe, E. B.

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. Piezoelectric vibration of the cell is used to randomize the sample to reduce preferred orientation effects. Instrument details are provided in [1, 2, 3]. Analyses of rock and soil samples by the Mars Exploration Rovers (MER) show nanophase ferric oxide (npOx) is a significant component of the Martian global soil [4] and is thought to be one of the major contributing phases that the Curiosity rover will encounter if a soil sample is analyzed in Gale Crater. Because of the nature of this material, npOx will likely contribute to an X-ray amorphous or short-order component of a XRD pattern measured by the CheMin instrument.

  19. Che cosa (non è rimasto della francesità?: addomesticamento e straniamento nelle traduzioni italiana e slovena di Les fleurs bleues di Raymond Queneau

    Directory of Open Access Journals (Sweden)

    Martina Ožbot

    2013-12-01

    Full Text Available Nel presente contributo vengono offerte alcune riflessioni sulla traduzione di aspetti culturalmente specifici nel testo letterario, e in particolare sulle versioni italiana e slovena del romanzo Les Fleurs bleues di Raymond Queneau, che sono opera rispettivamente di Italo Calvino e di Ana Barič Moder. Al centro dellʼattenzione è soprattutto la dicotomia traduttiva tra lʼapproccio straniante e quello domesticante. Un esame del testo originale e delle due traduzioni ha dimostrato che ambedue i traduttori si sono sforzati di preservare i caratteri della cultura di partenza iscritti nel romanzo queneauiano. Allo stesso tempo, però, hanno cercato di integrare le proprie versioni negli ambienti dʼarrivo quando ciò pareva necessario per rendere possibile il pieno funzionamento delle due traduzioni come opere letterarie che, nei specifici contesti italiano e sloveno, sono destinate ad avere la funzione di entità letterarie a sé stanti, cioè indipendenti dal loro primario legame con il testo di partenza francese. Fatte queste premesse, lʼapproccio generale dei due traduttori può essere caratterizzato come relativamente addomesticante, anche se in entrambe le versioni, e in particolare in quella italiana, viene concesso ampio spazio anche allo straniamento, purché esso non incrini la funzionalità della traduzione.

  20. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  1. Prognostischer Wert der Fläche und Dichte von Lymphgefäßen bei kutanem Plattenepithelkarzinom.

    Science.gov (United States)

    Krediet, Jorien Tannette; Kanitakis, Jean; Bob, Adrienne; Schmitter, Julia; Carine Krediet, Annelot; Röwert, Joachim; Stockfleth, Eggert; Painsi, Clemens; Hügel, Rainer; Terhorst, Dorothea; Lange-Asschenfeldt, Bernhard

    2016-11-01

    Kutane Plattenepithelkarzinome (SCC) sind bekannt für ihre Fähigkeit, über Lymphgefäße zu metastasieren. In neueren Studien wird das Ausmaß der Lymphangiogenese als möglicher prognostischer Faktor bei einigen Hauttumoren genannt. Ziel dieser Studie war die Quantifizierung der Lymphangiogenese bei SCC entweder durch computergestützte Bildanalyse oder mithilfe der Zählmethode nach Chalkley. Gefäßparameter wurden im Hinblick auf ihre Vorhersagekraft für die Bildung von Tumormetastasen beurteilt und verglichen. In dieser Fallkontrollstudie wurden die klinischen und histologischen Daten von jeweils 15 SCC-Patienten mit bzw. ohne Metastasen retrospektiv analysiert. In den SCC-Proben wurde der für das Lymphendothel spezifische Marker D2-40 und der pan-vaskuläre Marker CD31 immunhistochemisch angefärbt und durch computergestützte morphometrische Bildanalyse in Hotspots sowie mithilfe der digitalisierten Zählmethode nach Chalkley analysiert. Die Dichte von Lymphgefäßen, die relative Lymphgefäßfläche und die mit der Chalkley-Methode ermittelte Zahl an Lymphgefäßen (Chalkley-Count) waren bei metastasierten SCC signifikant erhöht. Die Tumordicke war bei metastasierten SCC signifikant höher und besaß die höchste Vorhersagekraft für eine Metastasierung. Die Tumordicke war ein signifikanter Prädiktor für Lymphangiogeneseparameter. Die Lymphangiogenese ist bei metastasierten SCC erhöht, doch ihr Ausmaß wird von der Tumordicke beeinflusst. Die Tumordicke bildet weiterhin den zuverlässigsten prädiktiven Faktor für die Metastasierung. © 2016 Deutsche Dermatologische Gesellschaft (DDG). Published by John Wiley & Sons Ltd.

  2. The proportion of in utero transfers (IUT) significantly influences outcome among a preterm delivery population

    LENUS (Irish Health Repository)

    Wall, V

    2011-02-01

    Institute of Obstetricians & Gynaecologists, RCPI Four Provinces Meeting, Junior Obstetrics & Gynaecology Society Annual Scientific Meeting, Royal Academy of Medicine in Ireland Dublin Maternity Hospitals Reports Meeting, Nov 2010

  3. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... effluent treatment plant indicated that the increased temperature observed in the lagoon emanated from the station. The conductivity of the water samples varied between 164 ╡S/cm - 600 ╡S/cm. The conductivity values are useful indication of ionic solutes present. The results showed that the downstream.

  4. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  5. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  6. European Analytical Column no. 38 from the Division of Analytical Chemistry (DAC of the European Association for Chemical and Molecular Sciences (EuCheMS, January 2010

    Directory of Open Access Journals (Sweden)

    BO KARLBERG

    2010-04-01

    Full Text Available The Euroanalysis conference series constitutes the cornerstone activity of the Division of Analytical Chemistry (DAC of the European Association for Chemical and Molecular Sciences (EuCheMS. Hence this column reports on the last Euroanalysis conference held in Innsbruck, Austria, in September 2009. The present column also follows up the pattern from the previous two columns; namely to invite a European analytical chemist to give his or her view on a certain topic of interest. This time Professor Paul Worsfold gives his personal view on water quality in the developing world.

  7. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  8. A Modular Approach to Integrating Biofuels Education into ChE Curriculum Part I--Learning Materials

    Science.gov (United States)

    He, Q. Peter; Wang, Jin; Zhang, Rong; Johnson, Donald; Knight, Andrew; Polala, Ravali

    2016-01-01

    In view of potential demand for skilled engineers and competent researchers in the biofuels field, we have identified a significant gap between advanced biofuels research and undergraduate biofuels education in chemical engineering. To help bridge this gap, we created educational materials that systematically integrate biofuels technologies into…

  9. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  10. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  11. Sequence comparison of phoR, gyrB, groEL, and cheA genes as phylogenetic markers for distinguishing Bacillus amyloliquefaciens and B. subtilis and for identifying Bacillus strain B29.

    Science.gov (United States)

    Yu, C; Jin, J; Meng, L-Q; Xia, H-H; Yuan, H-F; Wang, J; Yu, D-S; Zhao, X-Y; Sha, C-Q

    2017-05-20

    Given the close genetic relationship between Bacillus amyloliquefaciens and B. subtilis, distinguishing the two solely based on their physiological and biochemical characteristics and 16S rRNA sequences is difficult. Molecular identification was used to discover suitable genes for distinguishing the two bacteria, and to identify the bio-controlling strain B29, due to molecular identification has been paid more and more attention. The similarity of four genes, cheA, gyrB, groEL and phoR, of the two species was compared by the software BLASTN and MAGA, and phylogenetic tree was constructed. The B29 strain was re-identified by using the screened genes. The similarities of the four genes, gyrB, groEL, cheA and phoR, of the two species were 93-95%, 82-84%, 76-78% and 76-77%, respectively. The homologies of the four genes of the strain B29 and the strains of B. amyloliquefaciens strains were more than 95%. We determined how well the phoR and cheA genes could be used to differentiate B. amyloliquefacien and B. subtilis. The previously isolated biological control strain B29, initially classified as B. subtilis, was re-classified as B. amyloliquefaciens. Our data indicate that other than the phoR gene, the cheA gene might be a useful phylogenetic marker for differentiating B. subtilis and B. amyloliquefaciens.

  12. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  13. Geochemical characteristics of fault core and damage zones of the Hong-Che Fault Zone of the Junggar Basin (NW China) with implications for the fault sealing process

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Pei, Yangwen; Liu, Bo; Guo, Jianxun

    2017-08-01

    Faults may have a complex internal structure, including fault core and damage zone, and can act as major conduits for fluid migration. The migration of fluids along faults is generally associated with strong fluid-rock interaction, forming large amounts of cement that fill in the fractures. The cementation of the fault fractures is considered to be one of the important parameters of fault sealing. The different components of faults have diverse geochemical features because of varying physical characteristics. The investigation of the geochemical characteristics of the fault and damage zones could provide important information about the fault sealing process, which is very important in oil and gas exploration. To understand the fault-cemented sealing process, detailed geochemical studies were conducted on the fault and damage zones of the Hong-Che Fault of the northwestern Junggar Basin in China. The major and trace element data of our study suggest that the fault core is characterized by higher loss on ignition (LOI), potassium loss, Chemical Index of Alteration (CIA), and Plagioclase Index of Alteration (PIA) values and lower high field strength element (HFSE), large-ion lithosphile element (LILE), and rare earth element (REE) concentrations compared with the damage zone, implying more serious elemental loss and weathering of the fault core compared with the damage zone during faulting. The carbon and oxygen isotope data reveal that the cement of the Hong-Che Fault Zone formed due to multiple sources of fluids. The fault core was mainly affected by deep sources of hydrothermal fluids. In combination with previous studies, we suggest a potential fault-cemented sealing process during the period of fault movement. The fault core acts as the fluid conduit during faulting. After faulting, the fault core is cemented and the damage zone becomes the major conduit for fluid migration. The cementation firstly occurs on two sides of the damage zone in the upper part of the

  14. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  15. Un rilievo sotto sopra Modelli digitali 3D ad alta definizione sia dei fondali che delle coste

    Directory of Open Access Journals (Sweden)

    Codevintec Italiana Srl Codevintec Italiana Srl

    2009-03-01

    Full Text Available An upside down survey: shores and sea bed hi-res 3D digital models Laser scanning and interferometric bathymetry represent the cutting edge of coastal survey technology and can be very beneficial for mapping complicated waterside areas. The similarity of the data provided by the two systems (point cloud and intensity value make it easy to integrate the two surveys using PolyWorks commercial software. The final product is a single 3D model made up of bathymetry and topography. Since 2004 Codevintec tested the integration of these two methodologies, carrying out a number of high resolution surveys, generating a complete and accurate digital model of areas both above and below water level, a result inimitable by any other topographical survey method. The 3D-laser scanner was an Optech ILRIS-ER that allows scanning in dynamic from the boat while a SEA SWATHplus-H wide swathsonar system was used to collect underwater topography. A combined GPS and inertial platform (Applanix POS/MV 320 is used to measure position and 3D attitude of the two sensors during the survey.

  16. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  17. PCBs attenuation and abundance of Dehalococcoides spp., bphC, CheA, and flic genes in typical polychlorinated biphenyl-polluted soil under floody and dry soil conditions.

    Science.gov (United States)

    Hashmi, Muhammad Zaffar; Qin, Zhihui; Yao, Xiaoyan; Ahmed, Zulkifl; Xiaomei, Su; Shen, Chaofeng; Tang, Xianjin

    2016-02-01

    This study investigates PCBs attenuation and the abundance of active polychlorinated-degrading Dehalococcoides spp. biphenyl dioxygenase (bphC), chemotaxis (CheA), and flagellum (flic) genes in floody and dry soil conditions polluted with polychlorinated biphenyls. The results revealed that total PCBs, high chlorinated PCBs (>4 cl), and less chlorinated PCBs (<4 cl) decreased with the passage of time in floody and dry soil conditions. The reduction of total PCBs (13.87%) and less chlorinated PCBs (15.39%) was more in dry soil than floody soil, while high chlorinated PCBs showed more reduction in floody soil (8.06%) than dry soil. Dehaloccoides spp., bphC, CheA, and flic genes indicated temporal dynamics in abundance in floody and dry soil conditions. The highest abundance was 1.6 × 10(9), 3.7 × 10(4), and 3.6 × 10(2) copies in floody and 1.6 × 10(4) copies in dry soil for Dehalococcoides spp., bphC, CheA, and flic, respectively. Multivariate statistics (RDA) revealed that Dehaloccoides spp. were positively influenced by the higher chlorinated PCBs and soil physical properties, CheA gene with floody soil, flic gene with total PCBs and less chlorinated PCBs, and bphC gene was affected with moisture contents and less chlorinated PCBs. This study provides new insight in the attenuation of PCBs and the abundance of active Dehalococcoides spp. and genes in PCBs polluted soil under floody and dry soil conditions.

  18. Quality of the Fosso della Casaccia: analysis of the macroinvertebrates colonizing artificial substrates; Stato di qualita` del fosso della Casaccia: analisi dei macroinvertebrati che colonizzano substrati artificiali

    Energy Technology Data Exchange (ETDEWEB)

    Prato, S.; Morgana, J.G.; Antonelli, D.; Folletto, A. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-01-01

    Aim of this work is to analyse the environmental quality of a small stream, the Fosso della Casaccia, flowing near Research Centre of ENEA (Rome, Central Italy). The study was carried out comparing zoo benthic communities of two sampling sites, chosen upstream and downstream the sewage of the Research Centre. Macro invertebrates were sampled using artificial substrates and standard hand net. Taxa number and distribution along along the watercourse were compared. Moreover, biotic index values (I.B.E.=Indice Biotico Esteso) were calculated using data on macro invertebrates collected with both sampling methodologies. Artificial substrates were also useful in establishing colonization patterns at each sampling site, and bio masses of individuals belonging to different trophic groups. The results show the greater sampling effectiveness of artificial substrates, confirming their usefulness for establishing the environmental quality. [Italiano] Il presente lavoro prende in considerazione la qualita` ambientale del Fosso della Casaccia, un piccolo corso d`acqua che scorre in prossimita` del Centro di Ricerche ENEA Casaccia (Italia Centrale). Lo studio e` stato realizzato in base al confronto fra le comunita` zoobentoniche di due stazioni sperimentali situate a monte e a valle dello scarico di acque reflue del centro. Il campionamento dei macroinvertebrati e` stato effettuato utilizzando due diversi metodi di raccolta: i substrati artificiali e il retino immanicato standard. Gli organismi sono stati classificati in unita` sistematiche, e si e` analizzata la loro distribuzione lungo il corso d`acqua. Inoltre sono stati calcolati i valori degli indici biotici I.B.E. (Indice Biotico Esteso) utilizzando i dati ottenuti con le due metodologie di campionamento. L`uso di substrati artificiali in ogni stazione di campionamento e` stato utile anche per stabilire il tipo di colonizzazione, l`abbondanza e le biomasse degli individui appartenenti ai vari gruppi trofici. I nostri

  19. Mineralogy, provenance, and diagenesis of a potassic basaltic sandstone on Mars: CheMin X‐ray diffraction of the Windjana sample (Kimberley area, Gale Crater)

    Science.gov (United States)

    Bish, David L.; Vaniman, David T.; Chipera, Steve J.; Blake, David F.; Ming, Doug W.; Morris, Richard V.; Bristow, Thomas F.; Morrison, Shaunna M.; Baker, Michael B.; Rampe, Elizabeth B.; Downs, Robert T.; Filiberto, Justin; Glazner, Allen F.; Gellert, Ralf; Thompson, Lucy M.; Schmidt, Mariek E.; Le Deit, Laetitia; Wiens, Roger C.; McAdam, Amy C.; Achilles, Cherie N.; Edgett, Kenneth S.; Farmer, Jack D.; Fendrich, Kim V.; Grotzinger, John P.; Gupta, Sanjeev; Morookian, John Michael; Newcombe, Megan E.; Rice, Melissa S.; Spray, John G.; Stolper, Edward M.; Sumner, Dawn Y.; Vasavada, Ashwin R.; Yen, Albert S.

    2016-01-01

    Abstract The Windjana drill sample, a sandstone of the Dillinger member (Kimberley formation, Gale Crater, Mars), was analyzed by CheMin X‐ray diffraction (XRD) in the MSL Curiosity rover. From Rietveld refinements of its XRD pattern, Windjana contains the following: sanidine (21% weight, ~Or95); augite (20%); magnetite (12%); pigeonite; olivine; plagioclase; amorphous and smectitic material (~25%); and percent levels of others including ilmenite, fluorapatite, and bassanite. From mass balance on the Alpha Proton X‐ray Spectrometer (APXS) chemical analysis, the amorphous material is Fe rich with nearly no other cations—like ferrihydrite. The Windjana sample shows little alteration and was likely cemented by its magnetite and ferrihydrite. From ChemCam Laser‐Induced Breakdown Spectrometer (LIBS) chemical analyses, Windjana is representative of the Dillinger and Mount Remarkable members of the Kimberley formation. LIBS data suggest that the Kimberley sediments include at least three chemical components. The most K‐rich targets have 5.6% K2O, ~1.8 times that of Windjana, implying a sediment component with >40% sanidine, e.g., a trachyte. A second component is rich in mafic minerals, with little feldspar (like a shergottite). A third component is richer in plagioclase and in Na2O, and is likely to be basaltic. The K‐rich sediment component is consistent with APXS and ChemCam observations of K‐rich rocks elsewhere in Gale Crater. The source of this sediment component was likely volcanic. The presence of sediment from many igneous sources, in concert with Curiosity's identifications of other igneous materials (e.g., mugearite), implies that the northern rim of Gale Crater exposes a diverse igneous complex, at least as diverse as that found in similar‐age terranes on Earth. PMID:27134806

  20. Issues relating to classification of colluvial soils in young morainic areas (Chełmno and Brodnica Lake District, northern Poland

    Directory of Open Access Journals (Sweden)

    Świtoniak Marcin

    2015-06-01

    Full Text Available Colluvial soils (in Polish: gleby deluwialne are an important part of the soil cover in young morainic landscapes of northern Poland. They evolved as a result of the accumulation of eroded material at the foot of the slopes and bottoms of closed depressions. The aim of this study was to determine the systematic position of colluvial soils commonly found in the Chełmno and Brodnica Lake District, northern Poland. Ten soil pits located in different types of landscapes were selected for testing soil properties. The colluvial material is characterized by diversified properties: thickness, particle-size distribution, organic carbon content, color, pH, and base saturation. As a result, the investigated soils represent broad spectrum of typological units according to Polish Soil Classification (2011. Some of them contain epipedons mollic and meet the criteria of colluvial chernozemic soils. They were found mainly on buried black earths in areas with small slope inclinations. Many pedons contain pale colored acidic colluvial material with low base saturation and low organic carbon content and must be classified as other types: arenosols (in Polish: arenosole or rusty soils (in Polish: gleby rdzawe. These soils occur mostly in areas with intensive relief and overlay the different soil types, including rusty soil and organic soils. They are formed as a result of soils lessivés and rusty soils truncation. An introduction of the additional units of “proper colluvial soils” which have epipedon ochric, and “rusty-colluvial soils” with endopedon sideric to the next edition of Polish Soil Classification would enable a more precise expression of the genesis of these soils in the type rank. Moreover, the definition of chernozemic colluvial soils could be extended to colluvial soils with umbric horizon. Classifying soils derived from colluvial material as soils of other types leads to the disappearance of this units on maps and underestimation of the

  1. L’immagine che appare

    Directory of Open Access Journals (Sweden)

    Giovanni Matteucci

    2012-05-01

    Full Text Available It’s a matter of fact that images are not taken for signs. Therefore there must be some intrinsic peculiarity, which allows them to convey a content but, in the same breath, prevents them from collapsing into mere semiotic structures. Such a feature could lie in a sort of “semblance grammar”, which gives off the perceptual potential of images, and reveals itself in the experience before any determination of an ontological status. It’s in the way the image appears that the power of the image to articulate fruitfully a thought manifests itself.

  2. Linee di ricerca emergenti nell’educational technology

    Directory of Open Access Journals (Sweden)

    Maria Ranieri

    2015-12-01

    Full Text Available Il presente contributo intende restituire un quadro delle linee di ricerca emergenti nel campo dell’educational technology. Le fonti utilizzate a questo scopo e illustrate nella sezione introduttiva hanno permesso di individuare sei aree di interesse, vale a dire: apprendere in mobilità; social web e apprendimento; learning analytics; digital literacy/digital reading; OER e MOOC; ambienti immersivi e videogame. Per ciascuna di queste aree vengono delineate le principali direttrici di ricerca che le connotano e i relativi avanzamenti. Il lavoro si conclude con alcune considerazioni di sintesi sulle tendenze generali della ricerca nel settore.

  3. Architecture of buried reverse fault zone in the sedimentary basin: A case study from the Hong-Che Fault Zone of the Junggar Basin

    Science.gov (United States)

    Liu, Yin; Wu, Kongyou; Wang, Xi; Liu, Bo; Guo, Jianxun; Du, Yannan

    2017-12-01

    It is widely accepted that the faults can act as the conduits or the barrier for oil and gas migration. Years of studies suggested that the internal architecture of a fault zone is complicated and composed of distinct components with different physical features, which can highly influence the migration of oil and gas along the fault. The field observation is the most useful methods of observing the fault zone architecture, however, in the petroleum exploration, what should be concerned is the buried faults in the sedimentary basin. Meanwhile, most of the studies put more attention on the strike-slip or normal faults, but the architecture of the reverse faults attracts less attention. In order to solve these questions, the Hong-Che Fault Zone in the northwest margin of the Junggar Basin, Xinjiang Province, is chosen for an example. Combining with the seismic data, well logs and drill core data, we put forward a comprehensive method to recognize the internal architectures of buried faults. High-precision seismic data reflect that the fault zone shows up as a disturbed seismic reflection belt. Four types of well logs, which are sensitive to the fractures, and a comprehensive discriminated parameter, named fault zone index are used in identifying the fault zone architecture. Drill core provides a direct way to identify different components of the fault zone, the fault core is composed of breccia, gouge, and serpentinized or foliated fault rocks and the damage zone develops multiphase of fractures, which are usually cemented. Based on the recognition results, we found that there is an obvious positive relationship between the width of the fault zone and the displacement, and the power-law relationship also exists between the width of the fault core and damage zone. The width of the damage zone in the hanging wall is not apparently larger than that in the footwall in the reverse fault, showing different characteristics with the normal fault. This study provides a

  4. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  5. Moving out of the Laboratory: Deploying Pervasive Technologies in a Hospital

    DEFF Research Database (Denmark)

    Hansen, Thomas Riisgaard; Bardram, Jakob; Søgaard, Mads

    2006-01-01

    The authors deployed a distributed system containing a location-tracking system, a context-awareness system, wall-sized displays, and mobile phones in a Danish hospital's operating ward. This article presents the lessons they learned from deploying these pervasive computing technologies and a che......The authors deployed a distributed system containing a location-tracking system, a context-awareness system, wall-sized displays, and mobile phones in a Danish hospital's operating ward. This article presents the lessons they learned from deploying these pervasive computing technologies...

  6. Technological innovation in the Italian school. A critical and historical analysis

    Directory of Open Access Journals (Sweden)

    Camilla Moricca

    2016-04-01

    Full Text Available Technological introduction into school takes place in the form of innovations that maintaining low awareness and memories of the previous phases. The work recalls briefly the main institutional initiatives and best-known theories of reference in order to foster a historical-critical awareness of what the experience may have informed us. In the last part we focus on references in vogue, such as coding and robotics, wondering if they are really innovations and if they are based on valid educational criteria. L’innovazione tecnologica nella scuola italiana. Per un’analisi critica e storicaL’introduzione tecnologica nella scuola è caratterizzata da ondate che si succedono conservando scarsa consapevolezza e ricordo della fase precedente. Il lavoro ripercorre in modo sintetico le principali iniziative istituzionali e le più note teorie di riferimento che le hanno accompagnate nell’ottica di favorire una consapevolezza storico-critica su ciò che l’esperienza ci può aver insegnato. Nell’ultima parte ci si sofferma su riferimenti oggi in voga, quali il coding e la robotica, chiedendoci se siano davvero nuovi e se poggino su criteri pedagogici fondati.

  7. Membrane technologies for desalting seawater and managing water resources; Le tecnologie di membrana per la dissalazione dell'acqua di mare e la gestione della risorsa idrica

    Energy Technology Data Exchange (ETDEWEB)

    Pizzichini, M. [ENEA, Divisione Biotecnologie e Agricoltura, Rome (Italy); Braccio, G. [ENEA, Divisione Fonti Rinnovabili, Rome (Italy); Bozzini, A. [Food and Agriculture Organization of the United Nations, Rome (Italy)

    2001-04-01

    Water is an irreplaceable resource for life that fundamentally conditions human economic and social development, especially in arid regions. Clean technologies such as membrane separation processes, in particular reverse osmosis, whether or not coupled with photovoltaic technology, can solve local water-deficit problems that jeopardise development and human life itself. The commercialisation of these systems offers an interesting opportunity for Italian manufacturers. [Italian] L'acqua e' una fonte di vita insostituibile che condiziona profondamente lo sviluppo economico e sociale dell'uomo, specialmente nelle aree geografiche aride. L'impiego di tecnologie pulite come i processo separativi a membrana, in particoalre di osmosi inversa accoppiati o meno alla tecnologia fotovoltaica, possono risolvere problemi locali di carenza idrica che mettono a rischio lo sviluppo e la vita stessa delle popolazioni.

  8. International trade, technological change and evolution of work market; Commercio internazionale, cambiamento tecnologico e mercato del lavoro

    Energy Technology Data Exchange (ETDEWEB)

    Cacciotti, M.

    1999-07-01

    The report estimates the historic series of wages and employment depending on the average unit value of importation prices in the most important european countries, Italy, France and Germany for the years 1988-1996. Results shows that in the traditional sectors, with unskilled employment are negative influenced by international trade, otherwise, in the technological advanced sectors, influenced are to be considered positive. [Italian] Lo studio sottopone a stima le serie storiche dei salari e dell'occupazione in funzione del valore medio unitario dei prezzi alle importazioni per i piu' importanti paesi europei, Italia, Francia, Germania, durante il periodo 1988-1996. I risultati mostrano che per i settori tradizionali, che impiegano manodopera meno qualificata, il commercio internazionel tende ad influenzare negativamente i livelli salariali ed occupazionali, mentre per i settorui tecnologicamente piu' avanzati determina variazioni positive dei salari e dell'occupazioni.

  9. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  10. I mutamenti tecnologici nelle condizioni odierne: riflessioni di un economista. (Technological changes in present-day conditions: reflections of an economist

    Directory of Open Access Journals (Sweden)

    P. SYLOS LABINI

    2013-12-01

    Full Text Available Tutti gli economisti concordano sul fatto che i cambiamenti tecnologici costituiscono la principale fonte di sviluppo economico . Tuttavia , molti economisti sono convinti che tali cambiamenti sono importanti solo per spinegre verso l'alto il tasso di sviluppo economico, che a lungo andare sarebbe altrimenti più basso e costante , con l'accumulazione di capitale e forza lavoro di crescita in atto gradualmente . Al contrario , il presente lavoro sostiene che nel lungo periodo , il progresso tecnico non è il fattore principale dello sviluppo economico , ma piuttosto una condizione necessaria . L'autore esamina l'evoluzione tecnologica nella teoria economica e la storia dello sviluppo economico . La disoccupazione tecnologica e la disoccupazione keynesiana sono quindi analizzate , così come la riduzione dell'orario di lavoro . Infine , l'autore considera più recenti sviluppi tecnologici ed economici e la loro relazione con il lavoro manuale e intellettuale .All economists agree that technological changes constitute the main source of economic development. Nonetheless, many economists are convinced that such changes are important only in pushing up the rate of economic development, which in the long run would otherwise be lower and constant, with capital accumulation and labor force growth taking place gradually. To the contrary, the present work argues that in the long run, technical progress is not the main factor of economic development, but rather a necessary condition. The author examines technological change in economic theory and the history of economic development. Technological unemployment and Keynesian unemployment are then considered as well as the reduction of working hours. Finally, the author considers more recent technological and economic developments and their relation to manual and intellectual labour.JEL: O33, E24

  11. Laser Technology.

    Science.gov (United States)

    Gauger, Robert

    1993-01-01

    Describes lasers and indicates that learning about laser technology and creating laser technology activities are among the teacher enhancement processes needed to strengthen technology education. (JOW)

  12. De la prévention chronologique à la prévention relationnelle; la prévention quaternaire comme tâche du médecin de famille.

    OpenAIRE

    Jamoulle, Marc

    2010-01-01

    La prévention clinique est traditionnellement exprimée comme une vue du médecin sur une tâche à réaliser avant la survenue d’un évènement. Initiée par Leavell et Clark en 1958 elle est complétée en 1988 par J-A Bury qui dénomme prévention quaternaire les soins palliatifs.Le paradigme change, le patient devient central aux soins, la prévention clinique est perçue au travers de la relation entre le médecin et le patient. Le croisement de la science du médecin et de la conscience du patient perm...

  13. Sélection et intégration d'une souche probiotique fonctionnelle dans une matrice sèche

    OpenAIRE

    Lemetais, Guillaume

    2012-01-01

    Probiotics are live microorganisms that can act on the immune system at specific sites in the gastro-intestinal tract. From a technological point of view, the development of a dietary supplement containing viable and functional probiotics requires the control of the selection and production steps. In a first time, we have developed specific and sensitive screening tests to determine the ability of bacteria to be dried and the origin of its sensitivity. To develop these tests, we investigated ...

  14. Revolutionary Learning, Biodiversity, and Transformative Action. Essay Review of "Learning in Social Action: A Contribution To Understanding Informal Education" by Griff Foley; "Transformative Learning: Educational Vision for the Twenty-First Century" by Edmund O'Sullivan; and "Che Guevara, Paulo Freire and the Pedagogy of Revolution" by Peter McLaren.

    Science.gov (United States)

    Mayo, Peter

    2001-01-01

    Three books, published 1999-2000, map out a vision of education as a vehicle for human emancipation and global transformation. Their approaches to presenting the "big picture" differ, focusing on case studies of learning through local social action; the impact of Che Guevara and Paulo Freire on liberation discourse worldwide; and comprehensive…

  15. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  16. Teachers’ training and the use of educational technologies: research results

    Directory of Open Access Journals (Sweden)

    Marina Chiaro

    2017-01-01

    Full Text Available Acquire technological skills is an important requirement clearly evident by teachers in primary and secondary school at the end of a blended training course held at the University of Rome Three about issues related to students with Learning Disabilities. It is also significant the chance for teachers to constitute professional communities, such as the Community of Practice in the Lifelong Learning perspective, that might lead to collaborative strategies, knowledge sharing, discussion and reflection that are necessary to face the difficulties that every innovation involves. These factors can help teachers to overcome the condition of isolation which represents an important barrier to the development of an inclusive school in order to design inclusive educational strategies with the use of Information and Communication Technology according to the cultural perspective of the International Classification of Functioning, Disability and Health for Children and Youth.Formazione degli insegnanti ed impiego delle tecnologie didattiche per l’inclusione: risultati di ricercaAcquisire competenze tecnologiche rappresenta una importante esigenza palesata da docenti in servizio nella scuola primaria e secondaria di I e II grado al termine di un percorso formativo svolto in modalità blended presso l’Università degli Studi di Roma Tre su tematiche relative agli allievi con Disturbi Specifici di Apprendimento. Rilevante anche la possibilità per gli insegnanti di costituire delle comunità professionali, quali le Comunità di Pratica, in ottica di lifelong learning, che possano dar luogo a strategie collaborative, di condivisione delle conoscenze, di confronto e riflessione necessari per affrontare le difficoltà che ogni innovazione comporta. Tali modalità possono rappresentare un supporto al superamento della condizione di isolamento in cui spesso i docenti si trovano ad operare, aspetto che costituisce uno dei principali ostacoli allo sviluppo di una

  17. Taming Technology

    Science.gov (United States)

    Branscomb, Lewis M.

    1971-01-01

    Reviews aspects of technology in our society: technology as a force for social change; reasons for the frustration and dissatisfaction with technology; how technology decentralizes power; the individual's influence; resolving conflicts in the ionized" society; regulation of technology; corporate responsibility; and the potential pitfalls for the…

  18. European analytical column no. 37 (January 2009) Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Grasserbauer, Manfred; Andersen, Jens Enevold Thaulov

    2009-01-01

    This issue of the European Analytical Column has again a somewhat different format: once more DAC invited a guest columnist to give his views on various matters related to Analytical Chemistry in Europe. This year, Professor Manfred Grasserbauer of the Vienna University of Technology focuses...... on current challenges for European analytical chemistry. During the period 2002–2007 Professor Grasserbauer was Director of the Institute for Environment and Sustainability, Joint Research Centre of the European Commission, Ispra. There is no doubt that many challenges exist at the present time for all of us...... representing a major branch of chemistry, namely analytical chemistry. The global financial crisis is affecting all branches of chemistry, especially analytical chemistry since our discipline by tradition has many close links to industry. Already now a decrease of industrial commitment with respect to new...

  19. European analytical column No. 37 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Grasserbauer, Manfred; Andersen, Jens Enevold Thaulov

    2009-01-01

    The European Analytical Column again has a somewhat different format. We have once more invited a guest columnist to give his views on various matters related to analytical chemistry in Europe. This year we have invited Prof. Manfred Grasserbauer of Vienna University of Technology to present some...... of the current challenges for European analytical chemistry. During the period 2002– 2007 Manfred Grasserbauer was Director of the Institute for Environment and Sustainability, Joint Research Centre of the European Commission, Ispra. There is no doubt that many challenges exist at the present time for all those...... representing a major branch of chemistry, namely, analytical chemistry. The global financial crisis is affecting all branches of chemistry, but analytical chemistry in particular since our discipline by tradition has many close links to industry. We are already noticing a decreased industrial commitment...

  20. Assistive Technology

    Science.gov (United States)

    ... Page Resize Text Printer Friendly Online Chat Assistive Technology Assistive technology (AT) is any service or tool that helps ... be difficult or impossible. For older adults, such technology may be a walker to improve mobility or ...

  1. Sport Technology

    CSIR Research Space (South Africa)

    Kirkbride, T

    2007-11-01

    Full Text Available Technology is transforming the games themselves and at times with dire consequences. Tony Kirkbride, Head: CSIR Technology Centre said there are a variety of sports technologies and there have been advances in material sciences and advances...

  2. Rover Technologies

    Data.gov (United States)

    National Aeronautics and Space Administration — Develop and mature rover technologies supporting robotic exploration including rover design, controlling rovers over time delay and for exploring . Technology...

  3. Nano technology

    International Nuclear Information System (INIS)

    Lee, In Sik

    2002-03-01

    This book is introduction of nano technology, which describes what nano technology is, alpha and omega of nano technology, the future of Korean nano technology and human being's future and nano technology. The contents of this book are nano period is coming, a engine of creation, what is molecular engineering, a huge nano technology, technique on making small things, nano materials with exorbitant possibility, the key of nano world the most desirable nano technology in bio industry, nano development plan of government, the direction of development for nano technology and children of heart.

  4. European analytical column No. 37 from the Division of Analytical Chemistry (DAC of the European Association for Chemical and Molecular Sciences (EuCheMS

    Directory of Open Access Journals (Sweden)

    BO KARLBERG

    2009-04-01

    Full Text Available INTRODUCTORY COMMENTS FROM THE CHAIRMAN OF DACThe European Analytical Column has again a somewhat different format. We have once more invited a guest columnist to give their views on various matters related to Analytical Chemistry in Europe. This year we have invited Professor Manfred Grasserbauer of the Vienna University of Technology to present some of the current challenges for European analytical chemistry. During the period 2002–2007 Professor Grasserbauer was Director of the Institute for Environment and Sustainability, Joint Research Centre of the European Commission, Ispra. There is no doubt that many challenges exist at the present time for all of us representing a major branch of chemistry, namely analytical chemistry.The global financial crisis is affecting all branches of chemistry but analytical chemistry in particular since our discipline by tradition has many close links to industry. We notice already now a decreased industrial commitment with respect to new research projects and sponsoring of conferences. It is therefore important that we strengthen our efforts and that we keep our presence at analytical chemistry meetings and conferences unchanged.Recent activities of DAC and details regarding the major analytical-chemistry event this year in Europe, Euroanalysis XV in Innsbruck, are also reported.

  5. Information Technology

    Science.gov (United States)

    2003-01-01

    The first wave delivered a range of services to most areas of the world through a vast, carefully constructed global network. Cellular technology ...Information Technology and Services Alliance. Digital Planet 2002: The Global Information Economy. February 2002. Yegyazarian, Anush. Sales Taxes...Information Technology ABSTRACT: The information technology (IT) industry affects virtually every industry in the n economy. During the late 90

  6. For an inclusive education: the innovative challenge of technologies for social emotional learning

    Directory of Open Access Journals (Sweden)

    Annalisa Morganti

    2017-01-01

    Full Text Available The paper presents a collection of national, European and international evidence intended to identify the efficacy of social and emotional learning, of educational technologies, with a focus, in both cases, on inclusive processes. The paper, that is the outcome of the joint work of the authors, investigates the added, potential value given by technology to social and emotional learning, through different tiers of actions and the main features of ed-tech that can support such a use.Per un’educazione inclusiva: la sfida innovativa delle tecnologie per l’educazione socio-emotivaIl contributo presenta una raccolta di evidenze nazionali, europee ed internazionali, volte a individuare l’efficacia, dell’educazione socio-emotiva, delle tecnologie per la didattica, con un’attenzione, in entrambi i casi, ai processi inclusivi. Frutto del lavoro congiunto degli autori, il contributo indaga il valore aggiunto che la tecnologia può offrire all’educazione socio-emotiva, su differenti piani di azione e le principali caratteristiche ed-tech che possono supportarne tale utilizzo.

  7. Electronic technology

    International Nuclear Information System (INIS)

    Kim, Jin Su

    2010-07-01

    This book is composed of five chapters, which introduces electronic technology about understanding of electronic, electronic component, radio, electronic application, communication technology, semiconductor on its basic, free electron and hole, intrinsic semiconductor and semiconductor element, Diode such as PN junction diode, characteristic of junction diode, rectifier circuit and smoothing circuit, transistor on structure of transistor, characteristic of transistor and common emitter circuit, electronic application about electronic equipment, communication technology and education, robot technology and high electronic technology.

  8. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  9. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  10. Globalization & technology

    DEFF Research Database (Denmark)

    Narula, Rajneesh

    Technology and globalization are interdependent processes. Globalization has a fundamental influence on the creation and diffusion of technology, which, in turn, affects the interdependence of firms and locations. This volume examines the international aspect of this interdependence at two levels...

  11. Living Technology

    DEFF Research Database (Denmark)

    2010-01-01

    This book is aimed at anyone who is interested in learning more about living technology, whether coming from business, the government, policy centers, academia, or anywhere else. Its purpose is to help people to learn what living technology is, what it might develop into, and how it might impact...... our lives. The phrase 'living technology' was coined to refer to technology that is alive as well as technology that is useful because it shares the fundamental properties of living systems. In particular, the invention of this phrase was called for to describe the trend of our technology becoming...... increasingly life-like or literally alive. Still, the phrase has different interpretations depending on how one views what life is. This book presents nineteen perspectives on living technology. Taken together, the interviews convey the collective wisdom on living technology's power and promise, as well as its...

  12. Earthing Technology

    NARCIS (Netherlands)

    Blok, Vincent

    2017-01-01

    In this article, we reflect on the conditions under which new technologies emerge in the Anthropocene and raise the question of how to conceptualize sustainable technologies therein. To this end, we explore an eco-centric approach to technology development, called biomimicry. We discuss opposing

  13. Technology Tiers

    DEFF Research Database (Denmark)

    Karlsson, Christer

    2015-01-01

    A technology tier is a level in a product system: final product, system, subsystem, component, or part. As a concept, it contrasts traditional “vertical” special technologies (for example, mechanics and electronics) and focuses “horizontal” feature technologies such as product characteristics...

  14. A pilot study assessing the impact of a fortified supplementary food on the health and well-being of crèche children and adult TB patients in South Africa.

    Directory of Open Access Journals (Sweden)

    Michael Rudolph

    Full Text Available The South African population faces many of the global concerns relating to micronutrient deficiency and the impact this has on health and well-being. Moreover, there is a high prevalence of HIV infection, compounded by a high level of co-infection with TB.This pilot study evaluates the impact of a fortified supplementary food on the health and well-being of a cohort of crèche children, aged 3 to 6, and adult TB patients drawn from the Presidential Node of Alexandra, Johannesburg, South Africa. A further aim of this study was to evaluate the sensitivity and validity of non-invasive indicators of nutritional status in a field-based population sample.The investigational product, e'Pap, is supported by extensive anecdotal evidence that whole grain cereals with food-style nutrients constitute an effective supplementary food for those suffering from the effects of food insecurity, poor health and well-being, and coping with TB and HIV infection.The results indicate a beneficial effect of e'Pap for both study populations, and particularly for adult TB patients, whose baseline data reflected severe food insecurity and malnutrition in the majority of cases. There is evidence to suggest statistically significant improvements in key micronutrient levels, well-being and energy, hand-grip strength, the Bioelectrical Impedance Analysis (BIA Illness Marker, and certain clinical indicators. Although Body Mass Index (BMI and Mid Upper Arm Circumference (MUAC are frequently used as standard measures to evaluate the efficacy of nutritional interventions, these indicators were not sufficiently sensitive in this study. Nor does weight gain necessarily indicate improved nutritional status. Hand-grip strength, lean body mass, and the BIA Illness Marker seem to be more useful indicators of change in nutritional status.

  15. Soulful Technologies

    DEFF Research Database (Denmark)

    Fausing, Bent

    2010-01-01

    or anthropomorphism is important for the branding of new technology. Technology is seen as creating a techno-transcendence towards a more qualified humanity which is in contact with fundamental human values like intuition, vision, and sensing; all the qualities that technology, industrialization, and rationalization......, - in short modernity - have taken away from human existence. What old technology has removed now comes back through new technology promoting a better humanity. The present article investigates how digital technology and affects are presented and combined, with examples from everyday imagery, e.g. TV......Samsung introduced in 2008 a mobile phone called "Soul" made with a human touch and including itself a "magic touch". Through the analysis of a Nokia mobile phone TV-commercials I want to examine the function and form of digital technology in everyday images. The mobile phone and its digital camera...

  16. Technology '90

    International Nuclear Information System (INIS)

    1991-01-01

    The US Department of Energy (DOE) laboratories have a long history of excellence in performing research and development in a number of areas, including the basic sciences, applied-energy technology, and weapons-related technology. Although technology transfer has always been an element of DOE and laboratory activities, it has received increasing emphasis in recent years as US industrial competitiveness has eroded and efforts have increased to better utilize the research and development resources the laboratories provide. This document, Technology '90, is the latest in a series that is intended to communicate some of the many opportunities available for US industry and universities to work with the DOE and its laboratories in the vital activity of improving technology transfer to meet national needs. Technology '90 is divided into three sections: Overview, Technologies, and Laboratories. The Overview section describes the activities and accomplishments of the DOE research and development program offices. The Technologies section provides descriptions of new technologies developed at the DOE laboratories. The Laboratories section presents information on the missions, programs, and facilities of each laboratory, along with a name and telephone number of a technology transfer contact for additional information. Separate papers were prepared for appropriate sections of this report

  17. La nuova fisica che ci aspetta

    CERN Multimedia

    Shiga, David

    2007-01-01

    The big accelerator that will enter in function at CERN at the end of the year will have the hard task to verify the relevance of the string theory, today the better candiddate to be the famous "theory of everything" that physicists are looking for since decades. (1 page)

  18. Di Dio che viene dall'Ikea

    Directory of Open Access Journals (Sweden)

    Paolo Amodio

    2014-06-01

    Full Text Available The possibilities offered by the last generation of scanning and transmission electron microscopes allow to spy on the inner structure of biological tissues and to observe bio-architectures which multiply – overcoming classical categories – the conventional standards of order and symmetry, revealing hierarchically organized micro- and nano-structures. These new paradigms form the basis for creating effective physical-mathematical models, leading to simulate (and predict the destiny of biological organisms and elementary “living” systems. The whole world of Research is therefore forced to an updated (bien sûr, more authentic (maybe, necessary (?, interdisciplinary (was ist das? common thinking over? What’s the buzz about Beauty?

  19. Che cos'e la storia?

    OpenAIRE

    Vella, Andrew P.

    1984-01-01

    In this article, the author tackles some important points when it comes to teaching history at University level; 1. A definition of History 2. The difficulties in writing History 3. Historical objectives and 4. Research techniques and Historical sources.

  20. Sensemaking technologies

    DEFF Research Database (Denmark)

    Madsen, Charlotte Øland

    Research scope: The scope of the project is to study technological implementation processes by using Weick's sensemaking concept (Weick, 1995). The purpose of using a social constructivist approach to investigate technological implementation processes is to find out how new technologies transform...... patterns of social action and interaction in organisations (Barley 1986; 1990, Orlikowski 2000). Current research in the field shows that new technologies affect organisational routines/structures/social relationships/power relations/dependencies and alter organisational roles (Barley 1986; 1990, Burkhardt......, Orlikowski 2000). Viewing the use of technology as a process of enactment opens up for investigating the social processes of interpreting new technology into the organisation (Orlikowski 2000). The scope of the PhD project will therefore be to gain a deeper understanding of how the enactment of new...

  1. Technological risks

    International Nuclear Information System (INIS)

    Klinke, A.; Renn, O.

    1998-01-01

    The empirical part about the technological risks deals with different technologies: nuclear energy, early warning systems of nuclear weapons and NBC-weapons, and electromagnetic fields. The potential of damage, the contemporary management strategies and the relevant characteristics will be described for each technology: risks of nuclear energy; risks of early warning systems of nuclear weapons and NBC-weapons; risks of electromagnetic fields. (authors)

  2. Technological risks

    Energy Technology Data Exchange (ETDEWEB)

    Klinke, A.; Renn, O. [Center of Technology Assessment in Baden-Wuerttemberg, Stuttgart (Germany)

    1998-07-01

    The empirical part about the technological risks deals with different technologies: nuclear energy, early warning systems of nuclear weapons and NBC-weapons, and electromagnetic fields. The potential of damage, the contemporary management strategies and the relevant characteristics will be described for each technology: risks of nuclear energy; risks of early warning systems of nuclear weapons and NBC-weapons; risks of electromagnetic fields. (authors)

  3. Technology alliances

    International Nuclear Information System (INIS)

    Torgerson, D.F.; Boczar, P.G.; Kugler, G.

    1991-10-01

    In the field of nuclear technology, Canada and Korea developed a highly successful relationship that could serve as a model for other high-technology industries. This is particularly significant when one considers the complexity and technical depth required to design, build and operate a nuclear reactor. This paper will outline the overall framework for technology transfer and cooperation between Canada and Korea, and will focus on cooperation in nuclear R and D between the two countries

  4. Chemistry Technology

    Data.gov (United States)

    Federal Laboratory Consortium — Chemistry technology experts at NCATS engage in a variety of innovative translational research activities, including:Design of bioactive small molecules.Development...

  5. Technology Catalogue

    International Nuclear Information System (INIS)

    1994-02-01

    The Department of Energy's Office of Environmental Restoration and Waste Management (EM) is responsible for remediating its contaminated sites and managing its waste inventory in a safe and efficient manner. EM's Office of Technology Development (OTD) supports applied research and demonstration efforts to develop and transfer innovative, cost-effective technologies to its site clean-up and waste management programs within EM's Office of Environmental Restoration and Office of Waste Management. The purpose of the Technology Catalogue is to provide performance data on OTD-developed technologies to scientists and engineers assessing and recommending technical solutions within the Department's clean-up and waste management programs, as well as to industry, other federal and state agencies, and the academic community. OTD's applied research and demonstration activities are conducted in programs referred to as Integrated Demonstrations (IDs) and Integrated Programs (IPs). The IDs test and evaluate.systems, consisting of coupled technologies, at specific sites to address generic problems, such as the sensing, treatment, and disposal of buried waste containers. The IPs support applied research activities in specific applications areas, such as in situ remediation, efficient separations processes, and site characterization. The Technology Catalogue is a means for communicating the status. of the development of these innovative technologies. The FY93 Technology Catalogue features technologies successfully demonstrated in the field through IDs and sufficiently mature to be used in the near-term. Technologies from the following IDs are featured in the FY93 Technology Catalogue: Buried Waste ID (Idaho National Engineering Laboratory, Idaho); Mixed Waste Landfill ID (Sandia National Laboratories, New Mexico); Underground Storage Tank ID (Hanford, Washington); Volatile organic compound (VOC) Arid ID (Richland, Washington); and VOC Non-Arid ID (Savannah River Site, South Carolina)

  6. Thermally activated technologies: Technology Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2003-05-01

    The purpose of this Technology Roadmap is to outline a set of actions for government and industry to develop thermally activated technologies for converting America’s wasted heat resources into a reservoir of pollution-free energy for electric power, heating, cooling, refrigeration, and humidity control. Fuel flexibility is important. The actions also cover thermally activated technologies that use fossil fuels, biomass, and ultimately hydrogen, along with waste heat.

  7. Technological Advancements

    Science.gov (United States)

    Kennedy, Mike

    2010-01-01

    The influx of technology has brought significant improvements to school facilities. Many of those advancements can be found in classrooms, but when students head down the hall to use the washrooms, they are likely to find a host of technological innovations that have improved conditions in that part of the building. This article describes modern…

  8. Maritime Technology

    DEFF Research Database (Denmark)

    Sørensen, Herman

    1997-01-01

    Elementary introduction to the subject "Maritime Technology".The contents include drawings, sketches and references in English without any supplementary text.......Elementary introduction to the subject "Maritime Technology".The contents include drawings, sketches and references in English without any supplementary text....

  9. Technology collaboration

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, Jacob [Halliburton (Brazil)

    2011-07-01

    The aim of this paper is to present Halliburton's Brazilian technology center. Halliburton has technology centers in the United States, Saudi Arabia, India, Singapore and Brazil, all of which aim at delivering accelerated innovation in the oil sector. The technology centers engage in research and development activities with the help of various universities and in collaboration with the customer or supplier. The Halliburton Brazil technology center provides its customers with timely research and development solutions for enhancing recovery and mitigating reservoir uncertainty; they are specialized in finding solutions for pre- and post-salt carbonate drilling and in the enhancement of production from mature fields. This presentation showcased the work carried out by the Halliburton Brazil technology center to help customers develop their deepwater field activities.

  10. Sensemaking technology

    DEFF Research Database (Denmark)

    Madsen, Charlotte Øland

    Research objective: The object of the LOK research project is to gain a better understanding of the technological strategic processes in organisations by using the concept/metaphor of sensemaking. The project will investigate the technological strategies in organisations in order to gain a deeper...... understanding of the cognitive competencies and barriers towards implementing new technology in organisations. The research will therefore concentrate on researching the development process in the organisation's perception of the external environmental elements of customers, suppliers, competitors, internal...... and external technology and legislation and the internal environmental elements of structure, power relations and political arenas. All of these variables have influence on which/how technologies are implemented thus creating different outcomes all depending on the social dynamics that are triggered by changes...

  11. Ergonomics technology

    Science.gov (United States)

    Jones, W. L.

    1977-01-01

    Major areas of research and development in ergonomics technology for space environments are discussed. Attention is given to possible applications of the technology developed by NASA in industrial settings. A group of mass spectrometers for gas analysis capable of fully automatic operation has been developed for atmosphere control on spacecraft; a version for industrial use has been constructed. Advances have been made in personal cooling technology, remote monitoring of medical information, and aerosol particle control. Experience gained by NASA during the design and development of portable life support units has recently been applied to improve breathing equipment used by fire fighters.

  12. «Possino tante belle curiosità vedersi, prima che in Torino, in Firenze»: relazioni tra Medici e Savoia nel secondo Seicento attraverso Donato Rossetti / «Possino tante belle curiosità vedersi, prima che in Torino, in Firenze» (Could such a lot of beautiful curiosities be seen in Turin earlier than in Florence : relationships between the Medici and the Savoia during the second half of the 17th Century through Donato Rossetti

    Directory of Open Access Journals (Sweden)

    Roberta Piccinelli

    2014-06-01

    Full Text Available Il saggio presenta alcuni risultati dell’indagine archivistica condotta sulle filze Savoia del fondo Mediceo del Principato dell’Archivio di Stato di Firenze. I documenti, letti criticamente e selezionati attraverso una prospettiva storico artistica, permettono di mettere in luce nuovi aspetti della figura dell’ingegnere livornese Donato Rossetti, il quale svolge il ruolo di intermediario informativo artistico tra Torino e Firenze. Attraverso suoi dispacci da Torino e missive inviate da Francesco Bondicchi da Milano a Firenze emergono sia alcuni aspetti inediti delle relazioni tra le due corti, sia il rapporto biunivoco tra centri e periferie che si precisa nel corso del Seicento. A metà secolo il ruolo di modello svolto da Firenze fa sentire ancora la propria influenza al di fuori dei confini del granducato e contemporaneamente Firenze guarda con vivo interesse alla scena artistica e urbanistica torinese. Relations between the Savoia and the Florentine court were very intense during the early modern age. Almost every day, diplomatics and residents in the Savoia court sent letters and avvisi to Florence by revealing interesting details on the everyday life and by shedding light on a range of relevant political, diplomatic, familiar and artistic dynamics. Florentine ambassadors’ or intermediaries’ reports - such as Donato Rossetti’s letters - focus on the first concern of the Savoia court, after settling in Turin, that was to build a fortified citadel and to redraw the plan of the city. During my systematic analysis of Florentine court documents at the Florence State Archive, I uncovered compelling evidence of these intricate affairs regarding the rebuilding of Turin, and these unpublished documents shed new light both on the expansion of the city and on relations between Savoia and Medici courts. This paper provide evidence to suggest that Florence was considered by the Savoy Court as the leading innovator in visual arts and

  13. A Comprehensive Model of the Dry Desulphurisation Process Une modélisation non empirique du procédé de désulfuration par voie sèche

    Directory of Open Access Journals (Sweden)

    Flament P.

    2006-11-01

    humide des fumées, le procédé de désulfuration par voie sèche reste un moyen attractif pour éliminer le dioxyde de soufre lorsque le taux de réduction souhaité ne dépasse pas 90 %. Dans cette technique, l'élimination du SO2 se fait en injectant directement dans les produits de combustion de très fines particules d'un absorbant calcique tel que le calcaire (CaCO3 ou la chaux (Ca(OH². L'absorbant est tout d'abord transformé en oxyde de calcium (CaO avant de réagir avec le SO2 pour former un composé stable : le sulfate de calcium (CaSO4. Bien que les réactions globales soient extrêmement simples, une description complète des mécanismes nécessite de connaître à la fois, les propriétés physiques initiales de l'absorbant et leur évolution durant la réaction. De plus, les conditions d'injection des particules jouent un rôle prépondérant dans le procédé de désulfuration par voie sèche. Tous ces aspects sont traités dans ce papier. Le modèle de désulfuration a d'abord été testé seul par comparaison avec les données cinétiques de la Fondation Internationale de Recherches sur les Flammes (FRIF, puis, couplé avec le code KIVA, il a été utilisé pour simuler la désulfuration dans un nouveau type de chaudière développée par Babcock Entreprise et l'Institut Français du Pétrole (chaudière 'AUDE'. Dans ce dernier cas, l'objectif poursuivi était de déterminer la meilleure configuration à donner au système d'injection des particules pour obtenir un taux de désulfuration maximum. La dispersion des particules étant un paramètre important du procédé de désulfuration, un exemple de validation du modèle de dispersion est également traité. L'injection de particules dans une couche de mélange a été choisie comme cas test. L'accord entre les valeurs expérimentales de Ando et al. (1990 et les calculs effectués avec KIVA est satisfaisant.

  14. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  15. Technology Innovation

    Science.gov (United States)

    EPA produces innovative technologies and facilitates their creation in line with the Agency mission to create products such as the stormwater calculator, remote sensing, innovation clusters, and low-cost air sensors.

  16. Videodisc technology

    Energy Technology Data Exchange (ETDEWEB)

    Marsh, F.E. Jr.

    1981-03-01

    An overview of the technology of videodiscs is given. The emphasis is on systems that use reflection or transmission of laser light. Possible use of videodiscs for storage of bibliographic information is considered. 6 figures, 3 tables. (RWR)

  17. Technology | FNLCR

    Science.gov (United States)

    The Frederick National Laboratory develops and applies advanced, next-generation technologies to solve basic and applied problems in the biomedical sciences, and serves as a national resource of shared high-tech facilities.

  18. Globalization & technology

    DEFF Research Database (Denmark)

    Narula, Rajneesh

    of innovation" understanding of learning. Narula and Smith reconcile an important paradox. On the one hand, locations and firms are increasingly interdependent through supranational organisations, regional integration, strategic alliances, and the flow of investments, technologies, ideas and people......Technology and globalization are interdependent processes. Globalization has a fundamental influence on the creation and diffusion of technology, which, in turn, affects the interdependence of firms and locations. This volume examines the international aspect of this interdependence at two levels....... The boundaries of firms and countries are increasingly porous and imprecise, because firms use alliances and outsourcing, and countries are rarely technologically self-sufficient. On the other hand, locations remain distinct and idiosyncratic, with innovation systems remaining largely nationally bound. Knowledge...

  19. Plasma technology

    International Nuclear Information System (INIS)

    Drouet, M.G.

    1984-03-01

    IREQ was contracted by the Canadian Electrical Association to review plasma technology and assess the potential for application of this technology in Canada. A team of experts in the various aspects of this technology was assembled and each team member was asked to contribute to this report on the applications of plasma pertinent to his or her particular field of expertise. The following areas were examined in detail: iron, steel and strategic-metals production; surface treatment by spraying; welding and cutting; chemical processing; drying; and low-temperature treatment. A large market for the penetration of electricity has been identified. To build up confidence in the technology, support should be provided for selected R and D projects, plasma torch demonstrations at full power, and large-scale plasma process testing

  20. Exploration technology

    Energy Technology Data Exchange (ETDEWEB)

    Roennevik, H.C. [Saga Petroleum A/S, Forus (Norway)

    1996-12-31

    The paper evaluates exploration technology. Topics discussed are: Visions; the subsurface challenge; the creative tension; the exploration process; seismic; geology; organic geochemistry; seismic resolution; integration; drilling; value creation. 4 refs., 22 figs.

  1. Lasers technology

    International Nuclear Information System (INIS)

    2014-01-01

    The Laser Technology Program of IPEN is developed by the Center for Lasers and Applications (CLA) and is committed to the development of new lasers based on the research of new optical materials and new resonator technologies. Laser applications and research occur within several areas such as Nuclear, Medicine, Dentistry, Industry, Environment and Advanced Research. Additional goals of the Program are human resource development and innovation, in association with Brazilian Universities and commercial partners

  2. Cognitive technologies

    CERN Document Server

    Mello, Alan; Figueiredo, Fabrício; Figueiredo, Rafael

    2017-01-01

    This book focuses on the next generation optical networks as well as mobile communication technologies. The reader will find chapters on Cognitive Optical Network, 5G Cognitive Wireless, LTE, Data Analysis and Natural Language Processing. It also presents a comprehensive view of the enhancements and requirements foreseen for Machine Type Communication. Moreover, some data analysis techniques and Brazilian Portuguese natural language processing technologies are also described here. .

  3. Technology cycles and technology revolutions

    Energy Technology Data Exchange (ETDEWEB)

    Paganetto, Luigi; Scandizzo, Pasquale Lucio

    2010-09-15

    Technological cycles have been characterized as the basis of long and continuous periods economic growth through sustained changes in total factor productivity. While this hypothesis is in part consistent with several theories of growth, the sheer magnitude and length of the economic revolutions experienced by humankind seems to indicate surmise that more attention should be given to the origin of major technological and economic changes, with reference to one crucial question: role of production and use of energy in economic development.

  4. Persuasive Technology

    DEFF Research Database (Denmark)

    This book constitutes the proceedings of the 5th International Conference on Persuasive Technology, PERSUASIVE 2010, held in Copenhagen Denmark in June 2010. The 25 papers presented were carefully reviewed and selected from 80 submissions. In addition three keynote papers are included in this vol......This book constitutes the proceedings of the 5th International Conference on Persuasive Technology, PERSUASIVE 2010, held in Copenhagen Denmark in June 2010. The 25 papers presented were carefully reviewed and selected from 80 submissions. In addition three keynote papers are included...... in this volume. The topics covered are emotions and user experience, ambient persuasive systems, persuasive design, persuasion profiles, designing for health, psychology of persuasion, embodied and conversational agents, economic incentives, and future directions for persuasive technology....

  5. Seafood Technology

    DEFF Research Database (Denmark)

    Børresen, Torger

    This presentation will fill the total picture of this conference between fisheries and aquaculture, blue biotech and bioconservation, by considering the optimal processing technology of marine resources from the raw material until the seafood reaches the plate of the consumer. The situation today...... must be performed such that total traceability and authenticity of the final products can be presented on demand. The most important aspects to be considered within seafood technology today are safety, healthy products and high eating quality. Safety can be divided into microbiological safety...... and not presenting any safety risk per se. Seafood is healthy due to the omega-3 fatty acids and the nutritional value of vitamins, peptides and proteins. The processing technology must however be performed such that these valuable features are not lost during production. The same applies to the eating quality. Any...

  6. Smart technology

    International Nuclear Information System (INIS)

    Bruckner, D.G.

    1991-01-01

    The success of smart technology in the pursuit of the Gulf War has accentuated the awareness of how the Safeguards and Security disciplines are changing in response to new weaponry. Throughout the Department of Energy Integrated Complex (IC) Safeguards and Security efforts such as: Protection Programs Operations; Materials, Controls and Accountability; Information Security; Computer Security; Operational Security; Personnel Security, Safeguards and/or Security (S and S) surveys, and Inspections and Evaluations are undergoing a reassessment and refocusing. Some of this is in response to such things as the DOE initiated Freeze Report and the Drell Report. An important aspect is also technological, adjusting the way business is done in light of the weapons, tools and processes/procedures becoming available. This paper addresses the S and S issues with the promise of using smart technology to develop new approaches and equipment across the IC

  7. Variations autour de la tâche dans l'enseignement / apprentissage des langues aujourd'hui What kind of tasks are used for L2 teaching and learning today?

    Directory of Open Access Journals (Sweden)

    Elke Nissen

    2011-10-01

    Full Text Available Cet article se donne pour objectif d'identifier les types de tâches, et leurs dénominateurs communs, qui sont présentés aujourd'hui – où "l'approche par les tâches" est soutenue par le Conseil de l'Europe – aux apprenants. Il analyse pour cela les articles issus de deux numéros de revues et un ouvrage collectif récents. Il apparaît que la grande majorité des scénarios pédagogiques s'y inscrit dans la perspective actionnelle... du moins d'après la déclaration des auteurs, car leur définition de ce qu'est une tâche ne correspond pas toujours à celle du CECR. Pour le public visé, étudiants ou professionnels, on propose le plus souvent des mono-tâches, mais également des projets, ou encore des simulations avec un enchaînement de plusieurs tâches. Elles s'inscrivent généralement dans la (future réalité sociale des apprenants, mais certaines laissent également la place à des thèmes artistiques ou (interculturels. Contrairement à ce que l'on aurait pu attendre dans une démarche qui responsabilise l'apprenant, le recours à Internet n'est pas toujours systématique.At a time when action- and task-based learning is sustained by the European Council, this paper explores which types of tasks are given to second language learners today and what aspects these tasks have in common. The paper analyses two recent issues of scientific journals and one collective book. The analysis shows that the majority of pedagogical scenarios described in these texts claim to adopt an action- and task-based approach. However, in reality the way they define a task does not always correspond to the definition given by the European Framework of Reference for Languages. The described tasks are exclusively dedicated to higher and professional education; they are mostly single tasks, but they can also be projects and simulations including several successive tasks. They generally correspond to the learners' (future reality, with themes that are

  8. Approche multidimensionnelle de la difficulté objective dans une tâche d’anticipation coï ncidence Multidimensional approach of objective difficulty in an aiming task

    Directory of Open Access Journals (Sweden)

    P. Deneuve

    2010-09-01

    Full Text Available

     

    Cet article a pour objet de proposer une nouvelle procédure pour classer les tâches motrices à caractère informationnel à partir d’une approche multidimensionnelle de la difficulté. L’expérimentation a consisté à faire passer des tests de pointage à 345 sujets sur cibles mobiles créées et gérées par ordinateur. Les paramètres des cibles ont été choisis pour leur indépendance et la possibilité de les positionner sur des échelles numériques. Trois descripteurs ont été retenus : la vitesse de déplacement, la surface de la cible et l’incertitude spatiale. La performance ne semblant pas être la seule variable dépendante résumant la difficulté, il lui a été adjoint trois autres variables : les tentatives, le temps de réaction et le temps moteur. En utilisant des outils statistiques permettant des analyses de données multidimensionnelles (CAH, AFC, il a été possible soit d’agréger des tâches aux profils identiques soit de les différencier en fonction du poids de chaque descripteur sur les variables dépendantes. Surtout, il est envisageable de préciser l’apport de chaque variable dans la définition de la difficulté que se donne a posteriori le chercheur.
    PALABRAS CLAVE: Difficulté, traitement de l’information, tâche motrice, classification, analyse de données.

    This article deals with a new method to classify informational motor tasks, through a multidimensional approach of difficulty. The following experiment is used: 345 subjects are asked to point at computer-managed mobile targets. The 3 selected target parameters are: velocity, area and spatial uncertainty. Independence and numerical scalability are the reasons for this choice. As performance does not sump up difficulty, other dependent variables have been added: number of attempts, reaction time and motor time. The use of

  9. Technology Transfer

    Science.gov (United States)

    Smith, Nanette R.

    1995-01-01

    The objective of this summer's work was to attempt to enhance Technology Application Group (TAG) ability to measure the outcomes of its efforts to transfer NASA technology. By reviewing existing literature, by explaining the economic principles involved in evaluating the economic impact of technology transfer, and by investigating the LaRC processes our William & Mary team has been able to lead this important discussion. In reviewing the existing literature, we identified many of the metrics that are currently being used in the area of technology transfer. Learning about the LaRC technology transfer processes and the metrics currently used to track the transfer process enabled us to compare other R&D facilities to LaRC. We discuss and diagram impacts of technology transfer in the short run and the long run. Significantly, it serves as the basis for analysis and provides guidance in thinking about what the measurement objectives ought to be. By focusing on the SBIR Program, valuable information regarding the strengths and weaknesses of this LaRC program are to be gained. A survey was developed to ask probing questions regarding SBIR contractors' experience with the program. Specifically we are interested in finding out whether the SBIR Program is accomplishing its mission, if the SBIR companies are providing the needed innovations specified by NASA and to what extent those innovations have led to commercial success. We also developed a survey to ask COTR's, who are NASA employees acting as technical advisors to the SBIR contractors, the same type of questions, evaluating the successes and problems with the SBIR Program as they see it. This survey was developed to be implemented interactively on computer. It is our hope that the statistical and econometric studies that can be done on the data collected from all of these sources will provide insight regarding the direction to take in developing systematic evaluations of programs like the SBIR Program so that they can

  10. Technology applications

    Science.gov (United States)

    Anuskiewicz, T.; Johnston, J.; Leavitt, W.; Zimmerman, R. R.

    1972-01-01

    A summary of NASA Technology Utilization programs for the period of 1 December 1971 through 31 May 1972 is presented. An abbreviated description of the overall Technology Utilization Applications Program is provided as a background for the specific applications examples. Subjects discussed are in the broad headings of: (1) cancer, (2) cardiovascular disease, (2) medical instrumentation, (4) urinary system disorders, (5) rehabilitation medicine, (6) air and water pollution, (7) housing and urban construction, (8) fire safety, (9) law enforcement and criminalistics, (10) transportation, and (11) mine safety.

  11. Architectural technology

    DEFF Research Database (Denmark)

    2005-01-01

    The booklet offers an overall introduction to the Institute of Architectural Technology and its projects and activities, and an invitation to the reader to contact the institute or the individual researcher for further information. The research, which takes place at the Institute of Architectural...... Technology at the Roayl Danish Academy of Fine Arts, School of Architecture, reflects a spread between strategic, goal-oriented pilot projects, commissioned by a ministry, a fund or a private company, and on the other hand projects which originate from strong personal interests and enthusiasm of individual...

  12. Technology Transfer: Marketing Tomorrow's Technology

    Science.gov (United States)

    Tcheng, Erene

    1995-01-01

    The globalization of the economy and the end of the Cold War have triggered many changes in the traditional practices of U.S. industry. To effectively apply the resources available to the United States, the federal government has firmly advocated a policy of technology transfer between private industry and government labs, in this case the National Aeronautics and Space Administration (NASA). NASA Administrator Daniel Goldin is a strong proponent of this policy and has organized technology transfer or commercialization programs at each of the NASA field centers. Here at Langley Research Center, the Technology Applications Group (TAG) is responsible for facilitating the transfer of Langley developed research and technology to U.S. industry. Entering the program, I had many objectives for my summer research with TAG. Certainly, I wanted to gain a more thorough understanding of the concept of technology transfer and Langley's implementation of a system to promote it to both the Langley community and the community at large. Also, I hoped to become more familiar with Langley's research capabilities and technology inventory available to the public. More specifically, I wanted to learn about the technology transfer process at Langley. Because my mentor is a member of Materials and Manufacturing marketing sector of the Technology Transfer Team, another overriding objective for my research was to take advantage of his work and experience in materials research to learn about the Advanced Materials Research agency wide and help market these developments to private industry. Through the various projects I have been assigned to work on in TAG, I have successfully satisfied the majority of these objectives. Work on the Problem Statement Process for TAG as well as the development of the Advanced Materials Research Brochure have provided me with the opportunity to learn about the technology transfer process from the outside looking in and the inside looking out. Because TAG covers

  13. Blast Technologies

    Science.gov (United States)

    2011-06-27

    Team Leader Risa Scherer Blast Mitigation Interior and Laboratory Team Leader Blast Technologies POC’s Government Point Of Contacts (POCs): To...to yield injury assessments at higher fidelities and with higher confidence UNCLASSIFIED UNCLASSIFIED Risa Scherer Blast Mitigation Interior and

  14. Health technology

    International Nuclear Information System (INIS)

    Nicolas, Delphine; Dangleant, Caroline; Ganier, Aude; Kaczmarek, Delphine

    2008-01-01

    The CEA is an organization with a primarily technological focus, and one of the key areas in which it carries out research is Health Technology. This field of research was recognized and approved by the French Atomic Energy Committee on July 20, 2004. The expectations of both the public and health care professionals relate to demands for the highest standards of health care, at minimum risk. This implies a need to diagnose illness and disease as accurately and as at early a stage as possible, to target surgery precisely to deal only with damaged organs or tissues, to minimize the risk of side effects, allergies and hospital-acquired infections, to follow-up and, as far as possible, tailor the health delivery system to each individual's needs and his or her lifestyle. The health care sector is subject to rapid changes and embraces a vast range of scientific fields. It now requires technological developments that will serve to gather increasing quantities of useful information, analyze and integrate it to obtain a full understanding of highly complex processes and to be able to treat the human body as un-invasively as possible. All the technologies developed require assessment, especially in the hospital environment. (authors)

  15. Technology transfer

    International Nuclear Information System (INIS)

    Boury, C.

    1986-01-01

    This paper emphasizes in the specific areas of design, engineering and component production. This paper presents what Framatome has to offer in these areas and its export oriented philosophy. Then, a typical example of this technology transfer philosophy is the collaboration with the South Korean firm, Korea Heavy Industries Corporation (KHIC) for the supply of KNU 9 and KNU 10 power stations

  16. Technology Transfer

    Science.gov (United States)

    Bullock, Kimberly R.

    1995-01-01

    The development and application of new technologies in the United States has always been important to the economic well being of the country. The National Aeronautics and Space Administration (NASA) has been an important source of these new technologies for almost four decades. Recently, increasing global competition has emphasized the importance of fully utilizing federally funded technologies. Today NASA must meet its mission goals while at the same time, conduct research and development that contributes to securing US economic growth. NASA technologies must be quickly and effectively transferred into commercial products. In order to accomplish this task, NASA has formulated a new way of doing business with the private sector. Emphasis is placed on forming mutually beneficial partnerships between NASA and US industry. New standards have been set in response to the process that increase effectiveness, efficiency, and timely customer response. This summer I have identified potential markets for two NASA inventions: including the Radially Focused Eddy Current Sensor for Characterization of Flaws in Metallic Tubing and the Radiographic Moire. I have also worked to establish a cooperative program with TAG, private industry, and a university known as the TAG/Industry/Academia Program.

  17. Energy Technology.

    Science.gov (United States)

    Eaton, William W.

    Reviewed are technological problems faced in energy production including locating, recovering, developing, storing, and distributing energy in clean, convenient, economical, and environmentally satisfactory manners. The energy resources of coal, oil, natural gas, hydroelectric power, nuclear energy, solar energy, geothermal energy, winds, tides,…

  18. (Environmental technology)

    Energy Technology Data Exchange (ETDEWEB)

    Boston, H.L.

    1990-10-12

    The traveler participated in a conference on environmental technology in Paris, sponsored by the US Embassy-Paris, US Environmental Protection Agency (EPA), the French Environmental Ministry, and others. The traveler sat on a panel for environmental aspects of energy technology and made a presentation on the potential contributions of Oak Ridge National Laboratory (ORNL) to a planned French-American Environmental Technologies Institute in Chattanooga, Tennessee, and Evry, France. This institute would provide opportunities for international cooperation on environmental issues and technology transfer related to environmental protection, monitoring, and restoration at US Department of Energy (DOE) facilities. The traveler also attended the Fourth International Conference on Environmental Contamination in Barcelona. Conference topics included environmental chemistry, land disposal of wastes, treatment of toxic wastes, micropollutants, trace organics, artificial radionuclides in the environment, and the use biomonitoring and biosystems for environmental assessment. The traveler presented a paper on The Fate of Radionuclides in Sewage Sludge Applied to Land.'' Those findings corresponded well with results from studies addressing the fate of fallout radionuclides from the Chernobyl nuclear accident. There was an exchange of new information on a number of topics of interest to DOE waste management and environmental restoration needs.

  19. Geospatial Technology

    Science.gov (United States)

    Reed, Philip A.; Ritz, John

    2004-01-01

    Geospatial technology refers to a system that is used to acquire, store, analyze, and output data in two or three dimensions. This data is referenced to the earth by some type of coordinate system, such as a map projection. Geospatial systems include thematic mapping, the Global Positioning System (GPS), remote sensing (RS), telemetry, and…

  20. Photovoltaic technologies

    International Nuclear Information System (INIS)

    Bagnall, Darren M.; Boreland, Matt

    2008-01-01

    Photovoltaics is already a billion dollar industry. It is experiencing rapid growth as concerns over fuel supplies and carbon emissions mean that governments and individuals are increasingly prepared to ignore its current high costs. It will become truly mainstream when its costs are comparable to other energy sources. At the moment, it is around four times too expensive for competitive commercial production. Three generations of photovoltaics have been envisaged that will take solar power into the mainstream. Currently, photovoltaic production is 90% first-generation and is based on silicon wafers. These devices are reliable and durable, but half of the cost is the silicon wafer and efficiencies are limited to around 20%. A second generation of solar cells would use cheap semiconductor thin films deposited on low-cost substrates to produce devices of slightly lower efficiency. A number of thin-film device technologies account for around 5-6% of the current market. As second-generation technology reduces the cost of active material, the substrate will eventually be the cost limit and higher efficiency will be needed to maintain the cost-reduction trend. Third-generation devices will use new technologies to produce high-efficiency devices. Advances in nanotechnology, photonics, optical metamaterials, plasmonics and semiconducting polymer sciences offer the prospect of cost-competitive photovoltaics. It is reasonable to expect that cost reductions, a move to second-generation technologies and the implementation of new technologies and third-generation concepts can lead to fully cost-competitive solar energy in 10-15 years. (author)

  1. Technology Programme

    International Nuclear Information System (INIS)

    Batistoni, Paola; De Marco, Francesco; Pieroni, Leonardo

    2005-01-01

    The technology activities carried out by the Euratom-ENEA Association in the framework of the European Fusion Development Agreement concern the Next Step (International Thermonuclear Experimental Reactor - ITER), the Long-Term Programme (breeder blanket, materials, International Fusion Materials Irradiation Facility - IFMIF), Power Plant Conceptual Studies and Socio-Economic Studies. The Underlying Technology Programme was set up to complement the fusion activities as well to develop technologies with a wider range of interest. The Technology Programme mainly involves staff from the Frascati laboratories of the Fusion Technical and Scientific Unit and from the Brasimone laboratories of the Advanced Physics Technologies Unit. Other ENEA units also provide valuable contributions to the programme. ENEA is heavily engaged in component development/testing and in design and safety activities for the European Fusion Technology Programme. Although the work documented in the following covers a large range of topics that differ considerably because they concern the development of extremely complex systems, the high level of integration and coordination ensures the capability to cover the fusion system as a whole. In 2004 the most significant testing activities concerned the ITER primary beryllium-coated first wall. In the field of high-heat-flux components, an important achievement was the qualification of the process for depositing a copper liner on carbon fibre composite (CFC) hollow tiles. This new process, pre-brazed casting (PBC), allows the hot radial pressing (HRP) joining procedure to be used also for CFC-based armour monoblock divertor components. The PBC and HRP processes are candidates for the construction of the ITER divertor. In the materials field an important milestone was the commissioning of a new facility for chemical vapour infiltration/deposition, used for optimising silicon carbide composite (SiCf/SiC) components. Eight patents were deposited during 2004

  2. Technology Programme

    Energy Technology Data Exchange (ETDEWEB)

    Batistoni, Paola; De Marco, Francesco; Pieroni, Leonardo (ed.)

    2005-07-01

    The technology activities carried out by the Euratom-ENEA Association in the framework of the European Fusion Development Agreement concern the Next Step (International Thermonuclear Experimental Reactor - ITER), the Long-Term Programme (breeder blanket, materials, International Fusion Materials Irradiation Facility - IFMIF), Power Plant Conceptual Studies and Socio-Economic Studies. The Underlying Technology Programme was set up to complement the fusion activities as well to develop technologies with a wider range of interest. The Technology Programme mainly involves staff from the Frascati laboratories of the Fusion Technical and Scientific Unit and from the Brasimone laboratories of the Advanced Physics Technologies Unit. Other ENEA units also provide valuable contributions to the programme. ENEA is heavily engaged in component development/testing and in design and safety activities for the European Fusion Technology Programme. Although the work documented in the following covers a large range of topics that differ considerably because they concern the development of extremely complex systems, the high level of integration and coordination ensures the capability to cover the fusion system as a whole. In 2004 the most significant testing activities concerned the ITER primary beryllium-coated first wall. In the field of high-heat-flux components, an important achievement was the qualification of the process for depositing a copper liner on carbon fibre composite (CFC) hollow tiles. This new process, pre-brazed casting (PBC), allows the hot radial pressing (HRP) joining procedure to be used also for CFC-based armour monoblock divertor components. The PBC and HRP processes are candidates for the construction of the ITER divertor. In the materials field an important milestone was the commissioning of a new facility for chemical vapour infiltration/deposition, used for optimising silicon carbide composite (SiCf/SiC) components. Eight patents were deposited during 2004

  3. Technological Networks

    Science.gov (United States)

    Mitra, Bivas

    The study of networks in the form of mathematical graph theory is one of the fundamental pillars of discrete mathematics. However, recent years have witnessed a substantial new movement in network research. The focus of the research is shifting away from the analysis of small graphs and the properties of individual vertices or edges to consideration of statistical properties of large scale networks. This new approach has been driven largely by the availability of technological networks like the Internet [12], World Wide Web network [2], etc. that allow us to gather and analyze data on a scale far larger than previously possible. At the same time, technological networks have evolved as a socio-technological system, as the concepts of social systems that are based on self-organization theory have become unified in technological networks [13]. In today’s society, we have a simple and universal access to great amounts of information and services. These information services are based upon the infrastructure of the Internet and the World Wide Web. The Internet is the system composed of ‘computers’ connected by cables or some other form of physical connections. Over this physical network, it is possible to exchange e-mails, transfer files, etc. On the other hand, the World Wide Web (commonly shortened to the Web) is a system of interlinked hypertext documents accessed via the Internet where nodes represent web pages and links represent hyperlinks between the pages. Peer-to-peer (P2P) networks [26] also have recently become a popular medium through which huge amounts of data can be shared. P2P file sharing systems, where files are searched and downloaded among peers without the help of central servers, have emerged as a major component of Internet traffic. An important advantage in P2P networks is that all clients provide resources, including bandwidth, storage space, and computing power. In this chapter, we discuss these technological networks in detail. The review

  4. Innovative Technology in Automotive Technology

    Science.gov (United States)

    Gardner, John

    2007-01-01

    Automotive Technology combines hands-on training along with a fully integrated, interactive, computerized multistationed facility. Our program is a competency based, true open-entry/open-exit program that utilizes flexible self-paced course outlines. It is designed around an industry partnership that promotes community and economic development,…

  5. Playful Technology

    DEFF Research Database (Denmark)

    Johansen, Stine Liv; Eriksson, Eva

    2013-01-01

    In this paper, the design of future services for children in Danish public libraries is discussed, in the light of new challenges and opportunities in relation to new media and technologies. The Danish government has over the last few years initiated and described a range of initiatives regarding...... the future of public libraries, especially in relation to children as a particular user group. This paper explores play culture, and takes a stance especially in the project ‘Families at play in the library’, but also in experiences from related projects. The focus is on families playing together...... in the library, the changing role of the librarians and the library space. We argue that intertwining traditional library services with new media forms and engaging play is the core challenge for future design in physical public libraries, but also that it is through new media and technology that new...

  6. Technology transfer

    International Nuclear Information System (INIS)

    Anon.

    1977-01-01

    Illustrated by the example of the FRG's nuclear energy exports, it is shown that the nuclear technology transfer leads to new dimensions of intergovernmental relations, which hold within themselves on account of multiple state-to-state, scientific, industrial and - last but not least - personal contacts the chance of far-reaching friendships between countries and people. If the chance is taken, this can also be seen as an important contribution towards maintaining the peace. (orig.) [de

  7. Group technology

    International Nuclear Information System (INIS)

    Rome, C.P.

    1976-01-01

    Group Technology has been conceptually applied to the manufacture of batch-lots of 554 machined electromechanical parts which now require 79 different types of metal-removal tools. The products have been grouped into 7 distinct families which require from 8 to 22 machines in each machine-cell. Throughput time can be significantly reduced and savings can be realized from tooling, direct-labor, and indirect-labor costs

  8. Army Technology

    Science.gov (United States)

    2015-02-01

    MUTT ) is a semi-autonomous robotic follower that lightens the load for Soldiers by decreasing the amount of equipment they need to carry when...dismounted in the toughest of terrains. The MUTT uses advanced, proven commercial technology that has been adapted for the rigors of the battlefield...With ultra-quiet electric motors, the MUTT gives Soldiers unmatched internal transportability options and expeditionary power that includes hands- free

  9. ADSL Technology

    Directory of Open Access Journals (Sweden)

    Slavko Šarić

    2002-11-01

    Full Text Available The paper deals with the ADSL (Asymmetric Digital SubscriberLine technology- the asymmetric digital telecommunicationtechnology. It is characterised by high-speed transmissionof data and simultaneous transmission of information regardingthe throughput capacity of the telephone network. Thisresults in better efficiency of transmission, and higher utilisationof the bandwidth. Due to its advantages, the use of ADSLtechnology is increasing daily, especially by ente1prises in Europeand worldwide.

  10. Nuclear technology

    International Nuclear Information System (INIS)

    1983-03-01

    This report examines nuclear technology in Canada, with emphasis on Quebec, as a means of revitilizing industry. The historical, present day, and future states of Atomic Energy of Canada Limited are examined. Future research programs are discussed in greatest detail. These range from disposal of porcine wastes to new applications for electricity to nuclear medical techniques (to cite only a few examples). The executive summary is written in English. (23 fig., 16 tab.)

  11. Emerging technologies

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Shin-yee

    1993-03-01

    The mission of the Emerging Technologies thrust area at Lawrence Livermore National Laboratory is to help individuals establish technology areas that have national and commercial impact, and are outside the scope of the existing thrust areas. We continue to encourage innovative ideas that bring quality results to existing programs. We also take as our mission the encouragement of investment in new technology areas that are important to the economic competitiveness of this nation. In fiscal year 1992, we have focused on nine projects, summarized in this report: (1) Tire, Accident, Handling, and Roadway Safety; (2) EXTRANSYT: An Expert System for Advanced Traffic Management; (3) Odin: A High-Power, Underwater, Acoustic Transmitter for Surveillance Applications; (4) Passive Seismic Reservoir Monitoring: Signal Processing Innovations; (5) Paste Extrudable Explosive Aft Charge for Multi-Stage Munitions; (6) A Continuum Model for Reinforced Concrete at High Pressures and Strain Rates: Interim Report; (7) Benchmarking of the Criticality Evaluation Code COG; (8) Fast Algorithm for Large-Scale Consensus DNA Sequence Assembly; and (9) Using Electrical Heating to Enhance the Extraction of Volatile Organic Compounds from Soil.

  12. Technology Management

    DEFF Research Database (Denmark)

    Pilkington, Alan

    2014-01-01

    This paper reports a bibliometric analysis (co-citation network analysis) of 10 journals in the management of technology (MOT) field. As well as introducing various bibliometric ideas, network analysis tools identify and explore the concepts covered by the field and their inter-relationships. Spe......This paper reports a bibliometric analysis (co-citation network analysis) of 10 journals in the management of technology (MOT) field. As well as introducing various bibliometric ideas, network analysis tools identify and explore the concepts covered by the field and their inter......-relationships. Specific results from different levels of analysis show the different dimensions of technology management: • Co-word terms identify themes • Journal co-citation network: linking to other disciplines • Co-citation network show concentrations of themes The analysis shows that MOT has a bridging role...... in integrating ideas from several distinct disciplines. This suggests that management and strategy are central to MOT which essentially relates to the firm rather than policy. Similarly we have a dual focus on capabilities, but can see subtle differences in how we view these ideas, either through an inwards...

  13. Wearable Technology

    Science.gov (United States)

    Watson, Amanda

    2013-01-01

    Wearable technology projects, to be useful, in the future, must be seamlessly integrated with the Flight Deck of the Future (F.F). The lab contains mockups of space vehicle cockpits, habitat living quarters, and workstations equipped with novel user interfaces. The Flight Deck of the Future is one element of the Integrated Power, Avionics, and Software (IPAS) facility, which, to a large extent, manages the F.F network and data systems. To date, integration with the Flight Deck of the Future has been limited by a lack of tools and understanding of the Flight Deck of the Future data handling systems. To remedy this problem it will be necessary to learn how data is managed in the Flight Deck of the Future and to develop tools or interfaces that enable easy integration of WEAR Lab and EV3 products into the Flight Deck of the Future mockups. This capability is critical to future prototype integration, evaluation, and demonstration. This will provide the ability for WEAR Lab products, EV3 human interface prototypes, and technologies from other JSC organizations to be evaluated and tested while in the Flight Deck of the Future. All WEAR Lab products must be integrated with the interface that will connect them to the Flight Deck of the Future. The WEAR Lab products will primarily be programmed in Arduino. Arduino will be used for the development of wearable controls and a tactile communication garment. Arduino will also be used in creating wearable methane detection and warning system.

  14. Understanding Technology?

    Directory of Open Access Journals (Sweden)

    Erik Bendtsen

    2016-11-01

    Full Text Available We are facing radical changes in our ways of living in the nearest future. Not necessarily of our own choice, but because tchnological development is moving so fast, that it will have still greater impact on many aspects of our lives. We have seen the beginnings of that change within the latest 35 years or so, but according to newest research that change will speed up immensely in the nearest years to come. The impact of that change or these changes will affect our working life immensely as a consequence of automation. How these changes are brought about and which are their consequences in a broad sense is being attempted to be understood and guessed by researchers. No one knows for sure, but specific patterns are visible. This paper will not try to guess, what will come, but will rather try to understand the deepest ”nature” of technology in order to understand the driving factors in this development: the genesis of technology in a broad sense in order to contibute to the understanding of the basis for the expected development.

  15. Photon technology. Hard photon technology; Photon technology. Hard photon gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    Research results of hard photon technology have been summarized as a part of novel technology development highly utilizing the quantum nature of photon. Hard photon technology refers to photon beam technologies which use photon in the 0.1 to 200 nm wavelength region. Hard photon has not been used in industry due to the lack of suitable photon sources and optical devices. However, hard photon in this wavelength region is expected to bring about innovations in such areas as ultrafine processing and material synthesis due to its atom selective reaction, inner shell excitation reaction, and spatially high resolution. Then, technological themes and possibility have been surveyed. Although there are principle proposes and their verification of individual technologies for the technologies of hard photon generation, regulation and utilization, they are still far from the practical applications. For the photon source technology, the laser diode pumped driver laser technology, laser plasma photon source technology, synchrotron radiation photon source technology, and vacuum ultraviolet photon source technology are presented. For the optical device technology, the multi-layer film technology for beam mirrors and the non-spherical lens processing technology are introduced. Also are described the reduction lithography technology, hard photon excitation process, and methods of analysis and measurement. 430 refs., 165 figs., 23 tabs.

  16. Architectural Technology and Technological Planning

    Directory of Open Access Journals (Sweden)

    Giorgio Giallocosta

    2011-11-01

    Full Text Available At least three fundamental aspects of the many singular technological approaches to architectural planning are currently evolving significantly and are ripe for potential development. The first relates to enhanced opportunities for defining the ex-ante characteristics and performance of building products and components, but particularly concerns potential leadership assumptions in planning and the ‘reification’ of architecture through ‘collective’ behaviours. The second relates to the tendency to try and overcome the connotation of architectural projects, inclusive of their entire life cycle. The third relates to current evolutionary developments (either potential or simply implicit in performance approach.

  17. Technology round and management of technology

    International Nuclear Information System (INIS)

    Park, Yong Tae

    1994-04-01

    This book deals with beginning of technology round with background of it, change of scientific technique paradigm with economy, management and policy, change of international political environment globalization of technical and economic environment, formation of strategic alliance, intensifying regionalism, new GATT system, UR and technology round, new international technique regulation and technology round of OECD, feature and meaning of technology round, assignment and scientific technique of Korea, past and present of scientific technology in Korea, correspondence for technology round.

  18. Incineration technologies

    CERN Document Server

    Buekens, Alfons

    2013-01-01

    Waste incineration is the art of completely combusting waste, while maintaining or reducing emission levels below current emission standards. Where possible, objectives include the recovering of energy as well as the  combustion residues.  Successful waste incineration makes it possible to achieve a deep reduction in waste volume, obtain a compact and sterile residue, and eliminate a wide array of pollutants. This book places waste incineration within the wider context of waste management, and demonstrates that, in contrast to landfills and composting, waste incineration can eliminate objectionable and hazardous properties such as flammability and toxicity, result in a significant reduction in volume, and destroy gaseous and liquid waste streams leaving little or no residues beyond those linked to flue gas neutralization and treatment. Moreover, waste incineration sterilizes and destroys putrescible matter, and produces usable heat.  Incineration Technologies first appeared as a peer-reviewed contribution ...

  19. Robot technology

    International Nuclear Information System (INIS)

    Vertut, Jean; Coiffet, Philippe.

    1985-01-01

    Teleoperation is concerned with the exploration and exploitation of of spaces which do not allow, because of their inaccessibility or hostility, direct access to man. This volume (Parts 2, 3 and 4) covers the contribution of computer science and automatic control to this technology. Part 2 includes a description of teleoperation systems followed by chapters on the operator substitution function by computer feedback to the operator. Part 3 has chapters on performance evaluation of teleoperation systems and the human operator in the teleoperation system. Part 4 is about applications of teleoperation in the nuclear industry, underwater, in space, in medicine, in industry and in security and civil protection. The nuclear applications include research and pilot facilities, reactor operation and maintenance, reactor decommissioning and dismantling and in emergencies, for example following a reactor accident. (U.K.)

  20. Lander Technologies

    Science.gov (United States)

    Chavers, Greg

    2015-01-01

    Since 2006 NASA has been formulating robotic missions to the lunar surface through programs and projects like the Robotic Lunar Exploration Program, Lunar Precursor Robotic Program, and International Lunar Network. All of these were led by NASA Marshall Space Flight Center (MSFC). Due to funding shortfalls, the lunar missions associated with these efforts, the designs, were not completed. From 2010 to 2013, the Robotic Lunar Lander Development Activity was funded by the Science Mission Directorate (SMD) to develop technologies that would enable and enhance robotic lunar surface missions at lower costs. In 2013, a requirements-driven, low-cost robotic lunar lander concept was developed for the Resource Prospector Mission. Beginning in 2014, The Advanced Exploration Systems funded the lander team and established the MSFC, Johnson Space Center, Applied Physics Laboratory, and the Jet Propulsion Laboratory team with MSFC leading the project. The lander concept to place a 300-kg rover on the lunar surface has been described in the New Technology Report Case Number MFS-33238-1. A low-cost lander concept for placing a robotic payload on the lunar surface is shown in figures 1 and 2. The NASA lander team has developed several lander concepts using common hardware and software to allow the lander to be configured for a specific mission need. In addition, the team began to transition lander expertise to United States (U.S.) industry to encourage the commercialization of space, specifically the lunar surface. The Lunar Cargo Transportation and Landing by Soft Touchdown (CATALYST) initiative was started and the NASA lander team listed above is partnering with three competitively selected U.S. companies (Astrobotic, Masten Space Systems, and Moon Express) to develop, test, and operate their lunar landers.

  1. Powder technology

    International Nuclear Information System (INIS)

    Agueda, Horacio

    1989-01-01

    Powder technology is experiencing nowadays a great development and has broad application in different fields: nuclear energy, medicine, new energy sources, industrial and home artifacts, etc. Ceramic materials are of daily use as tableware and also in the building industry (bricks, tiles, etc.). However, in machine construction its utilization is not so common. The same happens with metals: powder metallurgy is employed less than traditional metal forming techniques. Both cases deal with powder technology and the forming techniques as far as the final consolidation through sintering processes are very similar. There are many different methods and techniques in the forming stage: cold-pressing, slip casting, injection molding, extrusion molding, isostatic pressing, hot-pressing (which involves also the final consolidation step), etc. This variety allows to obtain almost any desired form no matter how complex it could be. Some applications are very specific as in the case of UO 2 pellets (used as nuclear fuels) but with the same technique and other materials, it is possible to manufacture a great number of different products. This work shows the characteristics and behaviour of two magnetic ceramic materials (ferrites) fabricated in the laboratory of the Applied Research Division of the Bariloche Atomic Center for different purposes. Other materials and products made with the same method are also mentioned. Likewise, densities and shrinkage obtained by different methods of forming (cold-pressing, injection molding, slip casting and extrusion molding) using high-purity alumina (99.5% Al 2 O 3 ). Finally, different applications of such methods are given. (Author) [es

  2. Technology programme

    International Nuclear Information System (INIS)

    2007-01-01

    The technology activities carried out by the EURATOM-ENEA Association concern the continuation of the European Fusion Development Agreement (EFDA) as well as the ITER activities coordinated by the ITER International Office and Fusion for Energy. Also included in the activities are design and RD under the Broader Approach Agreement between the EU and Japan. In order to better contribute to the programme a number of consortium agreements among the Associations are being signed. Collaboration with industries in view of their participation in the construction of ITER was further strengthened, mainly in the field of magnet and divertor components. The new European Test Blanket Facility at ENEA Brasimone was completed; the design of the ITER radial neutron camera was optimised and the performance achievable with the in-vessel viewing system was further assessed by experimental trials. Design activities for the JT-60SA magnet and power supply system as well as the design and experimental activities related to the target of the International Fusion Materials Irradiation Facility were continued. Significant work was done to define quality assurance for neutronics analyses. Mockups of the ITER pre-compression ring made in glass fibre epoxy were tested. The activities and results documented in the following illustrate ENEA's efforts to support fusion development

  3. How Technology Teachers Understand Technological Knowledge

    Science.gov (United States)

    Norström, Per

    2014-01-01

    Swedish technology teachers' views of technological knowledge are examined through a written survey and a series of interviews. The study indicates that technology teachers' understandings of what constitutes technological knowledge and how it is justified vary considerably. The philosophical discussions on the topic are unknown to them. This lack…

  4. International technology transfer

    International Nuclear Information System (INIS)

    Kwon, Won Gi

    1991-11-01

    This book introduces technology progress and economic growth, theoretical consideration of technology transfer, policy and mechanism on technology transfer of a developed country and a developing country, reality of international technology transfer technology transfer and industrial structure in Asia and the pacific region, technology transfer in Russia, China and Eastern Europe, cooperation of science and technology for development of Northeast Asia and strategy of technology transfer of Korea.

  5. Technological capabilities, technological dynamism and innovation offshoring

    OpenAIRE

    Schubert, Torben; Baier, Elisabeth; Rammer, Christian

    2016-01-01

    In this paper we analyze the conditions under which firms decide to offshore innovation. We consider the role of internal technological capabilities and technological dynamism in the firm environment, distinguishing speed and uncertainty of technological change. Using unique data from the German Innovation Survey we find that while high speed of technological change tends to drive innovation offshoring, high uncertainty about future technology developments results in more innovation offsho...

  6. Flywheel Technology

    Science.gov (United States)

    Ritchie, Lisa M.

    2004-01-01

    Throughout the summer of 2004, I am working on a number of different projects. While located in the Space Power and Propulsion Test Engineering branch, my main area of study is flywheel technology. I have been exposed to flywheels, their components, and their uses in today's society. I have been able to experience numerous flywheels here in the flywheel lab at NASA Glenn. My first main project was to explore the attributes and physical characteristics of a flywheel. Our branch was constructing a flywheel demonstration to be presented at the public open house taking place in June. Our Flywheel Interactive Demo, or FIDO, represents a real life multi-flywheel system here at NASA. I was given the opportunity to learn about how these flywheels store energy and are able to position a satellite. With all of this new knowledge, I was able to create the posters that explained how our demonstration worked. I also composed a step-by-step process made up of four experiments that any visitor could follow and perform on FIDO. By stepping through these experiments, the individual learns how a flywheel works. They not only read the explanation of what is happening, but they are also able to see it happen. Creating these two posters not only taught me, but also helped teach the general public during the open house, how flywheel technology is a very important part of our future. Through my research, I have learned that flywheels are able to store massive amounts of energy. They can be described as an electro-mechanical battery that stores kinetic energy while rotating. The faster it rotates, the more energy it stores. Their lifetime is about triple that of an ordinary battery. Flywheels also have the ability to combine energy storage with attitude control all in a single system. Attitude control is the ability to position a satellite as required. FIDO helps us to understand the rotational force (torque) that is applied upon a turn-table or satellite during wheel acceleration

  7. Agronomic by-products use from olive oil extraction: legislative, technological aspects and experimental results; Utilizzazione agronomica dei sottoprodotti dell`estrazione olearia: aspetti legislativi, tecnologici e risultati sperimentali

    Energy Technology Data Exchange (ETDEWEB)

    Amirante, R. [Campobasso, Univ. del Molise (Italy). Dipt. Scienze Animali, Vegetali e dell`Ambiente

    1998-01-01

    The state of the art in the olive oil extraction plants is presented in this paper. These plants allow the removal or reduction of water emission by extraction process with decanter, changing the by-products characteristics of the olive oil industry. The different waste water re-use possibilities are analyzed, in relation to the new Italian law about the discharge of the olive mills effluents. Then, new technologies for the substances-mix composting from agronomic industries and some different lay-out for the specific plants in the by-products transformation are presented. Experimental test of olive pomace composting, depleted olive pomace, waste water concentrate, and directed in field distribution of the olive pomace, are given in this paper. At last, interesting results can be achieved composting the waste waters and/or their concentrate, or the olive pomace or depleted olive pomace with organic and nitrogen products, obtaining good fertilizers. [Italiano] In questa memoria si illustra lo stato attuale della evoluzione degli impianti per l`estrazione olearia che tendono ad eliminare o comunque a ridurre l`immissione di acqua di processo nella estrazione centrifuga, modificando cosi` le caratteristiche dei sottoprodotti della industria olearia. Vengono, di seguito, analizzate le possibili destinazioni d`uso delle acque di vegetazione (A.V.) alla luce della nuova legislazione italiana in materia della possibile utilizzazione degli scarichi dei frantoi oleari. Si illustrano, quindi, nuove tecnologie per il compostaggio di sostanze derivate dall`agroindustria miscelate con altre matrici organiche e alcuni criteri costruttivi di impianti specifici per il trattamento dei suddetti sottoprodotti. Si riferisce, infine, su prove sperimentali di compostaggio di sanse vergini, sanse esauste e di concentrati delle A.V., nonche` sulla distribuzione diretta in campo delle sanse vergini. L`autore conclude affermando che sia le acque di vegetazione e i relativi concentrati di

  8. Marketing technologically advanced products

    OpenAIRE

    Bender, Horst

    1989-01-01

    This paper calls for a merger of technology and marketing under a customer value perspective; for an enhancement of the traditional technological innovation orientation of the technology-based firm with a market thrust. It establishes technology-based products as product-service offerings that are derived from technological innovation. The aim in marketing technology-based products is an improved understanding of how an organization can combine a technology orientation with a customer value t...

  9. Sports and Technology. Resources in Technology.

    Science.gov (United States)

    Hadley, Fred W.

    1993-01-01

    Technology is making a significant impact in all areas of sports and recreation. New equipment and computer training methods in spectator sports have had a major social and economic impact, and individual sports have reaped the benefits of technology. (JOW)

  10. Plasma technology directory

    International Nuclear Information System (INIS)

    Ward, P.P.; Dybwad, G.L.

    1995-01-01

    The Plasma Technology Directory has two main goals: (1) promote, coordinate, and share plasma technology experience and equipment within the Department of Energy; and (2) facilitate technology transfer to the commercial sector where appropriate. Personnel are averaged first by Laboratory and next by technology area. The technology areas are accelerators, cleaning and etching deposition, diagnostics, and modeling

  11. Hydrogen technologies and the technology learning curve

    International Nuclear Information System (INIS)

    Rogner, H.-H.

    1998-01-01

    On their bumpy road to commercialization, hydrogen production, delivery and conversion technologies not only require dedicated research, development and demonstration efforts, but also protected niche markets and early adopters. While niche markets utilize the unique technological properties of hydrogen, adopters exhibit a willingness to pay a premium for hydrogen fueled energy services. The concept of the technology learning curve is applied to estimate the capital requirements associated with the commercialization process of several hydrogen technologies. (author)

  12. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  13. International Technology Transfer.

    Science.gov (United States)

    Morris, Robert G.

    The flow of technology out of the United States is discussed. Methods of technology flow, such as licensing and investing, are identified, and the advantages and disadvantages of technology transfer are discussed, especially in relation to the government's role. (MLH)

  14. Computer technology and evolution

    OpenAIRE

    Mainzer, Klaus

    1998-01-01

    Computer technology and evolution : from artificial intelligence to artificial life. - In: Advances in the philosophy of technology / ed. by Evandro Agazzi ... - Newark, Del. : Soc. for Philosophy and Technology, 1999. - S. 105-119

  15. Excimer Laser Technology

    CERN Document Server

    Basting, Dirk

    2005-01-01

    This comprehensive survey on Excimer Lasers investigates the current range of the technology, applications and devices of this commonly used laser source, as well as the future of new technologies, such as F2 laser technology. Additional chapters on optics, devices and laser systems complete this compact handbook. A must read for laser technology students, process application researchers, engineers or anyone interested in excimer laser technology. An effective and understandable introduction to the current and future status of excimer laser technology.

  16. Technology Transfer Report

    Science.gov (United States)

    2000-01-01

    Since its inception, Goddard has pursued a commitment to technology transfer and commercialization. For every space technology developed, Goddard strives to identify secondary applications. Goddard then provides the technologies, as well as NASA expertise and facilities, to U.S. companies, universities, and government agencies. These efforts are based in Goddard's Technology Commercialization Office. This report presents new technologies, commercialization success stories, and other Technology Commercialization Office activities in 1999.

  17. Technology transfer by multinationals

    OpenAIRE

    Kostyantyn Zuzik

    2003-01-01

    The paper analyses the issue of technology transfer by multinational corporations. The following questions are explored: (a) world market of technologies, the role of MNCs (b) Choice of the technology transfer mode, Dunning's OLI-theory as a factor of the choice of the mode of transfer (c) measurement and profitability of technology transfer (d) transfer of technology through partnerships, JVs, alliances and through M&As (e) aspects of technology transfer by services multinationals. Paper uti...

  18. Morgantown Energy Technology Center, technology summary

    International Nuclear Information System (INIS)

    1994-06-01

    This document has been prepared by the DOE Environmental Management (EM) Office of Technology Development (OTD) to highlight its research, development, demonstration, testing, and evaluation activities funded through the Morgantown Energy Technology Center (METC). Technologies and processes described have the potential to enhance DOE's cleanup and waste management efforts, as well as improve US industry's competitiveness in global environmental markets. METC's R ampersand D programs are focused on commercialization of technologies that will be carried out in the private sector. META has solicited two PRDAs for EM. The first, in the area of groundwater and soil technologies, resulted in twenty-one contact awards to private sector and university technology developers. The second PRDA solicited novel decontamination and decommissioning technologies and resulted in eighteen contract awards. In addition to the PRDAs, METC solicited the first EM ROA in 1993. The ROA solicited research in a broad range of EM-related topics including in situ remediation, characterization, sensors, and monitoring technologies, efficient separation technologies, mixed waste treatment technologies, and robotics. This document describes these technology development activities

  19. Constructive Technology Assessmentand Technology Dynamics. The Case of Clean Technologies

    NARCIS (Netherlands)

    Schot, Johan

    1992-01-01

    A synthesis of neo-Schumpeterian evolutionary, sociological, and historical coevolution ary models could be used for constructive technology assessment, aimed at the active management of the process of technological change. This article proposes a synthetic quasi-evolutionary model, in which

  20. Fundamentals of technology roadmapping

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, M.L.; Bray, O.H.

    1997-04-01

    Technology planning is important for many reasons. Globally, companies are facing many competitive problems. Technology roadmapping, a form of technology planning can help deal with this increasingly competitive environment. While it has been used by some companies and industries, the focus has always been on the technology roadmap as a product, not on the process. This report focuses on formalizing the process so that it can be more broadly and easily used. As a DOE national security laboratory with R&D as a major product, Sandia must do effective technology planning to identify and develop the technologies required to meet its national security mission. Once identified, technology enhancements or new technologies may be developed internally or collaboratively with external partners. For either approach, technology roadmapping, as described in this report, is an effective tool for technology planning and coordination, which fits within a broader set of planning activities. This report, the second in a series on technology roadmapping, develops and documents this technology roadmapping process, which can be used by Sandia, other national labs, universities, and industry. The main benefit of technology roadmapping is that it provides information to make better technology investment decisions by identifying critical technologies and technology gaps and identifying ways to leverage R&D investments. It can also be used as a marketing tool. Technology roadmapping is critical when the technology investment decision is not straight forward. This occurs when it is not clear which alternative to pursue, how quickly the technology is needed, or when there is a need to coordinate the development of multiple technologies. The technology roadmapping process consists of three phases - preliminary activity, development of the technology roadmap, and follow-up activity.

  1. Educational Technology in China

    Science.gov (United States)

    Meifeng, Liu; Jinjiao, Lv; Cui, Kang

    2010-01-01

    This paper elaborates the two different academic views of the identity of educational technology in China at the current time--advanced-technology-oriented cognition, known as Electrifying Education, and problem-solving-oriented cognition, known as Educational Technology. It addresses five main modes of educational technology in China: as a…

  2. EPA'S ENVIRONMENTAL TECHNOLOGIES

    Science.gov (United States)

    The use of innovative technology is impeded by the lack of independent, credible information as to how the technology performs. Such data is needed by technology buyers and regulatory decision makers to make informed decisions on technologies that represent good financial invest...

  3. Emerging technology and ethics

    CERN Document Server

    Wakunuma, Kutoma

    2011-01-01

    This e-book on Emerging Technologies and Ethics includes a collection of essays which explore the future and ethics of emerging information and communication technologies. Articles in the collection include an overview of the legal implications which may be relevant to the ethical aspects of emerging technologies and also ethical issues arising from the mass-take up of mobile technologies.

  4. Student Technology Assistant Programs.

    Science.gov (United States)

    Van Eck, Rick; Marvin, Eric; Burr-McNeal, Blake; Jones, Marshall; Lowther, Deborah

    Schools face significant challenges in implementing computing technology within their curriculum. When technology support falters, the integrity of a school district's entire technology program is at risk. Teachers who have invested time to develop lesson plans using technology, especially those who are still newcomers, are less likely to continue…

  5. Marketing technology in macroeconomics.

    Science.gov (United States)

    Tamegawa, Kenichi

    2012-01-01

    In this paper, we incorporate a marketing technology into a dynamic stochastic general equilibrium model by assuming a matching friction for consumption. An improvement in matching can be interpreted as an increase in matching technology, which we call marketing technology because of similar properties. Using a simulation analysis, we confirm that a positive matching technology shock can increase output and consumption.

  6. Marketing technologically advanced products

    NARCIS (Netherlands)

    Bender, Horst

    1989-01-01

    This paper calls for a merger of technology and marketing under a customer value perspective; for an enhancement of the traditional technological innovation orientation of the technology-based firm with a market thrust. It establishes technology-based products as product-service offerings that are

  7. Soil washing technology evaluation

    International Nuclear Information System (INIS)

    Suer, A.

    1995-04-01

    Environmental Restoration Engineering (ERE) continues to review innovative, efficient, and cost effective technologies for SRS soil and/or groundwater remediation. As part of this effort, this technical evaluation provides review and the latest information on the technology for SRS soil remediation. Additional technology evaluation reports will be issued periodically to update these reports. The purpose of this report is to review the soil washing technology and its potential application to SRS soil remediation. To assess whether the Soil Washing technology is a viable option for SRS soil remediation, it is necessary to review the technology/process, technology advantages/limitations, performance, applications, and cost analysis

  8. NASA Technology Transfer System

    Science.gov (United States)

    Tran, Peter B.; Okimura, Takeshi

    2017-01-01

    NTTS is the IT infrastructure for the Agency's Technology Transfer (T2) program containing 60,000+ technology portfolio supporting all ten NASA field centers and HQ. It is the enterprise IT system for facilitating the Agency's technology transfer process, which includes reporting of new technologies (e.g., technology invention disclosures NF1679), protecting intellectual properties (e.g., patents), and commercializing technologies through various technology licenses, software releases, spinoffs, and success stories using custom built workflow, reporting, data consolidation, integration, and search engines.

  9. Physics and high technology

    International Nuclear Information System (INIS)

    Shao Liqin; Ma Junru.

    1992-01-01

    At present, the development of high technology has opened a new chapter in world's history of science and technology. This review describes the great impact of physics on high technology in six different fields (energy technology, new materials, information technology, biotechnology, space technology, and Ocean technology). It is shown that the new concepts and new methods created in physics and the special conditions and measurements established for physics researches not only deepen human's knowledge about nature but also point out new directions for engineering and technology. The achievements in physics have been more and more applied to high technology, while the development of high technology has explored some new research areas and raised many novel, important projects for physics. Therefore, it is important for us to strengthen the research on these major problems in physics

  10. Advancement in Engineering Technology

    DEFF Research Database (Denmark)

    Kalia, Kartik; Rehman, M. Atiqur; Hussain, Dil muhammed Akbar

    2016-01-01

    but to harvest those ideas, technology is a must. With the huge requirement of engineering equipment's, the industry needs specialists who can manage and operate these technologies. Detailed information about the merits and demerits of technology is also mentioned in this paper. Findings: Technology has affected...... the environment on a great scale; in some cases, technology is even replacing human being or use of manpower. So proper counter measures have been mentioned, which can be used to control and limit harmful effect....

  11. Newnes communications technology handbook

    CERN Document Server

    Lewis, Geoff

    1994-01-01

    Newnes Communications Technology Handbook provides a discussion on different topics relevant to communications technology. The book is comprised of 39 chapters that tackle a wide variety of concern in communications technology. The coverage of the text includes technologies, such as analog digital communications systems, radio frequency receiver, and satellite systems. The book also discusses some methods and techniques used in communications technology, including mixer signal processing, modulation and demodulation, and spread spectrum techniques. The text will be of great use to engineers, t

  12. Rational homoclinic solution and rogue wave solution for the ...

    Indian Academy of Sciences (India)

    1School of Science, Southwest University of Science and Technology, Mianyang 621000,. People's Republic of China. 2School of Mathematics and Statistics, Yunnan University, Kunming ... iut − 2uxx + 2uf = 0, ivt − 2vxx + 2vf = 0, ft − 4(uv∗ + u∗v)x = 0. (2). We now make the dependent variable transformation u = G. F. , v =.

  13. Luzia Simionescu - Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Luzia Simionescu. Articles written in Journal of Chemical Sciences. Volume 112 Issue 1 February 2000 pp 19-26 Inorganic and Analytical. Improved technology for manufacture of carbon electrodes · A Platon A Dumbrava N Iutes-Petrescu Luzia Simionescu · More Details ...

  14. Emerging Technologies Integrating Technology into Study Abroad

    Science.gov (United States)

    Godwin-Jones, Robert

    2016-01-01

    "Ready access to travel and to technology-enhanced social networking (e.g., Facebook or Skype) has changed the nature of study abroad to the point where today's experiences are fundamentally different from those of earlier eras" (Kinginger, 2013a, p. 345). In addition to more travel options and greater technology availability, study…

  15. Educational technology and the new technologies

    NARCIS (Netherlands)

    Verhagen, Pleunes Willem; Plomp, T.

    1989-01-01

    Like everywhere in our culture, new technologies gradually penetrate the field of education. This may be seen as a problem area, which asks for appropriate, actions by teachers, curriculum experts, instructional designers and others. As "technology" seems to be the main issue,one may quation whether

  16. Search Technologies | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Our team of technology transfer specialists has specialized training in invention reporting, patenting, patent strategy, executing technology transfer agreements and marketing. TTC is comprised of professionals with diverse legal, scientific, and business/marketing expertise. Most of our staff hold doctorate-level technical and/or legal training.

  17. Available Technologies | NCI Technology Transfer Center | TTC

    Science.gov (United States)

    Our team of technology transfer specialists has specialized training in invention reporting, patenting, patent strategy, executing technology transfer agreements and marketing. TTC is comprised of professionals with diverse legal, scientific, and business/marketing expertise. Most of our staff hold doctorate-level technical and/or legal training.

  18. SHARED TECHNOLOGY TRANSFER PROGRAM

    Energy Technology Data Exchange (ETDEWEB)

    GRIFFIN, JOHN M. HAUT, RICHARD C.

    2008-03-07

    The program established a collaborative process with domestic industries for the purpose of sharing Navy-developed technology. Private sector businesses were educated so as to increase their awareness of the vast amount of technologies that are available, with an initial focus on technology applications that are related to the Hydrogen, Fuel Cells and Infrastructure Technologies (Hydrogen) Program of the U.S. Department of Energy. Specifically, the project worked to increase industry awareness of the vast technology resources available to them that have been developed with taxpayer funding. NAVSEA-Carderock and the Houston Advanced Research Center teamed with Nicholls State University to catalog NAVSEA-Carderock unclassified technologies, rated the level of readiness of the technologies and established a web based catalog of the technologies. In particular, the catalog contains technology descriptions, including testing summaries and overviews of related presentations.

  19. ACR-700 advanced technologies

    International Nuclear Information System (INIS)

    Tapping, R.L.; Turner, C.W.; Yu, S.K.W.; Olmstead, R.; Speranzini, R.A.

    2004-01-01

    A successful advanced reactor plant will have optimized economics including reduced operating and maintenance costs, improved performance, and enhanced safety. Incorporating improvements based on advanced technologies ensures cost, safety and operational competitiveness of the ACR-700. These advanced technologies include modern configuration management; construction technologies; operational technology for the control centre and information systems for plant monitoring and analysis. This paper summarizes the advanced technologies used to achieve construction and operational improvements to enhance plant economic competitiveness, advances in the operational technology used for reactor control, and presents the development of the Smart CANDU suite of tools and its application to existing operating reactors and to the ACR-700. (author)

  20. Avionics systems integration technology

    Science.gov (United States)

    Stech, George; Williams, James R.

    1988-01-01

    A very dramatic and continuing explosion in digital electronics technology has been taking place in the last decade. The prudent and timely application of this technology will provide Army aviation the capability to prevail against a numerically superior enemy threat. The Army and NASA have exploited this technology explosion in the development and application of avionics systems integration technology for new and future aviation systems. A few selected Army avionics integration technology base efforts are discussed. Also discussed is the Avionics Integration Research Laboratory (AIRLAB) that NASA has established at Langley for research into the integration and validation of avionics systems, and evaluation of advanced technology in a total systems context.

  1. The Human Technology

    DEFF Research Database (Denmark)

    Fausing, Bent

    towards this very special and lost humanity. Without the technology, no special humanity is the prophecy. This personification or anthropomorphism is important for the branding of new technology. The technology is seen as creating a technotranscendens towards a more qualified humanity, which is in contact...... with fundamental human values like intuition, vision and sensing; all the qualities the technology, the industrialisation and rationalisation, or in short modernity, has been criticized for having taken away from human existence. What technology has taken away now comes back through new technology as an aid...

  2. [Health technology in Mexico].

    Science.gov (United States)

    Cruz, C; Faba, G; Martuscelli, J

    1992-01-01

    The features of the health technology cycle are presented, and the effects of the demographic, epidemiologic and economic transition on the health technology demand in Mexico are discussed. The main problems of science and technology in the context of a decreasing scientific and technological activity due to the economic crisis and the adjustment policies are also analyzed: administrative and planning problems, low impact of scientific production, limitations of the Mexican private sector, and the obstacles for technology assessment. Finally, this paper also discusses the main support strategies for science and technology implemented by the Mexican government during the 1980s and the challenges and opportunities that lie ahead.

  3. Focus on Technologies: Worry or Technology?

    Directory of Open Access Journals (Sweden)

    Saulius Kanišauskas

    2015-10-01

    Full Text Available The paper analyses different attitudes towards technologies in contemporary philosophical discourses. It points out that classical notion of technology formulated by Martin Heidegger seems to be more and more often questioned and even forgotten. As a result, it is being replaced by the theory of determinism, according to which the change of technologies determines the changes in social systems, the human being including. This happens this way and not vice versa. Nowadays technē, or “technika” (in English: technology is mostly understood in the instrumental meaning or in the meaning of power. It is considered to be a powerful means, tool or mechanism to influence, change, control and manipulate human consciousness and human feelings. Despite the fact that technologies have already been tamed, the problem of huge responsibility for using and developing them arises. It is questioned whether the increasing society’s attention to modern technologies is not a particular “technology” of the postmodern capitalism to manipulate social consciousness. In parallel with “yes” answer to this question, Albert Borgmann’s idea that the causes of technological development have an ontological dimension, i.e. the causes are rooted in the nature of human beings themselves and their desire to adore own creativity, is discussed. Thus, it becomes necessary to probe deeper into the nature of creativity.

  4. Graham St John, "Global Tribe: Technology, Spirituality and Psytrance", Equinox, Sheffield e Bristol, 2012

    Directory of Open Access Journals (Sweden)

    Carlo Nardi

    2016-07-01

    Full Text Available Global Tribe si inserisce in un filone di ricerca, quello che indaga la musica dance nelle sue numerose manifestazioni, che negli ultimi anni sta acquisendo una prominenza sempre maggiore in seno agli studi musicologici. A ciò ha contribuito negli ultimi anni Graham St John, caporedattore della rivista accademica Dancecult e autore o curatore di numerose pubblicazioni sul tema, tra cui The Local Scenes and Global Culture of Psytrance, che anticipa alcuni dei temi di questo volume. L’autore spiega di essere stato direttamente coinvolto nella scena di Melbourne fin dalla metà degli anni Novanta, estendendo successivamente la sua partecipazione alle comunità psytrance a livello globale; in questo contesto ha sviluppato in parallelo un interesse accademico, che costituisce la base delle idee e delle esperienze confluite in Global Tribe.

  5. General survey of technology management

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Yong Ha; Jang Dong Hun; Lee, In Woo

    1999-02-15

    The content of this book are technology and management, conception of technology management, feature and model of technology management system, elements of technology management, performance measurement of technology management, connectivity between technology and business function, system management of technology, manpower management, readership and technology management, motivation and technology management, management of technical investment evaluation, new item development and marketing, product liability management, intellectual property rights and transfer of technology.

  6. General survey of technology management

    International Nuclear Information System (INIS)

    Shin, Yong Ha; Jang Dong Hun; Lee, In Woo

    1999-02-01

    The content of this book are technology and management, conception of technology management, feature and model of technology management system, elements of technology management, performance measurement of technology management, connectivity between technology and business function, system management of technology, manpower management, readership and technology management, motivation and technology management, management of technical investment evaluation, new item development and marketing, product liability management, intellectual property rights and transfer of technology.

  7. Photon technology. Laser processing technology; Photon technology. Laser process gijutsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    Survey has been conducted to develop laser processing technology utilizing the interaction between substance and photon. This is a part of the leading research on photon technology development. The photon technology development is aimed at novel technology development highly utilizing the quantum nature of photons. In the field of laser processing, high quality photons are used as tools, special functions of atoms and molecules will be discovered, and processing for functional fabrication (photon machining) will be established. A role of laser processing in industries has become significant, which is currently spreading not only into cutting and welding of materials and scalpels but also into such a special field as ultrafine processing of materials. The spreading is sometimes obstructed due to the difficulty of procurement of suitable machines and materials, and the increase of cost. The purpose of this study is to develop the optimal laser technology, to elucidate the interaction between substance and photon, and to develop the laser system and the transmission and regulation systems which realize the optimal conditions. 387 refs., 115 figs., 25 tabs.

  8. CSIR Technology Impact 1996

    CSIR Research Space (South Africa)

    CSIR

    1996-01-01

    Full Text Available This issue of Technology Impact offers a brief snapshot of CSIR activities during the year under review by highlighting a number of innovative projects and initiatives in these areas. It presents a rich canvas portrays technology solutions...

  9. Resources, Technology, and Strategy

    DEFF Research Database (Denmark)

    Resources, Technology and Strategy brings together contributors from Europe, North America and Asia to consider the strategic relationship between technology and other resources, such as production capabilities, marketing prowess, finance and organisational culture. Throughout the book...

  10. Solar Thermal Energy Technology

    Energy Technology Data Exchange (ETDEWEB)

    Cason, D.L.; Pitsenbarger, J. [eds.

    1996-02-01

    Solar Thermal Energy Technology (PST) announces on a bimonthly basis the current worldwide research and development information that would expand the technology base required for the advancement of solar thermal systems as a significant energy resource.

  11. INFORMATION TECHNOLOGIES IN TOURISM

    OpenAIRE

    Radka Tosheva; Aleksandrina Gancheva

    2016-01-01

    In this article the focus is on the role of information technology in tourism, tourism business, electronic payments, software used by tourist companies, new technologies for online advertising and shopping, software for mobile devices.

  12. Technology in Residence.

    Science.gov (United States)

    Fox, Jordan

    1999-01-01

    Discusses the necessity for incorporating current technology in today's college residence halls to meet the more diverse and continued activities of its students. Technology addressed covers data networking and telecommunications, heating and cooling systems, and fire-safety systems. (GR)

  13. Technology Readiness Level Guidebook

    Science.gov (United States)

    2017-09-01

    This guidebook provides the necessary information for conducting a Technology Readiness Level (TRL) Assessment. TRL Assessments are a tool for determining the maturity of technologies and identifying next steps in the research process. This guidebook...

  14. Assisted Reproductive Technology (ART)

    Science.gov (United States)

    ... Share Facebook Twitter Pinterest Email Print Assisted Reproductive Technology (ART) ART refers to treatments and procedures that ... American Society for Reproductive Medicine. (2015). Assisted reproductive technologies: A guide for patients . Retrieved May 31, 2016, ...

  15. Genealogies of Modern Technology

    DEFF Research Database (Denmark)

    Riis, Søren

    2008-01-01

    Does modern technology differ from ancient technology and does it have a unique essence? This twofold question opens one of Martin Heidegger's most influential philosophical inquiries, The Question Concerning Technology. The answer Heidegger offers has inspired various critiques and appraisals from...... a vast number of contemporary scholars of technology.1 Heidegger's answer is traditionally thought to suggest a great difference between ancient and modern technology. However, by re-examining Heidegger's text, it is possible to discover previously ignored or misunderstood lines of thoughts that affirm...... a multi-stable interpretation of the origin of modern technology. In what follows, we shall see how The Question Concerning Technology in fact supports three different genealogies of modern technology...

  16. Technology Implementation Plan

    DEFF Research Database (Denmark)

    Jensen, Karsten Ingerslev; Schultz, Jørgen Munthe

    The Technology Implementation Plan (TIP) describes the main project results and the intended future use. The TIP is confidential.......The Technology Implementation Plan (TIP) describes the main project results and the intended future use. The TIP is confidential....

  17. Crystal-Clear Technology.

    Science.gov (United States)

    Ondris-Crawford, Renate J.; And Others

    1993-01-01

    Provides diagrams to aid in discussing polymer dispersed liquid crystal (PDLC) technology. Equipped with a knowledge of PDLC, teachers can provide students with insight on how the gap between basic science and technology is bridged. (ZWH)

  18. Technology licensing in China

    DEFF Research Database (Denmark)

    Wang, Yuandi; Li-Ying, Jason; Chen, Jin

    2015-01-01

    We explore the landscape of technology licensing among Chinese entities in the period 2000–12, using a unique database on technological licensing from the State Intellectual Property Office of China. We find that: first, among Chinese licensee organizations, firms have dominated in terms of the n......We explore the landscape of technology licensing among Chinese entities in the period 2000–12, using a unique database on technological licensing from the State Intellectual Property Office of China. We find that: first, among Chinese licensee organizations, firms have dominated in terms...... of the number of licensed technologies; second, the geographical distribution of licensed technologies among the provinces has gradually reached a new quantitative balance; third, utility models are the most popular technologies to be licensed and the majority of technology licensing in China has been between...

  19. Environmental technology verification methods

    CSIR Research Space (South Africa)

    Szewczuk, S

    2016-03-01

    Full Text Available Environmental Technology Verification (ETV) is a tool that has been developed in the United States of America, Europe and many other countries around the world to help innovative environmental technologies reach the market. Claims about...

  20. Clean Air Technology Center

    Science.gov (United States)

    The Clean Air Technology Center provides resources for emerging and existing air pollution prevention and control technologies and provides public access to data and information on their use, effectiveness and cost.

  1. CSIR Technology Impact 1994

    CSIR Research Space (South Africa)

    CSIR

    1994-01-01

    Full Text Available This issue of Technology Impact offers a brief snapshot of CSIR activities during the year under review by highlighting a number of innovative projects and initiatives in these areas. It presents a rich canvas portrays technology solutions...

  2. INFORMATION TECHNOLOGIES IN TOURISM

    Directory of Open Access Journals (Sweden)

    Radka Tosheva

    2016-12-01

    Full Text Available In this article the focus is on the role of information technology in tourism, tourism business, electronic payments, software used by tourist companies, new technologies for online advertising and shopping, software for mobile devices.

  3. Ship propulsion reactors technology

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2002-01-01

    This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)

  4. Dismantling technologies trends

    International Nuclear Information System (INIS)

    Devaux, P.

    2009-01-01

    In this work dismantling technologies trends realized by the CEA are reviewed. There following technologies are presented: Data acquisition from facilities; Scenario studies; Remote handling and carriers; Dismantling techniques; Decontamination.

  5. TECHNOLOGICAL IMPLEMENTATION PLAN

    DEFF Research Database (Denmark)

    Bellini, Anna

    2004-01-01

    This document has the purpose to describe the technological implementation plan in the IDEAL project.......This document has the purpose to describe the technological implementation plan in the IDEAL project....

  6. CSIR Technology Impact 1993

    CSIR Research Space (South Africa)

    CSIR

    1993-01-01

    Full Text Available This issue of Technology Impact offers a brief snapshot of CSIR activities during the year under review by highlighting a number of innovative projects and initiatives in these areas. It presents a rich canvas portrays technology solutions...

  7. CSIR Technology Impact 2000

    CSIR Research Space (South Africa)

    CSIR

    2000-01-01

    Full Text Available This millennium issue of Technology Impact celebrates the CSIR's contributions during the transitional 1999/2000 year. It presents a rich canvas portrays technology solutions and information which have touched the lives of people both within...

  8. CSIR Technology Impact 1999

    CSIR Research Space (South Africa)

    CSIR

    1999-01-01

    Full Text Available This issue of Technology Impact offers a brief snapshot of CSIR activities during the year under review by highlighting a number of innovative projects and initiatives in these areas. It presents a rich canvas portrays technology solutions...

  9. Fusion technology (FT)

    International Nuclear Information System (INIS)

    1978-01-01

    The annual report of tha fusion technology (FT) working group discusses the projects carried out by the participating institutes in the fields of 1) fuel injection and plasma heating, 2) magnetic field technology, and 3) systems investigations. (HK) [de

  10. ADVANTAGES OF GREEN TECHNOLOGY

    OpenAIRE

    Ghanshyam Das Soni

    2017-01-01

    Technology is application of knowledge to practical requirements. Green technologies encompass various aspects of technology which help us reduce the human impact on the environment and create ways of sustainable development. Social equitability, economic feasibility and sustainability are the key parameters for green technologies. Today the environment is racing towards the tipping point at which we would have done permanent irreversible damage to the planet earth. Our current actions are pu...

  11. New Mobile Technologies

    DEFF Research Database (Denmark)

    Tan, Su-En; Henten, Anders

    2006-01-01

    This paper takes a look at Clayton Christensen 's theory of disruptive technologies and how Christensen's theory relates to other innovation theories. It also proposes a new layer of analysis to this theory to better link the technology analysis to the market analysis of any given technology...... product. This layer suggests that complementarity and substitutability are important criteria for technologies to be market disruptions or sustaining changes....

  12. Emerging Technologies for Telemedicine

    Science.gov (United States)

    Minh, Cao Duc; Antoku, Yasuaki; Torata, Nobuhiro; Kudo, Kuriko; Okamura, Koji; Nakashima, Naoki; Tanaka, Masao

    2012-01-01

    This paper focuses on new technologies that are practically useful for telemedicine. Three representative systems are introduced: a Digital Video Transport System (DVTS), an H.323 compatible videoconferencing system, and Vidyo. Based on some of our experiences, we highlight the advantages and disadvantages of each technology, and point out technologies that are especially targeted at doctors and technicians, so that those interested in using similar technologies can make appropriate choices and achieve their own goals depending on their specific conditions. PMID:22563284

  13. Developments in lubricant technology

    CERN Document Server

    Srivastava, S P

    2014-01-01

    Provides a fundamental understanding of lubricants and lubricant technology including emerging lubricants such as synthetic and environmentally friendly lubricants Teaches the reader to understand the role of technology involved in the manufacture of lubricants Details both major industrial oils and automotive oils for various engines Covers emerging lubricant technology such as synthetic and environmentally friendly lubricants Discusses lubricant blending technology, storage, re-refining and condition monitoring of lubricant in equipment

  14. Rationalizing social technologies

    OpenAIRE

    V V Scherbina

    2016-01-01

    The article considers the problem of defining the specifics and types of social technologies (hereinafter ST). The author pursues the following objectives: first, to clarify the specific features of social technologies; second, to identify the grounds for classifying the existing types of social technologies; third, to describe the basic characteristics (functions, tasks, tools, the scope and limits of application, and ideological bases) of social technologies; fourth, to identify the basic f...

  15. NASA Astrophysics Technology Needs

    Science.gov (United States)

    Stahl, H. Philip

    2012-01-01

    July 2010, NASA Office of Chief Technologist (OCT) initiated an activity to create and maintain a NASA integrated roadmap for 15 key technology areas which recommend an overall technology investment strategy and prioritize NASA?s technology programs to meet NASA?s strategic goals. Science Instruments, Observatories and Sensor Systems(SIOSS) roadmap addresses technology needs to achieve NASA?s highest priority objectives -- not only for the Science Mission Directorate (SMD), but for all of NASA.

  16. Consuming technologies - developing routines

    DEFF Research Database (Denmark)

    Gram-Hanssen, Kirsten

    2008-01-01

    technologies and in this article these processes will be investigated from three different perspectives: an historical perspective of how new technologies have entered homes, a consumer perspective of how both houses and new technologies are purchased and finally, as the primary part of the article, a user...... perspective of how routines develop while these technologies are being used. In the conclusion these insights are discussed in relation to possible ways of influencing routines....

  17. Magnetic fusion technology

    CERN Document Server

    Dolan, Thomas J

    2014-01-01

    Magnetic Fusion Technology describes the technologies that are required for successful development of nuclear fusion power plants using strong magnetic fields. These technologies include: ? magnet systems, ? plasma heating systems, ? control systems, ? energy conversion systems, ? advanced materials development, ? vacuum systems, ? cryogenic systems, ? plasma diagnostics, ? safety systems, and ? power plant design studies. Magnetic Fusion Technology will be useful to students and to specialists working in energy research.

  18. Frontiers in biochip technology

    National Research Council Canada - National Science Library

    Xing, Wan-Li; Cheng, Jing

    2006-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . Haiching Ma, Yuan Wang, Amy S. Pomaybo, and Connie Tsai 2. Improvement of Microarray Technologies for Detecting Single Nucleotide Mismatch...

  19. Conducting a Technology Audit

    Science.gov (United States)

    Flaherty, William

    2011-01-01

    Technology is a critical component in the success of any high-functioning school district, thus it is important that education leaders should examine it closely. Simply put, the purpose of a technology audit is to assess the effectiveness of the technology for administrative or instructional use. Rogers Public Schools in Rogers, Arkansas, recently…

  20. Selecting Security Technology Providers

    Science.gov (United States)

    Schneider, Tod

    2009-01-01

    The world of security technology holds great promise, but it is fraught with opportunities for expensive missteps and misapplications. The quality of the security technology consultants and system integrators one uses will have a direct bearing on how well his school masters this complex subject. Security technology consultants help determine…

  1. Sex, Technology and Morality.

    Science.gov (United States)

    Case, Verna; And Others

    1986-01-01

    Provides an overview of the course "Sex, Technology, and Morality" which focuses on the human reproductive process and examines the advances in reproductive technology. The course emphasizes the social, political, and ethical implications of actual and possible technologies associated with human reproduction. (ML)

  2. Technological Style is History

    DEFF Research Database (Denmark)

    Blond, Lasse

    The effort to comprehend innovation across cultures and time highlights the importance of the explicating factors external to technology. It becomes relevant to nuance or differentiate the understanding of social and cultural responses to adopted technologies by recognizing that technology shapes...

  3. JAPAN'S TECHNOLOGY TRADE

    OpenAIRE

    Hagiwara, Taiji

    1994-01-01

    Japan's technology balance of trade has improved over the last twenty years. The position of Japan is examined through (1) comparison with other OECD countries, (2) the historical change in Japan's technology trade at the industry level, (3) Toshiba's technology trade as a typical case. The conclusion is that Japan is still behind the frontier of innovation.

  4. Power Technologies Data Book

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, L.

    2002-09-01

    This report, prepared by NREL's Energy Analysis Office, includes up-to-date information on power technologies, including complete technology profiles. The data book also contains charts on electricity restructuring, power technology forecasts and comparisons, electricity supply, electricity capability, electricity generation, electricity demand, prices, economic indicators, environmental indicators, conversion factors, and selected congressional questions and answers.

  5. Exploring Technology Education.

    Science.gov (United States)

    Van Duzer, Eric

    Modular middle school technology programs, generically called Exploring Technology Education (ETE) courses, are described and analyzed to determine their strengths and weaknesses and their appropriate role in middle school curricula. Interviews were conducted with teachers, officers of the Exploring Technology Educators Association, vendors and…

  6. Advanced manufacturing: Technology diffusion

    Energy Technology Data Exchange (ETDEWEB)

    Tesar, A.

    1995-12-01

    In this paper we examine how manufacturing technology diffuses rom the developers of technology across national borders to those who do not have the capability or resources to develop advanced technology on their own. None of the wide variety of technology diffusion mechanisms discussed in this paper are new, yet the opportunities to apply these mechanisms are growing. A dramatic increase in technology diffusion occurred over the last decade. The two major trends which probably drive this increase are a worldwide inclination towards ``freer`` markets and diminishing isolation. Technology is most rapidly diffusing from the US In fact, the US is supplying technology for the rest of the world. The value of the technology supplied by the US more than doubled from 1985 to 1992 (see the Introduction for details). History shows us that technology diffusion is inevitable. It is the rates at which technologies diffuse to other countries which can vary considerably. Manufacturers in these countries are increasingly able to absorb technology. Their manufacturing efficiency is expected to progress as technology becomes increasingly available and utilized.

  7. Optimizing Computer Technology Integration

    Science.gov (United States)

    Dillon-Marable, Elizabeth; Valentine, Thomas

    2006-01-01

    The purpose of this study was to better understand what optimal computer technology integration looks like in adult basic skills education (ABSE). One question guided the research: How is computer technology integration best conceptualized and measured? The study used the Delphi method to map the construct of computer technology integration and…

  8. Creative Technology and Rap

    Science.gov (United States)

    Ch'ien, Evelyn

    2011-01-01

    This paper describes how a linguistic form, rap, can evolve in tandem with technological advances and manifest human-machine creativity. Rather than assuming that the interplay between machines and technology makes humans robotic or machine-like, the paper explores how the pressure of executing artistic visions using technology can drive…

  9. Technology in Education

    Science.gov (United States)

    Roden, Kasi

    2011-01-01

    This paper was written to support a position on using technology in education. The purpose of this study was to support the use of technology in education by synthesizing previous research. A variety of sources including books and journal articles were studied in order to compile an overview of the benefits of using technology in elementary,…

  10. Connecting Technology and Learning.

    Science.gov (United States)

    Woolley, Ginny

    1998-01-01

    Teacher training programs must go beyond "how-to" workshops to facilitate understanding about technology's relationship to learning. An International School of Bangkok training program transforms teachers into learners immersed in technology-rich environments. The process involves seven phases: getting ready, learning about technology,…

  11. Materials and technology

    International Nuclear Information System (INIS)

    Gockel, E.; Simon, J.

    1998-01-01

    New materials and the processes for their economical fabrication and use are the factors which drive innovation in totally different fields of technology, such as energy engineering, transport, and information. But they also open up new fields of technology such as micro systems or medicine technology. Five out of a total of twelve articles are separately listed in the ENERGY database [de

  12. Lucas Heights technology park

    International Nuclear Information System (INIS)

    1987-01-01

    The proposed Lucas Heights Technology Park will pound together the applied research programs of Government, tertiary and industry sectors, aiming to foster technology transfer particularly to the high-technology manufacturing industry. A description of the site is given along with an outline of the envisaged development, existing facilities and expertise. ills

  13. Teaching Information Technology Law

    Science.gov (United States)

    Taylor, M. J.; Jones, R. P.; Haggerty, J.; Gresty, D.

    2009-01-01

    In this paper we discuss an approach to the teaching of information technology law to higher education computing students that attempts to prepare them for professional computing practice. As information technology has become ubiquitous its interactions with the law have become more numerous. Information technology practitioners, and in particular…

  14. E-Business Technologies

    OpenAIRE

    Carmen TIMOFTE

    2007-01-01

    Internet technologies have revolutionized the business world by creating a global online marketplace. Appropriate understanding for the technologies and the impact of different design choices of technologies (including the Internet and open systems) dramatically affects both functional and non-functional aspects of the e-business solution.

  15. Education Technology Success Stories

    Science.gov (United States)

    West, Darrell M.; Bleiberg, Joshua

    2013-01-01

    Advances in technology are enabling dramatic changes in education content, delivery, and accessibility. Throughout history, new technologies have facilitated the exponential growth of human knowledge. In the early twentieth century, the focus was on the use of radios in education. But since then, innovators have seen technology as a way to improve…

  16. Education Technology Transformation

    Science.gov (United States)

    Kennedy, Mike

    2012-01-01

    Years ago, as personal computers and other technological advancements began to find their way into classrooms and other educational settings, teachers and administrators sought ways to use new technology to benefit students. The potential for improving education was clear, but the limitations of the available education technology made it difficult…

  17. Moralizing Food Technology

    DEFF Research Database (Denmark)

    Coff, Christian Eyde

    2015-01-01

    Food technologies are common on many levels in society and used by both food professionals and consumers. Food technologies are not neutral. They inform and shape the behaviour of people. This paper presents a theoretical framework for analysing the mediating role of food technology and its influ...

  18. Green technology in Taiwan

    International Nuclear Information System (INIS)

    Runderkamp, D.

    2010-01-01

    Taiwan is striving for leadership in the field of green Technologies. Solar cells and Light Emitting Diodes (LED) are the best examples of successful Taiwanese green technologies. Electronic vehicles and smart grids are giving new impetus to the Taiwanese export of high-quality technology. [nl

  19. From Information Technologies to Knowledge Technologies?

    OpenAIRE

    Auzelle, Jean-Philippe; Mayer, Frédérique; Lhoste, Pascal

    2006-01-01

    In spite of the large variety of technological means available today to obtain and share knowledge needed by the progress of our Society, the relation between the knowledge produced and the knowledge required is not sufficiently facilitated. This paper aims to provide a partial answer to this issue. It proposes a NIAM/ORM formalization of exchanges between producers and users of knowledge. The resulting model is used to analyse and to discuss the deficiencies of the current technologies as we...

  20. Brief: Managing computing technology

    International Nuclear Information System (INIS)

    Startzman, R.A.

    1994-01-01

    While computing is applied widely in the production segment of the petroleum industry, its effective application is the primary goal of computing management. Computing technology has changed significantly since the 1950's, when computers first began to influence petroleum technology. The ability to accomplish traditional tasks faster and more economically probably is the most important effect that computing has had on the industry. While speed and lower cost are important, are they enough? Can computing change the basic functions of the industry? When new computing technology is introduced improperly, it can clash with traditional petroleum technology. This paper examines the role of management in merging these technologies

  1. Applied Semantic Web Technologies

    CERN Document Server

    Sugumaran, Vijayan

    2011-01-01

    The rapid advancement of semantic web technologies, along with the fact that they are at various levels of maturity, has left many practitioners confused about the current state of these technologies. Focusing on the most mature technologies, Applied Semantic Web Technologies integrates theory with case studies to illustrate the history, current state, and future direction of the semantic web. It maintains an emphasis on real-world applications and examines the technical and practical issues related to the use of semantic technologies in intelligent information management. The book starts with

  2. Transferring Technology to Industry

    Science.gov (United States)

    Wolfenbarger, J. Ken

    2006-01-01

    This slide presentation reviews the technology transfer processes in which JPL has been involved to assist in transferring the technology derived from aerospace research and development to industry. California Institute of Technology (CalTech), the organization that runs JPL, is the leading institute in patents for all U.S. universities. There are several mechanisms that are available to JPL to inform industry of these technological advances: (1) a dedicated organization at JPL, National Space Technology Applications (NSTA), (2) Tech Brief Magazine, (3) Spinoff magazine, and (4) JPL publications. There have also been many start-up organizations and businesses from CalTech.

  3. Incubation of NASA technology

    Science.gov (United States)

    Olson, Richard

    1996-03-01

    Traditionally, government agencies have sought to transfer technology by licensing to large corporations. An alternative route to commercialization is through the entrepreneurial process: using government technology to assist new businesses in the environment of a business incubator. The NASA Ames Technology Commercialization Center, in Sunnyvale, California, is a business incubator used to commercialize NASA technology. In operation almost two years, it has helped twenty new, high technology ventures. Ice Management Systems is one of these. The Center is funded by NASA and operated by IC2, a think-tank associated with the University of Texas at Austin.

  4. Encouraging environmentally strategic technologies

    International Nuclear Information System (INIS)

    Heaton, G.R.

    1994-01-01

    Having moved beyond its initial absorption with controlling new technology, environmental policy today must focus more strongly on promoting the development and adoption of new technologies. World Resource Institute's (WRI) ongoing study of 'environmentally strategic technology' is addressed to this fundamental policy issue. The study proposes criteria for identifying such technology, offers a specific list, suggests the kinds of public policy changes necessary to encourage their development and finally presents a comparison of critical technology lists (from the White House, the European Community, Japan and the US Department of Defense). (TEC)

  5. Better Learning Through Technology

    Science.gov (United States)

    Mathieu, R. D.; National InstituteScience Education, College Level-One Team

    2000-12-01

    The Learning Through Technology (LT2) resource is designed to help college Science, Mathematics, Engineering and Technology (SMET) instructors: - understand why and how they should use technology-enhanced learning strategies; - shape the powerful emerging technologies into learning tools that better prepare college students for the 21st century; and - provide all their students more experience with, and a better appreciation for, SMET as a living enterprise. The LT2 website includes case studies of learning technology innovations at a variety of post-secondary institutions. Personal narratives of faculty and students cover virtually every logistical, technological, inter-personal, and political issue involved in adapting learning technologies into courses or curricula. The site also includes a wide array of lively first-person vignettes about learning technology experiences from around the country. Frequently Asked Questions is a quick stop for opinions, advice, and bits of wisdom from experienced learning technology users. Finally, the Team is developing user-friendly evaluation resources to help faculty assess the success of learning technologies in improving student learning. The LT2 site is an element of the NISE website "Innovations in SMET Education". This site is intended to help college faculty meet multiple challenging goals including: educating all students to be scientifically literate in a technological society, developing the ranks of future scientists and skilled technicians, and preparing K-12 science and math teachers. The "Innovations in SMET Education" website can be found at www.wcer.wisc.edu/nise/cl1 .

  6. Technology in geriatrics.

    Science.gov (United States)

    Pilotto, Alberto; Boi, Raffaella; Petermans, Jean

    2018-03-13

    Recently, the interest of industry, government agencies and healthcare professionals in technology for aging people has increased. The challenge is whether technology may play a role in enhancing independence and quality of life and in reducing individual and societal costs of caring. Information and communication technologies, i.e. tools aimed at communicating and informing, assistive technologies designed to maintain older peoples' independence and increasing safety, and human-computer interaction technologies for supporting older people with motility and cognitive impairments as humanoid robots, exoskeletons, rehabilitation robots, service robots and companion-type are interdisciplinary topics both in research and in clinical practice. The most promising clinical applications of technologies are housing and safety to guarantee older people remaining in their own homes and communities, mobility and rehabilitation to improve mobility and gait and communication and quality of life by reducing isolation, improve management of medications and transportation. Many factors impair a broad use of technology in older age, including psychosocial and ethical issues, costs and fear of losing human interaction. A substantial lack of appropriate clinical trials to establish the clinical role of technologies to improve physical or cognitive performances and/or quality of life of subjects and their caregivers may suggest that the classical biomedical research model may not be the optimal choice to evaluate technologies in older people. In conclusion, successful technology development requires a great effort in interdisciplinary collaboration to integrate technologies into the existing health and social service systems with the aim to fit into the older adults' everyday life.

  7. Technology Museums in Denmark

    DEFF Research Database (Denmark)

    Søndergaard, Morten Karnøe

    2012-01-01

    within wind power technology. Finally special attention is devoted to the Danish Technological Museum. A museum which is the oldest and most elaborate of all the technology museums. The museum covers virtually every technological breakthrough with any relevance in a Danish section, with a special focus......This article presents an exhibit review of some of the major technology museums in Denmark. First comes an introduction to the Danish museum ”landscape”. Second a total of six museums and their technology focused exhibits are presented. Among the museums are the Fisheries and Maritime Museum...... in Esbjerg, housing one of the most impressive and representative exhibitions on the technology behind the strong Danish maritime sector. Another museum being mentioned is the Energy Museum, which covers the background for some of the major breakthroughs performed in Denmark within this area; particularly...

  8. Technology and Global Change

    Science.gov (United States)

    Grübler, Arnulf

    2003-10-01

    Technology and Global Change describes how technology has shaped society and the environment over the last 200 years. Technology has led us from the farm to the factory to the internet, and its impacts are now global. Technology has eliminated many problems, but has added many others (ranging from urban smog to the ozone hole to global warming). This book is the first to give a comprehensive description of the causes and impacts of technological change and how they relate to global environmental change. Written for specialists and nonspecialists alike, it will be useful for researchers and professors, as a textbook for graduate students, for people engaged in long-term policy planning in industry (strategic planning departments) and government (R & D and technology ministries, environment ministries), for environmental activists (NGOs), and for the wider public interested in history, technology, or environmental issues.

  9. Sensor technology foresight

    DEFF Research Database (Denmark)

    Andersen, Per Dannemand; Jørgensen, Birte Holst; Rasmussen, Birgitte

    2001-01-01

    , robustness, dispensability, and the abilityto be self-calibrating. Future sensors are expected to be integrated systems with multiple applications. The market sectors most influenced by new sensor technology change from topic to topic. But a general conclusion is that health care is the marketsector most......The Sensor Technology Center A/S (STC) in co-operation with Risoe National Laboratory has carried out a sensor technology foresight in order to strengthen a strategic outlook on sensor technology. The technology foresight (with a timeframe of 2000 to2015) has been performed in the period October...... 2000 - September 2001. The conclusions of the sensor technology report are based on 1) a scanning of existing forward looking literature on sensor technology, 2) a number of workshops with Danish andinternational participants and 3) an international survey with 174 respondents. Half of the respondents...

  10. Promoting renewable energy technologies

    International Nuclear Information System (INIS)

    Grenaa Jensen, S.

    2004-06-01

    Technologies using renewable energy sources are receiving increasing interest from both public authorities and power producing companies, mainly because of the environmental advantages they procure in comparison with conventional energy sources. These technologies can be substitution for conventional energy sources and limit damage to the environment. Furthermore, several of the renewable energy technologies satisfy an increasing political goal of self-sufficiency within energy production. The subject of this thesis is promotion of renewable technologies. The primary goal is to increase understanding on how technological development takes place, and establish a theoretical framework that can assist in the construction of policy strategies including instruments for promotion of renewable energy technologies. Technological development is analysed by through quantitative and qualitative methods. (BA)

  11. The Human Technology

    DEFF Research Database (Denmark)

    Fausing, Bent

     Bent Fausing  "The Humane Technology", abstract (for The Two Cultures: Balancing Choices and Effects Oxford University July 20-26, 2008). The paper will investigate the use of technology in everyday aesthetics such as TV-commercials for mobile phones for Nokia, which slogan is, as it is well known......, "Nokia - connecting people". Which function does this technology get in narratives, images, interactions and affects here?      The mobile phone and its digital camera are depicted as being able to make a unique human presence and interaction. The medium, the technology is a necessary helper to get...... towards this very special and lost humanity. Without the technology, no special humanity is the prophecy. This personification or anthropomorphism is important for the branding of new technology. The technology is seen as creating a technotranscendens towards a more qualified humanity, which is in contact...

  12. Technology Empowerment: Security Challenges.

    Energy Technology Data Exchange (ETDEWEB)

    Warren, Drake Edward [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Backus, George A. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jones, Wendell [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Nelson, Thomas R. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Skocypec, Russell D. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2017-03-01

    Technology empowerment” means that innovation is increasingly accessible to ordinary people of limited means. As powerful technologies become more affordable and accessible, and as people are increasingly connected around the world, ordinary people are empowered to participate in the process of innovation and share the fruits of collaborative innovation. This annotated briefing describes technology empowerment and focuses on how empowerment may create challenges to U.S. national security. U.S. defense research as a share of global innovation has dwindled in recent years. With technology empowerment, the role of U.S. defense research is likely to shrink even further while technology empowerment will continue to increase the speed of innovation. To avoid falling too far behind potential technology threats to U.S. national security, U.S. national security institutions will need to adopt many of the tools of technology empowerment.

  13. Dicty_cDB: CHE644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *inans*isktyf nftarryhlwlyg*trs**cftksrsrhiyyki**kkswsiwyclywc*nassn*tlfgs tk*yccrkenfp*l Translated Amino A...ksrsrhiyyki**kkswsiwyclywc*nassn*tlfgs tk*yccrkenfp*l Frame C: sflnyyiiyf*fylfiylfiyllfiylfiy**iviiaifvls*kk

  14. Einstein: I cento anni che sconvolsero il mondo

    CERN Multimedia

    Di Giorgio, Claudia

    2005-01-01

    In 1905, the german physicist published five articles about relativity, a theory which changed for ever our knowledge and our life. This beginning year will be "the mondial Year of Physcis" and the physics Community celebrate the Nobel Prize (⅓ page)

  15. Dicty_cDB: CHE346 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NVKNVSVKEIKRGM VAGDSKNDPPQETEKFVAQVIVLNHPGQIHAGYSPVLDCHTAHIACKFTEIVDKVDRRTG AVVAKEGTAAVVLKNGDAAMVELTPSRPMCVX...AVVAKEGTAAVVLKNGDAAMVELTPSRPMCVXSFTEHPPXGRFAV Frame B: ---klvslnqvwssplpqlvsqlksnqskcitnnsqkpvqvtm*vstlktfqs...kklkevw slvtpktihhkklknsllklssstiqvksmlvthqs*ivtlltlpvnslkssiklivvlv pslpkkvlppss*rmvmplwsn*phrvqcvxnpslnthx

  16. 97 Luigi Malerba, Che vergogna scrivere, Milano: Mondadori, 1996 ...

    African Journals Online (AJOL)

    User

    This collection of four loosely-connected essays deals, inter alia, with the status of literature and the writer in society. The first, "Lo scrittore come fantasma", moves from the servile position of the author during the Renaissance, to the author becoming a producer of commodities with the advent of copyright in 1793, pointing.

  17. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    Echantillonnage. Pour mener à bien notre étude, il a été indispensable d'utiliser une sardine d'une extrême fraîcheur. Les échantillons de sardine ont ainsi été prélevés au niveau du port d'Agadir quelques heures après capture courant du mois de septembre 2012 (taux maximal en lipides). Un lot de 10 kg de poisson a été.

  18. L'impronta idrica di quello che mangiamo

    NARCIS (Netherlands)

    Bacenetti, J.; Lovarelli, D.; Fiala, M.; Hoekstra, Arjen Ysbert

    2015-01-01

    È stata recentemente approvata la norma ISO (ISO 14046 Water footprint – requirements and guidelines) per la definizione dell’impronta idrica (Water Footprint) (vedi box). Questo nuovo indicatore di sostenibilità ambientale permette di quantificare il consumo di acqua dolce associato, direttamente o

  19. Le sfide che i figli degli immigrati devono affrontare

    Directory of Open Access Journals (Sweden)

    Sandra Sicurella

    2015-05-01

    Full Text Available Economic changes, poverty, wars, violence and socio-political conditions generated waves of migrants that irreversibly affect the daily lives in our country too. Children of migrants are requested to face many difficulties which are transformed into challenges on a daily basis in order to assert a position in the host society. The number of admissions of foreign children is constantly growing and often the culture clash may lead to exclusion. This is an extremely difficult situation, especially for children who sometimes do not have the adequate tools to deal with this.

  20. Una presenza che si fa ombra in Oriente

    Directory of Open Access Journals (Sweden)

    Giovanni Azzaroni

    2017-03-01

    Full Text Available In the contest of Asian culture the “shadow structure” is discussed connected to its native world and then it has to be interpreted starting to the culture of its original world. This essay investigates three different geographic situation, that is Japan (nōtheatre, China (shadow theatre and Indonesia (shadow theatre, to connect as well as possible the vision and “shadow philosophy” to accurate and cultural perspectives, which can relate it to real cultural images.

  1. Dicty_cDB: CHE818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8.1 Habrotrocha constricta 82 kDa heat shock protein 2 (hsp82-2) gene, partial cds. 88 3e-48 4 AF143854 |AF143854.1 Sinantherina soci...alis 82 kD heat shock protein (hsp82) gene, partial cds.

  2. The Bumpy Face of Che Guevara: An Interesting Case.

    Science.gov (United States)

    Chatterjee, Kingshuk; Roy, Anupam; Ghosh, Romana; Barua, Jayanta Kumar; Halder, Saswati; Banerjee, Gautam

    2017-01-01

    Placement of decorative tattoo on the skin may lead to various immunological, infective, and coincidental complications. Inoculation of human papillomavirus leading to development of verruca is an uncommon complication of tattoos. The present report highlights the development of verruca vulgaris, developing after 2 years of tattooing in a young male.

  3. Dicty_cDB: CHE224 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SDVKFLNTPHFELPPNANPGDFLR ETFDHPSAPKALEFAHGTTTLAFVYGGGIIVSXDSKSTQGPY--- ---rthlccccx*nfskxxifi*rxrfingxydywlg...*nwtxiilc***wd*itwstffm wxrfnxxlwcfxxrf*mgye*xxsi*trsxsclscnsqxxllwwxyqclscskrwle...fkyttfrittkcksr*ffkr ni*ssistksigictwynyisiciwwryycixrfkiytrtir--- ---nssllllhxkf*qxlxihikxtvyqwxl*llvgikldx...nyimlimmgldymvnvfhv xqvqxmxmvfxxqvlngi*mxxkhmnsvxxlfimqltxxltlvxlsmfimfkkmvgxrfl lmixsnxixnitilxqlinqxn*xqxl

  4. Che cos'è la conoscenza? un universo in espansione

    CERN Document Server

    Franceschini, Guiliano

    2017-01-01

    Il testo propone un viaggio nell'universo della conoscenza, tra le galassie di conoscenza (religione, scienza, arte), nel cervello (percezione, apprendimento, memoria) e nell'etica (dalla conoscenza all'educazione). Le argomentazioni si espandono attraverso un registro comunicativo intuitivo, tra divulgazione e speculazione, attraverso esempi e riferimenti concreti, rivolgendosi in alcuni casi direttamente al lettore.

  5. The bumpy face of che guevara: An interesting case

    Directory of Open Access Journals (Sweden)

    Kingshuk Chatterjee

    2017-01-01

    Full Text Available Placement of decorative tattoo on the skin may lead to various immunological, infective, and coincidental complications. Inoculation of human papillomavirus leading to development of verruca is an uncommon complication of tattoos. The present report highlights the development of verruca vulgaris, developing after 2 years of tattooing in a young male.

  6. Che fatica far festa all’Odin Teatret!

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2004-01-01

    A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark.......A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark....

  7. Dicty_cDB: CHE366 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxxkxvkxxxxxkxgxxxxxxxx...xxxxg* TIXKXVXXFXXYNIXXXSXXXLVLRLXGGMQXFVKTXXGKTITLEVEGXDNIENVKXKIQ DKEGIPPDQQRXIFX...MQIFVKTLTGKTITLEVEGSDNIENVX Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxgxxfxxxxxxgxxxx...fxkxkxxxxxxxcxxxxxxxxrxxxxxxxxxxfxwv nnxkxgxxxxgx*hxkxixxpxsfkixrwyanxc*nxxw*nnhfrs*...tirrwsysf*lqyskrihspfsfkikr wyanlc*nshw*nnhfrs*rf**h*kcx Frame B: ---xxxxxxxxnfxxxxxxxxxxxlxsxrxxxxx

  8. LES VIBRIONS DANS LES PRODUITS DE LA PÊCHE

    African Journals Online (AJOL)

    PC_WINDOWS

    19) sont étudiés en vue d'évaluer l'incidence de la contamination des produits de la pêche par Vibrions spp. Les résultats obtenus montrent une prévalence globale du genre Vibrio de 81% dans l'ensemble des produits de la pêche analysés.

  9. à l'encoche sèche

    African Journals Online (AJOL)

    naturel est une matière première importante en industrie. Il intervient à 70% dans la ... caoutchouc naturel de cette région est en constante progression, due au .... L'analyse a été effectuée avec le test statistique de Duncan au risque alpha = 5 % avec les valeurs de LEM transformées en Arc Sinus. Racine carrée de LEM ...

  10. Pragmatic Idealism: Ernesto Che Guevaras Strategic Choice for Bolivia

    Science.gov (United States)

    2017-06-01

    Guerrilla: Revolutionary Theory and Malpractice (New York: Alfred A. Knopf, 1971), 210. 2 An outline of the ideological drivers, strategic factors...develop theory through practical experience is believed to reflect his medical training, and his search for practical solutions was also evident...anywhere he happened to be.62 According to a letter to his mother, despite his anti- American sentiments, Guevara, a medical student in his native

  11. Dicty_cDB: CHE234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAGCTGCATCATCAGCTGCAAG sequence update 2002. 9.10 Translated Amino Acid sequence ---XLEVXQXVLKQGPPVPPPHCSTCAEXSS...SSAASSSAPSSASSSAPSSASSSAPSSSASSSAASSAA Translated Amino Acid sequence (All Frames) Frame A: ---XLEVXQXVLKQGPPVPPPHCSTCAEXSS...iism*srwndlysstkqlyqy*ipmlpxssnl yssinyccfnhcnncincrnynlcnycrynnwwnynwwfnf***ccflsr**rcllitik qccfkcrfk*tik*

  12. CHE COSA RESTA DI CHERUBINI OGGI? DUE CASI DI STUDIO

    Directory of Open Access Journals (Sweden)

    Emanuele Miola

    2016-09-01

    Full Text Available A partire dagli anni Duemila, il fenomeno delle cosiddette risorgenze dialettali si è manifestato, nel panorama linguistico italiano, anche attraverso l’emergenza dei dialetti negli ambiti propri della Comunicazione Mediata dal Computer e, specialmente, sui siti internet creati ‘dal basso’, come l’enciclopedia libera e multilingue online Wikipedia. In questo articolo, si esaminerà il lascito di Cherubini e del suo Vocabolario milanese-italiano sull’edizione regionale lombarda della Wikipedia: gli articoli di quest’ultima saranno passati in rassegna, sia dal punto di vista ortografico, comparando le scelte del lessicografo milanese con quelle più in voga online, sia dal punto di vista morfo-sintattico, discutendo in questo secondo caso la presenza e la produttività di alcuni verbi sintagmatici. What remains of Cherubini today? Two case studies Since the beginning of the twenty-first century, the phenomenon of dialect resurgence has manifested in Italy through the emergence of dialects in Computer Mediated Communication, especially, on bottom-up created Web sites, like the free, multilingual, online encyclopedia Wikipedia. In this article, we will examine the legacy of Cherubini and his Milanese-Italian dictionary on the regional Lombard version of Wikipedia. We will review the articles both in terms of spelling, comparing the choices of Milanese lexicographer with those most utilized currently online, and from a morpho-syntactic point of view, discussing the presence and the productivity of some phrasal verbs.

  13. ChE Undergraduate Research Projects in Biomedical Engineering.

    Science.gov (United States)

    Stroeve, Pieter

    1981-01-01

    Describes an undergraduate research program in biomedical engineering at the State University of New York at Buffalo. Includes goals and faculty comments on the program. Indicates that 58 percent of projects conducted between 1976 and 1980 have been presented at meetings or published. (SK)

  14. El Che y la natación

    Directory of Open Access Journals (Sweden)

    Ana Maria Peña Rojas

    2009-09-01

    Full Text Available Sobre la vida de Ernesto Guevara de la Serna se puede hablar de una trayectoria tan rica en todos los campos; que se pudiera decir del héroe de nuestra América, el guerrillero, el economista, el escritor, el fotógrafo y un gran apasionado por el deporte. Se aborda algunos aspectos relacionados con el Ché como practicante sistemático de la Natación en el sector residencial y escolar durante su vida, pues siempre le interesó la actividad deportiva a pesar de su escasa salud, por el padecimiento de asma bronquial desde su nacimiento. Tuvo junto a sus padres estancia en varios lugares, buscando condiciones para el progreso de su salud, pues además era el hijo primogénito y su madre padeció de la misma enfermedad durante su niñez, aunque heredó otras cosas muy buenas de ella. Supo sobreponerse con tesón y voluntad, tuvo gran incidencia en actividades relacionadas con la natación y otros deportes. Demostró gran destreza en el estilo Mariposa; aunque también practicaba el estilo pecho y el clavado. Su interactuar apasionado como deportista durante su juventud y adultez, lo hicieron más fuertes para enfrentar la vida, lo que posibilitó una formación integra en su persona; aquí se expresa la versatilidad e integridad y fortaleza de un hombre apasionado por la naturaleza, la formación de un hombre nuevo, con diferentes matices de ejemplaridad y paradigma de los pueblos de América Latina.

  15. Dicty_cDB: CHE547 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 25 Translated Amino Acid sequence glleninni*q*tk*INKKKNNNHFFFLXFXIKN--- ---MNWAIRDGTYESFKGSPASKGILQFDMWNVTPS...r*cnsihc*snrisnskts*k*yklnytt*nsn*n skll Frame C: glleninni*q*tk*INKKKNNNHFFFLXFX

  16. Dicty_cDB: CHE555 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available la EST MtBC10B03R1 : T7 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza of cultivar J...03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza ...a EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar Je

  17. Dicty_cDB: CHE822 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 46 0.021 2 BX855... Medicago truncatula EST MtBC43B08F1 : T3 end of clone MtBC43B08 of cDNA library MtBC from arbuscular myco

  18. Dicty_cDB: CHE515 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hvpkkxv*lilqsilmitmhvplipvhhqlvfptlqltvmi vnpctidscnnstglxxhsnqw****slvp*ih--- --...FGLXGGFXGGGTXGKXDCXTCKN*xtxfi*lxfkk ixkkfxkkfxkkkklfvflsniynf*k*kf Frame C: nkctvdscsnstgcvntpincddsnpctvdscnns

  19. JPRS Report, Science & Technology, Japan

    Science.gov (United States)

    1988-10-05

    This is Japan Report with Science and Technology. It contains the issues with different topics on biotecnology , defense industry, nuclear engineering, Marine technology, science and technology policy.

  20. Technology transfer 1994

    Energy Technology Data Exchange (ETDEWEB)

    1994-01-01

    This document, Technology Transfer 94, is intended to communicate that there are many opportunities available to US industry and academic institutions to work with DOE and its laboratories and facilities in the vital activity of improving technology transfer to meet national needs. It has seven major sections: Introduction, Technology Transfer Activities, Access to Laboratories and Facilities, Laboratories and Facilities, DOE Office, Technologies, and an Index. Technology Transfer Activities highlights DOE`s recent developments in technology transfer and describes plans for the future. Access to Laboratories and Facilities describes the many avenues for cooperative interaction between DOE laboratories or facilities and industry, academia, and other government agencies. Laboratories and Facilities profiles the DOE laboratories and facilities involved in technology transfer and presents information on their missions, programs, expertise, facilities, and equipment, along with data on whom to contact for additional information on technology transfer. DOE Offices summarizes the major research and development programs within DOE. It also contains information on how to access DOE scientific and technical information. Technologies provides descriptions of some of the new technologies developed at DOE laboratories and facilities.

  1. Technology '90

    Energy Technology Data Exchange (ETDEWEB)

    1991-01-01

    The US Department of Energy (DOE) laboratories have a long history of excellence in performing research and development in a number of areas, including the basic sciences, applied-energy technology, and weapons-related technology. Although technology transfer has always been an element of DOE and laboratory activities, it has received increasing emphasis in recent years as US industrial competitiveness has eroded and efforts have increased to better utilize the research and development resources the laboratories provide. This document, Technology '90, is the latest in a series that is intended to communicate some of the many opportunities available for US industry and universities to work with the DOE and its laboratories in the vital activity of improving technology transfer to meet national needs. Technology '90 is divided into three sections: Overview, Technologies, and Laboratories. The Overview section describes the activities and accomplishments of the DOE research and development program offices. The Technologies section provides descriptions of new technologies developed at the DOE laboratories. The Laboratories section presents information on the missions, programs, and facilities of each laboratory, along with a name and telephone number of a technology transfer contact for additional information. Separate papers were prepared for appropriate sections of this report.

  2. The Ultimate Technology

    DEFF Research Database (Denmark)

    Riis, Søren

    2013-01-01

    One of the most influential philosophers of the 20th century, Martin Heidegger (1889-1976), died prior to the remarkable cloning of the sheep Dolly and before Dr. Venter started his experiments on creating synthetic life, and he never explicitly discussed living technologies. However, by reinterp......One of the most influential philosophers of the 20th century, Martin Heidegger (1889-1976), died prior to the remarkable cloning of the sheep Dolly and before Dr. Venter started his experiments on creating synthetic life, and he never explicitly discussed living technologies. However......, by reinterpreting his notion of "modern technology," this article shows how it is possible to philosophically assess living technologies and to recognize ways in which Heidegger anticipated this phenomenon with his notion of cybernetics. The interpretation elucidates the fundamental process of technology becoming...... living and simultaneously presents living technology as the ultimate technology. The thesis of this article is that living technology is not just one more technology; rather, it is the perfection of technology as understood by Aristotle. Aristotle's thinking is in this way a key example of a profound...

  3. Technology and teen drivers.

    Science.gov (United States)

    Lee, John D

    2007-01-01

    The rapid evolution of computing, communication, and sensor technology is likely to affect young drivers more than others. The distraction potential of infotainment technology stresses the same vulnerabilities that already lead young drivers to crash more frequently than other drivers. Cell phones, text messaging, MP3 players, and other nomadic devices all present a threat because young drivers may lack the spare attentional capacity for vehicle control and the ability to anticipate and manage hazards. Moreover, young drivers are likely to be the first and most aggressive users of new technology. Fortunately, emerging technology can also support safe driving. Electronic stability control, collision avoidance systems, intelligent speed adaptation, and vehicle tracking systems can all help mitigate the threats to young drivers. However, technology alone is unlikely to make young drivers safer. One promising approach to tailoring technology to teen drivers is to extend proven methods for enhancing young driver safety. The success of graduated drivers license programs (GDL) and the impressive safety benefit of supervised driving suggest ways of tailoring technology to the needs of young drivers. To anticipate the effects of technology on teen driving it may be useful to draw an analogy between the effects of passengers and the effects of technology. Technology can act as a teen passenger and undermine safety or it can act as an adult passenger and enhance safety. Rapidly developing technology may have particularly large effects on teen drivers. To maximize the positive effects and minimize the negative effects will require a broad range of industries to work together. Ideally, vehicle manufacturers would work with infotainment providers, insurance companies, and policy makers to craft new technologies so that they accommodate the needs of young drivers. Without such collaboration young drivers will face even greater challenges to their safety as new technologies emerge.

  4. [Earth Science Technology Office's Computational Technologies Project

    Science.gov (United States)

    Fischer, James (Technical Monitor); Merkey, Phillip

    2005-01-01

    This grant supported the effort to characterize the problem domain of the Earth Science Technology Office's Computational Technologies Project, to engage the Beowulf Cluster Computing Community as well as the High Performance Computing Research Community so that we can predict the applicability of said technologies to the scientific community represented by the CT project and formulate long term strategies to provide the computational resources necessary to attain the anticipated scientific objectives of the CT project. Specifically, the goal of the evaluation effort is to use the information gathered over the course of the Round-3 investigations to quantify the trends in scientific expectations, the algorithmic requirements and capabilities of high-performance computers to satisfy this anticipated need.

  5. Technology transfer - the role of AEA Technology

    International Nuclear Information System (INIS)

    Hughes, A.E.; Bullough, R.; Mason, J.P.

    1989-01-01

    This paper concentrates mostly on examples of spin offs which have arisen from the more basic research carried out by the AEA. However, it should not be inferred from this that the only examples of successful technology transfer by the AEA are of a similar, often unforeseen nature. The most outstanding example of technology transfer by the AEA must surely be that achieved through the applied research which has enabled the establishment of a successful civil nuclear power programme in the UK. The natural transfer of technology here, achieved by virtue of the unique bridging position of the AEA with respect to universities and the nuclear industry, means that its success can easily be overlooked; to do so would be a mistake. However, by including spin off examples, we hope to illustrate how the AEA has also succeeded in bridging to more difficult areas where the special relationship which it shares with the nuclear industry is absent. (author)

  6. Water Technology Lecture 1: Introducing Water Technology

    OpenAIRE

    Gray, Nicholas Frederick

    2017-01-01

    This is a full set of PowerPoint lectures for a course in Water Technology currently given at Trinity College, University of Dublin by professor N.F. Gray. The lectures cover all aspects of water and wastewater treatment and are available for use to lecturers or those interested in the subject. The lecture series is to be used in conjunction with the new textbook ?Water Science and Technology? (4th edition) published by CRC Press in 2017. Lecture 1 is an introduction to the water indust...

  7. Technology Matters - When new technology reshape innovation

    DEFF Research Database (Denmark)

    Edwards, Kasper; Pedersen, Jørgen Lindgaard

    2004-01-01

    not to be managed in the sense that aims, instruments and resources are unclear. It is observed that new technology is adopted with a limited scope and fo-cus – often to solve a particular technical problem e.g. the quality of specifica-tion are too low. For a single reason a new technology is introduced within...... observed through these interviews that product configuration systems are being implemented to solve a particular problem only later to become a significant part of business processes. Product configuration systems over time become a central element when innovating new products....

  8. Responsible technology acceptance

    DEFF Research Database (Denmark)

    Toft, Madeleine Broman; Schuitema, Geertje; Thøgersen, John

    2014-01-01

    on private consumers’ acceptance of having Smart Grid technology installed in their home. We analyse acceptance in a combined framework of the Technology Acceptance Model and the Norm Activation Model. We propose that individuals are only likely to accept Smart Grid technology if they assess usefulness......As a response to climate change and the desire to gain independence from imported fossil fuels, there is a pressure to increase the proportion of electricity from renewable sources which is one of the reasons why electricity grids are currently being turned into Smart Grids. In this paper, we focus...... in terms of a positive impact for society and the environment. Therefore, we expect that Smart Grid technology acceptance can be better explained when the well-known technology acceptance parameters included in the Technology Acceptance Model are supplemented by moral norms as suggested by the Norm...

  9. Use of Payment Technology

    DEFF Research Database (Denmark)

    Xiao, Xiao; Hedman, Jonas; Runnemark, Emma

    2015-01-01

    Drawing on the theory of consumption value, this research-in-progress strives to provide a theoretical explanation of payment technology use by investigating the relationship between consumers’ perceptions of different consumption values associated with a certain payment technology and their choice...... to use the technology. We conducted the study in the context of Denmark, a Northern European country, with three well established payment technologies: cash, payment cards, and Internet banking. Following a focus group of identifying and defining four types of consumption values associated with each...... payment technology, a survey was then conducted by a national statistics agency in the country. Preliminary results have shown that different consumption values matter for the use of different payment technologies. The findings will potentially contribute to a better understanding of consumer payment...

  10. Buildings Energy Technology; (USA)

    Energy Technology Data Exchange (ETDEWEB)

    Cason, D.L.; Hicks, S.C. (eds.)

    1991-01-01

    Buildings Energy Technology (BET) announces on a monthly basis the current worldwide information available on the technology required for economic energy conservation in buildings and communities. Each issue of BET also will include an article presenting a program overview or highlighting a current energy conservation technology project of DOE's Office of Building Technologies (OBT) plus a listing of scheduled meetings of interest. This publication contains the abstracts of DOE reports, journal articles, conference papers, patents, theses, and monographs added to the Energy Science and Technology Database (EDB) during the past month. Also included are US information obtained through acquisition programs or interagency agreements and international information obtained through the International Energy Agency's Energy Technology Data Exchange or government-to-government agreements.

  11. Nuclear technology and beyond

    International Nuclear Information System (INIS)

    Akiyama, Mamoru

    1997-01-01

    After the confrontation of East and West, and the problem of North and South, we are now facing the era of Globalization in the presence of twenty-first century. Tracing the history of civilization, human being has progressed along with the accumulation of experience, and the development of science and technology. Science and technology bloomed in modern ages, especially, energy technology showed the giant leap in this century. Nuclear science and technology has been developed for peaceful purposes, and for the benefit of humanity. As a result, today, its progress led nuclear science and technology to have the great applicability to the development of the society. Toward the twenty-first century and Globalization, the science and technology developed in nuclear field is hoped to play a great contribution in various area of the society. (author)

  12. Everyday Struggels with Technology

    DEFF Research Database (Denmark)

    Mahnke, Martina; Schwartz, Sander Andreas

    2017-01-01

    Technology has not only become an integral part of people’s lives but also of people’s everyday struggles. Struggles with technology are complex in nature; we tend to not only struggle with their basic functions but also with how they make us feel. During the course of our life we tend to master...... and struggle with technology in different ways. This struggle has been studied in relation to media literacy (Livingstone, 2004), to domestication theory (Silverstone et al. 1992), or in everyday life (Bakardjieva, 2005). This work enhances these lines of studies by exploring everyday struggles with technology...... from a life stage (Erikson, 1959) point of view. In particular, we explore what are common struggles people have with technology and what are distinct struggles in relation to life stages. In conclusion, we will present our findings by outlining what we call ‘technological biographies’. Those...

  13. Emerging and Disruptive Technologies.

    Science.gov (United States)

    Kricka, Larry J

    2016-08-01

    Several emerging or disruptive technologies can be identified that might, at some point in the future, displace established laboratory medicine technologies and practices. These include increased automation in the form of robots, 3-D printing, technology convergence (e.g., plug-in glucose meters for smart phones), new point-of-care technologies (e.g., contact lenses with sensors, digital and wireless enabled pregnancy tests) and testing locations (e.g., Retail Health Clinics, new at-home testing formats), new types of specimens (e.g., cell free DNA), big biology/data (e.g., million genome projects), and new regulations (e.g., for laboratory developed tests). In addition, there are many emerging technologies (e.g., planar arrays, mass spectrometry) that might find even broader application in the future and therefore also disrupt current practice. One interesting source of disruptive technology may prove to be the Qualcomm Tricorder XPrize, currently in its final stages.

  14. NAND flash memory technologies

    CERN Document Server

    Aritome, Seiichi

    2016-01-01

    This book discusses basic and advanced NAND flash memory technologies, including the principle of NAND flash, memory cell technologies, multi-bits cell technologies, scaling challenges of memory cell, reliability, and 3-dimensional cell as the future technology. Chapter 1 describes the background and early history of NAND flash. The basic device structures and operations are described in Chapter 2. Next, the author discusses the memory cell technologies focused on scaling in Chapter 3, and introduces the advanced operations for multi-level cells in Chapter 4. The physical limitations for scaling are examined in Chapter 5, and Chapter 6 describes the reliability of NAND flash memory. Chapter 7 examines 3-dimensional (3D) NAND flash memory cells and discusses the pros and cons in structure, process, operations, scalability, and performance. In Chapter 8, challenges of 3D NAND flash memory are dis ussed. Finally, in Chapter 9, the author summarizes and describes the prospect of technologies and market for the fu...

  15. Technological Capability's Predictor Variables

    Directory of Open Access Journals (Sweden)

    Fernanda Maciel Reichert

    2011-03-01

    Full Text Available The aim of this study was to identify the factors that influence in configuration of the technological capability of companies in sectors with medium-low technological intensity. To achieve the goal proposed in this article a survey was carried out. Based on the framework developed by Lall (1992 which classifies firms in basic, intermediate and advanced level of technological capability; it was found that the predominant technological capability is intermediate, with 83.7% of respondent companies (plastics companies in Brazil. It is believed that the main contribution of this study is the finding that the dependent variable named “Technological Capability” can be explained at a rate of 65% by six variables: development of new processes; selection of the best equipment supplier; sales of internally developed new technology to third parties; design and manufacture of equipment; study of the work methods and perform inventory control; and improvement of product quality.

  16. Technology Transfer and Commercialization

    Science.gov (United States)

    Martin, Katherine; Chapman, Diane; Giffith, Melanie; Molnar, Darwin

    2001-01-01

    During concurrent sessions for Materials and Structures for High Performance and Emissions Reduction, the UEET Intellectual Property Officer and the Technology Commercialization Specialist will discuss the UEET Technology Transfer and Commercialization goals and efforts. This will include a review of the Technology Commercialization Plan for UEET and what UEET personnel are asked to do to further the goals of the Plan. The major goal of the Plan is to define methods for how UEET assets can best be infused into industry. The National Technology Transfer Center will conduct a summary of its efforts in assessing UEET technologies in the areas of materials and emissions reduction for commercial potential. NTTC is assisting us in completing an inventory and prioritization by commercialization potential. This will result in increased exposure of UEET capabilities to the private sector. The session will include audience solicitation of additional commercializable technologies.

  17. Technology transfer packages

    International Nuclear Information System (INIS)

    Mizon, G.A.; Bleasdale, P.A.

    1994-01-01

    Nuclear power is firmly established in many developed countries'energy policies and is being adopted by emerging nations as an attractive way of gaining energy self sufficiency. The early users of nuclear power had to develop the technology that they needed, which now, through increasing world wide experience, has been rationalised to meet demanding economic and environmental pressures. These justifiable pressures, can lead to existing suppliers of nuclear services to consider changing to more appropriate technologies and for new suppliers to consider licensing proven technology rather then incurring the cost of developing new alternatives. The transfer of technology, under license, is made more straight forward if the owner conveniently groups appropriate technology into packages. This paper gives examples of 'Technology Packages' and suggests criteria for the specification, selection and contractual requirements to ensure successful licensing

  18. Promoting renewable energy technologies

    DEFF Research Database (Denmark)

    Olsen, O.J.; Skytte, K.

    2004-01-01

    % of its annual electricity production. In this paper, we present and discuss the Danish experience as a case of promoting renewable energy technologies. The development path of the two technologies has been very different. Wind power is considered an outright success with fast deployment to decreasing...... technology and its particular context, it is possible to formulate some general principles that can help to create an effective and efficient policy for promoting new renewable energy technologies.......Wind power and combined heat and power (CHP) using biomass (for combustion, gasification or fermentation) are two of the most promising renewable technologies for generation of electricity. Denmark has a long and well-established tradition for these technologies that now account for approx. 25...

  19. Information Technology Resources Assessment

    Energy Technology Data Exchange (ETDEWEB)

    1993-04-01

    The Information Technology Resources Assessment (ITRA) is being published as a companion document to the Department of Energy (DOE) FY 1994--FY 1998 Information Resources Management Long-Range Plan. This document represents a collaborative effort between the Office of Information Resources Management and the Office of Energy Research that was undertaken to achieve, in part, the Technology Strategic Objective of IRM Vision 21. An integral part of this objective, technology forecasting provides an understanding of the information technology horizon and presents a perspective and focus on technologies of particular interest to DOE program activities. Specifically, this document provides site planners with an overview of the status and use of new information technology for their planning consideration.

  20. Contextualizacion y "Expresiones Pragmaticas": "Che" como Senal de Marco (Contextualization and "Pragmatic Expressions": "Che" as Deictic Marker).

    Science.gov (United States)

    Carranza, Isolda

    The pragmatic expressions of Argentine Spanish (e.g., "bueno, viste, no? mira") are defined as deictic signals. They are deictic because they indicate elements of the communicative situation: transitions between text segments, conversational roles, or the social relationship between participants. They also signal contextual suppositions…

  1. Trends in Technology Use

    OpenAIRE

    Florin Frant

    2009-01-01

    This study aims to investigate the relationship between the use of technology, working conditions and the health and well-being of workers in Europe. As it is known that characteristics of work organisation may reinforce or impair both positive and negative effects of technology use, the role of these characteristics is also considered in this study. The research will provide an insight into the trends and changes in technology use and working conditions in European count...

  2. Digital Sensor Technology

    Energy Technology Data Exchange (ETDEWEB)

    Ted Quinn; Jerry Mauck; Richard Bockhorst; Ken Thomas

    2013-07-01

    The nuclear industry has been slow to incorporate digital sensor technology into nuclear plant designs due to concerns with digital qualification issues. However, the benefits of digital sensor technology for nuclear plant instrumentation are substantial in terms of accuracy, reliability, availability, and maintainability. This report demonstrates these benefits in direct comparisons of digital and analog sensor applications. It also addresses the qualification issues that must be addressed in the application of digital sensor technology.

  3. Semiotic technology and practice

    DEFF Research Database (Denmark)

    Zhao, Sumin; Djonov, Emilia; van Leeuwen, Theo

    2014-01-01

    for discourse analysis and social semiotic research, focusing especially on the need to step away from the notion of text and to develop a holistic, non-logocentric, and adaptive multimodal approach to researching semiotic technologies. Using PowerPoint as a case study, this article takes a step toward...... developing a social semiotic multimodal theory of the relation between semiotic technologies, or technologies for making meaning, and semiotic practices....

  4. RFID TECHNOLOGY: AN OVERVIEW

    OpenAIRE

    Amit Kumar Pal; Akanksha Tripathi; Anupam Saigal

    2017-01-01

    The information technology has changed the way library professional to interact, communicate, share and acquire knowledge. However, when the computer was created it did not have features and facilities for users to interact. With the evaluation of Internet and Communication Technology, manual library has evolved into a dynamic, interactive and collaborative platform that facilitates exchange of knowledge and information among its users. RFID is the latest technology to be used in libraries an...

  5. Health care technology assessment

    Science.gov (United States)

    Goodman, Clifford

    1994-12-01

    The role of technology in the cost of health care is a primary issue in current debates concerning national health care reform. The broad scope of studies for understanding technological impacts is known as technology assessment. Technology policy makers can improve their decision making by becoming more aware, and taking greater advantage, of key trends in health care technology assessment (HCTA). HCTA is the systematic evaluation of the properties, impacts, and other attributes of health care technologies, including: technical performance; clinical safety and efficacy/effectiveness; cost-effectiveness and other economic attributes; appropriate circumstances/indications for use; and social, legal, ethical, and political impacts. The main purpose of HCTA is to inform technology-related policy making in health care. Among the important trends in HCTA are: (1) proliferation of HCTA groups in the public and private sectors; (2) higher standards for scientific evidence concerning technologies; (3) methodological development in cost analyses, health-related quality of life measurement, and consolidation of available scientific evidence (e.g., meta-analysis); (4) emphasis on improved data on how well technologies work in routine practice and for traditionally under-represented patient groups; (5) development of priority-setting methods; (6) greater reliance on medical informatics to support and disseminate HCTA findings.

  6. Technology Roadmaps: Cement

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2009-07-01

    To support its roadmap work focusing on key technologies for emissions reductions, the International Energy Agency (IEA) also investigated one particular industry: cement. Cement production includes technologies that are both specific to this industry and those that are shared with other industries (e.g., grinding, fuel preparation, combustion, crushing, transport). An industry specific roadmap provides an effective mechanism to bring together several technology options. It outlines the potential for technological advancement for emissions reductions in one industry, as well as potential cross-industry collaboration.

  7. Explosive Technology Group

    Data.gov (United States)

    Federal Laboratory Consortium — The Explosive Technology Group (ETG) provides diverse technical expertise and an agile, integrated approach to solve complex challenges for all classes of energetic...

  8. Mixed plastics recycling technology

    CERN Document Server

    Hegberg, Bruce

    1995-01-01

    Presents an overview of mixed plastics recycling technology. In addition, it characterizes mixed plastics wastes and describes collection methods, costs, and markets for reprocessed plastics products.

  9. Technology Education in Japan.

    Science.gov (United States)

    Murata, Shoji; Stern, Sam

    1993-01-01

    Describes the history, current status, and future direction of technology education in Japan, including the process of curriculum transition, secondary and postsecondary structure, and lack of resources. (SK)

  10. Distributed Energy Technology Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Distributed Energy Technologies Laboratory (DETL) is an extension of the power electronics testing capabilities of the Photovoltaic System Evaluation Laboratory...

  11. Extending Database Integration Technology

    National Research Council Canada - National Science Library

    Buneman, Peter

    1999-01-01

    Formal approaches to the semantics of databases and database languages can have immediate and practical consequences in extending database integration technologies to include a vastly greater range...

  12. Advanced Surface Technology

    DEFF Research Database (Denmark)

    Møller, Per; Nielsen, Lars Pleht

    , nitriding, carbonitriding, and many other lesser-known thermochemical processes used for solving technological problems. The book is richly illustrated with pictures and figures showing how the technology creates new innovative solutions for industry and how surfaces are becoming integral to the function......This new significant book on advanced modern surface technology in all its variations, is aimed at both teaching at engineering schools and practical application in industry. The work covers all the significant aspects of modern surface technology and also describes how new advanced techniques make...

  13. Networked Constellation Communications Technologies

    Data.gov (United States)

    National Aeronautics and Space Administration — Develop communications architectures and enabling technologies for mission concepts relying on multiple spatially distributed spacecraft to perform coordinated...

  14. Irradiation technology - industrial use

    International Nuclear Information System (INIS)

    Zyball, A.

    1995-01-01

    The most important applications of the radiation technology are the crosslinking of polymers and sterilisation. Although extensive experience about the use of this technology is available and powerful and dependable radiation facilities can be obtained, as yet the radiation technology has not found the acceptance it deserves in the industry. The main reason therefore has to do with how the question of radiation or the term radiation is presented to the industry and among the population. This paper will deal with considerations and ways in which the industrial use of the radiation technology can be expanded. (author)

  15. Acoustic Technology Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — This laboratory contains an electro-magnetic worldwide data collection and field measurement capability in the area of acoustic technology. Outfitted by NASA Langley...

  16. Solar Cooker Technological Change

    DEFF Research Database (Denmark)

    Ahmad, Bashir

    1997-01-01

    The challenges which solar cooking technology is facing right now is discussed. Based on a field study in Madras and Gujarat, it is asserted that there is an important incompatibility between the technology and the every day real-life conditions of the "users" of solar cooker. An evaluation report...... on a solar cooker technology in Burkina Faso supports the findings of the study. It is concluded that the users and other important actors have to be incorporated in the technological development process of solar cookers in the future....

  17. Future Information Technology

    CERN Document Server

    Stojmenovic, Ivan; Choi, Min; Xhafa, Fatos; FutureTech 2013

    2014-01-01

    Future technology information technology stands for all of continuously evolving and converging information technologies, including digital convergence, multimedia convergence, intelligent applications, embedded systems, mobile and wireless communications, bio-inspired computing, grid and cloud computing, semantic web, user experience and HCI, security and trust computing and so on, for satisfying our ever-changing needs. In past twenty five years or so, Information Technology (IT) influenced and changed every aspect of our lives and our cultures. These proceedings foster the dissemination of state-of-the-art research in all future IT areas, including their models, services, and novel applications associated with their utilization.

  18. Advanced Optical Fuzing Technology

    National Research Council Canada - National Science Library

    Lippe, Christian M. von der; Liu, J. J; Aliberti, Keith; Dang, Gerard; Chang, Wayne; Shen, Paul; Simonis, George

    2004-01-01

    .... The photonic component development exploits pioneering work and unique expertise at ARDEC, ARL, and Sandia National Laboratories by combining key optoelectronic technologies to design and demonstrate...

  19. Moralizing Food Technology

    DEFF Research Database (Denmark)

    Coff, Christian Eyde

    2015-01-01

    Food technologies are common on many levels in society and used by both food professionals and consumers. Food technologies are not neutral. They inform and shape the behaviour of people. This paper presents a theoretical framework for analysing the mediating role of food technology and its...... influence on food ethics. Post-phenomenology and the idea of a technologically mediated morality are central theoretical approaches. Four elements are included in the analytical framework: perception, interpretation, intentionality, and mediated morality. The framework is applied to two cases; food safety...

  20. Application Technology Research Unit

    Data.gov (United States)

    Federal Laboratory Consortium — To conduct fundamental and developmental research on new and improved application technologies to protect floricultural, nursery, landscape, turf, horticultural, and...

  1. Advanced Surface Technology

    DEFF Research Database (Denmark)

    Møller, Per; Nielsen, Lars Pleht

    This new significant book on advanced modern surface technology in all its variations, is aimed at both teaching at engineering schools and practical application in industry. The work covers all the significant aspects of modern surface technology and also describes how new advanced techniques make......, nitriding, carbonitriding, and many other lesser-known thermochemical processes used for solving technological problems. The book is richly illustrated with pictures and figures showing how the technology creates new innovative solutions for industry and how surfaces are becoming integral to the function...

  2. Traditions of technology

    Energy Technology Data Exchange (ETDEWEB)

    Nandy, A.

    1979-01-01

    Modern technology, with about 300 years of history behind it, has become the dominant tradition by marginalizing the other traditions of technology in the West and in the rest of the world. Important roles have been played in this marginalization by the ideology of Englightenment, by the Industrial Revolution, and nineteenth and twentieth century colonialism. They have blurred the difference between science and technology, underwritten the mechanomorphic world-image and promoted the concept of a value-free, ethically unrestrained technology. However, the present crises of technological consciousness has brought to the fore alternative traditions of technology, not as ethnotechnologies from which a universal, secular, modern technology can draw lessons, but as a competing philosophies of universality which can provide correctives to the alienating, exploitative, and dehumanizing role of modern science and technology. An alternative ideology of science is needed for this as well as a new legitimacy for the traditional technosystems and their cultural environments. Such a legitimacy will have to be based on a different set of values relating to the man--nature and man--man relationships and a deeper understanding of the politics of technology in its cross-national and cross-cultural contexts.

  3. Robotics Technology Crosscutting Program. Technology summary

    International Nuclear Information System (INIS)

    1995-06-01

    The Robotics Technology Development Program (RTDP) is a needs-driven effort. A length series of presentations and discussions at DOE sites considered critical to DOE's Environmental Restoration and Waste Management (EM) Programs resulted in a clear understanding of needed robotics applications toward resolving definitive problems at the sites. A detailed analysis of the resulting robotics needs assessment revealed several common threads running through the sites: Tank Waste Retrieval (TWR), Contaminant Analysis Automation (CAA), Mixed Waste Operations (MWO), and Decontamination and Dismantlement (D and D). The RTDP Group also realized that some of the technology development in these four areas had common (Cross Cutting-CC) needs, for example, computer control and sensor interface protocols. Further, the OTD approach to the Research, Development, Demonstration, Testing, and Evaluation (RDDT and E) process urged an additional organizational breakdown between short-term (1--3 years) and long-term (3--5 years) efforts (Advanced Technology-AT). These factors lead to the formation of the fifth application area for Crosscutting and Advanced Technology (CC and AT) development. The RTDP is thus organized around these application areas -- TWR, CAA, MWO, D and D, and CC and AT -- with the first four developing short-term applied robotics. An RTDP Five-Year Plan was developed for organizing the Program to meet the needs in these application areas

  4. Testing Technology: A Sandia technology bulletin

    Energy Technology Data Exchange (ETDEWEB)

    Goetsch, B.; Floyd, H.L.; Doran, L. [eds.

    1994-08-01

    Inside this issue is a farewell to Testing Technology message from technical advisor, Ruth David. Also included are articles on: Testing the I-40 bridge over the Rio Grande, simulated reactor meltdown studies, an inexpensive monitor for testing integrated circuits, testing of antihelicoptor mines, and quality assurance on aircraft inspection.

  5. The Next Technology Revolution - Nano Electronic Technology

    Science.gov (United States)

    Turlik, Iwona

    2004-03-01

    Nanotechnology is a revolutionary engine that will engender enormous changes in a vast majority of today's industries and markets, while potentially creating whole new industries. The impact of nanotechnology is particularly significant in the electronics industry, which is constantly driven by the need for higher performance, increased functionality, smaller size and lower cost. Nanotechnology can influence many of the hundreds of components that are typically assembled to manufacture modern electronic devices. Motorola manufactures electronics for a wide range of industries and communication products. In this presentation, the typical components of a cellular phone are outlined and technology requirements for future products, the customer benefits, and the potential impact of nanotechnology on many of the components are discussed. Technology needs include reliable materials supply, processes for high volume production, experimental and simulation tools, etc. For example, even routine procedures such as failure characterization may require the development of new tools for investigating nano-scale phenomena. Business needs include the development of an effective, high volume supply chain for nano-materials and devices, disruptive product platforms, and visible performance impact on the end consumer. An equally significant long-term industry need is the availability of science and engineering graduates with a multidisciplinary focus and a deep understanding of the fundamentals of nano-technology, that can harness the technology to create revolutionary products.

  6. Technology Transfer and Technology Transfer Intermediaries

    Science.gov (United States)

    Bauer, Stephen M.; Flagg, Jennifer L.

    2010-01-01

    A standard and comprehensive model is needed to evaluate and compare technology transfer systems and the stakeholders within these systems. The principle systems considered include federal laboratories, U.S. universities, the rehabilitation engineering research centers (RERCs), and large small business innovation research programs. An earlier…

  7. Technology Applications Team: Applications of aerospace technology

    Science.gov (United States)

    1993-01-01

    Highlights of the Research Triangle Institute (RTI) Applications Team activities over the past quarter are presented in Section 1.0. The Team's progress in fulfilling the requirements of the contract is summarized in Section 2.0. In addition to our market-driven approach to applications project development, RTI has placed increased effort on activities to commercialize technologies developed at NASA Centers. These Technology Commercialization efforts are summarized in Section 3.0. New problem statements prepared by the Team in the reporting period are presented in Section 4.0. The Team's transfer activities for ongoing projects with the NASA Centers are presented in Section 5.0. Section 6.0 summarizes the status of four add-on tasks. Travel for the reporting period is described in Section 7.0. The RTI Team staff and consultants and their project responsibilities are listed in Appendix A. The authors gratefully acknowledge the contributions of many individuals to the RTI Technology Applications Team program. The time and effort contributed by managers, engineers, and scientists throughout NASA were essential to program success. Most important to the program has been a productive working relationship with the NASA Field Center Technology Utilization (TU) Offices. The RTI Team continues to strive for improved effectiveness as a resource to these offices. Industry managers, technical staff, medical researchers, and clinicians have been cooperative and open in their participation. The RTI Team looks forward to continuing expansion of its interaction with U.S. industry to facilitate the transfer of aerospace technology to the private sector.

  8. Digital Actuator Technology

    Energy Technology Data Exchange (ETDEWEB)

    Ken Thomas; Ted Quinn; Jerry Mauck; Richard Bockhorst

    2014-09-01

    There are significant developments underway in new types of actuators for power plant active components. Many of these make use of digital technology to provide a wide array of benefits in performance of the actuators and in reduced burden to maintain them. These new product offerings have gained considerable acceptance in use in process plants. In addition, they have been used in conventional power generation very successfully. This technology has been proven to deliver the benefits promised and substantiate the claims of improved performance. The nuclear industry has been reluctant to incorporate digital actuator technology into nuclear plant designs due to concerns due to a number of concerns. These could be summarized as cost, regulatory uncertainty, and a certain comfort factor with legacy analog technology. The replacement opportunity for these types of components represents a decision point for whether to invest in more modern technology that would provide superior operational and maintenance benefits. Yet, the application of digital technology has been problematic for the nuclear industry, due to qualification and regulatory issues. With some notable exceptions, the result has been a continuing reluctance to undertake the risks and uncertainties of implementing digital actuator technology when replacement opportunities present themselves. Rather, utilities would typically prefer to accept the performance limitations of the legacy analog actuator technologies to avoid impacts to project costs and schedules. The purpose of this report is to demonstrate that the benefits of digital actuator technology can be significant in terms of plant performance and that it is worthwhile to address the barriers currently holding back the widespread development and use of this technology. It addresses two important objectives in pursuit of the beneficial use of digital actuator technology for nuclear power plants: 1. To demonstrate the benefits of digital actuator

  9. Technology Catalogue. First edition

    Energy Technology Data Exchange (ETDEWEB)

    1994-02-01

    The Department of Energy`s Office of Environmental Restoration and Waste Management (EM) is responsible for remediating its contaminated sites and managing its waste inventory in a safe and efficient manner. EM`s Office of Technology Development (OTD) supports applied research and demonstration efforts to develop and transfer innovative, cost-effective technologies to its site clean-up and waste management programs within EM`s Office of Environmental Restoration and Office of Waste Management. The purpose of the Technology Catalogue is to provide performance data on OTD-developed technologies to scientists and engineers assessing and recommending technical solutions within the Department`s clean-up and waste management programs, as well as to industry, other federal and state agencies, and the academic community. OTD`s applied research and demonstration activities are conducted in programs referred to as Integrated Demonstrations (IDs) and Integrated Programs (IPs). The IDs test and evaluate.systems, consisting of coupled technologies, at specific sites to address generic problems, such as the sensing, treatment, and disposal of buried waste containers. The IPs support applied research activities in specific applications areas, such as in situ remediation, efficient separations processes, and site characterization. The Technology Catalogue is a means for communicating the status. of the development of these innovative technologies. The FY93 Technology Catalogue features technologies successfully demonstrated in the field through IDs and sufficiently mature to be used in the near-term. Technologies from the following IDs are featured in the FY93 Technology Catalogue: Buried Waste ID (Idaho National Engineering Laboratory, Idaho); Mixed Waste Landfill ID (Sandia National Laboratories, New Mexico); Underground Storage Tank ID (Hanford, Washington); Volatile organic compound (VOC) Arid ID (Richland, Washington); and VOC Non-Arid ID (Savannah River Site, South Carolina).

  10. Etude de la réactivité hydraulique d’un ciment bélitique synthétisé à basse température par la méthode sèche en utilisant un minéralisateur

    Directory of Open Access Journals (Sweden)

    Mazouzi Wafaa

    2014-04-01

    Full Text Available Pour des raisons écologiques (réduction des émissions de CO2, les ciments bélitiques à faible teneur en alite ont fait l’objet de beaucoup de recherches ces dernières années afin de substituer le clinker Portland ordinaire. Ces recherches ont concernées la production du ciment bélitique à basse temperature et l’amélioration de son activité hydraulique, ainsi que l’étude de la durabilité des matériaux à base de ce ciment. Dans ce travail, le mélange cru des matières premières (calcaire et argile du ciment bélitique a été substitué par un autre mélange composé de poussière de chaux hydraulique des ateliers d’ensachage et de boue de forage des puits de pétrole en Algérie. Le procédé de cuisson par voie sèche en utilisant 2% de sulfate de zinc (ZnSO4 comme minéralisateur a été adopté pour la fabrication de ce ciment bélitique (éco-ciment à basse température (1100°C. L’analyse par diffraction des rayons X (DRX a montré que la phase fortement réactive de la bélite (άL-C2S a été stabilisée, ce qui montre la forte réactivité hydraulique de ce ciment bélitique. Les analyses par DRX, effectuées sur des pâtes du ciment bélitique synthétisé, et les essais physiques (temps de prise et mécaniques sur des pâtes et mortiers, ont confirmé la réactivité hydraulique de ce ciment qui demeure similaire à celle du ciment de type CEM I 42,5.

  11. Properties and processing technologies of polymers for medical devices; Proprieta' e tecnologie di lavorazione dei polimeri utilizzati nei dispositivi medici

    Energy Technology Data Exchange (ETDEWEB)

    Salernitano, E. [ENEA, Divisione Nuovi Materiali, Centro Ricerche Casaccia, Rome (Italy)

    2000-07-01

    The variety of biomaterials applications in medical devices for substitution or functional integration of organs and tissues has remarkably grown. This has allowed an increased survival of patients affected by traumatic or pathologic events. Biomaterials growing variety and improvement were remarkable and constant over the last twenty years; this fact yielded important clinical effects in every medical area, especially in orthopaedics, cardiovascular surgery and dentistry. Performances of medical materials are evaluated according to their bio functionality and biocompatibility. These concepts are strongly connected: bio functionality refers to devices physical and mechanical properties which allow to perform a specific function. Several transformation methods and different processing technologies allow to obtain products having different physico-chemical and mechanical properties. Among them, chemical and physical stability, biocompatibility, possibility to undergo sterilisation process, control of gases and moisture permeability, control of biodegradation products, wear and fatigue resistance and toughness are the most relevant. Most of research efforts are devoted to improve reliability and last of biomaterials already used thanks to their bio functionality and biocompatibility. Expected developments of medial devices are associated with the design of bio artificial organs, where biomaterials act as a scaffold for the three-dimensional cells growth. [Italian] Il numero delle applicazioni dei biomateriali in dispositivi medici che sostituiscono od integrino dal punto di vista funzionale organi o tessuti e' cresciuto notevolmente. Questo ha portato ad un aumento della sopravvivenza dei pazienti colpiti da eventi patologici o traumatici. La crescita ed il perfezionamento dei biomateriali e' stata, infatti, nell'ultimo ventennio considerevole e costante ed ha avuto importanti ricadute cliniche in tutte le discipline mediche ed in particolare in

  12. Assessing Teacher Technology Skills.

    Science.gov (United States)

    Anderson, Mary Alice

    2000-01-01

    Advocates the assessment of teachers' technology skills by school media and technology specialists who are involved in staff training. Discusses what should be assessed, including level of curricular integration and attitudes; assessment objectives; informal assessments; formal assessments; assessment tools; and administrators as role models for…

  13. Managing Technology Projects

    Science.gov (United States)

    Booth, Char

    2009-01-01

    This will be my first time authoring this column, and I'm delighted to have the opportunity it presents to explore the intersection of library technology and public services. As the recent title of the 2008 Internet Librarian conference indicates, "Beyond Library 2.0: User-Focused Tools and Technologies," the tide of what for several years has…

  14. Computers: Educational Technology Paradox?

    Science.gov (United States)

    Hashim, Hajah Rugayah Hj.; Mustapha, Wan Narita

    2005-01-01

    As we move further into the new millennium, the need to involve and adapt learners with new technology have been the main aim of many institutions of higher learning in Malaysia. The involvement of the government in huge technology-based projects like the Multimedia Super Corridor Highway (MSC) and one of its flagships, the Smart Schools have…

  15. New technologies in contraception

    OpenAIRE

    Rowlands, Sam

    2009-01-01

    New technologies in both reversible contraception and sterilisation are described. The review includes recent advances in the development of oral contraception, emergency contraception, injectable contraception, vaginal rings, subdermal implants, transdermal contraception, intrauterine devices, spermicides and barrier methods. It also covers methods of transcervical female sterilisation and more easily reversible male sterilisation. The emphasis is on the technology and its safety and effecti...

  16. Resources in Technology 7.

    Science.gov (United States)

    International Technology Education Association, Reston, VA.

    This volume of Resources in Technology contains the following eight instructional modules: (1) "Processing Technology"; (2) "Water--A Magic Resource"; (3) "Hazardous Waste Disposal--The NIMBY (Not in My Backyard) Syndrome"; (4) "Processing Fibers and Fabrics"; (5) "Robotics--An Emerging…

  17. School Security Technologies

    Science.gov (United States)

    Schneider, Tod

    2010-01-01

    Over the past decade electronic security technology has evolved from an exotic possibility into an essential safety consideration. Before resorting to high-tech security solutions, school officials should think carefully about the potential for unintended consequences. Technological fixes may be mismatched to the problems being addressed. They can…

  18. Botswana Journal of Technology

    African Journals Online (AJOL)

    Botswana Journal of Technology describes original developments or research in the field of Engineering and Technology. It is published twice a year. Vol 22, No 1 (2013). DOWNLOAD FULL TEXT Open Access DOWNLOAD FULL TEXT Subscription or Fee Access. Table of Contents. Articles. Urbanisation, infrastructure ...

  19. Educational Technology: Integration?

    Science.gov (United States)

    Christensen, Dean L.; Tennyson, Robert D.

    This paper presents a perspective of the current state of technology-assisted instruction integrating computer language, artificial intelligence (AI), and a review of cognitive science applied to instruction. The following topics are briefly discussed: (1) the language of instructional technology, i.e., programming languages, including authoring…

  20. Technology and Teaching Philosophy

    Science.gov (United States)

    King, Paul C.

    2012-01-01

    This article discusses the challenges faced when integrating new technologies into the classroom. Viewing the experiences of teaching a first year learning community through the lens of the principles of the Reflective Teaching Portfolio, the author looks to answer the question: "How should Technology relate to our Teaching Philosophy?"…

  1. CSIR Technology Impact 1998

    CSIR Research Space (South Africa)

    CSIR

    1998-01-01

    Full Text Available stream_source_info CSIR Technology Impact 1998.pdf.txt stream_content_type text/plain stream_size 23 Content-Encoding ISO-8859-1 stream_name CSIR Technology Impact 1998.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

  2. Technology and Educational Structure

    Science.gov (United States)

    Boocock, Sarane S.

    2012-01-01

    Most current debate on instructional technology is characterized either by grandiose speculation on the salvation of education through automation (without specification of "what" and "how" technological innovations will actually be introduced in specific classroom situations, and how the changes will be financed), or by jargon-filled hairsplitting…

  3. US blanket technology programs

    International Nuclear Information System (INIS)

    Nygren, R.E.

    1985-01-01

    Experimental research in US programs related to blanket technology is described through brief summaries of the objectives, facilities, recent experimental results and principal investigators for the Blanket Technology Program, TRIO-1 Experiment, TSTA, Fusion Hybrid Program and selected activities in the Fusion Materials and Fusion Safety Programs in neutronics research

  4. Advanced Mirror Technology Development

    Science.gov (United States)

    Stahl, H. Philip

    2017-01-01

    The Advanced Mirror Technology Development (AMTD) project matures critical technologies required to enable ultra-stable 4-m-or-larger monolithic or segmented ultraviolet, optical, and infrared (UVOIR) space telescope primary-mirror assemblies for general astrophysics and ultra-high-contrast observations of exoplanets.

  5. Learning Languages through Technology

    Science.gov (United States)

    Hanson-Smith, Elizabeth, Ed.; Rilling, Sarah, Ed.

    2007-01-01

    While posing important questions about how learning proceeds with new technologies, this volume demonstrates how teachers captivate the imagination of learners, from schoolchildren to postgraduates, by providing real-world purposes for language. The authors are from educational institutions in many regions of the world, and describe technology use…

  6. JOURNAL OF LANGUAGE, TECHNOLOGY ...

    African Journals Online (AJOL)

    Frederick Iraki

    It is also claimed that with modern technology, the tendency toward enjoying computer systems in education has also increased and it has affected the way of learning. EFL points in EFL classes. It is believed that the computer and also information technology was introduced in language laboratories to improve the learners' ...

  7. More Technology, Less Learning?

    Science.gov (United States)

    Kulesza, Justin; DeHondt, Gerald, II.; Nezlek, George

    2011-01-01

    Modern information technologies (presentation software, wireless laptop computers, cell phones, etc.) are purported to enhance student learning. Research to date provides an ambivalent and often conflicting set of outcomes about the effectiveness of such technologies in the context of the college classroom. Anecdotal evidence further complicates…

  8. IT Department Technology Transfer

    CERN Multimedia

    Birker, D

    2004-01-01

    The objective of Technology Transfer (TT) at CERN is “to make known and available to third parties under agreed conditions, technical developments achieved in fulfi lling the laboratory’s mission in fundamental research”. The IT Department contributes to this objective by the transfer of technology, expertise and know-how to industry, universities, public institutions and the society at large.

  9. Science and Technology Policy

    DEFF Research Database (Denmark)

    Baark, Erik

    1996-01-01

    This paper examines the status of science and technology in Mongolia, and discusses the policy issues which have emerged with the transition to market economy in recent years.......This paper examines the status of science and technology in Mongolia, and discusses the policy issues which have emerged with the transition to market economy in recent years....

  10. Riding the Technology Wave.

    Science.gov (United States)

    Malan, Pierre

    This paper presents an overview of information technology development. The first section sets the scene, comparing the first WAN (Wide Area Network) and Intel processor to current technology. The birth of the microcomputer is described in the second section, including historical background on semiconductors, microprocessors, and the microcomputer.…

  11. Graphite technology development plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1986-07-01

    This document presents the plan for the graphite technology development required to support the design of the 350 MW(t) Modular HTGR within the US National Gas-Cooled Reactor Program. Besides descriptions of the required technology development, cost estimates, and schedules, the plan also includes the associated design functions and design requirements.

  12. Technologies for life

    International Nuclear Information System (INIS)

    Kerner, J.

    2006-01-01

    In this video-film technologies applied in the BIONT, a. s. are presented. Production of radionuclides and radiopharmaceuticals as well as principles of positron emission tomography and diagnostic using is explained. Other technologies implemented and planned in the Cyclotron Center of the Slovak Republic are presented.

  13. Church - Technology - Nuclear Power

    International Nuclear Information System (INIS)

    May, H.

    1982-01-01

    In order to cope with the problems causing a great deal of trouble today, i.e. with fear and with the ethical substantiation of technology, the author considers an integration model necessary which is to link science and technology and religion and philosophy. (RW) [de

  14. Assistive Technologies for Reading

    Science.gov (United States)

    Ruffin, Tiece M.

    2012-01-01

    Twenty-first century teachers working with diverse readers are often faced with the question of how to integrate technology in reading instruction that meets the needs of the techno-generation. Are today's teachers equipped with the knowledge of how to effectively use Assistive Technologies (AT) for reading? This position paper discusses AT for…

  15. VENTILATION TECHNOLOGY SYSTEMS ANALYSIS

    Science.gov (United States)

    The report gives results of a project to develop a systems analysis of ventilation technology and provide a state-of-the-art assessment of ventilation and indoor air quality (IAQ) research needs. (NOTE: Ventilation technology is defined as the hardware necessary to bring outdoor ...

  16. A Technology Enabled Journey

    Science.gov (United States)

    Devine, Pamela Albert

    2012-01-01

    This article features Point Road School, a pre-K-4 school in New Jersey that enhances student learning by integrating new and emerging technologies into the curriculum. Point Road School's technology story began in 1996 with a grant for a classroom modem so students could email their university literacy buddies. The New Jersey school has moved…

  17. TECHNOLOGICAL INNOVATIONS AND SOCIETY.

    Science.gov (United States)

    MORSE, DEAN; WARNER, AARON W.

    THE PAPERS AND DISCUSSIONS IN THIS BOOK REPRESENT THE DELIBERATIONS OF THE 1964-65 COLUMBIA SEMINAR OF TECHNOLOGY AND SOCIAL CHANGE IN WHICH, DURING REGULAR MONTHLY MEETINGS THROUGHOUT THE ACADEMIC YEAR, A DIVERSE GROUP OF PHYSICAL SCIENTISTS, SOCIAL SCIENTISTS, BUSINESS LEADERS, AND PUBLIC OFFICIALS ATTEMPED TO RELATE TECHNOLOGY TO INNOVATION AND…

  18. Danish SDHW Technology

    DEFF Research Database (Denmark)

    Furbo, Simon

    1996-01-01

    The status of Danish technology for solar heating systems for hot water supply as well as R&D work in the field is presented.......The status of Danish technology for solar heating systems for hot water supply as well as R&D work in the field is presented....

  19. Mechatronics and hybrid technologies

    DEFF Research Database (Denmark)

    2008-01-01

    R&D international contributions to control and design of novel intelligent mechatronic products and solutions with sensor- and actuator technology.......R&D international contributions to control and design of novel intelligent mechatronic products and solutions with sensor- and actuator technology....

  20. Emerging wind energy technologies

    DEFF Research Database (Denmark)

    Rasmussen, Flemming; Grivel, Jean-Claude; Faber, Michael Havbro

    2014-01-01

    This chapter will discuss emerging technologies that are expected to continue the development of the wind sector to embrace new markets and to become even more competitive.......This chapter will discuss emerging technologies that are expected to continue the development of the wind sector to embrace new markets and to become even more competitive....

  1. Rehabilitation Technology Review.

    Science.gov (United States)

    Hatherleigh Co., Ltd., New York, NY.

    Designed as a special continuing education program for rehabilitation professionals, this document is divided into five lessons. Lesson 1, "Technology Assessment: Determining the Needs" (Ricardo G. Cerna), includes discussion on technology assessment and determining the needs of the clients as well as different types of assistive…

  2. Nuclear safeguards technology handbook

    International Nuclear Information System (INIS)

    1977-12-01

    The purpose of this handbook is to present to United States industrial organizations the Department of Energy's (DOE) Safeguards Technology Program. The roles and missions for safeguards in the U.S. government and application of the DOE technology program to industry safeguards planning are discussed. A guide to sources and products is included

  3. Environmental science and technology

    Energy Technology Data Exchange (ETDEWEB)

    Manahan, S.E. [Univ. of Missouri, Columbia, MO (United States)

    1998-12-31

    This complete survey of modern environmental science covers the four traditional spheres of the environment: water, air, earth, and life, and introduces a fifth sphere -- the anthrosphere -- which the author defines as the sphere of human activities, especially technology, that affect the earth. The book discusses how technology can be used in a manner that minimizes environmental disruption.

  4. What Is Educational Technology?

    Science.gov (United States)

    Ingle, Henry T.

    1975-01-01

    Featured in this issue are the English translations of two speeches delivered to graduate students in educational technology at Pontificia Universidade, Porto Alegre, Brazil. Henry Ingle defines educational technology in the traditional as well as modern sense, describes its essential elements, and discusses situations in which the use of…

  5. Information technology ethics

    DEFF Research Database (Denmark)

    Hongladarom, Soraj; Ess, Charles

    This book was the first publication to take a genuinely global approach to the diverse ethical issues evoked by Information and Communication Technologies and their possible resolutions. Readers will gain a greater appreciation for the problems and possibilities of genuinely global information...... ethics, which are urgently needed as information and communication technologies continue their exponential growth...

  6. Discourses of Technology

    DEFF Research Database (Denmark)

    Sommer, Jannek K.; Knudsen, Gry Høngsmark

    technology products to explore the negotiation of the familiar and alien that makes consumers reject or embrace a new technology. Thus, this particular project sets out to analyze consumer discourses surrounding the Google Glass video “How it Feels [through Google Glass]” on YouTube, because we want...

  7. Assistive Technology (Moldinclud)

    OpenAIRE

    Luján Mora, Sergio

    2011-01-01

    Slides of the seminar "Assistive Technology" taught at the Institul de Stat de Instruire Continua (Chisinau, Moldova) in november 2011. Transparencias del seminario "Assistive Technology" impartido en el Institul de Stat de Instruire Continua (Chisinau, Moldavia) en noviembre 2011. Tempus project: MOLDINCLUD, Teaching Training Centre for Inclusive Education (TEMPUS 158980-2009).

  8. Educational Technology in Japan.

    Science.gov (United States)

    Sakamoto, Takashi

    1987-01-01

    This overview of the current state of educational technology in Japan includes discussions of professional associations; academic and popular journals; diffusion of media and the budget in elementary and secondary schools; recent trends in government policies; educational technology research; a literature review; and suggestions of future trends.…

  9. Arts and Technology

    DEFF Research Database (Denmark)

    This book constitutes the thoroughly refereed post-conference proceedings of the Second International Conference on Arts and Technology, ArtsIT 2011, which was held in December 2011 in Esbjerg, Denmark. The 19 revised full papers and the two poster papers cover various topics such as Interaction...... and Art, Music and Performance, and Digital Technology....

  10. Implementation of Emerging Technologies

    DEFF Research Database (Denmark)

    Barba, F. J.; Orlien, Vibeke; Mota, Maria J.

    2016-01-01

    resources. Lastly, studies with specific examples of the implementation of these novel processing technologies in food industry are described, focusing on the application of high-pressure processing and pulsed electric fields to orange juice, milk, and oysters. Higher implementation costs were observed...... electric fields, ohmic heating, microwave, and ultrasound) emerging technologies are briefly reviewed. Most of these technologies have found niche applications in the food industry, replacing or complementing conventional preservation technologies. Thereby, data on commercialization, energy, and microbial......Novel processing technologies have been gaining interest among food researchers due to their lower impact on nutritional and sensory properties of the products compared to the conventional thermal techniques. In this chapter some of the most well-studied (eg, high-pressure processing, pulsed...

  11. Technology research and development

    International Nuclear Information System (INIS)

    Haas, G.M.; Abdov, M.A.; Baker, C.C.; Beuligmann, R.F.

    1985-01-01

    The U.S. Dept. of Energy discusses the new program plan, the parameters of which are a broad scientific and technology knowledge base, an attractive plasma configuration to be determined, and other issues concerning uncertainty as to what constitutes attractive fusion options to be determined in the future, and increased collaboration. Tables show changing directions in magnetic fusion energy, two examples of boundary condition impacts on long-term technology development, and priority classes of the latter. The Argonne National Laboratory comments on the relationship between science, technology and the engineering aspects of the fusion program. UCLA remarks on the role of fusion technology in the fusion program plan, particularly on results from the recent studies of FINESSE. General Dynamics offers commentary on the issues of a reduced budget, and new emphasis on science which creates an image of the program. A table illustrates technology research and development in the program plan from an industrial perspective

  12. Technology in L1

    DEFF Research Database (Denmark)

    Elf, Nikolaj Frydensbjerg; Hanghøj, Thorkild; Skaar, Håvard

    2015-01-01

    -of-school literacy practices. A final finding is the emphasis on teacher uncertainty regarding how and why to integrate technology within existing paradigms of the subject. This calls for further research on how technology may be justified in L1 practice, including various forms of teacher education.......In recent decades, several Scandinavian research projects have had an explicit focus on how technology intervenes in L1 (or so-called Mother Tongue Education) practices in Swedish, Norwegian and Danish educational contexts, and how this may impact on understanding of the subject. There is currently...... no systematic overview of the documented possibilities and challenges related to the use of technology in L1. At the same time, there is terminological confusion in use of ‘technology’ and related concepts in L1. Finally, there is a general lack of critical reflection on the relation between technological...

  13. Industrial technology transfer

    International Nuclear Information System (INIS)

    Bulger, W.

    1982-06-01

    The transfer of industrial technology is an essential part of the CANDU export marketing program. Potential customers require the opportunity to become self-sufficient in the supply of nuclear plant and equipment in the long term and they require local participation to the maximum extent possible. The Organization of CANDU Industries is working closely with Atomic Energy of Canada Ltd. in developing comprehensive programs for the transfer of manufacturing technology. The objectives of this program are: 1) to make available to the purchasing country all nuclear component manufacturing technology that exists in Canada; and 2) to assure that the transfer of technology takes place in an efficient and effective way. Technology transfer agreements may be in the form of joint ventures or license agreements, depending upon the requirements of the recipient

  14. Designing Human Technologies

    DEFF Research Database (Denmark)

    Simonsen, Jesper

    Research Initiative supporting Roskilde University’s new Humanities and Technology bachelor programme (‘HumTek’), and its three dimensions: Design, Humanities, and Technology. The research initiative involves 70 researchers from different departments and research groups at Roskilde University through...... a shared interdisciplinary research and educational collaboration. As a creative research initiative it focuses on change and innovative thinking. The innovativeness is a result of the strongly interdisciplinary perspective which is at the heart of Designing Human Technologies. Designing Human Technologies......Design is increasingly becoming a part of the university curriculum and research agenda. The keynote present and discuss Designing Human Technologies – an initiative aiming at establishing a design oriented main subject area alongside traditional main subject areas such as Natural Science...

  15. Art, Technology and Nature

    DEFF Research Database (Denmark)

    Since 1900, the connections between art and technology with nature have become increasingly inextricable. Through a selection of innovative readings by international scholars, this book presents the first investigation of the intersections between art, technology and nature in post-medieval times....... Transdisciplinary in approach, this volume’s 14 essays explore art, technology and nature’s shifting constellations that are discernible at the micro level and as part of a larger chronological pattern. Included are subjects ranging from Renaissance wooden dolls, science in the Italian art academies, and artisanal...... Camilla Skovbjerg Paldam and Jacob Wamberg trace the Kantian heritage of radically separating art and technology, and inserting both at a distance to nature, suggesting this was a transient chapter in history. Thus, they argue, the present renegotiation between art, technology and nature is reminiscent...

  16. Fusion technology programme

    International Nuclear Information System (INIS)

    Finken, D.

    1984-04-01

    KfK participates to the Fusion Technology Programme of the European Community. Most of the work in progress addresses the Next European Torus (NET) and the long term technology aspects as defined in the 82/86 programme. A minor part serves to preparation of future contributions and to design studies on fusion concepts in a wider perspective. The Fusion Technology Programme of Euratom covers mainly aspects of nuclear engineering. Plasma engineering, heating, refueling and vacuum technology are at present part of the Physics Programme. In view of NET, integration of the different areas of work will be mandatory. KfK is therefore prepared to address technical aspects beyond the actual scope of the physics experiments. The technology tasks are reported project wise under title and code of the Euratom programme. Most of the projects described here are shared with other European fusion laboratories as indicated in the table annexed to this report. (orig./GG)

  17. Energy and technology review

    International Nuclear Information System (INIS)

    Quirk, W.J.; Bookless, W.A.

    1994-05-01

    The Lawrence Livermore National Laboratory, operated by the University of California for the United States Department of Energy, was established in 1952 to do research on nuclear weapons and magnetic fusion energy. Since then, in response to new national needs, we have added other major programs, including technology transfer, laser science (fusion, isotope separation, materials processing), biology and biotechnology, environmental research and remediation, arms control and nonproliferation, advanced defense technology, and applied energy technology. These programs, in turn, require research in basic scientific disciplines, including chemistry and materials science, computing science and technology, engineering, and physics. The Laboratory also carries out a variety of projects for other federal agencies. Energy and Technology Review is published monthly to report on unclassified work in all our programs. This issue reviews work performed in the areas of modified retoring for waste treatment and underground stripping to remove contamination

  18. Globalization and Technology

    Directory of Open Access Journals (Sweden)

    Traian-Alexandru Miu

    2016-01-01

    Full Text Available Globalization, very complex phenomenon, involves overcoming the barriers between different states, which allowed the rapid transfer of capital, technology, information, and the "toxins" from one country to another. First, the technology formed the basis of rapid expansion of great ideas promoted by globalization. Undeniable progress in the field of technology and science, has conferred to the man extraordinary powers that have been used most often to the detriment of his spiritual progress. We must not deny that science and technology have brought many benefits to human, and he could expand the knowledge horizon upon the world in which he lives, exploiting information acquired and share them with others. Science and technology must become for postmodern man ways of talk and communion between human and divinity, all to the praise of God and the perfection of the creature.

  19. Working around technologies

    DEFF Research Database (Denmark)

    Dupret, Katia

    2017-01-01

    expressions of professionals’ active encounter with the complexity of work situations, and can therefore be important signs of professional ethical judgement. Drawing on science and technology studies and the concept of invisible work, the study discusses workaround situations that arise in health care work......This study discusses how professionalism and work ethics influence how health care professionals work around new technologies. When people avoid using technologies, they are not necessarily ceasing to engage in their work activities. The workaround strategies presented here are rather practical...... in Denmark. The aim and contribution of the study is twofold. First, it attempts to revitalise the discussion on technology workaround strategies as responsible professionalism. Second, it will direct attention to and contribute to an understanding of how the normativity embedded in technological development...

  20. Interpretation of Internet technology

    DEFF Research Database (Denmark)

    Madsen, Charlotte Øland

    2001-01-01

    Research scope: The topic of the research project is to investigate how new internet technologies such as e-trade and customer relation marketing and management are implemented in Danish food processing companies. The aim is to use Weick's (1995) sensemaking concept to analyse the strategic...... processes leading to the use of internet marketing technologies and to investigate how these new technologies are interpreted into the organisation. Investigating the organisational socio-cognitive processes underlying the decision making processes will give further insight into the socio......-cognitive competencies of organisations (Rindova & Fombrunn, 1999). The aim is to contribute to the existing technological implementation theory complex by studying the relationships between the elements of the socio-cognitive processes and the resulting interpretations and actions when new technologies are implemented...

  1. 2017 Annual Technology Baseline

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Wesley J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hand, M. M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Eberle, Annika [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Beiter, Philipp C [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kurup, Parthiv [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Turchi, Craig S [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Feldman, David J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Margolis, Robert M [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Augustine, Chad R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Maness, Michael [Formerly NREL; O' Connor, Patrick [Oak Ridge National Laboratory

    2018-03-26

    Consistent cost and performance data for various electricity generation technologies can be difficult to find and may change frequently for certain technologies. With the Annual Technology Baseline (ATB), the National Renewable Energy Laboratory annually provides an organized and centralized set of such cost and performance data. The ATB uses the best information from the Department of Energy national laboratories' renewable energy analysts as well as information from the Energy Information Administration for fuel-based technologies. The ATB has been reviewed by experts and it includes the following electricity generation technologies: land-based wind, offshore wind, utility-scale solar photovoltaics (PV), commercial-scale solar PV, residential-scale solar PV, concentrating solar power, geothermal power, hydropower, coal, natural gas, nuclear, and conventional biopower. This webinar presentation introduces the 2017 ATB.

  2. Technology and Sport

    DEFF Research Database (Denmark)

    Møller, Rasmus Bysted; Møller, Verner

    2015-01-01

    The relationship between sport and technology is close and can be both fruitful and destructive. Technology has a constitutive function in sport as it makes the activity possible and it can enhance performance as well as the sporting experience. The use of football boots is clearly more comfortable...... and effective than playing in bare feet in a game of football. However, sport challenges its athletes by demanding the employment of less efficient means rather than more efficient means in pursuit of sport specific goals. Therefore technology can potentially subtract from the sporting experience and even...... has long been a heated topic and with gene technology waiting around the corner the relationship between sport and technology has become strained and is more and more often viewed as problematic rather than benign. In this chapter we follow up on this trend by exposing what we consider a tendency...

  3. Accelerator technology in tokamaks

    International Nuclear Information System (INIS)

    Kustom, R.L.

    1977-01-01

    This article presents the similarities in the technology required for high energy accelerators and tokamak fusion devices. The tokamak devices and R and D programs described in the text represent only a fraction of the total fusion program. The technological barriers to producing successful, economical tokamak fusion power plants are as many as the plasma physics problems to be overcome. With the present emphasis on energy problems in this country and elsewhere, it is very likely that fusion technology related R and D programs will vigorously continue; and since high energy accelerator technology has so much in common with fusion technology, more scientists from the accelerator community are likely to be attracted to fusion problems

  4. Technology for Peacebuilding

    Directory of Open Access Journals (Sweden)

    Helena Puig Larrauri

    2013-11-01

    Full Text Available New technologies are changing how and when we learn about events and choose to respond to them. Mobile phones and the internet have altered how we engage with the world. With technology usage expanding rapidly in the developing world, new avenues of participation, engagement, and accountability are emerging. Globally, more people now have the opportunity to actively make use of these tools to participate in processes that impact their societies. This opportunity for participation is also an opportunity for engaging in new ways with peacebuilding processes. As the field of technology for peacebuilding grows, most attention has been paid to the potential of new technologies for bridging the gap between warning and response. Whilst the focus on the use of technology for early warning and response is important, there is more to this growing field. The empowerment of people to participate in localized conflict management efforts is one of the most significant innovations and opportunities created by new technologies. Technology can contribute to peacebuilding processes by offering tools that foster collaboration, transform attitudes, and give a stronger voice to communities. This article aims to give practitioners two related frameworks to understand how new technologies can enhance peacebuilding. The first section looks at the functions that technology can have in a peacebuilding program as a tool for data processing, communication, engagement, and gaming. We then examine the program areas that new technologies can best contribute to, covering early warning/early response systems, programs that allow citizens to voice their opinions and experiences, collaboration efforts, and programs aimed at transforming attitudes.

  5. Excursions in technology policy

    Science.gov (United States)

    Archibald, Robert B.

    1995-01-01

    This technical report presents a summary of three distinct projects: (1) Measuring economic benefits; (2) Evaluating the SBIR program; and (3) A model for evaluating changes in support for science and technology. the first project deals with the Technology Applications Group (TAG) at NASA Langley Research Center. The mission of TAG is to assist firms interested in commercializing technologies. TAG is a relatively new group as is the emphasis on technology commercialization for NASA. One problem faced by TAG and similar groups at other centers is measuring their effectiveness. The first project this summer, a paper entitled, 'Measuring the Economic Benefits of Technology Transfer from a National Laboratory: A Primer,' focused on this measurement problem. We found that the existing studies of the impact of technology transfer on the economy were conceptually flawed. The 'primer' outlines the appropriate theoretical framework for measuring the economic benefits of technology transfer. The second project discusses, one of the programs of TAG, the Small Business Innovation Research (SBIR) program. This program has led to over 400 contracts with Small Business since its inception in 1985. The program has never been evaluated. Crucial questions such as those about the extent of commercial successes from the contracts need to be answered. This summer we designed and implemented a performance evaluation survey instrument. The analysis of the data will take place in the fall. The discussion of the third project focuses on a model for evaluating changes in support for science and technology. At present several powerful forces are combining to change the environment for science and technology policy. The end of the cold war eliminated the rationale for federal support for many projects. The new- found Congressional conviction to balance the budget without tax increases combined with demographic changes which automatically increase spending for some politically popular programs

  6. Communication technology update and fundamentals

    CERN Document Server

    Grant, August E

    2010-01-01

    New communication technologies are being introduced at an astonishing rate. Making sense of these technologies is increasingly difficult. Communication Technology Update and Fundamentals is the single best source for the latest developments, trends, and issues in communication technology. Featuring the fundamental framework along with the history and background of communication technologies, Communication Technology Update and Fundamentals, 12th edition helps you stay ahead of these ever-changing and emerging technologies.As always, every chapter ha

  7. United States advanced technologies

    International Nuclear Information System (INIS)

    Longenecker, J.R.

    1985-01-01

    In the United States, the advanced technologies have been applied to uranium enrichment as a means by which it can be assured that nuclear fuel cost will remain competitive in the future. The United States is strongly committed to the development of advanced enrichment technology, and has brought both advanced gas centrifuge (AGC) and atomic vapor laser isotope separation (AVLIS) programs to a point of significant technical refinement. The ability to deploy advanced technologies is the basis for the confidence in competitive future price. Unfortunately, the development of advanced technologies is capital intensive. The year 1985 is the key year for advanced technology development in the United States, since the decision on the primary enrichment technology for the future, AGC or AVLIS, will be made shortly. The background on the technology selection process, the highlights of AGC and AVLIS programs and the way to proceed after the process selection are described. The key objective is to maximize the sales volume and minimize the operating cost. This will help the utilities in other countries supply low cost energy on a reliable, long term basis. (Kako, I.)

  8. Technology and medicine.

    Science.gov (United States)

    Booth, C

    1985-05-22

    Technology, which is older than science, has been of vital importance in the development of modern medicine. Even so, there are voices of dissent to be heard. The disenchantment with technology expressed by Aldous Huxley in Brave new world has been echoed by contemporary writers on the technology of modern medicine. Medicine is seen by some to have been dehumanized by technology, and techniques that are expensive are thought to be consuming a greater proportion of health resources than they deserve. The practice of medicine has, nevertheless, been transformed by modern technology and diagnostic techniques and therapeutic measures undreamed of a few short decades ago are now commonplace. There is no reason why these developments should be any more dehumanizing than the use of similar techniques in modern transportation or communication, nor is their expense out of proportion when compared with other demands on the nation's purse. British workers have been at the forefront of many recent advances. Yet, even though the National Health Service provides a ready market for the products of British medical technology, the nation depends to an inordinate degree on imported products. In the development of appropriate medical technology there is an urgent need for better communication between inventors, scientists, industrialists and the National Health Service. At the same time there is an equal need for improved evaluation of untried techniques. The pressure for a central integrating body to coordinate resources could well be supported by the establishment of evaluation units in the different health authorities in this country.

  9. The technology vicinity: a location based view on technology

    NARCIS (Netherlands)

    Steenhuis, H.J.; de Bruijn, E.J.; Kocaoglu, D.F.; Anderson, T.R.

    2001-01-01

    The issue of technology transfer has been viewed from many different perspectives. In this case the focus is on the process of (production) technology transfer. One of the difficulties in studying international technology transfer is the definition of technology. The many technology definitions that

  10. COPPER CABLE RECYCLING TECHNOLOGY

    International Nuclear Information System (INIS)

    Chelsea Hubbard

    2001-01-01

    The United States Department of Energy (DOE) continually seeks safer and more cost-effective technologies for use in deactivation and decommissioning (D and D) of nuclear facilities. The Deactivation and Decommissioning Focus Area (DDFA) of the DOE's Office of Science and Technology (OST) sponsors large-scale demonstration and deployment projects (LSDDPs). At these LSDDPs, developers and vendors of improved or innovative technologies showcase products that are potentially beneficial to the DOE's projects and to others in the D and D community. Benefits sought include decreased health and safety risks to personnel and the environment, increased productivity, and decreased costs of operation. The Idaho National Engineering and Environmental Laboratory (INEEL) generated a list of statements defining specific needs and problems where improved technology could be incorporated into ongoing D and D tasks. One such need is to reduce the volume of waste copper wire and cable generated by D and D. Deactivation and decommissioning activities of nuclear facilities generates hundreds of tons of contaminated copper cable, which are sent to radioactive waste disposal sites. The Copper Cable Recycling Technology separates the clean copper from contaminated insulation and dust materials in these cables. The recovered copper can then be reclaimed and, more importantly, landfill disposal volumes can be reduced. The existing baseline technology for disposing radioactively contaminated cables is to package the cables in wooden storage boxes and dispose of the cables in radioactive waste disposal sites. The Copper Cable Recycling Technology is applicable to facility decommissioning projects at many Department of Energy (DOE) nuclear facilities and commercial nuclear power plants undergoing decommissioning activities. The INEEL Copper Cable Recycling Technology Demonstration investigated the effectiveness and efficiency to recycle 13.5 tons of copper cable. To determine the effectiveness

  11. Emergent technologies: 25 years

    Science.gov (United States)

    Rising, Hawley K.

    2013-03-01

    This paper will talk about the technologies that have been emerging over the 25 years since the Human Vision and Electronic Imaging conference began that the conference has been a part of, and that have been a part of the conference, and will look at those technologies that are emerging today, such as social networks, haptic technologies, and still emerging imaging technologies, and what we might look at for the future.Twenty-five years is a long time, and it is not without difficulty that we remember what was emerging in the late 1980s. Yet to be developed: The first commercial digital still camera was not yet on the market, although there were hand held electronic cameras. Personal computers were not displaying standardized images, and image quality was not something that could be talked about in a standardized fashion, if only because image compression algorithms were not standardized yet for several years hence. Even further away were any standards for movie compression standards, there was no personal computer even on the horizon which could display them. What became an emergent technology and filled many sessions later, image comparison and search, was not possible, nor the current emerging technology of social networks- the world wide web was still several years away. Printer technology was still devising dithers and image size manipulations which would consume many years, as would scanning technology, and image quality for both was a major issue for dithers and Fourier noise.From these humble beginnings to the current moves that are changing computing and the meaning of both electronic devices and human interaction with them, we will see a course through the changing technology that holds some features constant for many years, while others come and go.

  12. Digital security technology simplified.

    Science.gov (United States)

    Scaglione, Bernard J

    2007-01-01

    Digital security technology is making great strides in replacing analog and other traditional security systems including CCTV card access, personal identification and alarm monitoring applications. Like any new technology, the author says, it is important to understand its benefits and limitations before purchasing and installing, to ensure its proper operation and effectiveness. This article is a primer for security directors on how digital technology works. It provides an understanding of the key components which make up the foundation for digital security systems, focusing on three key aspects of the digital security world: the security network, IP cameras and IP recorders.

  13. Buildings Energy Technology

    Energy Technology Data Exchange (ETDEWEB)

    Cason, D.L.; Emmanuel, L. [eds.

    1996-11-01

    BET announces on a monthly basis current worldwide information available on the technology required for economic energy conservation in buildings and communities. It contains abstracts of DOE reports, journal articles, conference papers,patents,theses, and monographs added to the Energy Science and Technology Database during the past month. Also included are US information obtained through acquisition programs or interagency agreements and international information obtained through IEA`s Energy Technology Data Exchange or government- to-government agreements. The citations are available for online searching and retrieval; current information, added daily, is available to DOE and its contractors.

  14. Information Technology Service

    International Nuclear Information System (INIS)

    Ageron, M.; Boninchi, V.; Chartoire, M.; Combroux, A.; Giraud, N.; Jacquet, G.; Lagrange, B.; Malleret, S.; Martin, C.; Mas, J.; Morgue, M.; Ollivier, T.

    1998-01-01

    The information technology service works out the choices concerning the information technology systems of general use in the laboratory: computers, network, peripherals, workstations, software. It intervenes at the same time in the definition of the procedures and equipment specific to the research groups. The entire data acquisition is centralized by the service. The personnel is sharing the following two large directions of activities: - management of information technology park (setup, configuration and maintenance of the materials and soft ensemble, training and assistance afforded to users); - participation in software projects either in elaboration of applications or in realization and maintenance of specific tools

  15. Educational technology, reimagined.

    Science.gov (United States)

    Eisenberg, Michael

    2010-01-01

    "Educational technology" is often equated in the popular imagination with "computers in the schools." But technology is much more than merely computers, and education is much more than mere schooling. The landscape of child-accessible technologies is blossoming in all sorts of directions: tools for communication, for physical construction and fabrication, and for human-computer interaction. These new systems and artifacts allow educational designers to think much more creatively about when and where learning takes place in children's lives, both within and outside the classroom.

  16. ACCELERATING NANO-TECHNOLOGICAL

    DEFF Research Database (Denmark)

    Jensen, Jens Stissing; Koch, Christian

    2007-01-01

    By viewing the construction industry as a technological innovation system (TIS) this paper discusses possible initiatives to accelerate nanotechnological innovations. The point of departure is a recent report on the application of nano-technology in the Danish construction industry, which concludes...... of the system are furthermore poorly equipped at identifying potentials within high-tech areas. In order to exploit the potentials of nano-technology it is thus argued that an alternative TIS needs to be established. Initiatives should identify and support “incubation rooms” or marked niches in order...

  17. Bridge technology report

    CERN Document Server

    2013-01-01

    Please note this is a Short Discount publication. As LANs have proliferated, new technologies and system concepts have come to the fore. One of the key issues is how to interconnect networks. One means of interconnection is to use a 'bridge'. Other competing technologies are repeaters, routers, and gateways. Bridges permit traffic isolation, connect network segments together and operate at the MAC layer. Further, because they operate at the MAC layer, they can handle a variety of protocols such as TCP/IP, SNA, and X.25. This report focuses on the specific technology of bridging two netw

  18. Calculations in furnace technology

    CERN Document Server

    Davies, Clive; Hopkins, DW; Owen, WS

    2013-01-01

    Calculations in Furnace Technology presents the theoretical and practical aspects of furnace technology. This book provides information pertinent to the development, application, and efficiency of furnace technology. Organized into eight chapters, this book begins with an overview of the exothermic reactions that occur when carbon, hydrogen, and sulfur are burned to release the energy available in the fuel. This text then evaluates the efficiencies to measure the quantity of fuel used, of flue gases leaving the plant, of air entering, and the heat lost to the surroundings. Other chapters consi

  19. Technology transfer and innovation

    International Nuclear Information System (INIS)

    Ashworth, Graham; Thornton, Anna

    1987-01-01

    The aims of the conference were advice, assistance and action for all those with technology to licence or inventions to patent, and for people seeking financial help and advice. There was a free exchange of ideas and information. Of the forty or so papers collected together, many are concerned with the financial aspects of new ventures, others look at technology transfer from academic institutes and schemes which support technological problems. One paper on fast reactor collaboration in Europe, is indexed separately. (U.K.)

  20. Fusion technology programme

    International Nuclear Information System (INIS)

    Finken, D.

    1985-05-01

    In the current Fusion Technology Programme of the European Community the KfK association is working at present on 16 R and D contracts. Most of the work is strongly oriented towards the Next European Torus. Direct support to NET is given by three KfK delegates being member of the NET study group. In addition to the R and D contracts the association is working on 11 NET study contracts. Though KfK contributes to all areas defined in fusion technology, the main emphasis is put on superconducting magnet and breeding blanket development. Other important fields are tritium technology, materials research, and remote handling. (orig./GG)