
Sample records for technology assessment ta

  1. Social shaping of technology in TA and HTA

    DEFF Research Database (Denmark)

    Clausen, Christian; Yoshinaka, Yutaka


    The paper discusses how the social shaping of technology (SST) approach may be useful in understanding the role played by technology assessment within the context of technological development and change. It is proposed that an SST perspective on TA (or HTA) yields particular insight, regardless...... of whether or not the TA activity bases itself on a social shaping understanding of technology. This is because SST addresses the socially negotiated character of technological development, where TA itself may be construed as an element influencing the process of such negotiation. At the same time, TA...... is a construction, that is, itself a product of negotiations involving social actors. Thus, an understanding that TA is socially shaped, and is involved in the shaping of technology, opens up for a perspective on TA as both entailing constraints and enablements within the context of the particular agenda...

  2. Engineering Mathematics Assessment Using "MapleTA" (United States)

    Jones, Ian S.


    The assessment of degree level engineering mathematics students using the computer-aided assessment package MapleTA is discussed. Experience of academic and practical issues for both online coursework and examination assessments is presented, hopefully benefiting other academics in this novel area of activity. (Contains 6 figures and 1 table.)

  3. Ta Keo Temple Reconstruction Based on Terrestrial Laser Scanning Technology (United States)

    Xi, X.; Wang, C.; Wan, Y. P.; Khuon, K. N.


    Ta Keo temple is one of the very famous temple complex of Angkor Wat in northwestern Cambodia. It has been suffering massive collapse and other serious damages in recent years. Nowadays, Terrestrial Laser Scanning(TLS) technology is considered as a wellestablished resource for heritage documentation and protection (Lerma et al, 2008; Reshetyuk, 2009). This paper used TLS to reconstruct Ta Keo Temple. Firstly, we acquired 71 scanning stations of points cloud data with high density and high accuracy, and over one thousand images with high spatial resolution about the temple. Secondly, the raw points cloud data were denoised, reduced and managed efficiently, and registrated using an adjusted ICP algorithm. Thirdly, a triangulation method was used to model most objects. At last, we mapped the texture data into the digital model and a 3-D model of Ta Keo with high accuracy was achieved. The authors focus on large object reconstruction by TLS technology, and pay much attention to the scanning design, multi-station data and the whole project's data registration, and texture mapping and so on. The research result will be useful for Ta Keo restoration, reconstruction and protection. Also, it is a good reference source for large complex buildings reconstruction when using terrestrial laser scanning technology.

  4. Thermodynamic assessment of the Si-Ta system

    Energy Technology Data Exchange (ETDEWEB)

    Drouelle, I., E-mail: [Laboratoire de Physicochimie de l' Etat Solide, ICMMO, Universite de Paris-Sud, 91405 Orsay Cedex (France); Servant, C. [Laboratoire de Physicochimie de l' Etat Solide, ICMMO, Universite de Paris-Sud, 91405 Orsay Cedex (France)


    Highlights: Black-Right-Pointing-Pointer The thermodynamic modelling of the Si-Ta system is made with the CALPHAD method. Black-Right-Pointing-Pointer The liquid and bcc phases are treated with a solution model and compounds as stoichiometric. Black-Right-Pointing-Pointer The excess Gibbs energy of the solution phases is assessed with the T dependence by Kaptay. Black-Right-Pointing-Pointer The calculations based on the thermodynamic optimisation agree well with the experiments. - Abstract: The thermodynamic modeling of the silicon-tantalum binary system was carried out with the help of the CALPHAD (CALculation of PHAse Diagram) method. A solution model was used for the description of the liquid and bcc phases while the Si{sub 2}Ta, Si{sub 3}Ta{sub 5L}T, Si{sub 3}Ta{sub 5H}T SiTa{sub 2} and SiTa{sub 3} compounds are treated as stoichiometric. The excess Gibbs energy function of the solution phases was assessed with the recent exponential temperature dependence of the interaction parameters by Kaptay [1-3] and compared with the Redlich-Kister [4] polynomial equation results. The calculations based on the thermodynamic modeling are in good agreement with the phase diagram data and experimental thermodynamic values available in literature.

  5. Interactive Technology Assessment in the Real World

    NARCIS (Netherlands)

    Marris, Claire; Joly, Pierre-Benoit; Rip, Arie


    Participatory Technology Assessment (pTA) initiatives have usually been analyzed as if they existed in a social and political vacuum. This article analyzes the linkages that occur, in both directions, between the microcosm set up by a pTA exercise and the real world outside. This dual-dynamics persp

  6. Interactive technology assessment and wide reflective equilibrium.

    NARCIS (Netherlands)

    Reuzel, R.P.B.; Wilt, G.J. van der; Have, H.A.M.J. ten; Vries Robbé, P.F. de


    Interactive technology assessment (iTA) provides an answer to the ethical problem of normative bias in evaluation research. This normative bias develops when relevant perspectives on the evaluand (the thing being evaluated) are neglected. In iTA this bias is overcome by incorporating different persp

  7. Seismic assessment of Technical Area V (TA-V).

    Energy Technology Data Exchange (ETDEWEB)

    Medrano, Carlos S.


    The Technical Area V (TA-V) Seismic Assessment Report was commissioned as part of Sandia National Laboratories (SNL) Self Assessment Requirement per DOE O 414.1, Quality Assurance, for seismic impact on existing facilities at Technical Area-V (TA-V). SNL TA-V facilities are located on an existing Uniform Building Code (UBC) Seismic Zone IIB Site within the physical boundary of the Kirtland Air Force Base (KAFB). The document delineates a summary of the existing facilities with their safety-significant structure, system and components, identifies DOE Guidance, conceptual framework, past assessments and the present Geological and Seismic conditions. Building upon the past information and the evolution of the new seismic design criteria, the document discusses the potential impact of the new standards and provides recommendations based upon the current International Building Code (IBC) per DOE O 420.1B, Facility Safety and DOE G 420.1-2, Guide for the Mitigation of Natural Phenomena Hazards for DOE Nuclear Facilities and Non-Nuclear Facilities.

  8. TA-54 (Area G) Risk Assessment from Extreme Wildfire Scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Linn, Rodman Ray [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Koo, Eunmo [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Honig, Kristen Ann [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); White, Judith [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Funk, David John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Los Alamos National Laboratory (LANL) and surrounding areas have been exposed to at least four significant wildfires since 1977 and there have been numerous others within 50 miles of LANL. Based on this history, wildfires are considered a risk to LANL facilities and their contents. While many LANL facilities are at risk to wildfire to some degree, they are found in a wide variety of conditions, thus they have varying sensitivities to wildfires. Additionally, LANL facilities have various functions and different assets, so they have a wide range of values or consequences if compromised. Therefore, determining the risks and precautions that are warranted to mitigate these risks must be done on a case-by-case basis. In an effort to assess possible wildfire risks to sensitive materials stored in a Perma-Con® in dome TA-54-0375, a conventional fire risk analysis was performed. This conventional risk analysis is documented in Engineering Evaluation Form AP-FIRE-001-FM1, which is dated 9/28/2015 and was titled ‘Wildland Fire Exposure Evaluation for Building TA-54-0375’ (Hall 2015). This analysis acknowledged that there was significant chance of wildfire in the vicinity of TA-54-0375, but the amount of combustible material surrounding the building was deemed low. The wildland fuels that were closest to the building were largely fine fuels and were not expected to have significant duration of heat release. The prevailing winds at this location are from the south and southwest and the nearest significant upwind fuels (tree crowns or unmown grasses) are at least 300 feet away. Based on these factors the conventional wildland fire risk to TA-54-0375 was deemed minimal, “Acceptable As Is, No Action Required.” This risk evaluation was based on a combined assessment of low probability of wildfires arriving at the site from other directions (where higher fuel loadings might be present) as well as the effective setback of fuels in the direction that fire is

  9. 78 FR 41954 - TA-W-82,634, Prudential Global Business Technology Solutions Central Security Services Dresher... (United States)


    ... Employment and Training Administration TA-W-82,634, Prudential Global Business Technology Solutions Central Security Services Dresher, Pennsylvania; TA-W-82,634A, Prudential Global Business Technology Solutions Central Security Services Iselin, New Jersey; TA-W-82,634B, Prudential Global Business...

  10. CRED REA Coral Health and Disease Assessment at Ta'u Island, American Samoa in 2008 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Coral health and disease assessments were conducted along 2 consecutively placed 25-m transects, as part of Rapid Ecological Assessments conducted at 9 sites at Ta'u...

  11. Mechanisms of Low-Temperature Nitridation Technology on a TaN Thin Film Resistor for Temperature Sensor Applications. (United States)

    Chen, Huey-Ru; Chen, Ying-Chung; Chang, Ting-Chang; Chang, Kuan-Chang; Tsai, Tsung-Ming; Chu, Tian-Jian; Shih, Chih-Cheng; Chuang, Nai-Chuan; Wang, Kao-Yuan


    In this letter, we propose a novel low-temperature nitridation technology on a tantalum nitride (TaN) thin film resistor (TFR) through supercritical carbon dioxide (SCCO2) treatment for temperature sensor applications. We also found that the sensitivity of temperature of the TaN TFR was improved about 10.2 %, which can be demonstrated from measurement of temperature coefficient of resistance (TCR). In order to understand the mechanism of SCCO2 nitridation on the TaN TFR, the carrier conduction mechanism of the device was analyzed through current fitting. The current conduction mechanism of the TaN TFR changes from hopping to a Schottky emission after the low-temperature SCCO2 nitridation treatment. A model of vacancy passivation in TaN grains with nitrogen and by SCCO2 nitridation treatment is eventually proposed to increase the isolation ability in TaN TFR, which causes the transfer of current conduction mechanisms.

  12. Beyond checklists: toward an ethical-constructive technology assessment

    NARCIS (Netherlands)

    Kiran, Asle; Oudshoorn, Nelly E.J.; Verbeek, Peter P.C.C.


    While many technology assessments (TAs) formally conducted by TA organizations in Europe and the USA have examined the implications of new technologies for ‘quantifiable risks’ regarding safety, health or the environment, they have largely ignored the ethical implications of those technologies.

  13. Problems of method of technology assessment. A methodological analysis; Methodenprobleme des Technology Assessment; Eine methodologische Analyse

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, V.


    The study undertakes to analyse the theoretical and methodological structure of Technology Assessment (TA). It is based on a survey of TA studies which provided an important condition for theoreticall sound statements on methodological aspects of TA. It was established that the main basic theoretical problems of TA are in the field of dealing with complexity. This is also apparent in the constitution of problems, the most elementary and central approach of TA. Scientifically founded constitution of problems and the corresponding construction of models call for interdisciplinary scientific work. Interdisciplinarity in the TA research process is achieved at the level of virtual networks, these networks being composed of individuals suited to teamwork. The emerging network structures have an objective-organizational and an ideational basis. The objective-organizational basis is mainly the result of team composition and the external affiliations of the team members. The ideational basis of the virtual network is represented by the team members` mode of thinking, which is individually located at a multidisciplinary level. The theoretical `skeleton` of the TA knowledge system, which is represented by process knowledge based linkage structures, can be generated and also processed in connection with the knowledge on types of problems, areas of analysis and procedures to deal with complexity. Within this process, disciplinary knowledge is a necessary but not a sufficient condition. Metatheoretical and metadisciplinary knowledge and the correspondingly processes complexity of models are the basis for the necessary methodological awareness, that allows TA to become designable as a research procedure. (orig./HP) [Deutsch] Die Studie stellt sich die Aufgabe, die theoretische und methodische Struktur des Technology Assessment (TA) zu analysieren. Sie fusst auf Erhebungen, die bei Technology-Assessment-Studien vorgenommen wurden und die wesentliche Voraussetzungen fuer

  14. Combined experimental and theoretical assessments of the lattice dynamics and optoelectronics of TaON and Ta3N5

    KAUST Repository

    Nurlaela, Ela


    Presented herein is a detailed discussion of the properties of the lattice dynamic and optoelectronic properties of tantalum(V) oxynitride (TaON) and tantalum(V) nitride (Ta3N5), from experimental and theoretical standpoint. The active Raman and infra red (IR) frequencies of TaON and Ta3N5 were measured using confocal Raman and Fourier Transform Infrared spectroscopies (FTIR) and calculated using the linear response method within the density functional perturbation theory (DFPT). The detailed study leads to an exhaustive description of the spectra, including the symmetry of the vibrational modes. Electronic structures of these materials were computed using DFT within the range-separated hybrid HSE06 exchange–correlation formalism. Electronic and ionic contributions to the dielectric constant tensors of these materials were obtained from DFPT within the linear response method using the PBE functional. Furthermore, effective mass of photogenerated holes and electrons at the band edges of these compounds were computed from the electronic band structure obtained at the DFT/HSE06 level of theory. The results suggest that anisotropic nature in TaON and Ta3N5 is present in terms of dielectric constant and effective masses.

  15. Combined experimental and theoretical assessments of the lattice dynamics and optoelectronics of TaON and Ta3N5 (United States)

    Nurlaela, Ela; Harb, Moussab; del Gobbo, Silvano; Vashishta, Manish; Takanabe, Kazuhiro


    Presented herein is a detailed discussion of the properties of the lattice dynamic and optoelectronic properties of tantalum(V) oxynitride (TaON) and tantalum(V) nitride (Ta3N5), from experimental and theoretical standpoint. The active Raman and infra red (IR) frequencies of TaON and Ta3N5 were measured using confocal Raman and Fourier Transform Infrared spectroscopies (FTIR) and calculated using the linear response method within the density functional perturbation theory (DFPT). The detailed study leads to an exhaustive description of the spectra, including the symmetry of the vibrational modes. Electronic structures of these materials were computed using DFT within the range-separated hybrid HSE06 exchange-correlation formalism. Electronic and ionic contributions to the dielectric constant tensors of these materials were obtained from DFPT within the linear response method using the PBE functional. Furthermore, effective mass of photogenerated holes and electrons at the band edges of these compounds were computed from the electronic band structure obtained at the DFT/HSE06 level of theory. The results suggest that anisotropic nature in TaON and Ta3N5 is present in terms of dielectric constant and effective masses.

  16. Technology Assessment Need: Review on Attractiveness and Competitiveness (United States)

    Salwa Sait, Siti; Merlinda Muharam, Farrah; Chin, Thoo Ai; Sulaiman, Zuraidah


    Technology assessment is crucial in managing technology for the purpose of technology exploitation. With business environment continuously changing, firms have to address this issue critically as technology is considered one of the important elements to evaluate performance and gain competitive advantage. Missteps in deciding the best technology to be developed, employed or maintained would cost the firm overall value. To fulfil the need of finding the appropriate scale to assess suitable technology, this paper summarizes that technology assessment (TA) should cover two main aspects, namely technology attractiveness and competitiveness. These components are seen capable to link the scale suggested towards evaluation of financial and non-financial performance towards competitive advantage.

  17. Advocacy and technology assessment (United States)

    Jones, E. M.


    A highly structured treatment is presented of adversarial systems as they apply to technology assessment. One approach to the problem of adequate criteria of assessment focuses upon the internal operations of assessment entities; operations include problem perception, problem formulation, selection, utilization, determination, and evaluation. Potential contributions of advocacy as a mode of inquiry in technology are discussed; advocacy is evaluated by representative sets of criteria of adequate assessment which include participant criteria, perspectives criteria, situations criteria, base values criteria, and strategies criteria.

  18. Hot spray technology of TA7 titanium alloy coated by molybdenum and its bonding strength

    Institute of Scientific and Technical Information of China (English)

    Li Xiaoquan; Du Zeyu; Yang Xuguang


    A kind of surface modification test was introduced, by which plasma spray in argon atmosphere with CNC4500 system was applied for TA7 titanium alloy to be coated with molybdenum, and technology to produce metallurgical bonding at interface of coating and base meal was tested by heating in vacuum condition for diffusion after hot spray.With the help of scan electron microscope analysis ( SEM) , the effect of argon inlet pressure and heating temperature on coating structure as well as product of diffusion layer were studied.The glued tensile test method was used to measure bonding strength of base metal to coating.The result has shown that both argon inlet pressure and heating temperature exert some effect on coating structure and the width of diffusion layer.A bonding strength of base metal to coating which is greater than molybdenum coating itself may be attained and can be controlled in more than 50 MPa level with tested hot spray technology.

  19. [Research and Application of the ICP-MS Detection Technology for the Content of Nb and Ta in Geochemical Sample]. (United States)

    Li, Zi-qiang; Li, Xiao-ying; Zhu, Kun; Xu, Xiao-xia; Yan, Zhi-yuan


    In order to provide the test analysis technology to support the exploration and development of niobium and tantalum resource, based on the special chemical properties of Nb and Ta in geochemical sample, we studied the detection methods for the content of Nb and Ta in geochemical sample by using inductively coupled plasma mass spectrometry (ICP-MS). The results show that the sample dissolution and instrumental parameter of ICP-MS, especially the former have significant influence? on detection results. Therefore, optimizing important parameters of sample dissolution is the key of the detection technology. The optimal parameters are that the weight of sample is 50 mg; the dosage of HF acid is 15 mL; the concentration of nitric acid and tartaric acid in the sample solution is 2% and 1.5%, respectively; the validity period of detection for sample solution ≤1 d. The detection method has been validated by the national geochemistry standard reference material. The precise and exaction of method meet the required of industry standards. The detection limits of method for Nb and Ta are 1.05 and 0.13 μg · g(-1), respectively. The experiment proved that the ICP-MS detection methods, which using certain preparation process of sample solutions, is suitable for accurate and rapid determination of Nb and Ta in geochemical sample, especially geochemical survey samples which with a large amount and low content of Nb and Ta.

  20. Information technology resources assessment

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, D.F. [ed.


    This year`s Information Technology Resources Assessment (ITRA) is something of a departure from traditional practice. Past assessments have concentrated on developments in fundamental technology, particularly with respect to hardware. They form an impressive chronicle of decreasing cycle times, increasing densities, decreasing costs (or, equivalently, increasing capacity and capability per dollar spent), and new system architectures, with a leavening of operating systems and languages. Past assessments have aimed -- and succeeded -- at putting information technology squarely in the spotlight; by contrast, in the first part of this assessment, we would like to move it to the background, and encourage the reader to reflect less on the continuing technological miracles of miniaturization in space and time and more on the second- and third-order implications of some possible workplace applications of these miracles. This Information Technology Resources Assessment is intended to provide a sense of technological direction for planners in projecting the hardware, software, and human resources necessary to support the diverse IT requirements of the various components of the DOE community. It is also intended to provide a sense of our new understanding of the place of IT in our organizations.

  1. Information technology resources assessment

    Energy Technology Data Exchange (ETDEWEB)

    Stevens, D.F. (ed.)


    This year's Information Technology Resources Assessment (ITRA) is something of a departure from traditional practice. Past assessments have concentrated on developments in fundamental technology, particularly with respect to hardware. They form an impressive chronicle of decreasing cycle times, increasing densities, decreasing costs (or, equivalently, increasing capacity and capability per dollar spent), and new system architectures, with a leavening of operating systems and languages. Past assessments have aimed -- and succeeded -- at putting information technology squarely in the spotlight; by contrast, in the first part of this assessment, we would like to move it to the background, and encourage the reader to reflect less on the continuing technological miracles of miniaturization in space and time and more on the second- and third-order implications of some possible workplace applications of these miracles. This Information Technology Resources Assessment is intended to provide a sense of technological direction for planners in projecting the hardware, software, and human resources necessary to support the diverse IT requirements of the various components of the DOE community. It is also intended to provide a sense of our new understanding of the place of IT in our organizations.

  2. Health care technology assessment (United States)

    Goodman, Clifford


    The role of technology in the cost of health care is a primary issue in current debates concerning national health care reform. The broad scope of studies for understanding technological impacts is known as technology assessment. Technology policy makers can improve their decision making by becoming more aware, and taking greater advantage, of key trends in health care technology assessment (HCTA). HCTA is the systematic evaluation of the properties, impacts, and other attributes of health care technologies, including: technical performance; clinical safety and efficacy/effectiveness; cost-effectiveness and other economic attributes; appropriate circumstances/indications for use; and social, legal, ethical, and political impacts. The main purpose of HCTA is to inform technology-related policy making in health care. Among the important trends in HCTA are: (1) proliferation of HCTA groups in the public and private sectors; (2) higher standards for scientific evidence concerning technologies; (3) methodological development in cost analyses, health-related quality of life measurement, and consolidation of available scientific evidence (e.g., meta-analysis); (4) emphasis on improved data on how well technologies work in routine practice and for traditionally under-represented patient groups; (5) development of priority-setting methods; (6) greater reliance on medical informatics to support and disseminate HCTA findings.

  3. Information Technology Resources Assessment

    Energy Technology Data Exchange (ETDEWEB)


    The Information Technology Resources Assessment (ITRA) is being published as a companion document to the Department of Energy (DOE) FY 1994--FY 1998 Information Resources Management Long-Range Plan. This document represents a collaborative effort between the Office of Information Resources Management and the Office of Energy Research that was undertaken to achieve, in part, the Technology Strategic Objective of IRM Vision 21. An integral part of this objective, technology forecasting provides an understanding of the information technology horizon and presents a perspective and focus on technologies of particular interest to DOE program activities. Specifically, this document provides site planners with an overview of the status and use of new information technology for their planning consideration.

  4. Early phase Technology Assessment of nanotechnology in oncology

    NARCIS (Netherlands)

    Retèl, Valesca P.; Hummel, Marjan J.M.; Harten, van Willem H.


    To perform early Technology Assessment (TA) of nanotechnology in oncology. The possibilities of nanotechnology for detection (imaging), diagnosis and treatment of cancer are subject of different research programs where major investments are concerned. As a range of bio- nanotechnologies is expected

  5. Prospective Technology Assessment of Synthetic Biology: Fundamental and Propaedeutic Reflections in Order to Enable an Early Assessment. (United States)

    Schmidt, Jan Cornelius


    Synthetic biology is regarded as one of the key technosciences of the future. The goal of this paper is to present some fundamental considerations to enable procedures of a technology assessment (TA) of synthetic biology. To accomplish such an early "upstream" assessment of a not yet fully developed technology, a special type of TA will be considered: Prospective TA (ProTA). At the center of ProTA are the analysis and the framing of "synthetic biology," including a characterization and assessment of the technological core. The thesis is that if there is any differentia specifica giving substance to the umbrella term "synthetic biology," it is the idea of harnessing self-organization for engineering purposes. To underline that we are likely experiencing an epochal break in the ontology of technoscientific systems, this new type of technology is called "late-modern technology." -I start this paper by analyzing the three most common visions of synthetic biology. Then I argue that one particular vision deserves more attention because it underlies the others: the vision of self-organization. I discuss the inherent limits of this new type of late-modern technology in the attempt to control and monitor possible risk issues. I refer to Hans Jonas' ethics and his early anticipation of the risks of a novel type of technology. I end by drawing conclusions for the approach of ProTA towards an early societal shaping of synthetic biology.

  6. Technologies for Language Assessment. (United States)

    Burstein, Jill; And Others


    Reviews current and developing technology uses that are relevant to language assessment and discusses examples of recent linguistic applications from the laboratory at the Educational Testing Service. The processes of language test development are described and the functions they serve from the perspective of a large testing organization are…

  7. Information technology resources assessment

    Energy Technology Data Exchange (ETDEWEB)

    Loken, S.C. [ed.


    The emphasis in Information Technology (IT) development has shifted from technology management to information management, and the tools of information management are increasingly at the disposal of end-users, people who deal with information. Moreover, the interactive capabilities of technologies such as hypertext, scientific visualization, virtual reality, video conferencing, and even database management systems have placed in the hands of users a significant amount of discretion over how these resources will be used. The emergence of high-performance networks, as well as network operating systems, improved interoperability, and platform independence of applications will eliminate technical barriers to the use of data, increase the power and range of resources that can be used cooperatively, and open up a wealth of possibilities for new applications. The very scope of these prospects for the immediate future is a problem for the IT planner or administrator. Technology procurement and implementation, integration of new technologies into the existing infrastructure, cost recovery and usage of networks and networked resources, training issues, and security concerns such as data protection and access to experiments are just some of the issues that need to be considered in the emerging IT environment. As managers we must use technology to improve competitiveness. When procuring new systems, we must take advantage of scalable resources. New resources such as distributed file systems can improve access to and efficiency of existing operating systems. In addition, we must assess opportunities to improve information worker productivity and information management through tedmologies such as distributed computational visualization and teleseminar applications.


    Directory of Open Access Journals (Sweden)

    Armin GRUNWALD


    Full Text Available This paper includes a brief overview of the basic motivations and objectives of TA, followed by a description of the three main operating fields of TA: providing scientific advice for decision‐making in the political system, contributing to public debate, and enriching technology development and engineering practice. These issues will then be considered in more detail by referring to various approaches to the relationship between TA and technology development and by presenting a specific case study of an accompanying TA process over various development stages of the bioliq® process for converting dry biomass into fuel (Biomass to Liquid and chemicals. The accompanying TA work on the bioliq® process can, as a result of more than ten years of experience, be considered a successful technology assessment as it has opened up a new research field with a highly precautionary aspect on the one hand, and helped to win over technology‐oriented research institutes to reorienting their research work, on the other. The results of the TA studies allowed to assess e.g. the competitiveness of the bioliq® process at a very early stage. The mutual trust built up in the course of the historical development between the parties involved has always been essential for this ongoing accompanying TA process. TA has been proven, in this way, a useful tool to uncover new chances for engineering research and development, and to accompany the research process.

  9. Suntown Technology will Finish the Construction of 200,000 T/A Aluminum Foil Production Base

    Institute of Scientific and Technical Information of China (English)


    <正>The"200,000 t/a world top ranking aluminum foil processing base"by the Suntown Technology Group is called"201 Project",it is also one of the Group’s key construction projects in 2014.This project formally kicked off in May 2013,and will be fully completed and launched into production at the end of October,2014.The 201 Project mainly

  10. Photovoltaic technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Backus, C.E.


    After a brief review of the history of photovoltaic devices and a discussion of the cost goals set for photovoltaic modules, the status of photovoltaic technology is assessed. Included are discussions of: current applications, present industrial production, low-cost silicon production techniques, energy payback periods for solar cells, advanced materials research and development, concentrator systems, balance-of-system components. Also discussed are some nontechnical aspects, including foreign markets, US government program approach, and industry attitudes and approaches. (LEW)

  11. Technology Assessment Tool - An Application of Systems Engineering to USDOE Technology Proposals

    Energy Technology Data Exchange (ETDEWEB)

    Rynearson, Michael Ardel


    This paper discusses the system design for a Technology Assessment (TA) tool that can be used to quantitatively evaluate new and advanced technologies, products, or processes. Key features of the tool include organization of information in an indentured hierarchy; questions and categories derived from the decomposition of technology performance; segregation of life-cycle issues into six assessment categories; and scoring, relative impact, and sensitivity analysis capability. An advantage of the tool's use is its ability to provide decision analysis data, based on incomplete or complete data.

  12. Technology Assessment Tool - An Application of Systems Engineering to USDOE Technology Proposals

    Energy Technology Data Exchange (ETDEWEB)

    Rynearson, Michael Ardel


    This paper discusses the system design for a Technology Assessment (TA) tool that can be used to quantitatively evaluate new and advanced technologies, products, or processes. Key features of the tool include organization of information in an indentured hierarchy; questions and categories derived from the decomposition of technology performance; segregation of life-cycle issues into six assessment categories; and scoring, relative impact, and sensitivity analysis capability. An advantage of the tool's use is its ability to provide decision analysis data, based on incomplete or complete data.

  13. Technology Assessment Tool - An Application of Systems Engineering to USDOE Technology Proposals

    Energy Technology Data Exchange (ETDEWEB)

    M. A. Rynearson


    This paper discusses the system design of a Technology Assessment (TA) tool that can be used to quantitatively evaluate new and advanced technologies, products, or processes. Key features of the tool include organization of information in an indentured hierarchy; questions and categories derived from the decomposition of technology performance; segregation of life-cycle issues into six assessment categories; and scoring, relative impact, and sensitivity analysis capability. An advantage of the tool's use is its ability to provide decision analysis data, based on incomplete or complete data.

  14. Combined experimental and theoretical assessments of the lattice dynamics and optoelectronics of TaON and Ta{sub 3}N{sub 5}

    Energy Technology Data Exchange (ETDEWEB)

    Nurlaela, Ela; Harb, Moussab [Division of Physical Sciences and Engineering, KAUST Catalysis Center (KCC), King Abdullah University of Science and Technology (KAUST), 4700 KAUST, Thuwal 23955-6900 Saudi Arabia (Saudi Arabia); Gobbo, Silvano del [Solar and Photovoltaic Engineering Center, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia); Vashishta, Manish [Division of Physical Sciences and Engineering, KAUST Catalysis Center (KCC), King Abdullah University of Science and Technology (KAUST), 4700 KAUST, Thuwal 23955-6900 Saudi Arabia (Saudi Arabia); Takanabe, Kazuhiro, E-mail: [Division of Physical Sciences and Engineering, KAUST Catalysis Center (KCC), King Abdullah University of Science and Technology (KAUST), 4700 KAUST, Thuwal 23955-6900 Saudi Arabia (Saudi Arabia)


    Presented herein is a detailed discussion of the properties of the lattice dynamic and optoelectronic properties of tantalum(V) oxynitride (TaON) and tantalum(V) nitride (Ta{sub 3}N{sub 5}), from experimental and theoretical standpoint. The active Raman and infra red (IR) frequencies of TaON and Ta{sub 3}N{sub 5} were measured using confocal Raman and Fourier Transform Infrared spectroscopies (FTIR) and calculated using the linear response method within the density functional perturbation theory (DFPT). The detailed study leads to an exhaustive description of the spectra, including the symmetry of the vibrational modes. Electronic structures of these materials were computed using DFT within the range-separated hybrid HSE06 exchange–correlation formalism. Electronic and ionic contributions to the dielectric constant tensors of these materials were obtained from DFPT within the linear response method using the PBE functional. Furthermore, effective mass of photogenerated holes and electrons at the band edges of these compounds were computed from the electronic band structure obtained at the DFT/HSE06 level of theory. The results suggest that anisotropic nature in TaON and Ta{sub 3}N{sub 5} is present in terms of dielectric constant and effective masses. - Graphical abstract: Detailed investigation has been conducted from combined experimental and theoretical approaches on Raman and IR spectroscopies, electronic structures, dielectric constants and effective masses of TaON and Ta{sub 3}N{sub 5}. - Highlights: • Crystal structures of TaON and Ta{sub 3}N{sub 5} are discussed based on XRD and DFT calculation. • Raman and IR spectra of TaON and Ta{sub 3}N{sub 5} materials are measured and computed by DFPT method. • Optoelectronic properties of TaON and Ta{sub 3}N{sub 5} are discussed. • Dielectric constant and effective masses of TaON and Ta{sub 3}N{sub 5} are calculated.

  15. Technology assessment heat pumps

    Energy Technology Data Exchange (ETDEWEB)

    Rudolph, R.; Purper, G. (Battelle-Institut e.V., Frankfurt am Main (Germany, F.R.))

    Technology assessment for an increased application of heat pumps is carried out in four areas: Effects in the economics area, i.e. effects on the economic goals which are defined in the Stability Law, on the goals of the power supply policy which result from the energy programme and its projections, and on the economic structure as a whole. The whole range of social problems concerning the use of heat pumps, i.e. the questions which social groups are affected, how they react, and what consequences are they expected to have on energy conservation as an object of social policy. Consequences in the governmental and administrative sectors, i.e. effects on legislation, administration and government budgets. Effects on the ecological systems; of prime interest in this context are the utilisation of environmental energy, changes in the heat balance, and emmission of pollutants.

  16. Methods for assessment of innovative medical technologies during early stages of development.


    Hagen, Anja; Schönermark, Matthias P.; Lühmann, Dagmar; Neumann, Ulrike; Bartelmes, Marc


    Conventional Health Technology Assessment (HTA) is usually conducted at a point in time at which the development of the respective technology may no longer be influenced. By this time developers and/or purchasers may have misinvested resources. Thus the demand for Technology Assessment (TA) which incorporates appropriate methods during early development stages of a technology becomes apparent. Against this health political background, the present report describes methods for a development-acc...

  17. Early phase Technology Assessment of nanotechnology in oncology. (United States)

    Retèl, Valesca P; Hummel, Marjan J M; van Harten, Willem H


    To perform early Technology Assessment (TA) of nanotechnology in oncology. The possibilities of nanotechnology for detection (imaging), diagnosis and treatment of cancer are subject of different research programs where major investments are concerned. As a range of bio- nanotechnologies is expected to enter the oncology field it is relevant to consider the various aspects involved in especially early TA. This article provides two cases of early assessment of (predecessors of) nanotechnologies: Microarray Analysis and Photodynamic Therapy implementation, which methodology can be extrapolated to other nanotechnologies in oncology. Constructive Technology Assessment (CTA) is used for the introduction of technologies that are still in a dynamic phase of development or in an early stage of diffusion. The selection of studied aspects in CTA is based on: clinical aspects (safety, efficacy, and effectiveness), economic (cost-effectiveness), patient related (QoL, ethical/juridical and psychosocial), organizational aspects (diffusion and adoption) and scenario drafting. The features of the technology and the phase of implementation are decisive for choices and timing of the specific aspects to be studied. A framework was drafted to decide on the relevant aspects. In the first case, early implementation of Microarray Analysis; clinical effectiveness, logistics, patient centeredness and scenario drafting were given priority. Related to the diffusion-phase of Photodynamic Therapy however other aspects were evaluated, such as early cost-effectiveness analysis for possible reimbursement. Often CTA will result in a mixed method design. Especially scenario drafting is a powerful instrument to predict possible developments that can be anticipated upon in the assessment. CTA is appropriate for the study of early implementation of new technologies in oncology. In early TA small series often necessitate a mix of quantitative and qualitative methods. The features of nanotechnology

  18. Technology Performance Level Assessment Methodology.

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, Jesse D.; Bull, Diana L; Malins, Robert Joseph; Costello, Ronan Patrick; Aurelien Babarit; Kim Nielsen; Claudio Bittencourt Ferreira; Ben Kennedy; Kathryn Dykes; Jochem Weber


    The technology performance level (TPL) assessments can be applied at all technology development stages and associated technology readiness levels (TRLs). Even, and particularly, at low TRLs the TPL assessment is very effective as it, holistically, considers a wide range of WEC attributes that determine the techno-economic performance potential of the WEC farm when fully developed for commercial operation. The TPL assessment also highlights potential showstoppers at the earliest possible stage of the WEC technology development. Hence, the TPL assessment identifies the technology independent “performance requirements.” In order to achieve a successful solution, the entirety of the performance requirements within the TPL must be considered because, in the end, all the stakeholder needs must be achieved. The basis for performing a TPL assessment comes from the information provided in a dedicated format, the Technical Submission Form (TSF). The TSF requests information from the WEC developer that is required to answer the questions posed in the TPL assessment document.

  19. Assessment of Radiometer Calibration with GPS Radio Occultation for the MiRaTA CubeSat Mission. (United States)

    Marinan, Anne D; Cahoy, Kerri L; Bishop, Rebecca L; Lui, Susan S; Bardeen, James R; Mulligan, Tamitha; Blackwell, William J; Leslie, R Vincent; Osaretin, Idahosa; Shields, Michael


    The Microwave Radiometer Technology Acceleration (MiRaTA) is a 3U CubeSat mission sponsored by the NASA Earth Science Technology Office (ESTO). The science payload on MiRaTA consists of a tri-band microwave radiometer and Global Positioning System (GPS) radio occultation (GPSRO) sensor. The microwave radiometer takes measurements of all-weather temperature (V-band, 50-57 GHz), water vapor (G-band, 175-191 GHz), and cloud ice (G-band, 205 GHz) to provide observations used to improve weather forecasting. The Aerospace Corporation's GPSRO experiment, called the Compact TEC (Total Electron Content) and Atmospheric GPS Sensor (CTAGS), measures profiles of temperature and pressure in the upper troposphere/lower stratosphere (∼20 km) and electron density in the ionosphere (over 100 km). The MiRaTA mission will validate new technologies in both passive microwave radiometry and GPS radio occultation: (1) new ultra-compact and low-power technology for multi-channel and multi-band passive microwave radiometers, (2) the application of a commercial off the shelf (COTS) GPS receiver and custom patch antenna array technology to obtain neutral atmospheric GPSRO retrieval from a nanosatellite, and (3) a new approach to spaceborne microwave radiometer calibration using adjacent GPSRO measurements. In this paper, we focus on objective (3), developing operational models to meet a mission goal of 100 concurrent radiometer and GPSRO measurements, and estimating the temperature measurement precision for the CTAGS instrument based on thermal noise. Based on an analysis of thermal noise of the CTAGS instrument, the expected temperature retrieval precision is between 0.17 K and 1.4 K, which supports the improvement of radiometric calibration to 0.25 K.

  20. Dental implants of TiTa30 produced by powder technology

    Energy Technology Data Exchange (ETDEWEB)

    Wack, T.; Biehl, V.; Breme, J. [Universitaet des Saarlandes, Saarbruecken (Germany). Lehrstuhl fuer Metallische Werkstoffe; Schwanke, C.; Schaeffer, L.


    The production and the mechanical properties of porous parts of the biocompatible titanium alloy TiTa30 produced via powder metallurgy are described. The aim of the study was to create endosseous dental implants with a low Young`s modulus and a porous surface, which will result in a good load transfer from the implant to the bone thus stimulating the formation of new bone and ultimately by the ingrowth of bone into the surface of the implant lead to a good anchorage in the bone. Other applications of such porous parts might be bearings or filters. The new alloy TiTa30 was melted in an electric-arc furnace in a water-cooled mould in an argon atmosphere and then powdered by the hydrogenation - dehydrogenation (HDH)-process. Samples were produced by unidirectional pressing and then sintering of the green bodies under vacuum. The influence of the sintering parameters (particle size, compacting pressure, sintering time and temperature) on the mechanical properties was investigated. While the Young`s modulus and the yield strength varied only with the resulting porosity, the fatigue strength of the samples also depended on the particle size and the sintering temperature and time. It was possible to produce samples with a Young`s modulus comparable to that of bone and a fatigue strength high enough for use as a dental implant. In addition to the mechanical testing the functionality of the implants (bone ingrowth and implant anchorage) was tested in-vivo in animal experiments. (orig.) 5 refs.

  1. Melter Technologies Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Perez, J.M. Jr. [Pacific Northwest National Lab., Richland, WA (United States); Schumacher, R.F. [Savannah River Technology Center, Aiken, SC (United States); Forsberg, C.W. [Oak Ridge National Lab., TN (United States)


    The problem of controlling and disposing of surplus fissile material, in particular plutonium, is being addressed by the US Department of Energy (DOE). Immobilization of plutonium by vitrification has been identified as a promising solution. The Melter Evaluation Activity of DOE`s Plutonium Immobilization Task is responsible for evaluating and selecting the preferred melter technologies for vitrification for each of three immobilization options: Greenfield Facility, Adjunct Melter Facility, and Can-In-Canister. A significant number of melter technologies are available for evaluation as a result of vitrification research and development throughout the international communities for over 20 years. This paper describes an evaluation process which will establish the specific requirements of performance against which candidate melter technologies can be carefully evaluated. Melter technologies that have been identified are also described.

  2. Turbine imaging technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Moursund, R. A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Carlson, T. J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)


    The goal of this project was to identify and evaluate imaging technologies for observing juvenile fish within a Kaplan turbine, and specifically that would enable scientists to determine mechanisms of fish injury within an operating turbine unit. This report documents the opportunities and constraints for observing juvenile fish at specific locations during turbine passage. These observations were used to make modifications to dam structures and operations to improve conditions for fish passage while maintaining or improving hydropower production. The physical and hydraulic environment that fish experience as they pass through the hydroelectric plants were studied and the regions with the greatest potential for injury were defined. Biological response data were also studied to determine the probable types of injuries sustained in the turbine intake and what types of injuries are detectable with imaging technologies. The study grouped injury-causing mechanisms into two categories: fluid (pressure/cavitation, shear, turbulence) and mechanical (strike/collision, grinding/pinching, scraping). The physical constraints of the environment, together with the likely types of injuries to fish, provided the parameters needed for a rigorous imaging technology evaluation. Types of technology evaluated included both tracking and imaging systems using acoustic technologies (such as sonar and acoustic tags) and optic technologies (such as pulsed-laser videography, which is high-speed videography using a laser as the flash). Criteria for determining image data quality such as frame rate, target detectability, and resolution were used to quantify the minimum requirements of an imaging sensor.

  3. Superconducting Technology Assessment (United States)


    of Nb/Al- Nx /NbTiN junctions for SIS mixer applications,” IEEE Trans. Appl. Superconduct., vol. 11, pp. 76–79, Mar. 2001. [48] M. Gurvitch, W. A...Another connector developed by IBM for commercial applications using a dendritic interposer technology. A “beam-on-pad” approach developed by Siemens

  4. Health technology assessment in Finland

    DEFF Research Database (Denmark)

    Mäkelä, Marjukka; Roine, Risto P


    Since the 1990s, health policy makers in Finland have been supportive of evidence-based medicine and approaches to implement its results. The Finnish Office for Health Technology Assessment (Finohta) has grown from a small start in 1995 to a medium-sized health technology assessment (HTA) agency......, with special responsibility in providing assessments to underpin national policies in screening. External evaluations enhanced the rapid growth. In the Finnish environment, decision making on health technologies is extremely decentralized, so Finohta has developed some practical tools for implementing HTA...... findings. The Managed Uptake of Medical Methods program links the hospital districts to agree on introduction of technologies. The Ohtanen database provides Finnish-language summaries of major assessments made in other countries....

  5. Assessment of relative Ti, Ta, and Nb (TITAN) enrichments in ocean island basalts (United States)

    Peters, Bradley J.; Day, James M. D.


    sensitivity of trace element concentrations to processes governing solid-melt interactions has made them valuable tools for tracing the effects of partial melting, fractional crystallization, metasomatism, and similar processes on the composition of a parental melt. Recent studies of ocean island basalts (OIB) have sought to correlate Ti, Ta, and Nb (TITAN) anomalies to isotopic tracers, such as 3He/4He and 187Os/188Os ratios, which may trace primordial deep mantle sources. A new compilation of global OIB trace element abundance data indicates that positive TITAN anomalies, though statistically pervasive features of OIB, may not be compositional features of their mantle sources. OIB show a range of Ti (Ti/Ti* = 0.28-2.35), Ta (Ta/Ta* = 0.11-93.4), and Nb (Nb/Nb* = 0.13-17.8) anomalies that show negligible correlations with 3He/4He ratios, indicating that TITAN anomalies are not derived from the less-degassed mantle source traced by high-3He/4He. Positive TITAN anomalies can be modeled using variable degrees (0.1-10%) of nonmodal batch partial melting of garnet-spinel lherzolite at temperatures and pressures considered typical for OIB petrogenesis, and subjecting this partial melt to fractional crystallization and assimilation of mid-ocean ridge basalt-like crust (AFC). Correlations of TITAN anomalies with modal abundances of olivine and clinopyroxene in porphyritic Canary Islands lavas provide empirical support for this process and indicate that high abundances of these phases in OIB may create misleading trace element anomalies on primitive mantle-normalized spider diagrams. Because partial melting and AFC are common to all mantle-derived magmas, caution should be used when attributing TITAN anomalies to direct sampling of recycled or deep mantle sources by hotspots.

  6. Assessing Advanced Technology in CENATE

    Energy Technology Data Exchange (ETDEWEB)

    Tallent, Nathan R.; Barker, Kevin J.; Gioiosa, Roberto; Marquez, Andres; Kestor, Gokcen; Song, Shuaiwen; Tumeo, Antonino; Kerbyson, Darren J.; Hoisie, Adolfy


    PNNL's Center for Advanced Technology Evaluation (CENATE) is a new U.S. Department of Energy center whose mission is to assess and facilitate access to emerging computing technology. CENATE is assessing a range of advanced technologies, from evolutionary to disruptive. Technologies of interest include the processor socket (homogeneous and accelerated systems), memories (dynamic, static, memory cubes), motherboards, networks (network interface cards and switches), and input/output and storage devices. CENATE is developing a multi-perspective evaluation process based on integrating advanced system instrumentation, performance measurements, and modeling and simulation. We show evaluations of two emerging network technologies: silicon photonics interconnects and the Data Vortex network. CENATE's evaluation also addresses the question of which machine is best for a given workload under certain constraints. We show a performance-power tradeoff analysis of a well-known machine learning application on two systems.

  7. Quality assurance and technology assessment: pieces of a larger puzzle. (United States)

    McDonald, I G


    Increasing integration of health care and health services research has resulted in an overlap between disciplines involved in the evaluation of clinical practice. We have examined the relationships of quality assurance (QA), medical technology assessment (TA), clinical epidemiology (CE) and evidence-based medicine (EBM) from an historical perspective. Clinicians, patients and administrators need local information on effectiveness of routine care. Information from trials alone, efficacy data, will not suffice nor can it be culled from administrative databases designed for other purposes. The current activities of QA should be therefore be expanded to include the study of the effectiveness of interventions in terms of appropriateness of use, patient outcomes and study of the determinants of outcomes, as seen from the perspective of doctors, patients, administrators and policy makers, using data collected during the course of routine patient care. With the assistance of information technology, with methodological support and multidisciplinary cooperation, clinicians can do this as part of a more broadly defined clinical research. Quality assurance and TA both evolved with the objective of studying clinical care but have quite different historical roots, complementary perspectives and objectives, use different methods and involve a different set of practitioners. Quality assurance is a type of 'formative' evaluation conducted in the clinical setting using indicators as flags of process or outcome events of interest, simple surveys and audit studies. Its primary aim is to achieve incremental improvement rather than to simply pass judgement. An important underlying assumption is that health care behaves as a complex dynamic system. Technology assessment, a form of summative evaluation with an orientation towards policy, synthesises information from formal scientific studies of efficacy in the form of clinical trials and studies of cost-effectiveness. For the evaluation

  8. Preliminary assessment of numerical data requirements TA-73 landfill Los Alamos, New Mexico

    Energy Technology Data Exchange (ETDEWEB)


    A numerical model, TOUGH2, was selected for describing liquid- and gas-phase flow in the unsaturated tuff underlying the TA-73 landfill. The model was selected primarily for its ability to simulate the significant mechanisms that may affect transport of contaminants through the vadose zone at the TA-73 landfill, including non-isothermal flow through fractured media. TOUGH2 is the best documented, verified, and validated model capable of performing the required simulations. The sensitivity analyses that were performed and describes in this report identified the input parameters that the selected numerical model is most sensitive to. The input parameters analyzed were saturated hydraulic conductivity, van Genuchten {alpha} and n, residual and saturated moisture contents, infiltration rate, fracture spacing and permeability, atmospheric pressure, and temperature. The sensitivity analyses were performed using a model grid that was designed to incorporate the regions in the landfill vicinity where contaminant transport is likely to occur and where the physical processes affecting flow and transport are the most dynamic. The sensitivity analyses performed suggest that the model is quite sensitive to a number of input parameters, including saturated hydraulic conductivity, the van Genuchten parameters {alpha} and n (for both the tuff matrix and fractures), fracture density and aperture, and atmospheric pressure. The results indicate that additional site-specific hydraulic properties and fracture data should be obtained before attempting to perform predictive, numerical simulations of gas- and liquid-phase flow beneath the landfill.

  9. Participating despite questions: toward a more confident participatory technology assessment : commentary on: "Questioning 'participation': a critical appraisal of its conceptualization in a Flemish participatory technology assessment". (United States)

    Guston, David H


    While the important challenges of public deliberations on emerging technologies are crucial to keep in mind, this paper argues that scholars and practitioners have reason to be more confident in their performance of participatory technology assessments (pTA). Drawing on evidence from the 2008 National Citizens' Technology Forum (NCTF) conducted by the Center for Nanotechnology in Society at Arizona State University, this paper describes how pTA offers a combination of intensive and extensive qualities that are unique among modes of engagement. In the NCTF, this combination led to significant learning and opinion changes, based on what can be characterized as a high-quality deliberation. The quality of the anticipatory knowledge required to address emerging technologies is always contested, but pTAs can be designed with outcomes in mind-especially when learning is understood as an outcome.

  10. GoTa-the future-oriented digital trunking technology%GoTa--面向未来的数字集群通信技术

    Institute of Scientific and Technical Information of China (English)

    薛育红; 刘守文; 刘金龙



  11. Technical Area V (TA-V) transformation project close-out report.

    Energy Technology Data Exchange (ETDEWEB)


    Sandia National Laboratories (SNL) Technical Area V (TA-V) has provided unique nuclear experimental environments for decades. The technologies tested in TA-V facilities have furthered the United States Nuclear Weapons program and has contributed to the national energy and homeland security mission. The importance of TA-V working efficiently to produce an attractive and effective platform for experiments should not be underestimated. Throughout its brief history, TA-V has evolved to address multiple and diverse sets of requirements. These requirements evolved over many years; however, the requirements had not been managed nor communicated comprehensively or effectively. A series of programmatic findings over several years of external audits was evidence of this downfall. Today, these same requirements flow down through a new TA-V management system that produces consistently applied and reproducible approaches to work practices. In 2008, the TA-V department managers assessed the state of TA-V services and work activities to understand how to improve customer interfaces, stakeholders perceptions, and workforce efficiencies. The TA-V management team initiated the TA-V Transformation Project after they deemed the pre-June 2008 operational model to be ineffective in managing work and in providing integrated, continuous improvement to TA-V processes. This report summarizes the TA-V Transformation Project goals, activities, and accomplishments.

  12. Sampling and analysis plan for assessment of beryllium in soils surrounding TA-40 building 15

    Energy Technology Data Exchange (ETDEWEB)

    Ruedig, Elizabeth [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Technical Area (TA) 40 Building 15 (40-15) is an active firing site at Los Alamos National Laboratory. The weapons facility operations (WFO) group plans to build an enclosure over the site in 2017, so that test shots may be conducted year-round. The enclosure project is described in PRID 16P-0209. 40-15 is listed on LANL OSH-ISH’s beryllium inventory, which reflects the potential for beryllium in/on soils and building surfaces at 40-15. Some areas in and around 40-15 have previously been sampled for beryllium, but past sampling efforts did not achieve complete spatial coverage of the area. This Sampling and Analysis Plan (SAP) investigates the area surrounding 40-15 via 9 deep (≥1-ft.) soil samples and 11 shallow (6-in.) soil samples. These samples will fill the spatial data gaps for beryllium at 40-15, and will be used to support OSH-ISH’s final determination of 40-15’s beryllium registry status. This SAP has been prepared by the Environmental Health Physics program in consultation with the Industrial Hygiene program. Industrial Hygiene is the owner of LANL’s beryllium program, and will make a final determination with regard to the regulatory status of beryllium at 40-15.

  13. Augmented Reality Tower Technology Assessment (United States)

    Reisman, Ronald J.; Brown, David M.


    Augmented Reality technology may help improve Air Traffic Control Tower efficiency and safety during low-visibility conditions. This paper presents the assessments of five off-duty controllers who shadow-controlled' with an augmented reality prototype in their own facility. Initial studies indicated unanimous agreement that this technology is potentially beneficial, though the prototype used in the study was not adequate for operational use. Some controllers agreed that augmented reality technology improved situational awareness, had potential to benefit clearance, control, and coordination tasks and duties and could be very useful for acquiring aircraft and weather information, particularly aircraft location, heading, and identification. The strongest objections to the prototype used in this study were directed at aircraft registration errors, unacceptable optical transparency, insufficient display performance in sunlight, inadequate representation of the static environment and insufficient symbology.

  14. Health technology assessment in Singapore. (United States)

    Pwee, Keng Ho


    The Republic of Singapore is an island city-state in Southeast Asia. Its population enjoys good health and the Singapore Ministry of Health's mission is to promote good health and reduce illness, ensure access to good and affordable health care, and pursue medical excellence. This is achieved through a healthcare system that includes both private and public sector elements. The financing philosophy of Singapore's healthcare delivery system is based on individual responsibility and community support. Health care in Singapore is financed by a combination of taxes, employee medical benefits, compulsory health savings, insurance, and out-of-pocket payment. The capability for health technology assessment in Singapore was developed concurrently with its medical device regulation system in the 1990s. The first formal unit with health technology assessment (HTA) functions was established in September 1995. Today, HTA features in decision making for the Standard Drug List, licensing of medical clinics, the Health Service Development Programme, healthcare subsidies, and policy development. The public sector healthcare delivery clusters have also recently started health services research units with HTA functions. Singapore is organizing the 6th Health Technology Assessment International (HTAi) Annual Meeting in June 2009. Bringing this prestigious international conference to Asia for the first time will help raise awareness of HTA in the region.

  15. A novel technology for quick acclimation of an anaerobic microbial consortia used for biodegrading teraphthalic acid(TA)

    Institute of Scientific and Technical Information of China (English)


    The seed sludge originated from a methane fermentation reactor was enriched and acclimated with TA as sole carbon source under nitrate respiration mode first for 6 week, and then can be turned to methane fermentation conditions. After 6 weeks processing, the specific rate acclimation. Aftera total of 90 days for the enrichment and acclimation, the fermentative bacteria which originally existed in the seed sludge nearly disappeared, and instead of them, the TA reductive and cleaving bacteria group was formed in the new consortia, which was confirmed by the MPN counts and roll tube counts. Compared with the control experiment, the acclimation period can be shortened by about 50%.

  16. Health technology assessment in Mexico. (United States)

    Gómez-Dantés, Octavio; Frenk, Julio


    The history of health technology assessment (HTA) in Mexico is examined, starting with the efforts to incorporate this topic into the policy agenda and culminating with the recent creation of a specialized public agency. Information was gathered through a bibliographic search and interviews with actors involved in HTA in Mexico. HTA efforts were developed in Mexico since the mid-1980s with the participation both of academics and of policy makers, a relationship that eventually led to the creation of the Center for Technological Excellence within the Ministry of Health. Institutionalization of HTA in resource-constrained settings requires the development of a critical mass of researchers involved in this field, the implementation of information efforts, and the establishment of strong relationships between HTA experts and policy makers.

  17. Technology Assessment Report: Aqueous Sludge Gasification Technologies (United States)

    The study reveals that sludge gasification is a potentially suitable alternative to conventional sludge handling and disposal methods. However, very few commercial operations are in existence. The limited pilot, demonstration or commercial application of gasification technology t...

  18. Evaluation and Assessment in Educational Information Technology. (United States)

    Liu, Leping, Ed.; Johnson, D. LaMont, Ed.; Maddux, Cleborne D., Ed.; Henderson, Norma J., Ed.

    This book contains the following articles on evaluating and assessing educational information technology: (1) "Assessing Learning in the New Age of Information Technology in Education" (Leping Liu, D. LaMont Johnson, Cleborne D. Maddux, and Norma J. Henderson); (2) "Instruments for Assessing the Impact of Technology in Education" (Rhonda…

  19. CRED REA Benthic Parameter Assessment at Ta'u Island, American Samoa in 2008 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Point-count surveys at 50-cm intervals were conducted along 2 consecutively placed, 25m line transect lines, as part of Rapid Ecological Assessments conducted at 9...

  20. HVDC power transmission technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Hauth, R.L.; Tatro, P.J.; Railing, B.D. [New England Power Service Co., Westborough, MA (United States); Johnson, B.K.; Stewart, J.R. [Power Technologies, Inc., Schenectady, NY (United States); Fink, J.L.


    The purpose of this study was to develop an assessment of the national utility system`s needs for electric transmission during the period 1995-2020 that could be met by future reduced-cost HVDC systems. The assessment was to include an economic evaluation of HVDC as a means for meeting those needs as well as a comparison with competing technologies such as ac transmission with and without Flexible AC Transmission System (FACTS) controllers. The role of force commutated dc converters was to be assumed where appropriate. The assessment begins by identifying the general needs for transmission in the U.S. in the context of a future deregulated power industry. The possible roles for direct current transmission are then postulated in terms of representative scenarios. A few of the scenarios are illustrated with the help of actual U.S. system examples. non-traditional applications as well as traditional applications such as long lines and asynchronous interconnections are discussed. The classical ``break-even distance`` concept for comparing HVDC and ac lines is used to assess the selected scenarios. The impact of reduced-cost converters is reflected in terms of the break-even distance. This report presents a comprehensive review of the functional benefits of HVDC transmission and updated cost data for both ac and dc system components. It also provides some provocative thoughts on how direct current transmission might be applied to better utilize and expand our nation`s increasingly stressed transmission assets.

  1. Technology modernization assessment flexible automation

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, D.W.; Boyd, D.R.; Hansen, N.H.; Hansen, M.A.; Yount, J.A.


    The objectives of this report are: to present technology assessment guidelines to be considered in conjunction with defense regulations before an automation project is developed to give examples showing how assessment guidelines may be applied to a current project to present several potential areas where automation might be applied successfully in the depot system. Depots perform primarily repair and remanufacturing operations, with limited small batch manufacturing runs. While certain activities (such as Management Information Systems and warehousing) are directly applicable to either environment, the majority of applications will require combining existing and emerging technologies in different ways, with the special needs of depot remanufacturing environment. Industry generally enjoys the ability to make revisions to its product lines seasonally, followed by batch runs of thousands or more. Depot batch runs are in the tens, at best the hundreds, of parts with a potential for large variation in product mix; reconfiguration may be required on a week-to-week basis. This need for a higher degree of flexibility suggests a higher level of operator interaction, and, in turn, control systems that go beyond the state of the art for less flexible automation and industry in general. This report investigates the benefits and barriers to automation and concludes that, while significant benefits do exist for automation, depots must be prepared to carefully investigate the technical feasibility of each opportunity and the life-cycle costs associated with implementation. Implementation is suggested in two ways: (1) develop an implementation plan for automation technologies based on results of small demonstration automation projects; (2) use phased implementation for both these and later stage automation projects to allow major technical and administrative risk issues to be addressed. 10 refs., 2 figs., 2 tabs. (JF)

  2. Technology-assisted dietary assessment (United States)

    Zhu, Fengqing; Mariappan, Anand; Boushey, Carol J.; Kerr, Deb; Lutes, Kyle D.; Ebert, David S.; Delp, Edward J.


    Dietary intake provides valuable insights for mounting intervention programs for prevention of disease. With growing concern for adolescent obesity, the need to accurately measure diet becomes imperative. Assessment among adolescents is problematic as this group has irregular eating patterns and have less enthusiasm for recording food intake. Preliminary studies among adolescents suggest that innovative use of technology may improve the accuracy of diet information from young people. In this paper, we propose a novel food record method using a mobile device that will provide an accurate account of daily food and nutrient intake among adolescents. Our approach includes the use of image analysis tools for identification and quantification of food consumption. Images obtained before and after food is consumed can be used to estimate the diet of an individual. In this paper we describe our initial results and indicate the potential of the proposed system.


    Directory of Open Access Journals (Sweden)

    Larisa Alexejevna Ismagilova


    Full Text Available We consider the topical issue of implementation of innovative technologies in the aircraft engine building industry. In this industry, products with high reliability requirements are developed and mass-produced. These products combine the latest achievements of science and technology. To make a decision on implementation of innovative technologies, a comprehensive assessment is carried out. It affects the efficiency of the innovations realization. In connection with this, the assessment of quality of innovative technologies is a key aspect in the selection of technological processes for their implementation. Problems concerning assessment of the quality of new technologies and processes of production are considered in the suggested method with respect to new positions. The developed method of assessing the quality of innovative technologies stands out for formed system of the qualimetric characteristics ensuring the effectiveness, efficiency, adaptability of innovative technologies and processes. The feature of suggested system of assessment is that it is based on principles of matching and grouping of quality indicators of innovative technologies and the characteristics of technological processes. The indicators are assessed from the standpoint of feasibility, technologies competiveness and commercial demand of products. In this paper, we discuss the example of implementing the approach of assessing the quality of the innovative technology of high-tech products such as turbine aircraft engine.

  4. Decentralized Solar Energy Technology Assessment Program: review of activities (April 1978-December 1979)

    Energy Technology Data Exchange (ETDEWEB)

    Bronfman, B.H.; Carnes, S.A.; Schweitzer, M.; Peelle, E.; Enk, G.


    The Decentralized Solar Energy Technology Assessment Program (TAP), sponsored by the Office of Solar Energy, Department of Energy, is a technology assessment and planning activity directed at local communities. Specifically, the objectives of the TAP are: (1) to assess the socioeconomic and institutional impacts of the widespread use of renewable energy technologies; (2) to involve communities in planning for their energy futures; and (3) to plan for local energy development. This report discusses two major efforts of the TAP during the period April 1978 to December 1979: the community TA's and several support studies. Four communities have been contracted to undertake an assessment-planning exercise to examine the role of solar renewable energy technologies in their future. The communities selected are the Southern Tier Central Region of New York State, (STC); Richmond, Kentucky, Kent, Ohio; and Franklin County, Massachusetts. Descriptions and progress to date of the community TA's are presented in detail. Two major support study efforts are also presented. A review of existing literature on the legal and institutional issues relative to the adoption of decentralized solar technologies is summarized. A preliminary analysis of potential socioeconomic impacts and other social considerations relative to decentralized solar technologies is also described.

  5. Modelling in Medical Technology Assessment

    NARCIS (Netherlands)

    B.C. Michel (Bowine)


    textabstractHealth care is a rapidly developing field in which new technologies are introduced continuously. Not all new technologies have the same impact however: most represent only small changes in existing technologies, whereas only a few - like organ transplants - really are revolutionary new d

  6. Liquefaction technology assessment. Final report

    Energy Technology Data Exchange (ETDEWEB)


    A survey of coal liquefaction technology and analysis of projected relative performance of high potential candidates has been completed and the results are reported here. The key objectives of the study included preparation of a broad survey of the status of liquefaction processes under development, selection of a limited number of high potential process candidates for further study, and an analysis of the relative commercial potential of these candidates. Procedures which contributed to the achievement of the above key goals included definition of the characteristics and development status of known major liquefaction process candidates, development of standardized procedures for assessing technical, environmental, economic and product characteristics for the separate candidates, and development of procedures for selecting and comparing high potential processes. The comparisons were made for three production areas and four marketing areas of the US. In view of the broad scope of the objectives the survey was a limited effort. It used the experience gained during preparation of seven comprehensive conceptual designs/economic evaluations plus comprehensive reviews of the designs, construction and operation of several pilot plants. Results and conclusions must be viewed in the perspective of the information available, how this information was treated, and the full context of the economic comparison results. Comparative economics are presented as ratios; they are not intended to be predictors of absolute values. Because the true cost of constructing and operating large coal conversion facilities will be known only after commercialization, relative values are considered more appropriate. (LTN)

  7. Social Shaping in Danish Technology Assessment

    DEFF Research Database (Denmark)

    Hansen, Anne Grethe; Clausen, Christian


    for technology policy initiatives at the beginning of the new millennium, as prerequisites for socially feasible and desirable technology development and innovation. On the basis of the Danish technology assessments of the 1980s, it is argued that technology assessments and the social shaping perspectives...... in these projects contributed to new insights into the processes of technological change and thus to policy formulation. The social shaping perspective and technology assessment experiences are suggested as important guides to future technology strategies.......The term ‘social shaping of technology’ has been used broadly as a response to techno-economic deterministic understandings of the relations between technology and society. Social shaping has brought together analysts from different backgrounds who share a common interest in the role of social...

  8. Establishment of Health Technology Assessment in Iran

    Directory of Open Access Journals (Sweden)

    Shila Doaee


    Full Text Available Objective: Health Technology Assessment (HTA aims at informing healthcare policymakers, managers and practitioners of the "clinical consequences, but also the economic, ethical, and other social implications of the diffusion and use of a specific procedure or technique on medical practice". So considering the policy-oriented nature of HTA that calls for a close integration into the functioning and governance of health systems the present study focuses on executive processes and function of the HTA office of Iran.Materials and methods: Data of this review study were collected through documented sources and observations from 2007 to 2010.Results: Health Technology Assessment began its activities as a secretariat in the Deputy of Health in 2007 and it continues as a Health Technology Assessment Office at the Management of Health Technology Assessment, Standardization, and Tariff at the Deputy of curative affairs of MOHME in the beginning of 2010.14 Technology of modern medical equipment and 8 pharmaceutical medicine are assessed, Now many of measures for HTA establishment  such as cooperation National Institute of Health Research (NIHR, Holding scientific committee meetings, Establishing  the  Master's degree of  health technology assessment ,Building capacities for health technology assessment through education in major universities of the country.Conclusion: pay attention to health technology assessment, selection and application of proper technologies in the frameworks of policy-making and managerial strategies and make efforts to develop it with the support of the governmental in Iran is necessary.



    Universe" ...................................... 5 Figure 4: MEA Architecture [60...weight. Figure 4: MEA Architecture [60] 2.2 How Does Ga2O3 Compare to Other Semiconductors? We are paying attention to β-Ga2O3 because of its...growth is possible. • Limited crystal orientation have been demonstrated. • Technology base is narrowly located in Japan . Mainstream technology

  10. Technology for Online Portfolio Assessment Programs (United States)

    Ferrara, Victoria M.


    Portfolio assessment is a valid and reliable method to assess experiential learning. Developing a fully online portfolio assessment program is neither easy nor inexpensive. The institution seeking to take its portfolio assessment program online must make a commitment to its students by offering the technologies most suited to meet students' needs.…



    Larisa Alexejevna Ismagilova; Nadegda Aleksandrovna Sukhova


    We consider the topical issue of implementation of innovative technologies in the aircraft engine building industry. In this industry, products with high reliability requirements are developed and mass-produced. These products combine the latest achievements of science and technology. To make a decision on implementation of innovative technologies, a comprehensive assessment is carried out. It affects the efficiency of the innovations realization. In connection with this, the assessment of qu...

  12. Life Cycle Assessment of Slurry Management Technologies

    DEFF Research Database (Denmark)

    Wesnæs, Marianne; Wenzel, Henrik; Petersen, Bjørn Molt

    This report contains the results of Life Cycle Assessments of two slurry management technologies - acidification and decentred incineration. The LCA foundation can be used by the contributing companies for evaluating the environmental sustainability of a specific technology from a holistic Life...... Cycle perspective. Through this the companies can evaluate the environmental benefits and disadvantages of introducing a specific technology for slurry management. From a societal perspective the results can contribute to a clarification of which slurry management technologies (or combination...

  13. Civil Engineering Technology Needs Assessment. (United States)

    Oakland Community Coll., Farmington, MI. Office of Institutional Planning and Analysis.

    In 1991, a study was conducted by Oakland Community College (OCC) to evaluate the need for a proposed Civil Engineering Technology program. An initial examination of the literature focused on industry needs and the job market for civil engineering technicians. In order to gather information on local area employers' hiring practices and needs, a…

  14. Knowledge in health technology assessment

    DEFF Research Database (Denmark)

    Tjørnhøj-Thomsen, Tine; Hansen, Helle Ploug


    to generate knowledge and evidence about the patient aspects of a given technology. This raises questions about how knowledge is produced in HTA reports and what kind of knowledge is considered relevant. This article uses a Danish HTA on patient education from 2009 as empirical material for a critical...... examination and discussion of knowledge and knowledge production about the patient aspects of HTA....

  15. Wireless technology for ABC Assessment

    DEFF Research Database (Denmark)

    Kristensen, Margit; Kyng, Morten; Christensen, Erika Frischknecht;

      In medical emergency service (EMS) the ABC status (Airway-Breathing-Circulation) of victims is essential in the decision making process regarding prioritizing and treatment. Today's use of information technology does, however, not inform directly about "A" and "B". The parameters are evaluated ...

  16. Potentiometric RuO2-Ta2O5 pH sensors fabricated using thick film and LTCC technologies. (United States)

    Manjakkal, Libu; Zaraska, Krzysztof; Cvejin, Katarina; Kulawik, Jan; Szwagierczak, Dorota


    The paper reports on the preparation, properties and application of potentiometric pH sensors with thick film RuO2-Ta2O5 sensing electrode and Ag/AgCl/KCl reference electrode screen printed on an alumina substrate. Furthermore, it presents fabrication procedure and characterization of a new miniaturized pH sensor on LTCC (low temperature cofired ceramics) substrate, destined for wireless monitoring. The crystal structure, phase and elemental composition, and microstructure of the films were investigated by X-ray diffractometry, Raman spectroscopy, scanning electron microscopy and energy dispersive spectroscopy. Potentiometric characterization was performed in a wide pH range of 2-12 for different storage conditions and pH loops. The advantages of the proposed thick film pH sensors are: (a) low cost and easy fabrication, (b) excellent sensitivity close to the Nernstian response (56mV/pH) in the wide pH range, (c) fast response, (d) long lifetime, (e) good reproducibility, (f) low hysteresis and drift effects, and (g) low cross-sensitivity towards Li(+), Na(+) and K(+) as interfering ions. The applicability of the sensors for pH measurement of river, tap and distilled water, and some drinks was also tested.

  17. Landslide risk assessment in the Göta Älv river valley to limit consequences of climate change on society (United States)

    Hedlund, Jonas; Lind, Bo; Tremblay, Marius; Zackrisson, Peter; Cederbom, Charlotte


    Higher temperatures, higher average precipitation and increased occurrence of extreme rainfall events are some expected climate changes in Sweden during the coming 70-100 years. Due to the changing climate the risk for floods, erosion and landslides are expected to increase. in large parts of the country. To prevent extensive floodings and damages of cities and infrastructure around Lake Vänern, it is necessary to allow controlled overflow from Lake Vänern through the river Göta Älv. An overflow in the river, in turn, leads to increased risk for erosion and landslides along the Göta Älv valley. In order to meet the upcoming climate changes and to handle the increasing flows through the river, we need to improve the knowledge of the stability of the entire river bank. The Swedish Government has commissioned the Swedish Geotechnical Institute (SGI) to investigate the landslide potential of the Göta Älv valley, taking the predicted climate changes into consideration. The investigated area includes the parts of Göta Älv that could be affected by the increased flows from Lake Vänern; areas where the increased flow will affect stability and where landslides could cause serious damages or damming of the river. The investigation area includes c. 90 km of the Göta Älv river plus tributaries in connection to Göta Älv. In the landslide risk analyses developed for Göta Älv, the likelihood of landslides and estimation of the subsequent consequences are included. The methodology involves mapping of landslide hazards and a judgement of the risk area on the basis of a risk matrix. The landslide risk analysis allows for an assessment of where geotechnical reinforcements would be necessary. A cost estimation for the required reinforcement measures is also provided. In areas where the estimated risk for a landslide is low (e.g. limited consequences), stability mapping in accordance with the model used by the Swedish Civil Contingencies Agency (MSB) is developed

  18. Technologies Assessing Limb Bradykinesia in Parkinson's Disease. (United States)

    Hasan, Hasan; Athauda, Dilan S; Foltynie, Thomas; Noyce, Alastair J


    The MDS-UPDRS (Movement Disorders Society - Unified Parkinson's Disease Rating Scale) is the most widely used scale for rating impairment in PD. Subscores measuring bradykinesia have low reliability that can be subject to rater variability. Novel technological tools can be used to overcome such issues. To systematically explore and describe the available technologies for measuring limb bradykinesia in PD that were published between 2006 and 2016. A systematic literature search using PubMed (MEDLINE), IEEE Xplore, Web of Science, Scopus and Engineering Village (Compendex and Inspec) databases was performed to identify relevant technologies published until 18 October 2016. 47 technologies assessing bradykinesia in PD were identified, 17 of which offered home and clinic-based assessment whilst 30 provided clinic-based assessment only. Of the eligible studies, 7 were validated in a PD patient population only, whilst 40 were tested in both PD and healthy control groups. 19 of the 47 technologies assessed bradykinesia only, whereas 28 assessed other parkinsonian features as well. 33 technologies have been described in additional PD-related studies, whereas 14 are not known to have been tested beyond the pilot phase. Technology based tools offer advantages including objective motor assessment and home monitoring of symptoms, and can be used to assess response to intervention in clinical trials or routine care. This review provides an up-to-date repository and synthesis of the current literature regarding technology used for assessing limb bradykinesia in PD. The review also discusses the current trends with regards to technology and discusses future directions in development.

  19. Carbon Capture: A Technology Assessment (United States)


    time. The absence of a significant market for the novel technologies put them at a further disadvantage . This is similar to the situation for CO2...the overall CCS process applied to a power plant or other industrial process. The CO2 produced from carbon in the fossil fuels or biomass feedstock...Air or Oxygen Fossil Fuels; Biomass USEFUL PRODUCTS (e.g., electricity, fuels, chemicals, hydrogen) CO2 CO2 Capture & Compress CO2 Transport CO2

  20. Assessing medical technologies in development; a new paradigm of medical technology assessment

    NARCIS (Netherlands)

    Hummel, J. Marjan; van Rossum, Wouter; Verkerke, Gijsbertus Jacob; Rakhorst, Gerhard


    Objective: Our study aims to provide a practical contribution to the field of medical technology assessment within a new paradigm. This paradigm indicates the need for more comprehensive technology assessments in the development stage of a new technology. - Method: We introduce a method, based on

  1. Assessing medical technologies in development - A new paradigm of medical technology assessment

    NARCIS (Netherlands)

    Hummel, MJM; van Rossum, W; Verkerke, GJ; Rakhorst, G


    Objective: Our study aims to provide a practical contribution to the field of medical technology assessment within a new paradigm. This paradigm indicates the need for more comprehensive technology assessments in the development stage of a new technology. Method: We introduce a method, based on Saat

  2. Automatization of Student Assessment Using Multimedia Technology. (United States)

    Taniar, David; Rahayu, Wenny

    Most use of multimedia technology in teaching and learning to date has emphasized the teaching aspect only. An application of multimedia in examinations has been neglected. This paper addresses how multimedia technology can be applied to the automatization of assessment, by proposing a prototype of a multimedia question bank, which is able to…

  3. On Quality Assessment of Learning Technology Specifications

    NARCIS (Netherlands)

    Janssen, José; Berlanga, Adriana; Koper, Rob


    Janssen, J., Berlanga, A. J., & Koper, R. (2012). On Quality Assessment of Learning Technology Specifications. In J. C. Ramalho, A. Simões, & R. Queirós (Eds.). Innovations in XML Applications and Metadata Management: Advancing Technologies (pp. 78-95). Hershey, PA, USA: IGI Global. Below file

  4. A Suite of Tools for Technology Assessment (United States)


    Saden, Povinelli & Rosen, 1989). • This was a significant change in emphasis on the part of NASA, where technology had previously viewed as merely...Cost Analysis Symposium, April 13, 2005. A Suite of Tools for Technology Assessment 24 Bibliography - continued: • Sadin, Stanley T.; Povinelli

  5. The internationalization of health technology assessment. (United States)

    Menon, D; Marshall, D


    Health technology assessment as a formalized set of activities has a relatively short history. At its current stage of development, it is clear that it has global dimensions and impact. In this paper we review the history of health technology assessment, its development as a form of health services research, and its "institutionalization." We then identify the reasons for its internationalization, review current international initiatives, and propose actions to be taken to improve cooperation among countries.

  6. Health technology assessment. Evaluation of biomedical innovative technologies. (United States)

    Turchetti, Giuseppe; Spadoni, Enza; Geisler, Eliezer Elie


    This article describes health technology assessment (HTA) as an evaluation tool that applies systematic methods of inquiry to the generation and use of health technologies and new products. The focus of this article is on the contributions of HTA to the management of the new product development effort in the biomedical organization. Critical success factors (CSFs) are listed, and their role in assessing success is defined and explained. One of the conclusions of this article is that HTA is a powerful tool for managers in the biomedical sector, allowing them to better manage their innovation effort in their continuing struggle for competitiveness and survival.

  7. The social function of technology assessment (United States)

    Huddle, F. P.


    The problem of preserving the uneasy balance between a dynamic society and the equilibrium of man-environment society is discussed. Four sets of activities involved in technology assessment are considered: (1) Technology forecasting is necessary to warn of future dangers and opportunities, for effective timing, and to identify tradeoffs and alternatives. But forecasting is also chancy at best. (2) Social indicators need to be developed for the characterization of social status and measurement of social progress, as well as a better understanding of social needs. (3) With respect to technology assessment, the conflict between profitable directions of innovations and socially desirable directions is described, and a systematic way is needed to determine in advance what is technologically feasible to meet social needs. (4) National goals with respect to scientific and technological developments are also required.

  8. Too many cooks batter technology assessment. (United States)

    Wagner, M


    The bustling activity and interest in technology assessment obscures two growing problems. More than 70 groups, sporting a variety of agendas, are involved in assessing new devices, drugs and procedures; variations in the information they seek or the methods they use sometimes produce findings that conflict or can't be compared.

  9. An environmental assessment system for environmental technologies

    DEFF Research Database (Denmark)

    Clavreul, Julie; Baumeister, Hubert; Christensen, Thomas Højlund


    A new model for the environmental assessment of environmental technologies, EASETECH, has been developed. The primary aim of EASETECH is to perform life-cycle assessment (LCA) of complex systems handling heterogeneous material flows. The objectives of this paper are to describe the EASETECH...

  10. An environmental assessment system for environmental technologies

    DEFF Research Database (Denmark)

    Clavreul, Julie; Baumeister, Hubert; Christensen, Thomas Højlund;


    A new model for the environmental assessment of environmental technologies, EASETECH, has been developed. The primary aim of EASETECH is to perform life-cycle assessment (LCA) of complex systems handling heterogeneous material flows. The objectives of this paper are to describe the EASETECH...

  11. Assessment and Learning Technologies: An Overview (United States)

    Farrell, Treasa; Rushby, Nick


    Assessment pervades the learning process. This paper provides an overview of the application of technology to support and enhance diagnostic, formative and summative assessment. The focus is on examining how it can replace what already exists, improve the functionality, catalyse a redesign of the process and in some circumstances, make possible…

  12. Spent Nuclear Fuel Alternative Technology Risk Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Perella, V.F.


    A Research Reactor Spent Nuclear Fuel Task Team (RRTT) was chartered by the Department of Energy (DOE) Office of Spent Fuel Management with the responsibility to recommend a course of action leading to a final technology selection for the interim management and ultimate disposition of the foreign and domestic aluminum-based research reactor spent nuclear fuel (SNF) under DOE''s jurisdiction. The RRTT evaluated eleven potential SNF management technologies and recommended that two technologies, direct co-disposal and an isotopic dilution alternative, either press and dilute or melt and dilute, be developed in parallel. Based upon that recommendation, the Westinghouse Savannah River Company (WSRC) organized the SNF Alternative Technology Program to further develop the direct co-disposal and melt and dilute technologies and provide a WSRC recommendation to DOE for a preferred SNF alternative management technology. A technology risk assessment was conducted as a first step in this recommendation process to determine if either, or both, of the technologies posed significant risks that would make them unsuitable for further development. This report provides the results of that technology risk assessment.

  13. Health technology assessment and thyroid surgery. (United States)

    Lucchini, R; Sanguinetti, A; Monacelli, M; Triola, R; Avenia, S; Conti, C; Santoprete, S; Avenia, N


    The growth of technological innovation, the request for assistance, the rising patient's expectations and the interest of the industry have led to a rise in the cost of health care systems. In this context the role of the National Health System is not to delay the development or adoption of new technologies, but rather to drive the development selecting priorities and promoting its use. Health Technology Assessment (HTA) is a multidisciplinary and multidimensional approach for analyzing the medical-clinical, social, organizational, economic, ethical and legal implications of a technology (devices, drugs, procedures) through the assessment of multiple parameters such as effectiveness, safety, costs of the social and organizational impact. A health technology assessment is a comprehensive, systematic evaluation of the prerequisites for estimating the consequences of using health technology. Main characteristic of HTA is that the problem is tackled using an approach focused on four main elements: - technology; - patient; - organization; - economy. The authors have applied the HTA method for the analysis of the ultrasonic focus dissector on thyroid surgery. They compared the cost of the surgical procedure using the ultrasonic dissector and without it in a case study of 440 patients who underwent thyroidectomy.

  14. Health Technology Assessment and patient safety

    Directory of Open Access Journals (Sweden)

    Andrew Mulcahy


    Full Text Available

    Health Technology Assessment (HTA is a process used to evaluate the clinical effectiveness and costeffectiveness of health technologies by a systematic review of clinical, economic, and utilization research.

    Despite widespread investment in patient safety technologies in the U.K., U.S., and elsewhere, little HTA has been done to establish the clinical or cost-effectiveness of these technologies. The HTA and patient safety literature suggests there are four categories of patient safety HTA, including HTA for existing safety technologies, underutilized safety technologies, emerging safety technologies, as well as safety aspects of technologies with a non-safety primary purpose.

    Recent HTA and other research, including a 2002 evidencebased evaluation of patient safety technologies from the U.S. Agency for Health Research and Quality, provide an important foundation for a more comprehensive approach to patient safety HTA. However, HTA programs must address prioritization, methodology, and dissemination challenges introduced by patient safety technologies before significant progress can Te made.

  15. Web TA Production (WebTA) (United States)

    US Agency for International Development — WebTA is a web-based time and attendance system that supports USAID payroll administration functions, and is designed to capture hours worked, leave used and...

  16. Diabetes and Technology for Increased Activity (DaTA Study: The effects of exercise and technology on heart rate variability and metabolic syndrome risk factors.

    Directory of Open Access Journals (Sweden)

    Melanie I Stuckey


    Full Text Available This study tested the hypothesis that an eight-week exercise intervention supported by mobile health (mHealth technology would improve metabolic syndrome (MetS risk factors and heart rate variability (HRV in a population with MetS risk factors. Participants (n=12; 3 male; aged 56.9±7.0y reported to the laboratory for assessment of MetS risk factors and fitness (VO2max at baseline (V0 and after eight-weeks (V2 of intervention. Participants received an individualized exercise prescription and a mHealth technology kit for remote monitoring of blood pressure (BP, blood glucose, physical activity and body weight via smartphone. Participants underwent 24-h ambulatory monitoring of R-R intervals following V0 and V2. Low and high frequency powers of HRV were assessed from the recording and the ratio of low-to-high frequency powers and low and high frequency power in normalized units were calculated. One-way repeated measures analysis of variance showed that waist circumference (V0: 113.1±11.0cm, V2: 108.1±14.7cm; p=0.004 and diastolic BP (V0: 81±6mmHg, V2: 76±11mmHg; p=0.04 were reduced and VO2max increased (V0: 31.3ml/kg/min, V2: 34.8ml/kg/min; p=0.02 with no changes in other MetS risk factors. Low and high frequency powers in normalized units were reduced (V0: 75.5±12.0, V2: 72.0±12.1; p=0.03 and increased (V0: 24.5±12.0, V2: 28.0±12.1; p=0.03, respectively, with no other changes in HRV. Over the intervention period, changes in systolic BP were correlated negatively with the changes in R-R interval (r=-0.600; p=0.04 and positively with the changes in heart rate (r=0.611; p=0.03, with no other associations between MetS risk factors and HRV parameters. Thus, this eight-week mHealth supported exercise intervention improved MetS risk factors and HRV parameters, but only changes in systolic BP were associated with improved autonomic function.

  17. Independent Assessment of Technology Characterizations to Support the Biomass Program Annual State-of-Technology Assessments

    Energy Technology Data Exchange (ETDEWEB)

    Yeh, B.


    This report discusses an investigation that addressed two thermochemical conversion pathways for the production of liquid fuels and addressed the steps to the process, the technology providers, a method for determining the state of technology and a tool to continuously assess the state of technology. This report summarizes the findings of the investigation as well as recommendations for improvements for future studies.

  18. Status and assessment of photovoltaic technologies (United States)

    Kazmerski, L. L.

    The history and status of the current photovoltaic technologies are reviewed and evaluated. The problems and strengths of single-crystal, polycrystalline, and amorphous technologies are discussed, compared, and assessed. Single-junction and multiple-junction or tandem cell configurations are evaluated for performance, processing, and engineering criteria. Some emphasis is placed on the emerging thin film options for low cost terrestrial applications. The basic photovoltaic system building block, the solar cell, is discussed along with important module developments and problems. Future technology and research directions are provided for materials, cells, and modules.

  19. Status and assessment of photovoltaic technologies

    Energy Technology Data Exchange (ETDEWEB)

    Kazmerski, L.L. (Solar Energy Research Inst., Golden, CO (USA))


    The history and status of the current photovoltaic technologies are reviewed and evaluated. The problems and strengths of single-crystal, polycrystalline, and amorphous technologies are discussed, compared and assessed. Single-junction and multiple-junction or tandem cell configurations are evaluated for performance, processing, and engineering criteria. Some emphasis is placed on the emerging thin film options for low cost terrestrial applications. Discussions centre around the basic photovoltaic system building block, the solar cell, but important module developments and problems are cited. Future technology and research directions are provided for materials, cells, and modules. (author).

  20. Evidence review of technology and dietary assessment. (United States)

    Long, JoAnn D; Littlefield, Laurel A; Estep, Gary; Martin, Hope; Rogers, Toby J; Boswell, Carol; Shriver, Brent J; Roman-Shriver, Carmen R


    Diets high in fruit and vegetable consumption are associated with a decrease in chronic diseases. Dietary factors are linked to 4 of the 10 leading noncommunicable causes of death: cardiovascular disease, some cancers, stroke, and type 2 diabetes. Accurately measuring dietary patterns has many challenges. Dietary intake measurement has traditionally relied on self-report instruments such as 24-hour recall, food record, and food frequency questionnaires to record consumption history. These methods have inherent limitations in detecting small but important changes in fruit and vegetable consumption patterns. Promising advances in technology have made more sophisticated techniques for recording dietary intake possible. Computers and Web-based programs, handheld personal digital assistants with cameras and telephone cards, smart phones, cameras, and video recorders options may reduce the burden of recording what has been consumed. Furthermore, technology-based methods of dietary assessment may provide a higher degree of reliability and validity in visually determining fruit and vegetable consumption, and additional study is warranted. The purpose of this article is to present a review of the evidence on the effectiveness of technology-based methods for dietary assessment, which included fruit and vegetable consumption. One hundred and eighty-seven articles published between 1998 and 2008 were initially identified. Fifteen met the study inclusion criteria and were evaluated by an interdisciplinary team using the Stetler Strength of Evidence Scale. Six technology-based methods for dietary assessment were identified. Findings from validity and reliability testing of technology-based methods are encouraging and need replication. Clinically important features offered through technology may reduce reporting burden and offer behavioral feedback to users. Methodologically sound, empirical research into using technology-based application for dietary assessment in a variety of

  1. A Health Technology Assessment: laparoscopy versus colpoceliotomy. (United States)

    Damonti, A; Ferrario, L; Morelli, P; Mussi, M; Patregnani, C; Garagiola, E; Foglia, E; Pagani, R; Carminati, R; Porazzi, E


    The objective of this paper is the comparison between two different technologies used for the removal of a uterine myoma, a frequent benign tumor: the standard technology currently used, laparoscopy, and an innovative one, colpoceliotomy. It was considered relevant to evaluate the real and the potential effects of the two technologies implementation and, in addition, the consequences that the introduction or exclusion of the innovative technology would have for both the National Health System (NHS) and the entire community. The comparison between these two different technologies, the standard and the innovative one, was conducted using a Health Technology Assessment (HTA). In particular, in order to analyse their differences, a multi-dimensional approach was considered: effectiveness, costs and budget impact analysis data were collected, applying different instruments, such as the Activity Based Costing methodology (ABC), the Cost-Effectiveness Analysis (CEA) and the Budget Impact Analysis (BIA). Organisational, equity and social impact were also evaluated. The results showed that the introduction of colpoceliotomy would provide significant economic savings to the Regional and National Health Service; in particular, a saving of € 453.27 for each surgical procedure. The introduction of the innovative technology, colpoceliotomy, could be considered a valuable tool; one offering many advantages related to less invasiveness and a shorter surgical procedure than the standard technology currently used (laparoscopy).

  2. Sustainability assessment of advanced wastewater treatment technologies

    DEFF Research Database (Denmark)

    Høibye, Linda; Clauson-Kaas, Jes; Wenzel, Henrik


    As a consequence of the EU Water Framwork Directive, more focus is now on discharges of hazardous substances from wastewater treatment plants and sewers. Thus, many municipalities in Denmark may have to adopt to future advenced treatment technologies. This paper describes a holistic assessment...... of sustainability, sand filtration is the most advantageous method based on the technical and environmental assessment due to the low energy consumption and high efficiency with regard to the removal of heavy metals....

  3. Broadband Satellite Technologies and Markets Assessed (United States)

    Wallett, Thomas M.


    The current usage of broadband (data rate greater than 64 kilobits per second (kbs)) for multimedia network computer applications is increasing, and the need for network communications technologies and systems to support this use is also growing. Satellite technology will likely be an important part of the National Information Infrastructure (NII) and the Global Information Infrastructure (GII) in the next decade. Several candidate communications technologies that may be used to carry a portion of the increased data traffic have been reviewed, and estimates of the future demand for satellite capacity have been made. A study was conducted by the NASA Lewis Research Center to assess the satellite addressable markets for broadband applications. This study effort included four specific milestones: (1) assess the changing nature of broadband applications and their usage, (2) assess broadband satellite and terrestrial technologies, (3) estimate the size of the global satellite addressable market from 2000 to 2010, and (4) identify how the impact of future technology developments could increase the utility of satellite-based transport to serve this market.

  4. Community Needs Assessment Office Administration & Technology (OAT). (United States)

    Pezzoli, J. A.; Lum, Ku'uipo; Meyer, Diane

    The purpose of this survey was to obtain from employers the requisite skills and potential employment demand for office workers on Maui. Of particular interest was: (1) the assessment of various clerical skills and computer software in its relevance to the Office Administration & Technology (OAT) curriculum at Maui Community College; and (2)…

  5. Teacher Learning of Technology Enhanced Formative Assessment (United States)

    Feldman, Allan; Capobianco, Brenda M.


    This study examined the integration of technology enhanced formative assessment (FA) into teachers' practice. Participants were high school physics teachers interested in improving their use of a classroom response system (CRS) to promote FA. Data were collected using interviews, direct classroom observations, and collaborative discussions. The…

  6. An assessment of information communication technology content ...

    African Journals Online (AJOL)

    An assessment of information communication technology content, context and process dimensions in public health facilities in Machakos and Nairobi ... to lack of support from hospital top management team (χ 9.44, d.f.=4 and p=0.005).

  7. Technology and the issues facing nursing assessment. (United States)

    Ansell, Helen; Meyer, Alannah; Thompson, Shona

    This article describes an investigation into the use of technology and the issues nurses face undertaking nursing assessment. It reports qualitative, descriptive research involving interviews with ten ward nurses from three hospitals in New Zealand. Thematic analysis of the data revealed three key issues: the impact of technology, the influence of early warning systems and nurse autonomy. Results show how clinical decision making around nursing assessment is influenced by technology and the Early Warning Score. These clinical decisions may not always be informed by critical thinking in complex healthcare environments. The article concludes that nurse autonomy, while supported and endorsed in theory, is frequently in conflict with hospital risk-management policies and the use of prescriptive algorithms.

  8. Biomass Gasification Technology Assessment: Consolidated Report

    Energy Technology Data Exchange (ETDEWEB)

    Worley, M.; Yale, J.


    Harris Group Inc. (HGI) was commissioned by the National Renewable Energy Laboratory to assess gasification and tar reforming technologies. Specifically, the assessments focused on gasification and tar reforming technologies that are capable of producing a syngas suitable for further treatment and conversion to liquid fuels. HGI gathered sufficient information to analyze three gasification and tar reforming systems. This report summarizes the equipment, general arrangement of the equipment, operating characteristics, and operating severity for each technology. The order of magnitude capital cost estimates are supported by a basis-of-estimate write-up, which is also included in this report. The report also includes Microsoft Excel workbook models, which can be used to design and price the systems. The models can be used to analyze various operating capacities and pressures. Each model produces a material balance, equipment list, capital cost estimate, equipment drawings and preliminary general arrangement drawings. Example outputs of each model are included in the Appendices.

  9. Assessment of Sensor Technologies for Advanced Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Korsah, Kofi [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ramuhalli, Pradeep [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Vlim, R. [Argonne National Lab. (ANL), Argonne, IL (United States); Kisner, Roger A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Britton, Jr, Charles L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wootan, D. W. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anheier, Jr, N. C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Diaz, A. A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hirt, E. H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chien, H. T. [Argonne National Lab. (ANL), Argonne, IL (United States); Sheen, S. [Argonne National Lab. (ANL), Argonne, IL (United States); Bakhtiari, Sasan [Argonne National Lab. (ANL), Argonne, IL (United States); Gopalsami, S. [Argonne National Lab. (ANL), Argonne, IL (United States); Heifetz, A. [Argonne National Lab. (ANL), Argonne, IL (United States); Tam, S. W. [Argonne National Lab. (ANL), Argonne, IL (United States); Park, Y. [Argonne National Lab. (ANL), Argonne, IL (United States); Upadhyaya, B. R. [Univ. of Tennessee, Knoxville, TN (United States); Stanford, A. [Univ. of Tennessee, Knoxville, TN (United States)


    Sensors and measurement technologies provide information on processes, support operations and provide indications of component health. They are therefore crucial to plant operations and to commercialization of advanced reactors (AdvRx). This report, developed by a three-laboratory team consisting of Argonne National Laboratory (ANL), Oak Ridge National Laboratory (ORNL) and Pacific Northwest National Laboratory (PNNL), provides an assessment of sensor technologies and a determination of measurement needs for AdvRx. It provides the technical basis for identifying and prioritizing research targets within the instrumentation and control (I&C) Technology Area under the Department of Energy’s (DOE’s) Advanced Reactor Technology (ART) program and contributes to the design and implementation of AdvRx concepts.

  10. Constructive Technology Assessment for HIT development

    DEFF Research Database (Denmark)

    Høstgaard, Anna Marie Balling; Bertelsen, Pernille; Petersen, Lone Stub


    Experience and time has shown a need for new evaluation methods for evaluating Health Information Technology (HIT), as summative evaluation methods fail to accommodate the rapid and constant changes in HIT over time and to involve end-users, which has been recognized as an important success factor...... in HIT development. A new evaluation methodology, including an analytical framework, has been developed specifically for HIT development: Constructive Technology Assessment (CTA) for HIT. It offers solutions to both the problems associated with summative technology evaluation and a way to involve end......-users. The CTA methodology is based on a Socio-technical understanding of technological development as an open ended, emergent process. The CTA was used during the EHR development process in the Region of North Jutland where it proved successful inproviding learning and feedback between all relevant groups...

  11. Sustainability assessment of advanced wastewater treatment technologies

    DEFF Research Database (Denmark)

    Høibye, Linda; Clauson-Kaas, Jes; Wenzel, Henrik


    , which includes technical, economic and environmental aspects. The technical and economic assessment is performed on 5 advanced treatment technologies: sand filtration, ozone treatment, UV exclusively for disinfection of pathogenic microorganisms, Membrane Bioreactor (MBR), and UV in combination...... and three advanced treatment methods: sand filtration, ozone treatment and MBR. The technical and economic assessment showed that UV solely for disinfection purposes or ozone treatment are the most advantageous advanved treatment methods if the demands are restricted to pathogenic microorganisms. In terms......As a consequence of the EU Water Framwork Directive, more focus is now on discharges of hazardous substances from wastewater treatment plants and sewers. Thus, many municipalities in Denmark may have to adopt to future advenced treatment technologies. This paper describes a holistic assessment...

  12. Sustainability assessment of advanced wastewater treatment technologies. (United States)

    Høibye, L; Clauson-Kaas, J; Wenzel, H; Larsen, H F; Jacobsen, B N; Dalgaard, O


    As a consequence of the EU Water Framework Directive more focus is now on discharges of hazardous substances from wastewater treatment plants and sewers. Thus, many municipalities in Denmark may have to adopt to future advanced treatment technologies. This paper describes a holistic assessment, which includes technical, economical and environmental aspects. The technical and economical assessment is performed on 5 advanced treatment technologies: sand filtration, ozone treatment, UV exclusively for disinfection of pathogenic microorganisms, membrane bioreactor (MBR) and UV in combination with advanced oxidation. The technical assessment is based on 12 hazardous substances comprising heavy metals, organic pollutants, endocrine disruptors as well as pathogenic microorganisms. The environmental assessment is performed by life cycle assessment (LCA) comprising 9 of the specific hazardous substances and three advanced treatment methods; sand filtration, ozone treatment and MBR. The technical and economic assessment showed that UV solely for disinfection purposes or ozone treatment is the most advantageous advanced treatment methods if the demands are restricted to pathogenic microorganisms. In terms of sustainability, sand filtration is the most advantageous method based on the technical and environmental assessment due to the low energy consumption and high efficiency with regards to removal of heavy metals.

  13. Technology enhanced peer learning and peer assessment

    DEFF Research Database (Denmark)

    Henriksen, Christian Bugge; Bregnhøj, Henrik; Rosthøj, Susanne


    This paper explores the application of learning designs featuring formalised and structured technology enhanced peer learning. These include student produced learning elements, peer review discussions and peer assessment in the BSc/MSc level summer course Restoration of European Ecosystems...... and Freshwaters (REEF), the Master thesis preparation seminars for the Master of Public Health (MPH) and the MOOC course Global Environmental Management (GEM). The application of student produced learning elements and peer review discussions is investigated by analyzing quotes from course evaluations...... and performing focus group interviews. The application of peer assessment is investigated by analyzing the agreement of peer assessment between students assessing the same assignment. Our analyses confirm previous research on the value of peer learning and peer assessment and we argue that there could also...

  14. Technology enhanced peer learning and peer assessment

    Directory of Open Access Journals (Sweden)

    Christian Bugge Henriksen


    Full Text Available This paper explores the application of learning designs featuring formalised and structured technology enhanced peer learning. These include student produced learning elements, peer review discussions and peer assessment in the BSc/MSc level summer course Restoration of European Ecosystems and Freshwaters (REEF, the Master thesis preparation seminars for the Master of Public Health (MPH and the MOOC course Global Environmental Management (GEM. The application of student produced learning elements and peer review discussions is investigated by analyzing quotes from course evaluations and performing focus group interviews. The application of peer assessment is investigated by analyzing the agreement of peer assessment between students assessing the same assignment. Our analyses confirm previous research on the value of peer learning and peer assessment and we argue that there could also be a huge benefit from developing learning design patterns that facilitate informal peer learning and reinforce knowledge sharing practices.

  15. Health Technology Assessment: a field still maturing!

    Directory of Open Access Journals (Sweden)

    Renaldo N. Battista


    Full Text Available

    With this issue’s focus on Health Technology Assessment (HTA, the Italian Journal of Public Health has tackled an area of growing importance in today’s increasingly complex health care delivery systems.

    As the articles in this issue demonstrate, HTA has grown from a relatively narrow technical focus to a form of policy research underway in dozens of countries. Since its inception just over three decades ago,HTA has evolved through three distinct phases: the machine, the disease and the delivery mode, with the third of these still underway.

    As the focus has shifted from machines to disease conditions to service delivery approaches, HTA has drawn on research and modes of discourse from a growing variety of disciplines. Thus, despite the evolution that continues, HTA remains, at its core, both multidisciplinary and pragmatic, for the strengths of HTA arise from its integration of the efforts of actors in multiple, diverse disciplines with a view to producing knowledge that will assist decision-makers. The machine phase was marked by a focus on the technical performance of health technologies, often embodying innovative approaches to diagnosis or treatment of human illness.

    Given the newness and costliness of many technologies selected for assessment, a significant emphasis was placed on assessing the safety of these devices. Imaging technologies were the subject of assessment in many settings, perhaps in part because devices such as the CT scanner produced remarkable visual results that were heralded as affording breakthroughs in diagnosis and treatment. One need only look through the programs of early HTA conferences to see the emphasis on high cost, infrastructure-intensive health technologies that was the hallmark of the machine period.

  16. Technology Audit: Assessment of Innovative Portfolio

    Directory of Open Access Journals (Sweden)

    Kurushina Viktoria


    Full Text Available The article discusses the features of the technological audit performing in the companies of oil and gas sector of Russian economy. To measure the innovations quality level the scale was developed based on the Theory of Inventive Problem Solving and the theory of technological structures. Figures of the innovations quantity by levels, volume and quality of the innovative portfolio are offered for assessment the innovative portfolio quality. The method was tested on an example of oil and gas transporting enterprises. The results of the comparative analysis of innovative portfolio are shown.

  17. Natural-technological risk assessment and management (United States)

    Burova, Valentina; Frolova, Nina


    EM-DAT statistical data on human impact and economic damages in the 1st semester 2015 are the highest since 2011: 41% of disasters were floods, responsible for 39% of economic damage and 7% of events were earthquakes responsible for 59% of total death toll. This suggests that disaster risk assessment and management still need to be improved and stay the principle issue in national and international related programs. The paper investigates the risk assessment and management practice in the Russian Federation at different levels. The method is proposed to identify the territories characterized by integrated natural-technological hazard. The maps of the Russian Federation zoning according to the integrated natural-technological hazard level are presented, as well as the procedure of updating the integrated hazard level taking into account the activity of separate processes. Special attention is paid to data bases on past natural and technological processes consequences, which are used for verification of current hazard estimation. The examples of natural-technological risk zoning for the country and some regions territory are presented. Different output risk indexes: both social and economic, are estimated taking into account requirements of end-users. In order to increase the safety of population of the Russian Federation the trans-boundaries hazards are also taken into account.

  18. Energy Effectiveness Assessment of Composting Technologies


    Plūme, I.


    The incorrect biomass composting improperly results in considerable emission of greenhouse gases, loss of effluent and composting heat into environment. The composting heat and gases utilisation is especially suitable for plant enrichment and heating of greenhouses. The mathematical model is worked out for assessment of energy effectiveness and sustainability of biomass composting process. Coefficient of energy effectiveness for traditional litter manure composting technologies is 0.45 and ca...

  19. Use of technology in children's dietary assessment. (United States)

    Boushey, C J; Kerr, D A; Wright, J; Lutes, K D; Ebert, D S; Delp, E J


    Information on dietary intake provides some of the most valuable insights for mounting intervention programmes for the prevention of chronic diseases. With the growing concern about adolescent overweight, the need to accurately measure diet becomes imperative. Assessment among adolescents is problematic as this group has irregular eating patterns and they have less enthusiasm for recording food intake. We used qualitative and quantitative techniques among adolescents to assess their preferences for dietary assessment methods. Dietary assessment methods using technology, for example, a personal digital assistant (PDA) or a disposable camera, were preferred over the pen and paper food record. There was a strong preference for using methods that incorporate technology such as capturing images of food. This suggests that for adolescents, dietary methods that incorporate technology may improve cooperation and accuracy. Current computing technology includes higher resolution images, improved memory capacity and faster processors that allow small mobile devices to process information not previously possible. Our goal is to develop, implement and evaluate a mobile device (for example, PDA, mobile phone) food record that will translate to an accurate account of daily food and nutrient intake among adolescents. This mobile computing device will include digital images, a nutrient database and image analysis for identification and quantification of food consumption. Mobile computing devices provide a unique vehicle for collecting dietary information that reduces the burden on record keepers. Images of food can be marked with a variety of input methods that link the item for image processing and analysis to estimate the amount of food. Images before and after the foods are eaten can estimate the amount of food consumed. The initial stages and potential of this project will be described.

  20. The development of health technology assessment. (United States)

    Banta, David


    The field of health technology assessment (HTA) is still relatively new, but it has shown remarkable growth over the last decade, having spread first from the United States to Europe, and now to the entire world. HTA seeks to couple evidence with decision-making, and thus has similarities to evidence-based health care and evidence-based policy-making. The early history of HTA, beginning around 1975, reveals a first period of synthesising available evidence-principally that dealing with efficacy and cost-effectiveness of health care interventions-so as to put it in a format helpful to health policy-makers, especially those in national governments. From 1985 or so, the focus of the second period was on seeking more effective links with these policy-makers, particularly in Europe. The most recent period, beginning in the late 1990s, has been increasingly devoted to more effective dissemination and implementation in order to influence administrators and clinicians. While early assessments tended to focus on large, expensive, machine-based technologies, the scope has gradually widened to include smaller technologies, 'softer' technologies (such as counselling), and health care needs. Actual assessments have also taken on broader issues, such as organisational, social, and ethical implications. In the Member States of the European Union (EU), HTA activities are increasingly visible, and almost all now have a national focus for HTA associated with the Ministry of Health or its equivalent. Central and Eastern European countries are also developing HTA activities. Most recently, HTA has been highlighted by health policy documents from the European Commission. It seems likely that HTA will in the future be institutionalised in some form as part of EU activities.

  1. Tiger Team Assessment, Energy Technology Engineering Center

    Energy Technology Data Exchange (ETDEWEB)


    The Office Special Projects within the Office of Environment, Safety, and Health (EH) has the responsibility to conduct Tiger Team Assessments for the Secretary of Energy. This report presents the assessment of the buildings, facilities, and activities under the DOE/Rockwell Contract No. DE-AM03-76SF00700 for the Energy Technology Engineering Center (ETEC) and of other DOE-owned buildings and facilities at the Santa Susana Field Laboratory (SSFL) site in southeastern Ventura County, California, not covered under Contract No. DE-AM03-76SF00700, but constructed over the years under various other contracts between DOE and Rockwell International. ETEC is an engineering development complex operated for DOE by the Rocketdyne Division of Rockwell International Corporation. ETEC is located within SSFL on land owned by Rockwell. The balance of the SSFL complex is owned and operated by Rocketdyne, with the exception of a 42-acre parcel owned by the National Aeronautics and Space Administration (NASA). The primary mission of ETEC is to provide engineering, testing, and development of components related to liquid metals technology and to conduct applied engineering development of emerging energy technologies.

  2. Technology assessment of wind energy conversion systems

    Energy Technology Data Exchange (ETDEWEB)

    Meier, B. W.; Merson, T. J.


    Environmental data for wind energy conversion systems (WECSs) have been generated in support of the Technology Assessment of Solar Energy (TASE) program. Two candidates have been chosen to characterize the WECS that might be deployed if this technology makes a significant contribution to the national energy requirements. One WECS is a large machine of 1.5-MW-rated capacity that can be used by utilities. The other WECS is a small machine that is characteristic of units that might be used to meet residential or small business energy requirements. Energy storage systems are discussed for each machine to address the intermittent nature of wind power. Many types of WECSs are being studied and a brief review of the technology is included to give background for choosing horizontal axis designs for this study. Cost estimates have been made for both large and small systems as required for input to the Strategic Environmental Assessment Simulation (SEAS) computer program. Material requirements, based on current generation WECSs, are discussed and a general discussion of environmental impacts associated with WECS deployment is presented.


    Energy Technology Data Exchange (ETDEWEB)



    The objective of this Electric Infrastructure Technology, Training and Assessment Program was to enhance the reliability of electricity delivery through engineering integration of real-time technologies for wide-area applications enabling timely monitoring and management of grid operations. The technologies developed, integrated, tested and demonstrated will be incorporated into grid operations to assist in the implementation of performance-based protection/preventive measures into the existing electric utility infrastructure. This proactive approach will provide benefits of reduced cost and improved reliability over the typical schedule-based and as needed maintenance programs currently performed by utilities. Historically, utilities have relied on maintenance and inspection programs to diagnose equipment failures and have used the limited circuit isolation devices, such as distribution main circuit breakers to identify abnormal system performance. With respect to reliable problem identification, customer calls to utility service centers are often the sole means for utilities to identify problem occurrences and determine restoration methodologies. Furthermore, monitoring and control functions of equipment and circuits are lacking; thus preventing timely detection and response to customer outages. Finally, the two-way flow of real-time system information is deficient, depriving decision makers of key information required to effectively manage and control current electric grid demands to provide reliable customer service in abnormal situations. This Program focused on advancing technologies and the engineering integration required to incorporate them into the electric grid operations to enhance electrical system reliability and reduce utility operating costs.

  4. ['Medical technology assessment'; more than just efficacy]. (United States)

    Buskens, E


    'Medical technology assessment' means investigating the developments, costs and effects of medical technologies. Practising physicians increasingly are confronted with consequences of management based on such research results. In order to follow and participate in the discussion they should be aware of this and know the jargon. In policy problems, measures of effect in natural units (e.g. cardiovascular mortality) offer advantages over measures of clinical findings (e.g. decrease of the serum cholesterol levels). Survival in various health states and disorders can be compared by multiplying the number of life years gained by a factor for the quality of life in those years. Costs are usually expressed in monetary terms. These may be calculated as direct medical costs on the basis of fees or actual costs for society. The latter is the case when the balancing is based on a societal perspective. The societal perspective enables a more objective assessment of health effects than when a patient perspective is used. 'Incremental cost effectiveness' expresses where extra expenditures will have maximum effect, and bears higher relevance for policy decisions than mean costs per unit of effect. Immaterial matters are more difficult to assess, but should nevertheless be considered in selecting the policy to be implemented.

  5. Methods for assessment of innovative medical technologies during early stages of development. (United States)

    Bartelmes, Marc; Neumann, Ulrike; Lühmann, Dagmar; Schönermark, Matthias P; Hagen, Anja


    Conventional Health Technology Assessment (HTA) is usually conducted at a point in time at which the development of the respective technology may no longer be influenced. By this time developers and/or purchasers may have misinvested resources. Thus the demand for Technology Assessment (TA) which incorporates appropriate methods during early development stages of a technology becomes apparent. Against this health political background, the present report describes methods for a development-accompanying assessment of innovative medical technologies. Furthermore, international research programmes set out to identify or apply such methods will be outlined. A systematic literature search as well as an extensive manual literature search are carried out in order to obtain literature and information. The greatest units of the identified methods consist of assessment concepts, decision support methods, modelling approaches and methods focusing on users and their knowledge. Additionally, several general-purpose concepts have been identified. The identified research programmes INNO-HTA and MATCH (Multidisciplinary-Assessment-of-Technology-Centre-for-Healthcare) are to be seen as pilot projects which so far have not been able to generate final results. MATCH focuses almost entirely on the incorporation of the user-perspective regarding the development of non-pharmaceutical technologies, whereas INNO-HTA is basically concerned with the identification and possible advancement of methods for the early, socially-oriented technology assessment. Most references offer only very vague descriptions of the respective method and the application of greatly differing methods seldom exceeds the character of a pilot implementation. A standardisation much less an institutionalisation of development-accompanying assessment cannot be recognized. It must be noted that there is no singular method with which development-accompanying assessment should be carried out. Instead, a technology and

  6. Methods for assessment of innovative medical technologies during early stages of development

    Directory of Open Access Journals (Sweden)

    Hagen, Anja


    Full Text Available Conventional Health Technology Assessment (HTA is usually conducted at a point in time at which the development of the respective technology may no longer be influenced. By this time developers and/or purchasers may have misinvested resources. Thus the demand for Technology Assessment (TA which incorporates appropriate methods during early development stages of a technology becomes apparent. Against this health political background, the present report describes methods for a development-accompanying assessment of innovative medical technologies. Furthermore, international research programmes set out to identify or apply such methods will be outlined. A systematic literature search as well as an extensive manual literature search are carried out in order to obtain literature and information. The greatest units of the identified methods consist of assessment concepts, decision support methods, modelling approaches and methods focusing on users and their knowledge. Additionally, several general-purpose concepts have been identified. The identified research programmes INNO-HTA and MATCH (Multidisciplinary-Assessment-of-Technology-Centre-for-Healthcare are to be seen as pilot projects which so far have not been able to generate final results. MATCH focuses almost entirely on the incorporation of the user-perspective regarding the development of non-pharmaceutical technologies, whereas INNO-HTA is basically concerned with the identification and possible advancement of methods for the early, socially-oriented technology assessment. Most references offer only very vague descriptions of the respective method and the application of greatly differing methods seldom exceeds the character of a pilot implementation. A standardisation much less an institutionalisation of development-accompanying assessment cannot be recognized. It must be noted that there is no singular method with which development-accompanying assessment should be carried out. Instead, a

  7. Assessing the performance of health technology assessment organizations: a framework. (United States)

    Lafortune, Louise; Farand, Lambert; Mondou, Isabelle; Sicotte, Claude; Battista, Renaldo


    In light of growing demands for public accountability, the broadening scope of health technology assessment organizations (HTAOs) activities and their increasing role in decision-making underscore the importance for them to demonstrate their performance. Based on Parson's social action theory, we propose a conceptual model that includes four functions an organization needs to balance to perform well: (i) goal attainment, (ii) production, (iii) adaptation to the environment, and (iv) culture and values maintenance. From a review of the HTA literature, we identify specific dimensions pertaining to the four functions and show how they relate to performance. We compare our model with evaluations reported in the scientific and gray literature to confirm its capacity to accommodate various evaluation designs, contexts of evaluation, and organizational models and perspectives. Our findings reveal the dimensions of performance most often assessed and other important ones that, hitherto, remain unexplored. The model provides a flexible and theoretically grounded tool to assess the performance of HTAOs.

  8. A conceptual framework for energy technology sustainability assessment

    CSIR Research Space (South Africa)

    Musango, Josephine K


    Full Text Available the framework of incorporating the system dynamics methodology in energy technology assessment theory and practice within the context of sustainable development. The framework provides for technology sustainability assessment, which, in turn, can guide...

  9. Constructive technology assessment of gene expression profiling for breast cancer

    NARCIS (Netherlands)

    Retèl, Valesca Pavlawna


    Constructive Technology Assessment (CTA) can be used as a complementary approach to Health Technology Assessment (HTA), especially for the early and dynamic introduction of new technologies in a controlled way. CTA is based on the idea that during the course of technology development, choices are co

  10. Mobile technology for mental health assessment. (United States)

    Areàn, Patricia A; Hoa Ly, Kien; Andersson, Gerhard


    Assessment and outcome monitoring are critical for the effective detection and treatment of mental illness. Traditional methods of capturing social, functional, and behavioral data are limited to the information that patients report back to their health care provider at selected points in time. As a result, these data are not accurate accounts of day-to-day functioning, as they are often influenced by biases in self-report. Mobile technology (mobile applications on smartphones, activity bracelets) has the potential to overcome such problems with traditional assessment and provide information about patient symptoms, behavior, and functioning in real time. Although the use of sensors and apps are widespread, several questions remain in the field regarding the reliability of off-the-shelf apps and sensors, use of these tools by consumers, and provider use of these data in clinical decision-making.

  11. What Can TA Learn from Patient Narratives : Using Narrative Methodology to Assess the Role of Patients in Dutch Hospitals

    NARCIS (Netherlands)

    Heerings, M.; van Egmond, Stans; Sools, Anneke; van Duijvenbooden, Lisa; Drossaert, Stans; Michalek, Tomáš; Hebáková, Lenka; Hennen, Leonhard; Scherz, Constanze; Nierling, Linda; Hahn, Julia


    Using narrative methodology, we assess the feasibility of the active and independent patient, an image portrayed in Dutch government papers and contested by patient organizations, medical occupational groups and political parties. 109 stories about hospital care from 103 patients were collected

  12. [Indirect costs in health technology assessment]. (United States)

    Jakubczyk, Michał; Wrona, Witold; Macioch, Tomasz; Golicki, Dominik; Niewada, Maciej; Hermanowski, Tomasz


    In the health technology assessment it is crucial to define the perspective of the analysis. When the societal perspective is chosen it is necessary to include all the costs incurred by the society, also the costs of lost productivity resulting from absence of sick employees from work or their reduced efficiency at work. The aim of this article is to present the notion of indirect costs, their importance in health technology assessment and the methods of calculation. The economic literature has been reviewed for the state of knowledge on indirect costs. Three methods of calculation are described: human capital method, friction cost method or health state valuation. Indirect costs in Western European countries can amount to more than half of total costs attributed to the illness and its treatment. In the literature there is no consensus regarding the proper method of indirect costs calculation. It is necessary to conduct further theoretical and empirical research in the area of indirect costs and enhance discussion among Polish pharmacoeconomists.

  13. Life cycle assessment of biogas upgrading technologies. (United States)

    Starr, Katherine; Gabarrell, Xavier; Villalba, Gara; Talens, Laura; Lombardi, Lidia


    This article evaluates the life cycle assessment (LCA) of three biogas upgrading technologies. An in-depth study and evaluation was conducted on high pressure water scrubbing (HPWS), as well as alkaline with regeneration (AwR) and bottom ash upgrading (BABIU), which additionally offer carbon storage. AwR and BABIU are two novel technologies that utilize waste from municipal solid waste incinerators - namely bottom ash (BA) and air pollution control residues (APC) - and are able to store CO(2) from biogas through accelerated carbonation processes. These are compared to high pressure water scrubbing (HPWS) which is a widely used technology in Europe. The AwR uses an alkaline solution to remove the CO(2) and then the solution - rich in carbonate and bicarbonate ions - is regenerated through carbonation of APC. The BABIU process directly exposes the gas to the BA to remove and immediately store the CO(2), again by carbonation. It was determined that the AwR process had an 84% higher impact in all LCA categories largely due to the energy intensive production of the alkaline reactants. The BABIU process had the lowest impact in most categories even when compared to five other CO(2) capture technologies on the market. AwR and BABIU have a particularly low impact in the global warming potential category as a result of the immediate storage of the CO(2). For AwR, it was determined that using NaOH instead of KOH improves its environmental performance by 34%. For the BABIU process the use of renewable energies would improve its impact since accounts for 55% of the impact. Copyright © 2011 Elsevier Ltd. All rights reserved.

  14. Drug delivery system innovation and Health Technology Assessment: Upgrading from Clinical to Technological Assessment. (United States)

    Panzitta, Michele; Bruno, Giorgio; Giovagnoli, Stefano; Mendicino, Francesca R; Ricci, Maurizio


    Health Technology Assessment (HTA) is a multidisciplinary health political instrument that evaluates the consequences, mainly clinical and economical, of a health care technology; the HTA aim is to produce and spread information on scientific and technological innovation for health political decision making process. Drug delivery systems (DDS), such as nanocarriers, are technologically complex but they have pivotal relevance in therapeutic innovation. The HTA process, as commonly applied to conventional drug evaluation, should upgrade to a full pharmaceutical assessment, considering the DDS complexity. This is useful to study more in depth the clinical outcome and to broaden its critical assessment toward pharmaceutical issues affecting the patient and not measured by the current clinical evidence approach. We draw out the expertise necessary to perform the pharmaceutical assessment and we propose a format to evaluate the DDS technological topics such as formulation and mechanism of action, physicochemical characteristics, manufacturing process. We integrated the above-mentioned three points in the Evidence Based Medicine approach, which is data source for any HTA process. In this regard, the introduction of a Pharmaceutics Expert figure in the HTA could be fundamental to grant a more detailed evaluation of medicine product characteristics and performances and to help optimizing DDS features to overcome R&D drawbacks. Some aspects of product development, such as manufacturing processes, should be part of the HTA as innovative manufacturing processes allow new products to reach more effectively patient bedside. HTA so upgraded may encourage resource allocating payers to invest in innovative technologies and providers to focus on innovative material properties and manufacturing processes, thus contributing to bring more medicines in therapy in a sustainable manner.

  15. Technology in Schools: Suggestions, Tools and Guidelines for Assessing Technology in Elementary and Secondary Education. (United States)

    Ogle, Tom; Branch, Morgan; Canada, Bethann; Christmas, Oren; Clement, John; Fillion, Judith; Goddard, Ed; Loudat, N. Blair; Purwin, Tom; Rogers, Andy; Schmitt, Carl; Vinson, Mike

    This handbook is intended to facilitate the assessment of technology used to support elementary and secondary education in the United States. It is designed to help decision makers and technology users prepare, collect and assess information about whether and how technology is being used in their school systems. To make assessments that will be…

  16. What Do They Understand? Using Technology to Facilitate Formative Assessment (United States)

    Mitten, Carolyn; Jacobbe, Tim; Jacobbe, Elizabeth


    Formative assessment is so important to inform teachers' planning. A discussion of the benefits of using technology to facilitate formative assessment explains how four primary school teachers adopted three different apps to make their formative assessment more meaningful and useful.

  17. Assessment\tof\tnutritional\tstatus\tof\tchildren\tattending\tpaediatric\toutpatient department\tat\ta\ttertiary\tcare\thospital

    Directory of Open Access Journals (Sweden)



    Full Text Available Background The nutrition status is always neglected issue of public health. The high prevalence of\tmalnutrition\tin\tNFHS data gives alarm to\twork for the children who\tare\tassets\tof\tour\tcountry\tin\tfuture. Objectives To study the nutritional status of children attending pediatric OPD by anthropometric\tmeasurements\tand\tto\tknow\tthe\thealth\tstatus\tof\tthese\tchildren and\ttheir\trelation\twith\tnutritional\tstatus. Methods The\tnutritional\tprofile\tof\tchildren\tof age\tgroup 0-5 years attending\tPaediatric OPD\tat\tNew\tCivil\tHospital\t(NCH,\tSurat\twas\tstudied.\tStratification\tto\tget\tequal representation of both gender by enrolling 50 boys and 50 girls of each age group 0-6\tmonths, 6-12\tmonths,\t1-2 years,\t2-3 years,\t3-4 years and 4-5 years was\tdone.\tTotal\t600\tchildren\tof\tage\tgroup\tof 0-5\tyears\twere\tenrolled. Results As per WHO growth standards, 17.5%, 46% and 39.33% children had wasting, stunting and underweight respectively. Total\tmalnutrition cases were 386 with a prevalence of 64.3\t%. Age group wise prevalence of under\tnutrition\twas\thighest\tin\t37-48\tmonths age group (69.2\t%.\tAs per assessment of nutritional status of children\taged\t6-60\tmonths\tusing MUAC,\t45.8\t%\tchildren\thave\tmild\tto\tmoderate\tmalnutrition\twhereas\t1.8\t% has\tsevere\tmalnutrition. Conclusion Malnutrition\tis\tmore\tin\tboys\tcompared\tto\tgirls.\tMalnutrition\twas\tmore\tprevalent\tin\t12-60\tmonths\tage\tgroup children\tand\twas\tfound\tstatistically\tsignificant. Reduction\tof\tmalnutrition\tin\t0-5\tage\tgroup\tcan\tbe\tensured\tby availability\tof\tsupplementary\tfeed.

  18. Bridging the Gap Between Innovation and ELSA: The TA Program in the Dutch Nano-R&D Program NanoNed

    NARCIS (Netherlands)

    Rip, A.; Lente, H. van


    The Technology Assessment (TA) Program established in 2003 as part of the Dutch R&D consortium NanoNed is interesting for what it did, but also as an indication that there are changes in how new science and technology are pursued: the nanotechnologists felt it necessary to spend part of their fundin

  19. Bridging the Gap Between Innovation and ELSA: The TA Program in the Dutch Nano-R&D Program NanoNed

    NARCIS (Netherlands)

    Rip, A.; Lente, H. van


    The Technology Assessment (TA) Program established in 2003 as part of the Dutch R&D consortium NanoNed is interesting for what it did, but also as an indication that there are changes in how new science and technology are pursued: the nanotechnologists felt it necessary to spend part of their

  20. Technology-Based Classroom Assessments: Alternatives to Testing (United States)

    Salend, Spencer J.


    Although many teachers are using new technologies to differentiate instruction and administer tests, educators are also employing a range of technology-based resources and strategies to implement a variety of classroom assessments as alternatives to standardized and teacher-made testing. Technology-based classroom assessments focus on the use of…

  1. Technology-Based Classroom Assessments: Alternatives to Testing (United States)

    Salend, Spencer J.


    Although many teachers are using new technologies to differentiate instruction and administer tests, educators are also employing a range of technology-based resources and strategies to implement a variety of classroom assessments as alternatives to standardized and teacher-made testing. Technology-based classroom assessments focus on the use of…

  2. 75 FR 79354 - Assessment Technology Standards Request for Information (RFI) (United States)


    ..., virtual worlds, mobile devices, and simulations. 3.2.28 Accessibility. How do technology standards ensure... Assessment Technology Standards Request for Information (RFI) AGENCY: Office of Innovation and Improvement, U... pertaining to assessment technology standards. SUMMARY: The purpose of this RFI is to collect...

  3. Assessing the impact of new technology on complex sociotechnical systems

    CSIR Research Space (South Africa)

    Oosthuizen, R


    Full Text Available African Journal of Industrial Engineering Month Year Vol __(_) pp 1-3 ASSESSING THE IMPACT OF NEW TECHNOLOGY ON COMPLEX SOCIOTECHNICAL SYSTEMS R. Oosthuizen & L. Pretorius Department of Engineering and Technology Management University of Pretoria...

  4. Dietary assessment in Africa: Integration with innovative technology ...

    African Journals Online (AJOL)

    Dietary assessment in Africa: Integration with innovative technology. ... African Journal of Food, Agriculture, Nutrition and Development ... an opportunity for exploring the benefits and general acceptance of using technology to improve health.

  5. Space Launch System Upper Stage Technology Assessment (United States)

    Holladay, Jon; Hampton, Bryan; Monk, Timothy


    discussed in light of the various missions. For each mission there are several trajectory options and each will be discussed in terms of delta-v required and transit duration. Each propulsion system will be modeled, sized, and judged based on their applicability to the whole range of beyond LEO missions. Criteria for scoring will include the resulting dry mass of the stage, resulting propellant required, time to destination, and an assessment of key enabling technologies. In addition to the larger metrics, this paper will present the results of several coupled sensitivity studies. The ultimate goals of these tools and studies are to provide NASA with the most mass-, technology-, and cost-effective in-space stage for its future exploration missions.

  6. DoD Current State for Software Technology Readiness Assessments (United States)


    DoD Current State for Software Technology Readiness Assessments Systems & Software Technology Conference April 2010 Cynthia Dion-Schwarz, Ph.D...DoD Current State for Software Technology Readiness Assessments 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d...public release; distribution unlimited 13. SUPPLEMENTARY NOTES Presented at the 22nd Systems and Software Technology Conference (SSTC), 26-29 April

  7. Expanding the applicability of Heallth Technology Assessments

    DEFF Research Database (Denmark)

    Draborg, Eva; Hansen, Helle Ploug


    external validity and the effectiveness of a technology in normal daily practice. SR and HTAs favors internal valid trials and thereby proofs of possible cause-effect relationship between a technology and outcomes but at the expense of the wider perspectives of a technology. HTA have a policy...

  8. Assessment of Ga2O3 technology (United States)


    architecture [60]. ....................................................................... 10 Figure 5: Photograph of 4-inch diameter Ga2O3 wafer...breakdown voltages can provide orders of magnitude reduction in system size, cost and weight. Figure 4: A More-Electric Aircraft (MEA) architecture [60...Technology base is narrowly located in Japan . Mainstream technology. Czochralski • Mature technology base. • Crucible-free crystal growth

  9. History of healthcare technology assessment in Japan. (United States)

    Hisashige, Akinori


    There has been a rapid growth of healthcare technology assessment (HTA) activities among health service researchers and physicians in Japan in the younger generation since the mid-1980s. HTA has become visible since the Ministry of Health, Labor, and Welfare (MHLW) set up the several committees related to HTA in the late 1990s. The MHLW had to participate in regulatory and administrative reform, coping with the serious economic stagnation since 1991, following the economic recession in the 1980s. However, HTA has not been developed as expected. The most important failure is that the application of HTA to health policy has been neglected by the MHLW. Only application to clinical practice has been implemented by developing evidence-based clinical practice guidelines. The MHLW had the main aim of containing costs by reducing excess or useless healthcare services through guidelines, rather than to implement a radical reform. Without a central organization for HTA, several researchers have still continued to do HTA studies, but most researchers and physicians promoting HTA have been moved into diverse related areas. Ultimately, increasing efficiency may be the only way of reconciling rising demands for health care with public financing constraints. Therefore, the reconsideration and reorganization of HTA, which covers not only healthcare services but also the healthcare system as a whole, is becoming an urgent matter for healthcare reform.

  10. Life cycle assessment of emerging technologies

    DEFF Research Database (Denmark)

    Valsasina, Lucia; Pizzol, Massimo; Smetana, Sergiy;


    Abstract Milk is becoming a key food commodity as population grows and demand increases. The treatment of milk to extend its shelf life is thus an important step in avoiding losses and optimizing resource use. The drawbacks of the most common treatments for shelf stable milk are the loss of nutri......Abstract Milk is becoming a key food commodity as population grows and demand increases. The treatment of milk to extend its shelf life is thus an important step in avoiding losses and optimizing resource use. The drawbacks of the most common treatments for shelf stable milk are the loss...... shelf life. A life cycle assessment was performed comparing this emerging technology to the common thermal treatment: indirect ultra-high temperature sterilisation combined with non-aseptic homogenisation. The results show that high-pressure based processing has a lower environmental burden compared...... to the high-temperature based processing, already at pilot-scale, and this difference is primarily due to the lower electricity consumption. Additionally, upscaling considerations were made using power laws and scenario analysis to simulate future full-scale applications of UHPH. The upscaling shows...

  11. Rapid Technology Assessment Framework for Land Logistics (United States)


    Economy, Environment, Politics SWOT Strengths, Weaknesses, Opportunities, Threats TRL Technology Readiness Level US United States WHO World Health...structures, processes • Contract management Capability Life -Cycle Management (in support of force modernisation and preparedness...commonly based on projections of the global meta-trends across the physical, social and technological environments. Such discussions are numerous

  12. Methodology of constructive technology assessment in health care

    NARCIS (Netherlands)

    Douma, Kirsten F.L.; Karsenberg, Kim; Hummel, Marjan J.M.; Bueno-de-Mesquita, Jolien M.; Harten, van Wim H.


    Objectives: Technologies in health care are evolving quickly, with new findings in the area of biotechnological and genetic research being published regularly. A health technology assessment (HTA) is often used to answer the question of whether the new technology should be implemented into clinical

  13. Decision Gate Process for Assessment of a Technology Development Portfolio (United States)

    Kohli, Rajiv; Fishman, Julianna; Hyatt, Mark


    The NASA Dust Management Project (DMP) was established to provide technologies (to TRL 6 development level) required to address adverse effects of lunar dust to humans and to exploration systems and equipment, which will reduce life cycle cost and risk, and will increase the probability of sustainable and successful lunar missions. The technology portfolio of DMP consisted of different categories of technologies whose final product is either a technology solution in itself, or one that contributes toward a dust mitigation strategy for a particular application. A Decision Gate Process (DGP) was developed to assess and validate the achievement and priority of the dust mitigation technologies as the technologies progress through the development cycle. The DGP was part of continuous technology assessment and was a critical element of DMP risk management. At the core of the process were technology-specific criteria developed to measure the success of each DMP technology in attaining the technology readiness levels assigned to each decision gate. The DGP accounts for both categories of technologies and qualifies the technology progression from technology development tasks to application areas. The process provided opportunities to validate performance, as well as to identify non-performance in time to adjust resources and direction. This paper describes the overall philosophy of the DGP and the methodology for implementation for DMP, and describes the method for defining the technology evaluation criteria. The process is illustrated by example of an application to a specific DMP technology.

  14. New Modes of Constructive Technology Assessment for Developing Countries

    DEFF Research Database (Denmark)

    Christensen, David; Remmen, Arne

    . Technology assessment helps assess the potential positive or negative impacts following in the wake of introducing a new technology of any conceivable type. It has an overall philosophy of reducing the cost of learning in society’s handling of new technologies, anticipating impacts and feeding these insights...... in influencing technological change. In developing countries, technology assessment has received relatively little attention, but recent developments have expressed a ‘call-to-arms’ to tailor flexible approaches by ensuring the involvement of diverse stakeholders and citizens and continual learning among......An old piece of conventional wisdom warns against unsustainable ‘white elephants’ in any attempts at international transferal, adoption or development of technologies in developing countries. After more than half a century of failed attempts to introduce technologies in such settings mostly through...

  15. Assessments of emerging science and technologies: Mapping the landscape

    NARCIS (Netherlands)

    Forsberg, E.M.; Thorstensen, E.; Nielsen, R.O.; Bakker, de E.


    This paper presents comparative work from the EST-Frame project on technology appraisal. It focuses on studies of 'advisory domains' (more or less distinct traditions for assessment of technologies, such as risk analysis, foresight and ethical assessments). The purpose of the study was to increase t

  16. Principles of sustainability science to assess alternative energy technologies

    CSIR Research Space (South Africa)

    Brent, AC


    Full Text Available , adaptive capacity, and complexity of social-ecological systems to assess the potential of such technologies for increasing the carrying capacity and improving the resilience of social-ecological systems, or to assess the resilience of the technological...

  17. Technology assessment of PACS in Osaka University Hospital. (United States)

    Inamura, K; Satoh, K; Kondoh, H; Mori, Y; Kozuka, T


    This paper describes a methodology of PACS technology assessment and gives examples of the results of measurement of 24 items of PACS-related situations of image diagnosis systems in Osaka University Hospital before a PACS is installed. These data are to be compared with the data which will be measured after PACS is installed in the new Osaka University Hospital, in order to complete our technology assessment. We propose common variables, units, and conditions of measurement, in order to establish a standard method of data comparison between before and after PACS installation in hospitals at large. We designed our PACS taking technology assessment into account. We do not stop the technology assessment at the efficacy evaluation, because PACS must be more than a tool for radiological practice. We extend the technology assessment into the effectiveness evaluation, so that PACS is a part of radiological practice itself, and diagnostic accuracy, economy and efficiency are the results of PACS operation.

  18. A comparative study of the sensitivities of Salmonella typhimurium strains TA 98, TA 100 and TA 102 to hospital waste waters. (United States)

    Gupta, Preeti; Mathur, P; Mathur, N; Aarya, B


    Hospitals are a release source of many chemical compounds in their wastewaters. In the present study Salmonella typhimurium strains TA 98, TA 100 and TA 102 were analyzed for their sensitivity to hospital waste waters. The results of the study showed that hospital waste waters consists of mutagens causing frame shift mutations and base pair substitutions and amongst the three strains used in this study, TA 102 was most effective which along with TA 98 can be used for quick assessment of genotoxicity of hospital waste waters prior to its discharge. Genotoxic potential of hospital waste waters from five major hospitals located in Jaipur and Delhi was studied. Such waste waters should be treated prior to their discharge. The results of this study call for further detailed study in this area of research.

  19. Improving Software Guidance for Technology Readiness Assessments (TRA) (United States)


    Systems & Software Technology Conference Improving Software Guidance for Technology Readiness Assessments (TRA) 29 April 2010 Mike Nicol...APR 2010 2. REPORT TYPE 3. DATES COVERED 00-00-2010 to 00-00-2010 4. TITLE AND SUBTITLE Improving Software Guidance for Technology Readiness...Presented at the 22nd Systems and Software Technology Conference (SSTC), 26-29 April 2010, Salt Lake City, UT. 14. ABSTRACT 15. SUBJECT TERMS

  20. Assessing climate change mitigation technology interventions by international institutions

    DEFF Research Database (Denmark)

    de Coninck, Heleen; Puig, Daniel


    Accelerating the international use of climate mitigation technologies is key if effortsto curb climate change are to succeed, especially in developing countries, where weakdomestic technological innovation systems constrain the uptake of climate change mitigationtechnologies. Several...... intergovernmental agencies have set up specific programmes to supportthe diffusion of climate mitigation technologies. Using a simplified technological innovationsystem-based framework, this paper aims to systematically review these programmes, with thedual aim of assessing their collective success in promoting...

  1. Assessment of technology generating institutions in biotechnology ...

    African Journals Online (AJOL)



    May 18, 2009 ... biotechnology innovation system of South-Eastern. Nigeria. E. N. Ajani, M. C. ... Agricultural biotechnology provides new technological tools and aims to ..... constraints include poor fringe benefit to researchers ( x. = 2.90) ...

  2. Sustainability assessment of advanced wastewater treatment technologies

    DEFF Research Database (Denmark)

    Høibye, Linda; Clauson-Kaas, Jes; Wenzel, Henrik


    with advanced oxidation. The technical assessment is based on 12 hazardous substances comprising heavy metals, organic pollutants, endocrine disruptors as well as pathogenic microorganisms. The environmental assessment is performed by life cycle assessment (LCA) comprising 9 of the specific hazardous substances...

  3. Challenges for Information Technology Supporting Educational Assessment (United States)

    Webb, M.; Gibson, D.; Forkosh-Baruch, A.


    This article examines the scope for IT-enabled assessments to serve simultaneously both learners and the enterprise of education. The article proposes ways of combining frameworks that come from two different perspectives: 1) a conceptual approach to assessment design for computerized assessment based on evidence-centred design (ECD) and 2) a…

  4. Review on early technology assessments of nanotechnologies in oncology. (United States)

    Retèl, Valesca P; Hummel, Marjan J M; van Harten, Wim H


    Nanotechnology is expected to play an increasingly important role in the diagnostics, prognostics, and management of targeted cancer treatments. While papers have described promising results for nanotechnology in experimental settings, the translation of fundamental research into clinical applications has yet to be widely adopted. In future, policy makers will need to anticipate new developments for clinical implementation and introduce technology assessments. Here we present an overview of the literature on the technology assessments that have already been undertaken on early stage nanotechnology in cancer care, with particular emphasis placed on clinical efficacy, efficiency, logistics, patient-related features and technology dynamics. Owing to the current stage of development of most nanotechnologies, we found only a limited number of publications describing the application of either Health Technology Assessment (HTA) or Constructive Technology Assessment (CTA). In spite of the promising conclusions of most papers concerning the benefits of clinical implementation, actual clinically relevant applications were rarely encountered, and so far only a few publications report application of systematic forms of technology assessment. Most articles consider aspects of environmental safety, regulation and ethics, often mentioning the need to investigate such issues more thoroughly. Evaluation of financial and organizational aspects is often missing. In order to obtain a realistic perspective on the translation and implementation process there is a need for a broad and systematic evaluation of nanotechnologies at early stages of development. Assessment methods taking technology dynamics into account, such as Constructive Technology Assessment (CTA) should be considered for evaluation purposes.

  5. The Contribution of Health Technology Assessment, Health Needs Assessment, and Health Impact Assessment to the Assessment and Translation of Technologies in the Field of Public Health Genomics

    DEFF Research Database (Denmark)

    Rosenkotter, N.; Vondeling, H.; Blancquaert, I.


    or to identify infrastructural needs. HIA delivers information on the impact of technologies in a wider scope and promotes informed decision making. HTA, HNA and HIA provide a partly overlapping and partly unique set of methodologies and infrastructure for the translation and assessment of genomic health...... into the impact on public health and health care practice of those technologies that are actually introduced. This paper aims to give an overview of the major assessment instruments in public health [ health technology assessment (HTA), health needs assessment (HNA) and health impact assessment (HIA)] which could......The European Union has named genomics as one of the promising research fields for the development of new health technologies. Major concerns with regard to these fields are, on the one hand, the rather slow and limited translation of new knowledge and, on the other hand, missing insights...

  6. New Modes of Constructive Technology Assessment for Developing Countries

    DEFF Research Database (Denmark)

    Christensen, David; Remmen, Arne

    by a product or process in a developing country. On the other hand are those who design, develop and promote the technological solution. If the latter group is to follow the call for proactively taking in socio-cultural and user knowledge, what methods may be employed? This paper revisits the literature....... Technology assessment helps assess the potential positive or negative impacts following in the wake of introducing a new technology of any conceivable type. It has an overall philosophy of reducing the cost of learning in society’s handling of new technologies, anticipating impacts and feeding these insights...... universities, NGO’s, firms and users/citizens. In addressing this ‘call-to-arms’, this paper: ‐ Identifies how technology assessment principles may be brought into new decision-making arenas outside of its traditional application area of e.g. parliamentary governance systems. R evisits the technology...

  7. A Technology Assessment of Personal Computers. Vol. II: Personal Computer Technology, Users, and Uses. (United States)

    Nilles, Jack M.

    This volume reports on the initial phase of a technology assessment of personal computers. First, technological developments that will influence the rate of diffusion of personal computer technology among the general populace are examined. Then the probable market for personal computers is estimated and analyzed on a functional basis, segregating…

  8. Innovative and Alternative Technology Assessment Manual

    Energy Technology Data Exchange (ETDEWEB)



    This four chapter, six appendix manual presents the procedures and methodology as well as the baseline costs and energy information necessary for the analysis and evaluation of innovative and alternative technology applications submitted for federal grant assistance under the innovative and alternative technology provisions of the Clean Water Act of 1977. The manual clarifies and interprets the intent of Congress and the Environmental Protection Agency in carrying out the mandates of the innovative and alternative provisions of the Clean Water Act of 1977. [DJE 2005

  9. LNG vehicle technology, economics, and safety assessment (United States)

    Powars, Charles A.; Moyer, Carl B.; Lowell, Douglas D.


    Liquid natural gas (LNG) is an attractive transportation fuel because of its high heating value and energy density (i.e., Btu/lb. and Btu/gal.), clean burning characteristics, relatively low cost ($/Btu), and domestic availability. This research evaluated LNG vehicle and refueling system technology, economics, and safety. Prior and current LNG vehicle projects were studied to identify needed technology improvements. Life-cycle cost analyses considered various LNG vehicle and fuel supply options. Safety records, standards, and analysis methods were reviewed. The LNG market niche is centrally fueled heavy-duty fleet vehicles with high fuel consumption. For these applications, fuel cost savings can amortize equipment capital costs.

  10. Biomedical Technology Assessment The 3Q Method

    CERN Document Server

    Weinfurt, Phillip


    Evaluating biomedical technology poses a significant challenge in light of the complexity and rate of introduction in today's healthcare delivery system. Successful evaluation requires an integration of clinical medicine, science, finance, and market analysis. Little guidance, however, exists for those who must conduct comprehensive technology evaluations. The 3Q Method meets these present day needs. The 3Q Method is organized around 3 key questions dealing with 1) clinical and scientific basis, 2) financial fit and 3) strategic and expertise fit. Both healthcare providers (e.g., hospitals) an

  11. 20 Years of Technology and Language Assessment in "Language Learning & Technology" (United States)

    Chapelle, Carol A.; Voss, Erik


    This review article provides an analysis of the research from the last two decades on the theme of technology and second language assessment. Based on an examination of the assessment scholarship published in "Language Learning & Technology" since its launch in 1997, we analyzed the review articles, research articles, book reviews,…

  12. 20 Years of Technology and Language Assessment in "Language Learning & Technology" (United States)

    Chapelle, Carol A.; Voss, Erik


    This review article provides an analysis of the research from the last two decades on the theme of technology and second language assessment. Based on an examination of the assessment scholarship published in "Language Learning & Technology" since its launch in 1997, we analyzed the review articles, research articles, book reviews,…

  13. Superconducting Technology Assessment (NSA, Office of Corporate Assessments) (United States)

    Networking and Information Technology Research and Development, Executive Office of the President — The government, and particularly NSA, has a continuing need for ever-increasing computational power. The Agency is concerned about projected limitations of...

  14. Investigation of TaC–TaB2 ceramic composites

    Indian Academy of Sciences (India)

    Behzad Mehdikhani; Gholam Hossein Borhani; Saeed Reza Bakhshi; Hamid Reza Baharvandi


    The TaC–TaB2 composition was sintered by spark plasma (SPS) at 1900–2100°C and applied pressure of 30 MPa. TaC and 2–3 wt% B4C were used as starting powders. Densification process, phase evolution, microstructure and the mechanical properties of the composites were investigated. The results indicated that the TaC–TaB2 composition could be SPS to 97% of theoretical density in 10 min at 2100°C. Addition of B4C leads to an increase in the density sample from 76 to 97%. B4C nano-powder resists grain growth even at high temperature 2100°C. The formation of TaB2/carbon at TaC grain boundaries helps in pinning the grain boundary and inhibiting grain growth. The phase formation was associated with carbon and boron diffusion from the starting particles B4C to form TaB2 phases. TaC grain sizes decreased with increase in B4C concentration. Samples with 2.0 wt% B4C composition had highest flexure strength up to 520 MPa. The effect of B4C addition on hardness measured by microhardness has been studied. Hardness of samples containing 3.0 wt% B4C was 16.99 GPa.

  15. Technology assessments in transportation: survey of recent literature

    Energy Technology Data Exchange (ETDEWEB)

    LaBelle, S.J.


    A survey and an evaluation of recent studies of transportation systems done in a technology-assessment framework were undertaken as the basis for a detailed statement of work for a US Department of Energy technology assessment of transportation energy-conservation strategies. Several bibliographies were searched and numerous professionals in the field of technology assessment were contacted regarding current work. Detailed abstracts were prepared for studies judged to be sufficiently broad in coverage of impacts assessed, yet detailed in coverage of all or part of the nation's transportation systems. Some studies were rich in data but not comprehensive in their analytical approach; brief abstracts were prepared for these. An explanation of the criteria used to screen the studies, as well as abstracts of 37 reports, are provided in this compendium of transportation-technology-assessment literature.

  16. Fostering and Assessing Creativity in Technology Education (United States)

    Buelin-Biesecker, Jennifer Katherine


    This study compared the creative outcomes in student work resulting from two pedagogical approaches to creative problem solving activities. A secondary goal was to validate the Consensual Assessment Technique (CAT) as a means of assessing creativity. Linear models for problem solving and design processes serve as the current paradigm in classroom…

  17. Assessment of Technology for Information Services Planning (United States)


    organi- zation, and external services (external timesharing and turnkey computer systems). Areas of impact are specific to the organization. The...timesharing vendors, changing services turnkey systems - potential and problems impacts and trends o distributed data processing technology needed...includes credit cards, automobile loans, personal and real estate loans, and leasing . Service improvements would aim at expediting credit review, payment

  18. Using technology in assessing integrated science and mathematics learning (United States)

    Berlin, Donna F.; White, Arthur L.


    Drawing from current models, research, and science and mathematics education reform documents, this article first defines and/or delimits three broad domains of education: integrated school science and mathematics, assessment, and technology. Based upon this three-tiered discussion, a list of characteristics is then distilled to guide in the development of assessment for integrated school science and mathematics using technology. Two integrated school science and mathematics activities are provided to illustrate the alignment of instruction and assessment and the systematic integration of technology into both.

  19. Systems Engineering Technology Readiness Assessment of Hybrid-Electric Technologies for Tactical Wheeled Vehicles (United States)


    Department of Energy. 2007. Energy Efficiency and Renewable Energy. “Freedom CAR and vehicle technology program; Plug-In hybrid- electric vehicle R&D Plan...ENGINEERING TECHNOLOGY READINESS ASSESSMENT OF HYBRID- ELECTRIC TECHNOLOGIES FOR TACTICAL WHEELED VEHICLES by Eddie E. McCown September 2014 Thesis...HYBRID- ELECTRIC TECHNOLOGIES FOR TACTICAL WHEELED VEHICLES 5. FUNDING NUMBERS 6. AUTHOR(S) Eddie E. McCown 7. PERFORMING ORGANIZATION NAME(S) AND

  20. The conceptual and practical challenges to technology categorisation in the preparation of technology needs assessments

    DEFF Research Database (Denmark)

    Nygaard, Ivan; Hansen, Ulrich Elmer


    The strong focus in climate negotiations on the transfer and diffusion of technologies as ameans to mitigate and adapt to climate change has entailed various programs to promote the transfer and diffusion of climate technologies, including the Technology Needs Assessment project (TNA). Despite...... a framework for categorizing technologies according to the types of markets and non-markets in which they are diffused. While the framework has contributed to a higher degree of ‘market literacy’ among national stakeholders, four challenges in categorizing technologies have been identified: i) technologies...

  1. History of the international societies in health technology assessment: International Society for Technology Assessment in Health Care and Health Technology Assessment International. (United States)

    Banta, David; Jonsson, Egon; Childs, Paul


    The International Society for Technology Assessment in Health Care (ISTAHC) was formed in 1985. It grew out of the increasing awareness of the international dimensions of health technology assessment (HTA) and the need for new communication methods at the international level. The main function of ISTAHC was to present an annual conference, which gradually grew in size, and also to generally improve in quality from to year. ISTAHC overextended itself financially early in the first decade of the 2000s and had to cease its existence. A new society, Health Technology Assessment international (HTAi), based on many of the same ideas and people, grew up beginning in the year 2003. The two societies have played a large role in making the field of HTA visible to people around the world and providing a forum for discussion on the methods and role of HTA.

  2. Technologies Assessing Limb Bradykinesia in Parkinson’s Disease (United States)

    Hasan, Hasan; Athauda, Dilan S.; Foltynie, Thomas; Noyce, Alastair J.


    Background: The MDS-UPDRS (Movement Disorders Society – Unified Parkinson’s Disease Rating Scale) is the most widely used scale for rating impairment in PD. Subscores measuring bradykinesia have low reliability that can be subject to rater variability. Novel technological tools can be used to overcome such issues. Objective: To systematically explore and describe the available technologies for measuring limb bradykinesia in PD that were published between 2006 and 2016. Methods: A systematic literature search using PubMed (MEDLINE), IEEE Xplore, Web of Science, Scopus and Engineering Village (Compendex and Inspec) databases was performed to identify relevant technologies published until 18 October 2016. Results: 47 technologies assessing bradykinesia in PD were identified, 17 of which offered home and clinic-based assessment whilst 30 provided clinic-based assessment only. Of the eligible studies, 7 were validated in a PD patient population only, whilst 40 were tested in both PD and healthy control groups. 19 of the 47 technologies assessed bradykinesia only, whereas 28 assessed other parkinsonian features as well. 33 technologies have been described in additional PD-related studies, whereas 14 are not known to have been tested beyond the pilot phase. Conclusion: Technology based tools offer advantages including objective motor assessment and home monitoring of symptoms, and can be used to assess response to intervention in clinical trials or routine care. This review provides an up-to-date repository and synthesis of the current literature regarding technology used for assessing limb bradykinesia in PD. The review also discusses the current trends with regards to technology and discusses future directions in development. PMID:28222539


    DEFF Research Database (Denmark)

    Jacobsen, Peter; Jørgensen, Pelle Morten Thomas


    In order to cope with the future challenges of the health care sector, there is an urging need for improving efficiency at hospitals. The study presents a framework enabling health care managers of improving the in-house logistics. The distinctiveness of the framework is the way in which it relates...... technology, logistics, structure and procedures to efficiency. Changing one factor e.g. technology, initiates an iterative loop focusing on change in the related factors in order to obtain the optimal efficiency. The search for an optimal efficient solution is the driving force of the framework...... at a Danish hospital. The framework is tested on the blood sample logistics between the emergency department and laboratory with the goal of enhancing the efficiency of the emergency department....

  4. Defining the "proven technology" technical criterion in the reactor technology assessment for Malaysia's nuclear power program (United States)

    Anuar, Nuraslinda; Kahar, Wan Shakirah Wan Abdul; Manan, Jamal Abdul Nasir Abd


    Developing countries that are considering the deployment of nuclear power plants (NPPs) in the near future need to perform reactor technology assessment (RTA) in order to select the most suitable reactor design. The International Atomic Energy Agency (IAEA) reported in the Common User Considerations (CUC) document that "proven technology" is one of the most important technical criteria for newcomer countries in performing the RTA. The qualitative description of five desired features for "proven technology" is relatively broad and only provides a general guideline to its characterization. This paper proposes a methodology to define the "proven technology" term according to a specific country's requirements using a three-stage evaluation process. The first evaluation stage screens the available technologies in the market against a predefined minimum Technology Readiness Level (TRL) derived as a condition based on national needs and policy objectives. The result is a list of technology options, which are then assessed in the second evaluation stage against quantitative definitions of CUC desired features for proven technology. The potential technology candidates produced from this evaluation is further narrowed down to obtain a list of proven technology candidates by assessing them against selected risk criteria and the established maximum allowable total score using a scoring matrix. The outcome of this methodology is the proven technology candidates selected using an accurate definition of "proven technology" that fulfills the policy objectives, national needs and risk, and country-specific CUC desired features of the country that performs this assessment. A simplified assessment for Malaysia is carried out to demonstrate and suggest the use of the proposed methodology. In this exercise, ABWR, AP1000, APR1400 and EPR designs assumed the top-ranks of proven technology candidates according to Malaysia's definition of "proven technology".

  5. Illustrating anticipatory life cycle assessment for emerging photovoltaic technologies. (United States)

    Wender, Ben A; Foley, Rider W; Prado-Lopez, Valentina; Ravikumar, Dwarakanath; Eisenberg, Daniel A; Hottle, Troy A; Sadowski, Jathan; Flanagan, William P; Fisher, Angela; Laurin, Lise; Bates, Matthew E; Linkov, Igor; Seager, Thomas P; Fraser, Matthew P; Guston, David H


    Current research policy and strategy documents recommend applying life cycle assessment (LCA) early in research and development (R&D) to guide emerging technologies toward decreased environmental burden. However, existing LCA practices are ill-suited to support these recommendations. Barriers related to data availability, rapid technology change, and isolation of environmental from technical research inhibit application of LCA to developing technologies. Overcoming these challenges requires methodological advances that help identify environmental opportunities prior to large R&D investments. Such an anticipatory approach to LCA requires synthesis of social, environmental, and technical knowledge beyond the capabilities of current practices. This paper introduces a novel framework for anticipatory LCA that incorporates technology forecasting, risk research, social engagement, and comparative impact assessment, then applies this framework to photovoltaic (PV) technologies. These examples illustrate the potential for anticipatory LCA to prioritize research questions and help guide environmentally responsible innovation of emerging technologies.

  6. Quadrennial Technology Review 2015: Technology Assessments--Wind Power

    Energy Technology Data Exchange (ETDEWEB)



    Wind power has become a mainstream power source in the U.S. electricity portfolio, supplying 4.9% of the nation’s electricity demand in 2014. With more than 65 GW installed across 39 states at the end of 2014, utility-scale wind power is a cost-effective source of low-emissions power generation throughout much of the nation. The United States has significant sustainable land-based and offshore wind resource potential, greater than 10 times current total U.S. electricity consumption. A technical wind resource assessment conducted by the Department of Energy (DOE) in 2009 estimated that the land-based wind energy potential for the contiguous United States is equivalent to 10,500 GW capacity at 80 meters (m) hub and 12,000 GW capacity at 100 meters (m) hub heights, assuming a capacity factor of at least 30%. A subsequent 2010 DOE report estimated the technical offshore wind energy potential to be 4,150 GW. The estimate was calculated from the total offshore area within 50 nautical miles of shore in areas where average annual wind speeds are at least 7 m per second at a hub height of 90 m.

  7. Generating technology assessment. Phase I work plan, Task 1 report

    Energy Technology Data Exchange (ETDEWEB)


    A plan of work outlining information to assess electric generating technologies is presented. Projections are made of realistic and understandable engineering and cost assessments of nonnuclear electrical generating technologies. A computer-based method of producing such engineering and cost estimates for use by EIA's Coal and Electric Power Analysis Division is to be developed and implemented. Technologies and processes to be assessed are: all nonnuclear conventional and nonconventional (coal gasification, advanced combustion turbines, atmospheric fluidized bed combustion, fuel cells, geothermal, solar thermal and photovoltaics, biomass conversion to electricity, ocean thermal, wind, and MHD). Engineering specifications recommended for determination are listed. Compatibility of the technologies are to be assessed with EIA models: MEFS, LEAP, and NCM.

  8. Instruments for Assessing the Impact of Technology in Education (United States)

    Christensen, Rhonda; Knezek, Gerald


    Ten years of instrument development are summarized and placed within a framework for assessing the impact of technology in education. Seven well-validated instruments spanning the areas of attitudes, beliefs, skills, competencies, and technology integration proficiencies are presented, along with data analysis examples. These instruments are…

  9. Lifecycle Assessment of Biofuel Production from Wood Pyrolysis Technology (United States)

    Manyele, S. V.


    Due to a stronger dependency on biomass for energy, there is a need for improved technologies in biomass-to-energy conversion in Tanzania. This paper presents a life cycle assessment (LCA) of pyrolysis technology used for conversion of wood and wood waste to liquid biofuel. In particular, a survey of environmental impacts of the process is…

  10. Scenario drafting to anticipate future developments in technology assessment

    NARCIS (Netherlands)

    Retel, V.P.; Joore, M.A.; Rutgers, E.J.; Harten, van W.H.


    Background Health Technology Assessment (HTA) information, and in particular cost-effectiveness data is needed to guide decisions, preferably already in early stages of technological development. However, at that moment there is usually a high degree of uncertainty, because evidence is limited and d

  11. Technology needs assessment (TNA) resource document for South Africa

    CSIR Research Space (South Africa)

    Taviv, R


    Full Text Available TNA(Technology needs assessment) is a requirement of Article 4.5 of the UNFCCC ‘Technology Transfer’ is a broad set of processes covering the flows of know-how, experience and equipment for mitigating or adapting to climate change amongst different...

  12. Lifecycle Assessment of Biofuel Production from Wood Pyrolysis Technology (United States)

    Manyele, S. V.


    Due to a stronger dependency on biomass for energy, there is a need for improved technologies in biomass-to-energy conversion in Tanzania. This paper presents a life cycle assessment (LCA) of pyrolysis technology used for conversion of wood and wood waste to liquid biofuel. In particular, a survey of environmental impacts of the process is…

  13. Teacher Learning of Technology-Enhanced Formative Assessment (United States)

    Beatty, Ian D.; Feldman, Allan; Leonard, William J.; Gerace, William J.; St. Cyr, Karen; Lee, Hyunju; Harris, Robby


    "Technology-Enhanced Formative Assessment" (TEFA) is an innovative pedagogy for teaching secondary school science or mathematics with "classroom response system" technology. "Teacher Learning of TEFA" (TLT) is a five year research project studying teacher change in the context of an intensive, sustained, on-site professional development (PD)…

  14. New Technologies for Standoff Assessment of Radiological Contamination

    Energy Technology Data Exchange (ETDEWEB)

    Cherepy, N; Stevens, C; Wurtz, R; Sanner, R; Frank, M; Tillotson, T; Hrubesh, L; Dietrich, D; Dignon, J; Soufli, R


    Technologies to rapidly quantify surface activity with minimal worker contact would dramatically decrease the radiation dose a radiation worker receives in assessment and cleanup operations, while obtaining a clear image of exactly where dispersed contamination is located. LLNL efforts in the development of the Photochromic Radiation Dosimeter and the Imaging Assessment System will be described. Initial use of these technologies in decontamination and decommissioning of contaminated facilities demonstrates several significant advantages over standard techniques such as survey meters and swipes.

  15. Technologies for Assessing Behavioral and Cognitive Markers of Suicide Risk (United States)


    AWARD NUMBER: W81XWH-15-1-0632 TITLE: Technologies for Assessing Behavioral and Cognitive Markers of Suicide Risk PRINCIPAL INVESTIGATOR: Brian...CONTRACT NUMBER Technologies for Assessing Behavioral and Cognitive Markers of Suicide Risk 5b. GRANT NUMBER W81XWH-15-1-0632 5c. PROGRAM ELEMENT...suicide risk and to evaluate the predictive utility of these markers over a one year period. We propose to achieve these aims by: (a) collecting

  16. Potential Technologies for Assessing Risk Associated with a Mesoscale Forecast (United States)


    the actual model-forecast error—the 500-hPa root-mean-square error (RMSE) height error. Future work should also consider other forecast metrics such...ARL-TN-0708 ● OCT 2015 US Army Research Laboratory Potential Technologies for Assessing Risk Associated with a Mesoscale...OCT 2015 US Army Research Laboratory Potential Technologies for Assessing Risk Associated with a Mesoscale Forecast by Patrick A

  17. Technology assessment of geothermal energy resource development

    Energy Technology Data Exchange (ETDEWEB)


    Geothermal state-of-the-art is described including geothermal resources, technology, and institutional, legal, and environmental considerations. The way geothermal energy may evolve in the United States is described; a series of plausible scenarios and the factors and policies which control the rate of growth of the resource are presented. The potential primary and higher order impacts of geothermal energy are explored, including effects on the economy and society, cities and dwellings, environmental, and on institutions affected by it. Numerical and methodological detail is included in appendices. (MHR)

  18. Gender and risk assessment in contraceptive technologies

    NARCIS (Netherlands)

    Kammen, van Jessika; Oudshoorn, Nelly


    This paper concerns a comparison of risk assessment practices of contraceptives for women and men. Our analysis shows how the evaluation of health risks of contraceptives does not simply reflect the specific effects of chemical compounds in the human body. Rather, we show how side-effects were rated

  19. Technology assessment for Spaceship Two, space tourism, and private spaceflight (United States)

    Hancock, Randy

    A seven-step technology assessment was conducted to address questions regarding the significance and likely consequences associated with the introduction of Spaceship Two, space tourism, and private spaceflight. Impacts were assessed across four categories: the Role and Functions of Government, Private Industry Factors, Cultural and Societal Impacts, and the Time Frame in which these impacts were anticipated to occur. The technology assessment findings were compared to the results of expert interviews that addressed the sane four categories. The researcher noted that, while there was overwhelming agreement between the technology assessment's primary impacts and the expert interview responses, there were several differences. The technology assessment and interviewees agreed that the federal government would likely be both a regulator and user of private spaceflight. Both agreed that business partnerships would be key in pursuing private spaceflight. There was also consensus that, as market forces come to bear, ticket prices would drop and a larger market and broader passenger demographic would emerge. The technology assessment and experts agreed that an accident, especially one early in the industry's evolution, could be disastrous. Both agreed that private spaceflight can serve as a inspiration to students and be a positive influence in society, and both agreed that the start of passenger flights should take place in the 2010 - 2012 timeframe. Due to the potentially disastrous consequences of an accident, there was agreement between the technology assessment and experts on the value of flight and ground crew training, driven by insurance carriers and federal mandate. Most differences between the technology assessment's findings and the expert interview responses were due to omission, rather than direct disagreement. However, this was not the case in every instance. The most significant difference between the technology assessment and the experts involved the

  20. Characterization of a TaJ Gene from Wheat

    Institute of Scientific and Technical Information of China (English)


    A novel J-domain protein gene was cloned from wheat (Triticum aestivum L.) using RT-PCR technology and named as TaJ. The J-domain protein is defined by the presence of a J-domain. The cDNA of T. aestivum gene, TaJ (GenBank accession number: DQ789026), was 1 263 bp and contained a complete open reading frame (ORF) encoding a J-domain protein of 420 amino acid residues. The predicted amino acid sequence of TaJ possesses three functionally essential domains: the N-terminal J-domain which includes the highly conserved HPD tripeptide, an adjacent domain that is rich in glycine and phenylalanine residues (G/F) and a Cysteine-rich zinc-finger domain with four repeats of CxxCxGxG that is important for protein interactions. The C-terminal of TaJ was -CAQQ, a farnesylation motif. The full-length deduced amino acid sequence of TaJ is highly homologous to J-domain proteins from various plant species. Southern blot analysis indicated that a single copy of TaJ existed in wheat genome. The expression pattern of TaJ performed by real-time PCR demonstrated that heat shock (HS) at 37℃ induced the expression of TaJ rapidly and strongly, but the response of the TaJ gene to cold stress was much slower than that to HS. Tissue-specific expression analysis showed that the expression level of TaJ gene was much higher in leaves than that in roots.

  1. Measuring and Assessing Application-Specific Technology Readiness

    Directory of Open Access Journals (Sweden)

    Antonino Ardilio


    Full Text Available Technology readiness is a crucial issue for decision-makers in technology-driven enterprises, determining whether the technology will or won’t be adopted for use in products or as a process technology. We know that, in some cases, lower technology readiness will be accepted by the users; these could be end-users, but, more often, it will be used in companies. The impact of a too early or too late adopted technology can be huge for companies and can even threaten market position or the existence of the company itself. Research institutes and technology developers, in particular application-oriented research organizations, might be also interested in which parameters or technology attributes should be improved or extended, according to the addressed application field, so that the technology fulfils the market-requested functions and a fast diffusion in the market can be achieved. Existing technology readiness models cover the various usages of the technology. In many cases, they assess the technology’s use in across different industries and application fields. However, the requirements in many fields are mostly different and very specific; thus, evaluation at such a high level can’t conclude whether the technology should be considered and adopted in the applications involved. This paper introduces an approach on how to determine and map the application-specific readiness of technology by decomposing both the application and the technology into its requested functions, as well as dynamically mapping the individual technology performance criteria. The applicability of this model will be demonstrated and discussed by a use case in the area of OLED-technology.

  2. Space-reactor electric systems: subsystem technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, R.V.; Bost, D.; Determan, W.R.


    This report documents the subsystem technology assessment. For the purpose of this report, five subsystems were defined for a space reactor electric system, and the report is organized around these subsystems: reactor; shielding; primary heat transport; power conversion and processing; and heat rejection. The purpose of the assessment was to determine the current technology status and the technology potentials for different types of the five subsystems. The cost and schedule needed to develop these potentials were estimated, and sets of development-compatible subsystems were identified.

  3. Assessment of Wearable Sensor Technologies for Biosurveillance (United States)


    intelligence (AI) and biometric data, the device captures electrodermal activity in real time to assess emotional states. Using the technique of...Biometric smartwear Hexoskin Breathing rate, volume, cadence, ECG, sleep position, heart rate, and other physiological data Wearable Google Fit’s fitness tracking will display data such as heart rate, or detect whether its wearer has been physically active . Google’s

  4. Phase shifter technology assessment - Prospects and applications (United States)

    Sokolov, Vladimir


    Capabilities and limitations of MMIC phase shifter technology at microwave and millimeter wave frequencies are reviewed. MMIC-based phase arrays make it possible to integrate active elements at the array face, i.e., to incorporate transmit power amplifiers and/or low noise amplifiers at each antenna element. Active elements make it possible to increase power efficiency and reliability and provide graceful degradation. Monolithic integration of the various transmit/receive functions including phase shifting is considered to be feasible through at least the lower millimeter-wave frequency range (about 30-100 GHz). MMIC integration also allows more flexibility in array design including those that are intended for airborne conformal applications.

  5. The conceptual and practical challenges to technology categorisation in the preparation of technology needs assessments

    DEFF Research Database (Denmark)

    Nygaard, Ivan; Hansen, Ulrich Elmer


    The strong focus in climate negotiations on the transfer and diffusion of technologies as ameans to mitigate and adapt to climate change has entailed various programs to promote the transfer and diffusion of climate technologies, including the Technology Needs Assessment project (TNA). Despite...... for the challenges in formulating plans of actions for technologies. If, due to a lack of conceptual clarity, it is not clear to countries whether the diffusion of a specific technology should be implemented by a project or by means of an enabling framework, the measures proposed in the action plans may...

  6. Noninvasive imaging technologies for cutaneous wound assessment: A review. (United States)

    Paul, Dereck W; Ghassemi, Pejhman; Ramella-Roman, Jessica C; Prindeze, Nicholas J; Moffatt, Lauren T; Alkhalil, Abdulnaser; Shupp, Jeffrey W


    The ability to phenotype wounds for the purposes of assessing severity, healing potential and treatment is an important function of evidence-based medicine. A variety of optical technologies are currently in development for noninvasive wound assessment. To varying extents, these optical technologies have the potential to supplement traditional clinical wound evaluation and research, by providing detailed information regarding skin components imperceptible to visual inspection. These assessments are achieved through quantitative optical analysis of tissue characteristics including blood flow, collagen remodeling, hemoglobin content, inflammation, temperature, vascular structure, and water content. Technologies that have, to this date, been applied to wound assessment include: near infrared imaging, thermal imaging, optical coherence tomography, orthogonal polarization spectral imaging, fluorescence imaging, laser Doppler imaging, microscopy, spatial frequency domain imaging, photoacoustic detection, and spectral/hyperspectral imaging. We present a review of the technologies in use or development for these purposes with three aims: (1) providing basic explanations of imaging technology concepts, (2) reviewing the wound imaging literature, and (3) providing insight into areas for further application and exploration. Noninvasive imaging is a promising advancement in wound assessment and all technologies require further validation.

  7. Elaboration and validation of an assistive technology assessment questionnaire

    Directory of Open Access Journals (Sweden)

    Fernanda Jorge Guimarães


    Full Text Available Assistive Technologies consists of resources, methods, and strategies favoring autonomy and inclusion of elderly and people with disabilities, being scarce in the literature instruments assessing them. A methodology study conducted with a panel of specialists and people with visual impairment, aimed to elaborate and validate a questionnaire to assess educational assistive technology. To consider an item as valid, we used 80% as agreement percentage, and validity and reliability of the questionnaire were calculated. Assistive Technology was characterized in six attributes: objectives, access, clarity, structure and presentation, relevance and efficacy, interactivity, and 19 items were elaborated to compose the questionnaire. From those, 11 obtained percentages higher than 80%, seven were modified and one was excluded. The instrument Cronbach’s alpha was 0,822, guaranteeing validity and reliability of the tool to assess health education Assistive Technology, and therefore, its use is indicated.

  8. Technology Enhanced Formative Assessment for 21st Century Learning (United States)

    Spector, J. Michael; Ifenthaler, Dirk; Sampson, Demetrios; Yang, Lan; Mukama, Evode; Warusavitarana, Amali; Dona, Kulari Lokuge; Eichhorn, Koos; Fluck, Andrew; Huang, Ronghuai; Bridges, Susan; Lu, Jiingyan; Ren, Youqun; Gui, Xiaoqing; Deneen, Christopher C.; San Diego, Jonathan; Gibson, David C.


    This paper is based on the deliberations of the Assessment Working Group at EDUsummIT 2015 in Bangkok, Thailand. All of the members of Thematic Working Group 5 (TWG5) have contributed to this synthesis of potentials, concerns and issues with regard to the role of technology in assessment as, for and of learning in the 21st century. The group…

  9. Utilisation of medical technology assessment in health policy

    NARCIS (Netherlands)

    van den Heuvel, WJA; Wieringh, R; van den Heuvel, LPM


    Objective: To assess the contribution of medical technology assessment (MTA) to health policy decision making, the question has to be answered whether MTA is actually being used in decision-making processes and what factors are related to its utilisation. Design: We investigated recent Dutch policy

  10. Voice Assessment of Student Work: Recent Studies and Emerging Technologies (United States)

    Eckhouse, Barry; Carroll, Rebecca


    Although relatively little attention has been given to the voice assessment of student work, at least when compared with more traditional forms of text-based review, the attention it has received strongly points to a promising form of review that has been hampered by the limits of an emerging technology. A fresh review of voice assessment in light…

  11. A Technology Assessment of Personal Computers. Vol. I: Summary. (United States)

    Nilles, Jack M.

    This volume summarizes the results of a 2-year technology assessment of personal computers. The purpose of this study was to explore possible future modes of growth of the personal computer and related industries, to assess the impacts and consequences of that growth, and to present some of the policy issues and options which may arise as a…

  12. Reactor technology assessment and selection utilizing systems engineering approach (United States)

    Zolkaffly, Muhammed Zulfakar; Han, Ki-In


    The first Nuclear power plant (NPP) deployment in a country is a complex process that needs to consider technical, economic and financial aspects along with other aspects like public acceptance. Increased interest in the deployment of new NPPs, both among newcomer countries and those with expanding programs, necessitates the selection of reactor technology among commercially available technologies. This paper reviews the Systems Decision Process (SDP) of Systems Engineering and applies it in selecting the most appropriate reactor technology for the deployment in Malaysia. The integrated qualitative and quantitative analyses employed in the SDP are explored to perform reactor technology assessment and to select the most feasible technology whose design has also to comply with the IAEA standard requirements and other relevant requirements that have been established in this study. A quick Malaysian case study result suggests that the country reside with PWR (pressurized water reactor) technologies with more detailed study to be performed in the future for the selection of the most appropriate reactor technology for Malaysia. The demonstrated technology assessment also proposes an alternative method to systematically and quantitatively select the most appropriate reactor technology.

  13. Emerging frontier technologies for food safety analysis and risk assessment

    Institute of Scientific and Technical Information of China (English)

    DONG Yi-yang; LIU Jia-hui; WANG Sai; CHEN Qi-long; GUO Tian-yang; ZHANG Li-ya; JIN Yong; SU Hai-jia; TAN Tian-wei


    Access to security and safe food is a basic human necessity and essential for a sustainable world. To perform hi-end food safety analysis and risk assessment with state of the art technologies is of utmost importance thereof. With applications as exempliifed by microlfuidic immunoassay, aptasensor, direct analysis in real time, high resolution mass spectrometry, benchmark dose and chemical speciifc adjustment factor, this review presents frontier food safety analysis and risk assess-ment technologies, from which both food quality and public health wil beneift undoubtedly in a foreseeable future.

  14. The principles of Health Technology Assessment in laboratory medicine. (United States)

    Liguori, Giorgio; Belfiore, Patrizia; D'Amora, Maurizio; Liguori, Renato; Plebani, Mario


    The Health Technology Assessment (HTA) is a multi-professional and multidisciplinary evaluation approach designed to assess health technology in the broadest sense of the term, from its instruments to the rearranging of its organizational structures. It is by now an established methodology at national and international levels that involves several medical disciplines thanks to its versatility. Laboratory medicine is one of these disciplines. Such specialization was subjected, in recent years, to deep changes even from an organizational standpoint, in order to meet the health needs of the population, making them as effective and cost-effective as possible. In this regard, HTA was the tool used to assess implications in different areas.


    Directory of Open Access Journals (Sweden)

    Gazaryan Robert Kamoevich


    Full Text Available In this article, the procedure of identification of organizational and technological reliability is described. This methodology is applicable both to separate functional areas and to all industrial enterprises. Its objective is to assess the expediency of reorganization. The objective of this scientific research is the substantiation of reorganization of an industrial enterprise. Multivariable models, or convolutions, were used as research methods. According to the RF law, industrial enterprises are divided into four functional areas, each of which is assessed on the basis of multiple criteria. Assessment of organizational and technological reliability requires a multi-parameter model. Its axes correspond to the number of evaluation criteria. The set of criteria designated for the assessment of organizational and technological reliability is identified on the basis of the homogeneity of trend indicators designated for centripetal and centrifugal models. The axes of a multi-parameter model represent real and benchmark values. The unit serves as the benchmark value; it is the maximal value of this parameter. The formula based on average values shall be used to determine the total value of the above parameters. The authors have also generated a model of organizational and technological reliability of industrial enterprises. It is noteworthy that assessment of organizational and technological reliability of an industrial enterprise requires a concentric multi-layer model developed through the application of the convolution method.

  16. Technological and life cycle assessment of organics processing odour control technologies

    Energy Technology Data Exchange (ETDEWEB)

    Bindra, Navin [School of Engineering, University of Guelph, 50 Stone Road East, Guelph, Ontario N1G2W1 (Canada); Dubey, Brajesh, E-mail: [School of Engineering, University of Guelph, 50 Stone Road East, Guelph, Ontario N1G2W1 (Canada); Environmental Engineering Division, Department of Civil Engineering, Indian Institute of Technology, Kharagpur, West Bengal 721302 (India); Dutta, Animesh [School of Engineering, University of Guelph, 50 Stone Road East, Guelph, Ontario N1G2W1 (Canada)


    As more municipalities and communities across developed world look towards implementing organic waste management programmes or upgrading existing ones, composting facilities are emerging as a popular choice. However, odour from these facilities continues to be one of the most important concerns in terms of cost & effective mitigation. This paper provides a technological and life cycle assessment of some of the different odour control technologies and treatment methods that can be implemented in organics processing facilities. The technological assessment compared biofilters, packed tower wet scrubbers, fine mist wet scrubbers, activated carbon adsorption, thermal oxidization, oxidization chemicals and masking agents. The technologies/treatment methods were evaluated and compared based on a variety of operational, usage and cost parameters. Based on the technological assessment it was found that, biofilters and packed bed wet scrubbers are the most applicable odour control technologies for use in organics processing faculties. A life cycle assessment was then done to compare the environmental impacts of the packed-bed wet scrubber system, organic (wood-chip media) bio-filter and inorganic (synthetic media) bio-filter systems. Twelve impact categories were assessed; cumulative energy demand (CED), climate change, human toxicity, photochemical oxidant formation, metal depletion, fossil depletion, terrestrial acidification, freshwater eutrophication, marine eutrophication, terrestrial eco-toxicity, freshwater eco-toxicity and marine eco-toxicity. The results showed that for all impact categories the synthetic media biofilter had the highest environmental impact, followed by the wood chip media bio-filter system. The packed-bed system had the lowest environmental impact for all categories. - Highlights: • Assessment of odour control technologies for organics processing facilities. • Comparative life cycle assessment of three odour control technologies was conducted



    Lahue, Betsy J.; Baginska, Eva; Li, Sophia S.; Parisi, Monika


    Objectives: The aim of this study was to conduct a review of health technology assessments (HTAs) in cervical cancer screening to highlight the most common metrics HTA agencies use to evaluate and recommend cervical cancer screening technologies. Methods: The Center for Reviews and Dissemination (CRD), MedLine, and national HTA agency databases were searched using keywords (“cervical cancer screening” OR “cervical cancer” OR “cervical screening”) and “HTA” from January 2000 to October 2014. N...

  18. Nutrition and health technology assessment: when two worlds meet


    Poley, Marten J.


    There is a growing recognition that nutrition may have a positive impact on public health and that it may reduce medical expenditures. Yet, such claims need to be substantiated by evidence. This evidence could be delivered by health technology assessment (HTA), which can be thought of as the evaluation of technologies for clinical effectiveness, cost-effectiveness, and ethical, legal, and social impacts. The application of HTA to the field of “nutrition interventions” is recent. So far, HTA a...

  19. Technological Implications for Assessment Ecosystems: Opportunities for Digital Technology to Advance Assessment (United States)

    Behrens, John T.; DiCerbo, Kristen E.


    Background: It would be easy to think the technological shifts in the digital revolution are simple incremental progressions in societal advancement. However, the nature of digital technology is resulting in qualitative differences in nearly all parts of daily life. Purpose: This paper investigates how the new possibilities for understanding,…

  20. Health Monitoring System Technology Assessments: Cost Benefits Analysis (United States)

    Kent, Renee M.; Murphy, Dennis A.


    The subject of sensor-based structural health monitoring is very diverse and encompasses a wide range of activities including initiatives and innovations involving the development of advanced sensor, signal processing, data analysis, and actuation and control technologies. In addition, it embraces the consideration of the availability of low-cost, high-quality contributing technologies, computational utilities, and hardware and software resources that enable the operational realization of robust health monitoring technologies. This report presents a detailed analysis of the cost benefit and other logistics and operational considerations associated with the implementation and utilization of sensor-based technologies for use in aerospace structure health monitoring. The scope of this volume is to assess the economic impact, from an end-user perspective, implementation health monitoring technologies on three structures. It specifically focuses on evaluating the impact on maintaining and supporting these structures with and without health monitoring capability.

  1. Guidelines for the assessment and optimization of turboexpansion technologies

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht, Philipp; Mastandrea, Martin [TECNA Estudios y Proyectos de Ingenieria S.A. (Argentina)


    The operating performance of a turbo expansion process depends on several factors among which we find: pressure, temperature and feed stream composition, expected recovery, pressure required for residual gas and products' specifications. The evolution of markets has set the development of several technologies; it is therefore complex, and rather impossible, to establish which of those technologies represents the most suitable choice for certain conditions by simply inspecting the above-mentioned factors. Guidelines for the assessment and optimization of available technologies are presented in this work. Also, relevant matters to be taken into account in the development of different units of a turbo expansion plant are mentioned. (author)

  2. Assessment of a satellite power system and six alternative technologies

    Energy Technology Data Exchange (ETDEWEB)

    Wolsko, T.; Whitfield, R.; Samsa, M.; Habegger, L.S.; Levine, E.; Tanzman, E.


    The satellite power system is assessed in comparison to six alternative technologies. The alternatives are: central-station terrestrial photovoltaic systems, conventional coal-fired power plants, coal-gasification/combined-cycle power plants, light water reactor power plants, liquid-metal fast-breeder reactors, and fusion. The comparison is made regarding issues of cost and performance, health and safety, environmental effects, resources, socio-economic factors, and insitutional issues. The criteria for selecting the issues and the alternative technologies are given, and the methodology of the comparison is discussed. Brief descriptions of each of the technologies considered are included. (LEW)

  3. The contribution of health technology assessment, health needs assessment, and health impact assessment to the assessment and translation of technologies in the field of public health genomics. (United States)

    Rosenkötter, N; Vondeling, H; Blancquaert, I; Mekel, O C L; Kristensen, F B; Brand, A


    The European Union has named genomics as one of the promising research fields for the development of new health technologies. Major concerns with regard to these fields are, on the one hand, the rather slow and limited translation of new knowledge and, on the other hand, missing insights into the impact on public health and health care practice of those technologies that are actually introduced. This paper aims to give an overview of the major assessment instruments in public health [health technology assessment (HTA), health needs assessment (HNA) and health impact assessment (HIA)] which could contribute to the systematic translation and assessment of genomic health applications by focussing at population level and on public health policy making. It is shown to what extent HTA, HNA and HIA contribute to translational research by using the continuum of translational research (T1-T4) in genomic medicine as an analytic framework. The selected assessment methodologies predominantly cover 2 to 4 phases within the T1-T4 system. HTA delivers the most complete set of methodologies when assessing health applications. HNA can be used to prioritize areas where genomic health applications are needed or to identify infrastructural needs. HIA delivers information on the impact of technologies in a wider scope and promotes informed decision making. HTA, HNA and HIA provide a partly overlapping and partly unique set of methodologies and infrastructure for the translation and assessment of genomic health applications. They are broad in scope and go beyond the continuum of T1-T4 translational research regarding policy translation.

  4. Structure of metal-oxide Ti-Ta-(Ti,Ta)xOy coatings during spark alloying and induction-thermal oxidation (United States)

    Koshuro, V.; Fomin, A.; Fomina, M.; Rodionov, I.; Brzhozovskii, B.; Martynov, V.; Zakharevich, A.; Aman, A.; Oseev, A.; Majcherek, S.; Hirsch, S.


    The study focuses on combined spark alloying of titanium and titanium alloy surface and porous matrix structure oxidation. The metal-oxide coatings morphology is the result of melt drop transfer, heat treatment, and oxidation. The study establishes the influence of technological regimes of alloying and oxidation on morphological heterogeneity of metal- oxide system Ti-Ta-(Ti,Ta)xOy.

  5. Review of early assessment models of innovative medical technologies

    DEFF Research Database (Denmark)

    Fasterholdt, Iben; Krahn, Murray D; Kidholm, Kristian


    INTRODUCTION: Hospitals increasingly make decisions regarding the early development of and investment in technologies, but a formal evaluation model for assisting hospitals early on in assessing the potential of innovative medical technologies is lacking. This article provides an overview of models...... for early assessment in different health organisations and discusses which models hold most promise for hospital decision makers. METHODS: A scoping review of published studies between 1996 and 2015 was performed using nine databases. The following information was collected: decision context, decision...... problem, and a description of the early assessment model. RESULTS: 2362 articles were identified and 12 studies fulfilled the inclusion criteria. An additional 12 studies were identified and included in the review by searching reference lists. The majority of the 24 early assessment studies were variants...

  6. Sustainability assessment of energy technologies. Towards an integrative framework

    Energy Technology Data Exchange (ETDEWEB)

    Grunwald, Armin; Roesch, Christine [Karlsruhe Institute of Technology (KIT), Eggenstein-Leopoldshafen (DE). Inst. for Technology Assessment and Systems Analysis (ITAS)


    To be able to design and use energy technologies with regard to the needs of sustainable development, sustainability assessments are necessary prior to the respective decisions. However, as is known, they pose methodological problems: from the difficulties of anticipation of future developments via the determination of assessment criteria through to the necessity to define sustainable development accurately enough. In this contribution, we will introduce an integrative sustainability concept which has hardly been discussed in the energy context. We will analyse this concept with respect to deriving general principles for the sustainability assessment of energy technologies. As a case study, we consider in particular the field of the use of grassland for biomass production for energetic purposes. The integrative concept is shown to provide an overall framework to carry out comprehensible and, above all, comparative sustainability assessments. More or less as a by-product, it can be demonstrated that sustainability means also in the energy sector much more than just environmental compatibility. (orig.)

  7. Health technology assessment in Iran: challenges and views. (United States)

    Olyaeemanesh, Alireza; Doaee, Shila; Mobinizadeh, Mohammadreza; Nedjati, Mina; Aboee, Parisa; Emami-Razavi, Seyed Hassan


    Various decisions have been made on technology application at all levels of the health system in different countries around the world. Health technology assessment is considered as one of the best scientific tools at the service of policy- makers. This study attempts to investigate the current challenges of Iran's health technology assessment and provide appropriate strategies to establish and institutionalize this program. This study was carried out in two independent phases. In the first, electronic databases such as Medline (via Pub Med) and Scientific Information Database (SID) were searched to provide a list of challenges of Iran's health technology assessment. The views and opinions of the experts and practitioners on HTA challenges were studied through a questionnaire in the second phase which was then analyzed by SPSS Software version 16. This has been an observational and analytical study with a thematic analysis. In the first phase, seven papers were retrieved; from which, twenty- two HTA challenges in Iran were extracted by the researchers; and they were used as the base for designing a structured questionnaire of the second phase. The views of the experts on the challenges of health technology assessment were categorized as follows: organizational culture, stewardship, stakeholders, health system management, infrastructures and external pressures which were mentioned in more than 60% of the cases and were also common in the views. The identification and prioritization of HTA challenges which were approved by those experts involved in the strategic planning of the Department of Health Technology Assessment will be a step forward in the promotion of an evidence- based policy- making and in the production of comprehensive scientific evidence.

  8. Field investigations of soils at TA-19, TA-26, TA-73 and TA-0, SWMU aggregate 0-D and 016

    Energy Technology Data Exchange (ETDEWEB)

    McFadden, L.D. [Geoprofile, Inc., Albuquerque, NM (United States)


    Field based investigations of the general soil-geomorphic characteristics were carried out at TA-19, -26, -73, -0, Aggregate 0-D and -016 in order to provide information for utilization in ongoing and anticipated LANL ERP (Environmental Restoration Project) activities at these sites. These investigations show that soils exhibiting diverse morphologic character, varying ages, and relations to landforms characterize these sites. A review of recent and ongoing soils studies also shows that soil textural, chemical, and mineralogical characteristics may profoundly influence the migration and/or retardation of a variety of potential contaminants initially placed in direct contact with soils, or that encounter soils during subsurface percolation or discharge. Soil-geomorphic relations also provide important insights into recent site erosion, deposition or other surficial processes that must, be considered as part of environmental assessment of a given site and remediation; and, the planned geomorphic mapping activities at each site, as well as other associated activities (e.g, geophysical survey, site sampling) are accordingly appropriate and necessary with respect to identification of significant soil relations at each site. Specific and general recommendations in consideration of important findings regarding the possible impacts of soil development of the nature of contaminant behavior at various sites are provided to help guide sampling and analysis activities during ERP investigations outlined in the RFI Work Plan for Operational Unit-1071.

  9. The NICE ADHD health technology assessment: A review and critique

    Directory of Open Access Journals (Sweden)

    Schlander Michael


    Full Text Available Abstract Background Health technology assessments (HTAs by the National Institute for Health and Clinical Excellence (NICE enjoy high levels of international attention. The present analysis addresses NICE's appraisal of methylphenidate, atomoxetine and dexamphetamine for attention-deficit/hyperactivity disorder (ADHD in children and adolescents, published in March 2006. Methods A qualitative study of NICE Technology Appraisal No. 98 was done focusing on the >600-page technology assessment report, which aimed at evaluating ADHD treatment strategies by a clinical effectiveness review and an economic analysis using meta-analytical techniques and a cost-effectiveness model. Results The technology assessment was unable to differentiate between the various drugs in terms of efficacy, and its economic model was ultimately driven by cost differences. While the assessment concluded that the economic model "clearly identified an optimal treatment strategy" with first-line dexamphetamine, the NICE appraisal committee subsequently found it impossible to distinguish between the different strategies on grounds of cost-effectiveness. Analyzing the assessment reveals gaps and inconsistencies concerning data selection (ultimately relying on a small number of short-term studies only, data synthesis (pooling of heterogeneous study designs and clinical endpoints, and economic model structure (identifying double-counting of nonresponders as a likely source of bias, alongside further methodological anomalies. Conclusion Many conclusions of the NICE technology assessment rest on shaky grounds. There remains a need for a new, state-of-the-art systematic review of ADHD treatment strategies including economic evaluation, which ideally should address outcomes beyond children's health-related quality of life, such as long-term sequelae of the disorder and caregiver burden.

  10. Teknologvurdering, Broer og Brugere (Technology Assessment: Bridges and Users)

    DEFF Research Database (Denmark)

    Munch, Birgitte

    A critique of the scientific approaches grounding Danish technology assessments for beingnon-reflexive upon the consequences of its biased treatment of who and how some countsas ‘users'. Implications and new approaches are outlined in a story of engineering designers conceptualization of ships...

  11. Assessment, Technology and Democratic Education in the Age of Data (United States)

    Perrotta, Carlo


    This paper contends that powerful techniques to manipulate data, enabled by technological and economic developments, can be easily co-opted to serve the restrictive frameworks of hyper-controlling, managerial accountability that characterise current cultures of summative assessment in education. In response to these challenges, research is…

  12. Nutrition and health technology assessment: When two worlds meet

    NARCIS (Netherlands)

    M.J. Poley (Marten)


    textabstractThere is a growing recognition that nutrition may have a positive impact on public health and that it may reduce medical expenditures. Yet, such claims need to be substantiated by evidence. This evidence could be delivered by health technology assessment (HTA), which can be thought of as

  13. Integrating ethics in health technology assessment: many ways to Rome

    NARCIS (Netherlands)

    Hofmann, B.; Oortwijn, W.; Lysdahl, K. Bakke; Refolo, P.; Sacchini, D.; Wilt, G.J. van der; Gerhardus, A.


    OBJECTIVES: The aim of this study was to identify and discuss appropriate approaches to integrate ethical inquiry in health technology assessment (HTA). METHODS: The key question is how ethics can be integrated in HTA. This is addressed in two steps: by investigating what it means to integrate ethic

  14. Mapping of health technology assessment in selected countries

    NARCIS (Netherlands)

    Oortwijn, W.; Broos, P.; Vondeling, H.; Banta, D.; Todorova, L.


    Objectives: The aim of this study was to develop and apply an instrument to map the level of health technology assessment (HTA) development at country level in selected countries. We examined middle-income countries (Argentina, Brazil, India, Indonesia, Malaysia, Mexico, and Russia) and countries we

  15. Condition Assessment Technologies for Water Transmission and Distribution Systems (United States)

    As part of the U.S. Environmental Protection Agency’s (EPA’s) Aging Water Infrastructure Research Program, this research was conducted to identify and characterize the state of the technology for structural condition assessment of drinking water transmission and distribution syst...

  16. Developmental toxicity testing for safety assessment: new approaches and technologies. (United States)

    Knudsen, Thomas B; Kavlock, Robert J; Daston, George P; Stedman, Donald; Hixon, Mary; Kim, James H


    The ILSI Health and Environmental Sciences Institute's Developmental and Reproductive Toxicology Technical Committee held a 2-day workshop entitled "Developmental Toxicology-New Directions" in April 2009. The fourth session of this workshop focused on new approaches and technologies for the assessment of developmental toxicology. This session provided an overview of the application of genomics technologies for developmental safety assessment, the use of mouse embryonic stem cells to capture data on developmental toxicity pathways, dynamical cell imaging of zebrafish embryos, the use of computation models of development pathways and systems, and finally, high-throughput in vitro approaches being utilized by the EPA ToxCast program. Issues discussed include the challenges of anchoring in vitro predictions to relevant in vivo endpoints and the need to validate pathway-based predictions with targeted studies in whole animals. Currently, there are 10,000 to 30,000 chemicals in world-wide commerce in need of hazard data for assessing potential health risks. The traditional animal study designs for assessing developmental toxicity cannot accommodate the evaluation of this large number of chemicals, requiring that alternative technologies be utilized. Though a daunting task, technologies are being developed and utilized to make that goal reachable. © 2011 Wiley Periodicals, Inc.

  17. Technology assessment of automation trends in the modular home industry (United States)

    Phil Mitchell; Robert Russell Hurst


    This report provides an assessment of technology used in manufacturing modular homes in the United States, and that used in the German prefabricated wooden home industry. It is the first step toward identifying the research needs in automation and manufacturing methods that will facilitate mass customization in the home manufacturing industry. Within the United States...

  18. Reimbursement of pharmaceuticals: Reference pricing versus health technology assessment

    NARCIS (Netherlands)

    M. Drummond (Michael); B. Jönsson (Bengt); F.F.H. Rutten (Frans); T. Stargardt (Tom)


    textabstractReference pricing and health technology assessment are policies commonly applied in order to obtain more value for money from pharmaceuticals. This study focussed on decisions about the initial price and reimbursement status of innovative drugs and discussed the consequences for market a

  19. Framework for dementia Quality of Life assessment with Assistive Technology

    DEFF Research Database (Denmark)

    Peterson, Carrie Beth; Prasad, Neeli R.; Prasad, Ramjee


    This paper proposes a theoretical framework for a Quality of Life (QOL) evaluation tool that is sensitive, flexible, computerized, and specific to assistive technology (AT) for dementia care. Using the appropriate evaluation tool serves to improve methodologies that are used for AT assessment...

  20. The Post-implementation Assessment of Advanced Technology Utilization

    Directory of Open Access Journals (Sweden)

    Hynek Josef


    Full Text Available Efficient utilization of advanced manufacturing technology is usually seen as one of the crucial factors in achieving competitiveness on global markets. On the other hand, there are many problems associated with the advanced technology utilization. These problems could be related to the individual phases of the relevant project life cycle - starting from the early stages of AMT projects preparation and evaluation, through various problems related to the project implementation, its integration within the company environment, up to the issues related to the efficient utilization of the already deployed system. This paper focuses on the final stage of this processwhen the post-implementation assessment should be carried out in order to determine whether all initial expectations and objectives were met and whether all the originally promised benefits were delivered. Typical problems of technology benefits evaluation together with various methods, concepts as well as metrics used in the process of the assessment will be discussed here in particular.

  1. Integration of tablet technologies in the e-laboratory of cytology: a health technology assessment. (United States)

    Giansanti, Daniele; Pochini, Marco; Giovagnoli, Maria Rosaria


    Although tablet systems are becoming a powerful technology, particularly useful in every application of medical imaging, to date no one has investigated the acceptance and performance of this technology in digital cytology. The specific aims of the work were (1) to design a health technology assessment (HTA) tool to assess, in terms of performance and acceptance, the introduction of tablet technologies (wearable, portable, and non portable) in the e-laboratories of cytology and (2) to test the tool in a first significant application of digital cytology. An HTA tool was proposed operating on a domain of five dimensions of investigation comprising the basic information of the product of digital cytology, the perceived subjective quality of images, the assessment of the virtual navigation on the e-slide, the assessment of the information and communication technologies features, and the diagnostic power. Six e-slides regarding studies of cervicovaginal cytology digitalized by means of an Aperio ( ) scanner and uploaded onto the Web site were used for testing the methodology on three different network connections. Three experts of cytology successfully tested the methodology on seven tablets found suitable for the study in their own standard configuration. Specific indexes furnished by the tool indicated both a high degree of performance and subjective acceptance of the investigated technology. The HTA tool thus could be useful to investigate new tablet technologies in digital cytology and furnish stakeholders with useful information that may help them make decisions involving the healthcare system. From a global point of view the study demonstrates the feasibility of using the tablet technology in digital cytology.

  2. Human factors assessments of innovative technologies: Robotics sector

    Energy Technology Data Exchange (ETDEWEB)

    Moran, J.B. [Operating Engineers National Hazmat Program, Beaver, WV (United States)


    The U.S. Department of Energy (DOE) has funded major environmental technology developments over the past several years. One area that received significant attention is robotics, which has resulted in the development of a wide range of unique robotic systems tailored to the many tasks unique to the DOE complex. These systems are often used in highly hazardous environments, which reduces or eliminates worker exposures. The DOE, concurrent with the technology development initiative, also established and funded a 5-yr cooperative agreement intended to interface with the technology development community-with specific attention to the occupational safety and health aspects associated with individual technologies through human factors and hazard assessments. This program is now in its third year.

  3. Readings in technology assessment. [in relation to social impact and the law (United States)


    Papers are presented which reflect research in the following areas: development of the concept of technology assessment; institutionalization of technology assessment; the interface between law and technology assessment; and assessment case studies. Case studies include hazards of the medical use of X-rays, environmental noise effects in transportation planning, genetic technology, impact of underground coal mining, and aircraft/airport noise abatement.


    Energy Technology Data Exchange (ETDEWEB)

    M.A. Ebadian, Ph.D.


    The purpose of this investigation was to conduct a comparative analysis of innovative technologies for the non-aggressive removal of coatings from metal and masonry surfaces and the aggressive removal of one-quarter to one-inch thickness of surface from structural masonry. The technologies tested should be capable of being used in nuclear facilities. Innovative decontamination technologies are being evaluated under standard, non-nuclear conditions at the FIU-HCET technology assessment site in Miami, Florida. This study is being performed to support the OST, the Deactivation and Decommissioning (D&D) Focus Area, and the environmental restoration of DOE facilities throughout the DOE complex by providing objective evaluations of currently available decontamination technologies.

  5. Methods of synthesizing qualitative research studies for health technology assessment. (United States)

    Ring, Nicola; Jepson, Ruth; Ritchie, Karen


    Synthesizing qualitative research is an important means of ensuring the needs, preferences, and experiences of patients are taken into account by service providers and policy makers, but the range of methods available can appear confusing. This study presents the methods for synthesizing qualitative research most used in health research to-date and, specifically those with a potential role in health technology assessment. To identify reviews conducted using the eight main methods for synthesizing qualitative studies, nine electronic databases were searched using key terms including meta-ethnography and synthesis. A summary table groups the identified reviews by their use of the eight methods, highlighting the methods used most generally and specifically in relation to health technology assessment topics. Although there is debate about how best to identify and quality appraise qualitative research for synthesis, 107 reviews were identified using one of the eight main methods. Four methods (meta-ethnography, meta-study, meta-summary, and thematic synthesis) have been most widely used and have a role within health technology assessment. Meta-ethnography is the leading method for synthesizing qualitative health research. Thematic synthesis is also useful for integrating qualitative and quantitative findings. Four other methods (critical interpretive synthesis, grounded theory synthesis, meta-interpretation, and cross-case analysis) have been under-used in health research and their potential in health technology assessments is currently under-developed. Synthesizing individual qualitative studies has becoming increasingly common in recent years. Although this is still an emerging research discipline such an approach is one means of promoting the patient-centeredness of health technology assessments.

  6. Technology Assessment and Roadmap for the Emergency Radiation Dose Assessment Program

    Energy Technology Data Exchange (ETDEWEB)

    Turteltaub, K W; Hartman-Siantar, C; Easterly, C; Blakely, W


    A Joint Interagency Working Group (JIWG) under the auspices of the Department of Homeland Security Office of Research and Development conducted a technology assessment of emergency radiological dose assessment capabilities as part of the overall need for rapid emergency medical response in the event of a radiological terrorist event in the United States. The goal of the evaluation is to identify gaps and recommend general research and development needs to better prepare the Country for mitigating the effects of such an event. Given the capabilities and roles for responding to a radiological event extend across many agencies, a consensus of gaps and suggested development plans was a major goal of this evaluation and road-mapping effort. The working group consisted of experts representing the Departments of Homeland Security, Health and Human Services (Centers for Disease Control and the National Institutes of Health), Food and Drug Administration, Department of Defense and the Department of Energy's National Laboratories (see appendix A for participants). The specific goals of this Technology Assessment and Roadmap were to: (1) Describe the general context for deployment of emergency radiation dose assessment tools following terrorist use of a radiological or nuclear device; (2) Assess current and emerging dose assessment technologies; and (3) Put forward a consensus high-level technology roadmap for interagency research and development in this area. This report provides a summary of the consensus of needs, gaps and recommendations for a research program in the area of radiation dosimetry for early response, followed by a summary of the technologies available and on the near-term horizon. We then present a roadmap for a research program to bring present and emerging near-term technologies to bear on the gaps in radiation dose assessment and triage. Finally we present detailed supporting discussion on the nature of the threats we considered, the status of

  7. Pre-Test Analysis Predictions for the Shell Buckling Knockdown Factor Checkout Tests - TA01 and TA02 (United States)

    Thornburgh, Robert P.; Hilburger, Mark W.


    This report summarizes the pre-test analysis predictions for the SBKF-P2-CYL-TA01 and SBKF-P2-CYL-TA02 shell buckling tests conducted at the Marshall Space Flight Center (MSFC) in support of the Shell Buckling Knockdown Factor (SBKF) Project, NASA Engineering and Safety Center (NESC) Assessment. The test article (TA) is an 8-foot-diameter aluminum-lithium (Al-Li) orthogrid cylindrical shell with similar design features as that of the proposed Ares-I and Ares-V barrel structures. In support of the testing effort, detailed structural analyses were conducted and the results were used to monitor the behavior of the TA during the testing. A summary of predicted results for each of the five load sequences is presented herein.

  8. Multiple criteria decision analysis for health technology assessment. (United States)

    Thokala, Praveen; Duenas, Alejandra


    Multicriteria decision analysis (MCDA) has been suggested by some researchers as a method to capture the benefits beyond quality adjusted life-years in a transparent and consistent manner. The objectives of this article were to analyze the possible application of MCDA approaches in health technology assessment and to describe their relative advantages and disadvantages. This article begins with an introduction to the most common types of MCDA models and a critical review of state-of-the-art methods for incorporating multiple criteria in health technology assessment. An overview of MCDA is provided and is compared against the current UK National Institute for Health and Clinical Excellence health technology appraisal process. A generic MCDA modeling approach is described, and the different MCDA modeling approaches are applied to a hypothetical case study. A comparison of the different MCDA approaches is provided, and the generic issues that need consideration before the application of MCDA in health technology assessment are examined. There are general practical issues that might arise from using an MCDA approach, and it is suggested that appropriate care be taken to ensure the success of MCDA techniques in the appraisal process. Copyright © 2012 International Society for Pharmacoeconomics and Outcomes Research (ISPOR). Published by Elsevier Inc. All rights reserved.

  9. Technological and life cycle assessment of organics processing odour control technologies. (United States)

    Bindra, Navin; Dubey, Brajesh; Dutta, Animesh


    As more municipalities and communities across developed world look towards implementing organic waste management programmes or upgrading existing ones, composting facilities are emerging as a popular choice. However, odour from these facilities continues to be one of the most important concerns in terms of cost & effective mitigation. This paper provides a technological and life cycle assessment of some of the different odour control technologies and treatment methods that can be implemented in organics processing facilities. The technological assessment compared biofilters, packed tower wet scrubbers, fine mist wet scrubbers, activated carbon adsorption, thermal oxidization, oxidization chemicals and masking agents. The technologies/treatment methods were evaluated and compared based on a variety of operational, usage and cost parameters. Based on the technological assessment it was found that, biofilters and packed bed wet scrubbers are the most applicable odour control technologies for use in organics processing faculties. A life cycle assessment was then done to compare the environmental impacts of the packed-bed wet scrubber system, organic (wood-chip media) bio-filter and inorganic (synthetic media) bio-filter systems. Twelve impact categories were assessed; cumulative energy demand (CED), climate change, human toxicity, photochemical oxidant formation, metal depletion, fossil depletion, terrestrial acidification, freshwater eutrophication, marine eutrophication, terrestrial eco-toxicity, freshwater eco-toxicity and marine eco-toxicity. The results showed that for all impact categories the synthetic media biofilter had the highest environmental impact, followed by the wood chip media bio-filter system. The packed-bed system had the lowest environmental impact for all categories.

  10. The study of the life cycle of technology assessment model

    Institute of Scientific and Technical Information of China (English)

    SHEN Yu-Zhi; HUANG Xun-jiang


    The life cycle of technology is one of the most important indexes to weigh up the risk of the investment to neo-tech. There are so many uncertainties because it is conditioned by a lot of factors, we can not make a rational forecasting by traditional assessment method. So this paper gives a conprehensive consideration to the factors that influence production and makes some modification to production function, and establishes the life cycle of technology assessmet model by the method of fuzzy mathematics. So it quantifies the risk of investment. We can take it as one foundational index for the decision making of the investment.

  11. Knowledge in health technology assessment: who, what, how? (United States)

    Tjørnhøj-Thomsen, Tine; Hansen, Helle Ploug


    Health systems are placing more and more emphasis on designing and delivering services that are focused on the patient, and there is a growing interest in patient aspects of health policy research and health technology assessment (HTA). Only a few HTA agencies use and invest in scientific methods to generate knowledge and evidence about the patient aspects of a given technology. This raises questions about how knowledge is produced in HTA reports and what kind of knowledge is considered relevant. This article uses a Danish HTA on patient education from 2009 as empirical material for a critical examination and discussion of knowledge and knowledge production about the patient aspects of HTA.

  12. Prioritizing Information Technology Investments: Assessing the Correlations among Technological Readiness, Information Technology Flexibility, and Information Technology Effectiveness (United States)

    Walter, John T.


    Management's dilemma, when allocating financial resources towards the improvement of technological readiness and IT flexibility within their organizations, is to control financial risk and maximize IT effectiveness. Technological readiness is people's propensity to embrace and use technology. Its drivers are optimism, innovativeness, discomfort,…

  13. Hanford Tank Farm Vapors Abatement Technology and Vendor Proposals Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Burns, H. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Farrar, M. E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Fink, S. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    Suspected chemical vapor releases from the Hanford nuclear waste tank system pose concerns for worker exposure. Washington River Protection Solutions (WRPS) contracted the Savannah River National Laboratory (SRNL) to explore abatement technologies and strategies to remediate the vapors emitted through the ventilation system. In response, SRNL conducted an evaluation of technologies to abate, or reduce, vapor emissions to below 10% of the recognized occupational exposure limits (OELs). The evaluation included a review of published literature and a broadly communicated Request for Information to commercial vendors through a Federal Business Opportunities (Fed Biz Opps) web posting. In addition, SRNL conducted a workshop and post-workshop conference calls with interested suppliers (vendors) to assess proposals of relevant technologies. This report reviews applicable technologies and summarizes the approaches proposed by the vendors who participated in the workshop and teleconference interviews. In addition, the report evaluates the estimated performance of the individual technologies for the various classes of chemical compounds present in the Hanford Chemicals of Potential Concern (COPCs) list. Similarly, the report provides a relative evaluation of the vendor proposed approaches against criteria of: technical feasibility (and maturity), design features, operational considerations, secondary waste generation, safety/regulatory, and cost / schedule. These rough order-of-magnitude (ROM) cost estimates are intended to provide a comparison basis between technologies and are not intended to be actual project estimates.

  14. Hanford Tank Farm Vapors Abatement Technology and Vendor Proposals Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Burns, H. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Farrar, M. E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Fink, S. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    Suspected chemical vapor releases from the Hanford nuclear waste tank system pose concerns for worker exposure. Washington River Protection Solutions (WRPS) contracted the Savannah River National Laboratory (SRNL) to explore abatement technologies and strategies to remediate the vapors emitted through the ventilation system. In response, SRNL conducted an evaluation of technologies to abate, or reduce, vapor emissions to below 10% of the recognized occupational exposure limits (OELs). The evaluation included a review of published literature and a broadly communicated Request for Information to commercial vendors through a Federal Business Opportunities (Fed Biz Opps) web posting. In addition, SRNL conducted a workshop and post-workshop conference calls with interested suppliers (vendors) to assess proposals of relevant technologies. This report reviews applicable technologies and summarizes the approaches proposed by the vendors who participated in the workshop and teleconference interviews. In addition, the report evaluates the estimated performance of the individual technologies for the various classes of chemical compounds present in the Hanford Chemicals of Potential Concern (COPCs) list. Similarly, the report provides a relative evaluation of the vendor proposed approaches against criteria of: technical feasibility (and maturity), design features, operational considerations, secondary waste generation, safety/regulatory, and cost / schedule. These rough order magnitude (ROM) cost estimates are intended to provide a comparison basis between technologies and are not intended to be actual project estimates.

  15. Recent Life Assessment Technology for Existing Steam Turbines (United States)

    Saito, Kiyoshi; Sakuma, Akira; Fukuda, Masataka

    A large and growing portion of electricity is produced by aging thermal power plants. Although excellent, high quality materials such as CrMoV steel and 12% Cr steel, etc. are used for the steam turbines, various forms of metallurgical degradation, due to creep and fatigue, etc. affect the parts and components during long-term operation at high temperature. Extending the life of steam turbines and ensuring high reliability requires life assessment technology, scheduled repairing, conversion, modification and upgrading of components in order to provide a stable power supply. As the high temperature parts and components of aged steam turbines are mainly metallurgically damaged by creep, fatigue and the interaction of both, life assessment combined with analytical and nondestructive methods is essential for realizing strategic plant life extension. We have developed a life assessment technology that takes material degradation into consideration, and have applied the procedure to more than 650 units and 2500 components since 1983. A rotor bore replication device was developed in 1989 for the purpose of nondestructive observation of creep voids and supporting the validity of life prediction results. This paper describes the technical features and applied experience of recent life assessment technology for existing high temperature steam turbines.

  16. Dead Layer in a Ta/Ni81Fe19/Ta Structure

    Institute of Scientific and Technical Information of China (English)

    于广华; 任婷婷; 李明华; 朱逢吾; 姜宏伟; 赖武彦


    The effect of Ta seed layers and Ta cap layers on the effective magnetic thickness of ultrathin permalloy (Ni81 Fe19)was experimentally investigated for magnetic random access memory applications. The films were deposited by magnetron sputtering. For a Ta/Ni81Fe19/Ta fundamental structure, the Ta seed and Ta cap layers resulted in a loss of moment equivalent to a magnetically dead layer of thickness 1.6 ± 0.2 nm. In order to find the mechanism, the composition and chemical states at the interface regions of Ta/Ni81 Fe19 and Ni81 Fe19/Ta were studied using x-ray photoelectron spectroscopy and the peak decomposition technique. The results show that there are thermodynamically favourable reactions at the Ta/Ni81 Fe19 and Ni81Fe19/Ta interfaces: 2Ta + Ni = NiTa2.

  17. Teacher Learning of Technology-Enhanced Formative Assessment

    CERN Document Server

    Beatty, Ian D; Leonard, William J; Gerace, William J; Cyr, Karen St; Lee, Hyunju; Harris, Robby


    Technology-Enhanced Formative Assessment (TEFA) is a pedagogy for teaching with classroom response technology. Teacher Learning of TEFA is a five-year research project studying teacher change, in the context of an intensive professional development program designed to help science and mathematics teachers learn TEFA. First, we provide an overview of the project's participating teachers, its intervention (consisting of the technology, the pedagogy, and the professional development program), and its research design. Then, we present narratives describing the unfolding change process experienced by four teachers. Afterward, we present some preliminary findings of the research, describe a "model for the co-evolution of teacher and pedagogy" that we are developing, and identify general implications for professional development.

  18. Proposal for a state health technology assessment program. (United States)

    Colmenares, Phil


    Evidence suggests that a significant number of medical technologies are of little or no benefit to patients. Under current budgetary pressures, state health care programs cannot afford continued spending on unnecessary medical care without further cuts in enrollment. Limiting coverage of high-tech care only to indications supported by good clinical evidence would help save state health care dollars. However, there is currently no public process to formally evaluate new medical interventions in Wisconsin. In fact, new therapies often are introduced into clinical practice, and covered by state health insurance programs, even when there is weak or questionable evidence of clinical effectiveness. This article proposes the creation of a state Health Technology Assessment program in Wisconsin to systematically evaluate new tests or treatments, and to promote evidence-based coverage decisions. Such a program would help limit wasteful spending on unnecessary technologies, reinforce good clinical practice, and protect patients from the risks of interventions that have not been proven effective.

  19. Technical and economic assessment of energy conversion technologies for MSW

    Energy Technology Data Exchange (ETDEWEB)

    Livingston, W.R.


    Thermal processes for municipal solid wastes (MSW) based on pyrolysis and/or gasification that have relevance to the emerging UK market are described in this report, and the results of the technical and economical assessment of these processes are presented. The Mitsui R21 Technology, the Thermoselect Process, the Nippon Steel Waste Melting Process, the Pyropleq Process, and the Compact Power Process are selected for detailed comparison on the basis of the overall technical concept, the energy balance and the requirements for consumables, environmental performance, and the technical and commercial status of the technology. Details are also given of a comparison of the novel thermal technologies with conventional mass burn incineration for MSW.

  20. ECASTAR: Energy Conservation; an Assessment of Systems, Technologies and Requirements (United States)


    A methodology for a systems approach display and assessment of the potential for energy conservation actions and the impacts of those actions was presented. The U.S. economy is divided into four sectors: energy industry, industry, residential/commercial and transportation. Each sector is assessed with respect to energy conservation actions and impacts. The four sectors are combined and three strategies for energy conservation actions for the combined sectors are assessed. The three strategies (national energy conservation, electrification and diversification) represent energy conservation actions for the near term (now to 1985), the mid term (1985 to 2000) and the far term (2000 and beyond). The assessment procedure includes input/output analysis to bridge the flows between the sectors, and net economics and net energetics as performance criteria for the conservation actions. Targets of opportunity for large net energy net energy savings and the application of technology to achieve these savings are discussed.

  1. Implementation of Relevant Methods in Assessing Traffic-Technological Projects

    Directory of Open Access Journals (Sweden)

    Danijela Barić


    Full Text Available The assessment of investment traffic-technological projectsmeans a set of activities whose basic aim is to determine the justificationand feasibility of the projects. The decision-makingprocess, including the decision-making on investments is an extremelycomplex process, and the decision-maker has to have avision of the future and make decisions accordingly in a modemand flexible manner. Therefore, the decisions need to be theresult of a planning and research process based on relevant scientificmethods. The work includes the selected, analysed andpresented methods of cost-benefit analysis, methods of multi-criteria decision-making and SWOT (Strengths, Weaknesses,Opportunities, and Threats analysis methods. Regarding thebasic characteristics, the mentioned methods have been compared,the order of their implementation has been determined,and then they have been implemented in assessing the traffic-technological projects of reconstmction with the aim of selectingthe optimal variant solution.

  2. Environmental assessment of solid waste systems and technologies: EASEWASTE

    DEFF Research Database (Denmark)

    Kirkeby, Janus Torsten; Birgisdottir, Harpa; Hansen, Trine Lund


    to optimize current waste management systems with respect to environmental achievements and by authorities to Set Guidelines and regulations and to evaluate different strategies for handling of waste. The waste hierarchy has for decades been governing waste management but the ranking of handling approaches......A new model has been developed for evaluating the overall resource consumption and environmental impacts of municipal solid waste management systems by the use of life cycle assessment. The model is named EASEWASTE (Environmental Assessment of Solid Waste Systems and Technologies) and is able...... to compare different waste management strategies, waste treatment methods and waste process technologies. The potential environmental impacts can be traced back to the most important processes and waste fractions that contribute to the relevant impacts. A model like EASEWASTE can be used by waste planners...

  3. Hospital Based Health Technology Assessment: an example from Siena

    Directory of Open Access Journals (Sweden)

    Pietro Manzi


    Full Text Available The Health Technology Assessment (HTA has emerged in recent years as a useful tool in healthcare decision-making. It is a multidisciplinary process that summarizes information about the medical, social, economic and ethical issues related to the use of a health technology and provides evidence-based information on how to allocate resources. The experience of Siena University Hospital is an example of multidisciplinary hospital-based HTA. In the present paper we summarize the organization of HTA commission and the assessment methodology of the purchase, rental or sale of medical equipment and medical devices. Furthermore we illustrate the data concerning the commission activities in 2013.

  4. National Wind Technology Center sitewide, Golden, CO: Environmental assessment

    Energy Technology Data Exchange (ETDEWEB)



    The National Renewable Energy Laboratory (NREL), the nation`s primary solar and renewable energy research laboratory, proposes to expand its wind technology research and development program activities at its National Wind Technology Center (NWTC) near Golden, Colorado. NWTC is an existing wind energy research facility operated by NREL for the US Department of Energy (DOE). Proposed activities include the construction and reuse of buildings and facilities, installation of up to 20 wind turbine test sites, improvements in infrastructure, and subsequent research activities, technology testing, and site operations. In addition to wind turbine test activities, NWTC may be used to support other NREL program activities and small-scale demonstration projects. This document assesses potential consequences to resources within the physical, biological, and human environment, including potential impacts to: air quality, geology and soils, water resources, biological resources, cultural and historic resources, socioeconomic resources, land use, visual resources, noise environment, hazardous materials and waste management, and health and safety conditions. Comment letters were received from several agencies in response to the scoping and predecisional draft reviews. The comments have been incorporated as appropriate into the document with full text of the letters contained in the Appendices. Additionally, information from the Rocky Flats Environmental Technology Site on going sitewide assessment of potential environmental impacts has been reviewed and discussed by representatives of both parties and incorporated into the document as appropriate.

  5. An assessment of acid rock drainage continuous monitoring technology (United States)

    Fytas, K.; Hadjigeorgiou, J.


    In order to assess the magnitude and impact at affected mine sites of acid rock drainage (ARD), fixed-frequency sampling is often employed. This often involves manual sampling, at regular time intervals, of water and solids. It is felt that such sampling does not adequately describe the system evolution. Continuous monitoring offers a viable alternative in that it can better follow the seasonal fluctuations and high-frequency variations that characterize ARD. This paper evaluates existing continuous monitoring technology.

  6. Preliminary technology utilization assessment of the robotic fruit harvester (United States)

    Wilhelm, J.


    The results of an analysis whose purpose was to examine the history and progress of mechanical fruit harvesting, to determine the significance of a robotic fruit tree harvester and to assess the available market for such a product are summarized. Background information that can be used in determining the benefit of a proof of principle demonstration is provided. Such a demonstration could be a major step toward the transfer of this NASA technology.

  7. Zero-emission vehicle technology assessment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Woods, T.


    This is the final report in the Zero-Emission Vehicle (ZEV) Technology Assessment, performed for NYSERDA by Booz-Allen & Hamilton Inc. Booz-Allen wrote the final report, and performed the following tasks as part of the assessment: assembled a database of key ZEV organizations, their products or services, and plans; described the current state of ZEV technologies; identified barriers to widespread ZEV deployment and projected future ZEV technical capabilities; and estimated the cost of ZEVs from 1998 to 2004. Data for the ZEV Technology Assessment were obtained from several sources, including the following: existing ZEV industry publications and Booz-Allen files; major automotive original equipment manufacturers; independent electric vehicle manufacturers; battery developers and manufacturers; infrastructure and component developers and manufacturers; the U.S. Department of Energy, the California Air Resources Board, and other concerned government agencies; trade associations such as the Electric Power Research Institute and the Electric Transportation Coalition; and public and private consortia. These sources were contacted by phone, mail, or in person. Some site visits of manufacturers also were conducted. Where possible, raw data were analyzed by Booz-Allen staff and/or verified by independent sources. Performance data from standardized test cycles were used as much as possible.

  8. XPS analyses of Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films

    Energy Technology Data Exchange (ETDEWEB)

    Li Minghua, E-mail: [Department of Material Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Han Gang; Liu Yang; Feng Chun; Wang Haicheng; Teng Jiao; Yu Guanghua [Department of Material Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China)


    Highlights: Black-Right-Pointing-Pointer Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films were prepared by magnetron sputtering. The anisotropic magnetoresistance (AMR) increases dramatically after annealing. Black-Right-Pointing-Pointer The chemical states of Ta and MgO{sub x} at the interface of the NiFe/MgO{sub x}/Ta films, which were prepared at the different technological conditions, were analyzed by X-ray photoelectron spectroscopy (XPS). Black-Right-Pointing-Pointer The AMR of Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films is related to the chemical states of MgO{sub x}. These states were produced under different technical conditions and influence the film properties. - Abstract: Ta/MgO{sub x}/Ni{sub 81}Fe{sub 19}/MgO{sub x}/Ta films were prepared by magnetron sputtering. The anisotropic magnetoresistance (AMR) increases dramatically after annealing. The chemical states of Ta and MgO{sub x} at the interface of the NiFe/MgO{sub x}/Ta films, which were prepared at the different technological conditions, were analyzed by X-ray photoelectron spectroscopy (XPS). The results show that the AMR of the films is related to the chemical states of MgO{sub x}. The chemical states of Mg are different when MgO{sub x} is prepared at different technological conditions. Therefore, increasing the AMR is beneficial when more Mg{sup 2+} ions are present in the MgO{sub x} films.

  9. Technology and economic assessment of lactic acid production and uses

    Energy Technology Data Exchange (ETDEWEB)

    Datta, R.; Tsai, S.P.


    Lactic acid has been an intermediate-volume specialty chemical (world production {approximately}50,000 tons/yr) used in a wide range of food-processing and industrial applications. Potentially, it can become a very large-volume, commodity-chemical intermediate produced from carbohydrates for feedstocks of biodegradable polymers, oxygenated chemicals, environmentally friendly ``green`` solvents, and other intermediates. In the past, efficient and economical technologies for the recovery and purification of lactic acid from fermentation broths and its conversion to the chemical or polymer intermediates had been the key technology impediments and main process cost centers. Development and deployment of novel separations technologies, such as electrodialysis with bipolar membranes, extractive and catalytic distillations, and chemical conversion, can enable low-cost production with continuous processes in large-scale operations. The emerging technologies can use environmentally sound lactic acid processes to produce environmentally useful products, with attractive process economics. These technology advances and recent product and process commercialization strategies are reviewed and assessed.

  10. Assessing effects of technology usage on mathematics learning (United States)

    Lynch, Julianne


    Computer-based technologies are now commonplace in classrooms, and the integration of these media into the teaching and learning of mathematics is supported by government policy in most developed countries. However, many questions about the impact of computer-based technologies on classroom mathematics learning remain unanswered, and debates about when and how they ought to be used continue. An increasing number of studies seek to identify the effects of technology usage on classroom learning, and at a time when governments are calling for `evidence-based' policy development, many studies applying quasi-scientific methodologies to this field of practice are emerging. By analysing a series of conceptual frameworks for assessing the use of computer-based technologies to support school learning, this article emphasises the value of research into the relationship between technical and conceptual aspects of technology use in mathematics education and beyond, and challenges the usefulness of large-scale, quasi-scientific studies that focus on educational inputs and outputs.

  11. An assessment of desiccant cooling and dehumidification technology

    Energy Technology Data Exchange (ETDEWEB)

    Mei, V.C.; Chen, F.C. (Oak Ridge National Lab., TN (United States)); Lavan, Z. (Illinois Inst. of Tech., Chicago, IL (United States)); Collier, R.K. Jr. (Collier Engineering Services, Merritt Island, FL (United States)); Meckler, G. (Gershon Meckler Associates, P.C., Herndon, VA (United States))


    Desiccant systems are heat-actuated cooling and dehumidification technology. With the recent advances in this technology, desiccant systems can now achieve a primary energy coefficient of performance (COP) between 1.3 and 1.5, with potential to go to 1.7 and higher. It is becoming one of the most promising alternatives to conventional cooling systems. Two important and well-known advantages of desiccant cooling systems are that they are CFC free and they can reduce the electricity peak load. Another important but lesser-known advantage of desiccant technology is its potential for energy conservation. The energy impact study in this report indicated that a possible 13% energy saving in residential cooling and 8% in commercial cooling is possible. Great energy saving potential also exists in the industrial sector if industrial waste heat can be used for desiccant regeneration. The latest study on desiccant-integrated building heating, ventilating, and air conditioning (HVAC) systems indicated that the initial cost for the conventional cooling equipment was greatly reduced by using desiccant technology because of downsized compressors, fans, and ductworks. This cost reduction was more than enough to offset the cost of desiccant equipment. Besides, the system operation cost was also reduced. All these indicate that desiccant systems are also cost effective. This study provides an updated state-of-the-art assessment forsiccant technology in the field of desiccant materials, systems, computer models, and theoretical analyses. From this information the technology options were derived and the future research and development needs were identified. Because desiccant technology has already been applied in the commercial building sector with very encouraging results, it is expected that future market breakthroughs will probably start in this sector. A market analysis for the commercial building application is therefore included.

  12. Observation of 186mTa

    Institute of Scientific and Technical Information of China (English)


    Unreported tantalum isomer 18mTa has been produced through the reaction 186W(n,p) by irradiation of natW with 14 MeV neutrons. The activity of 186Ta and 186Ta was measured using HPGe detectors and several X-γ as well as γ-γ coincidence arrangements. The 186mTa has been identified by means of measuring known γ rays from 186Ta p-decay. The half-life of 186mTa has been determined to be (1.5±0.1) min.


    Scott, Anna Mae; Bond, Kenneth; Gutiérrez-Ibarluzea, Iñaki; Hofmann, Björn; Sandman, Lars


    Although consideration of ethical issues is recognized as a crucial part of health technology assessment, ethics analysis for HTA is generally perceived as methodologically underdeveloped in comparison to other HTA domains. The aim of our study is (i) to verify existing tools for quality assessment of ethics analyses for HTA, (ii) to consider some arguments for and against the need for quality assessment tools for ethics analyses for HTA, and (iii) to propose a preliminary set of criteria that could be used for assessing the quality of ethics analyses for HTA. We systematically reviewed the literature, reviewed HTA organizations' Web sites, and solicited views from thirty-two experts in the field of ethics for HTA. The database and HTA agency Web site searches yielded 420 references (413 from databases, seven from HTA Web sites). No formal instruments for assessing the quality of ethics analyses for HTA purposes were identified. Thirty-two experts in the field of ethics for HTA from ten countries, who were brought together at two workshops held in Edmonton (Canada) and Cologne (Germany) confirmed the findings from the literature. Generating a quality assessment tool for ethics analyses in HTA would confer considerable benefits, including methodological alignment with other areas of HTA, increase in transparency and transferability of ethics analyses, and provision of common language between the various participants in the HTA process. We propose key characteristics of quality assessment tools for this purpose, which can be applied to ethics analyses for HTA purposes.

  14. A consumer involvement model for health technology assessment in Canada. (United States)

    Pivik, Jayne; Rode, Elisabeth; Ward, Christopher


    Similar to other health policy initiatives, there is a growing movement to involve consumers in decisions affecting their treatment options. Access to treatments can be impacted by decisions made during a health technology assessment (HTA), i.e., the rigorous assessment of medical interventions such as drugs, vaccines, devices, materials, medical and surgical procedures and systems. The purpose of this paper was to empirically assess the interest and potential mechanisms for consumer involvement in HTA by identifying what health consumer organizations consider meaningful involvement, examining current practices internationally and developing a model for involvement based on identified priorities and needs. Canadian health consumer groups representing the largest disease or illness conditions reported a desire for involvement in HTA and provided feedback on mechanisms for facilitating their involvement.

  15. The politics of health technology assessment in Poland. (United States)

    Ozieranski, Piotr; McKee, Martin; King, Lawrence


    First, to identify risks associated with the scientific evaluation of drugs considered for state reimbursement in Poland through exploring strategies of influence employed by multinational drug companies in relation to the Agency for Health Technology Assessment (AHTAPol). Second, to ascertain whether the outcomes of drug evaluation meet the interests of the public payer in reimbursing cost-effective drugs supported by robust pharmacoeconomic evidence. We conducted 109 in-depth semi-structured interviews with a purposive sample of stakeholders involved in the reimbursement process in Poland. We analysed four available documentary sources, including recommendations issued by the AHTAPol. AHTAPol recommendations were an instrumental part of the blame avoidance strategy by political elites. Drug producers utilised direct and indirect strategies of influence. The direct strategies involved building relationships with a circle of health technology assessment analysts and medical experts working for the Agency. The indirect strategies employed leaders of opinion in the medical milieu, patient organisations, and political elites to endorse policy positions favourable to drug companies. The AHTAPol positively recommended an increasing proportion of the drugs it assessed, many of them reported as not cost-effective or supported by dubious pharmacoeconomic evidence. The strategies of influence entail a number of risks that may undermine the scientific evaluation of drugs. Some outcomes of drug evaluation may favour the interests of multinational drug companies over those of the public payer. We suggest that the risks involved in drug evaluation might be mitigated through (1) professionalization of health technology assessment; (2) restriction of job seeking and post public-payer employment; (3) disclosure and management of experts' conflicts of interest; (4) institutionalisation of patient and public involvement; and (5) increased institutional separation of the AHTAPol from

  16. Connected Classroom Technology Facilitates Multiple Components of Formative Assessment Practice (United States)

    Shirley, Melissa L.; Irving, Karen E.


    Formative assessment has been demonstrated to result in increased student achievement across a variety of educational contexts. When using formative assessment strategies, teachers engage students in instructional tasks that allow the teacher to uncover levels of student understanding so that the teacher may change instruction accordingly. Tools that support the implementation of formative assessment strategies are therefore likely to enhance student achievement. Connected classroom technologies (CCTs) include a family of devices that show promise in facilitating formative assessment. By promoting the use of interactive student tasks and providing both teachers and students with rapid and accurate data on student learning, CCT can provide teachers with necessary evidence for making instructional decisions about subsequent lessons. In this study, the experiences of four middle and high school science teachers in their first year of implementing the TI-Navigator™ system, a specific type of CCT, are used to characterize the ways in which CCT supports the goals of effective formative assessment. We present excerpts of participant interviews to demonstrate the alignment of CCT with several main phases of the formative assessment process. CCT was found to support implementation of a variety of instructional tasks that generate evidence of student learning for the teacher. The rapid aggregation and display of student learning evidence provided teachers with robust data on which to base subsequent instructional decisions.

  17. Expanding Health Technology Assessments to Include Effects on the Environment. (United States)

    Marsh, Kevin; Ganz, Michael L; Hsu, John; Strandberg-Larsen, Martin; Gonzalez, Raquel Palomino; Lund, Niels


    There is growing awareness of the impact of human activity on the climate and the need to stem this impact. Public health care decision makers from Sweden and the United Kingdom have started examining environmental impacts when assessing new technologies. This article considers the case for incorporating environmental impacts into the health technology assessment (HTA) process and discusses the associated challenges. Two arguments favor incorporating environmental impacts into HTA: 1) environmental changes could directly affect people's health and 2) policy decision makers have broad mandates and objectives extending beyond health care. Two types of challenges hinder this process. First, the nascent evidence base is insufficient to support the accurate comparison of technologies' environmental impacts. Second, cost-utility analysis, which is favored by many HTA agencies, could capture some of the value of environmental impacts, especially those generating health impacts, but might not be suitable for addressing broader concerns. Both cost-benefit and multicriteria decision analyses are potential methods for evaluating health and environmental outcomes, but are less familiar to health care decision makers. Health care is an important and sizable sector of the economy that could warrant closer policy attention to its impact on the environment. Considerable work is needed to track decision makers' demands, augment the environmental evidence base, and develop robust methods for capturing and incorporating environmental data as part of HTA.

  18. Life cycle assessment of products and technologies. LCA Symposium

    Energy Technology Data Exchange (ETDEWEB)

    Koukkari, H.; Nors, M. (eds.)


    VTT Technical Research Centre of Finland organised a Symposium 'Life Cycle Assessment of Products and Technologies' on the 6th of October, 2009. The Symposium gave a good overview of methods, tools and applications of Life Cycle Assessment developed and utilised in several technology fields of VTT. The 12 Symposium papers deal with recent LCA studies on products and technologies. The scope ranges from beverage cups to urban planning, from inventory databases to rating systems. Topical issues relating to climate change concern biorefineries and the overall impacts of the utilisation of biomass. The calculation of carbon footprints is also introduced through paper products and magazines. One example of LCA tools developed at VTT addresses cement manufacturing. VTT's transport emission database, LIPASTO, was introduced in detail. The use of LCA methods and life cycle thinking is described in various contexts: product development in relation to precision instruments; selection of materials and work processes in relation to sediment remediation project; and procedures of sustainability rating through VTT's office building Digitalo. The Climate Bonus project presented a demonstrated ICT support that informs about the greenhouse gas emissions and carbon footprints of households. (orig.)

  19. Gender in health technology assessment: pilot study on agency approaches. (United States)

    Panteli, Dimitra; Zentner, Annette; Storz-Pfennig, Philipp; Busse, Reinhard


    Gender as a social construct is a recognized health determinant. Because best practice in reporting health technology assessment (HTA) clearly specifies the need to appraise a technology's social impact within the target population, the extent to which gender issues are taken into account in HTA production is of interest, not only in light of equitable practices but also for reasons of effectiveness. The aim of this study is to provide a first assessment of the degree of gender sensitivity shown by HTA agencies around the world today. The Web sites of sixty HTA agencies were analyzed. The consideration of gender aspects was specifically looked for in each agency's general mission statement, its priority setting process, and its methodological approach. Additionally, specific gender-oriented initiatives not belonging to any of the aforementioned categories were identified. Of the sixty agencies, less than half mention a commitment to addressing the social implication of health technologies. Only fifteen institutions make information on their priority setting principles available on their Web sites and gender was an issue in two of those cases. Data on methodology were obtainable online from 18 agencies, two of which mentioned gender issues explicitly. Finally, gender-oriented initiatives were identified by thirteen agencies. A gender-sensitive approach is apparently rarely adopted in current HTA production. Exceptional practices and relevant tools do exist and could serve as examples to be promoted by international collaborative networks.

  20. Development and Implementation of Health Technology Assessment: A Policy Study

    Directory of Open Access Journals (Sweden)

    P Abooee


    Full Text Available Background: To provide an overview of the development of health technology assessment (HTA in Iran since 2007, and to facilitate further development of HTA and its integration into policy making.Methods: Data of this study were collected through key documents (e.g. literature, laws, and other official documentation and analyzed by experts of opinion in form of qualitative methods.Results: Health technology assessment entered to the political agenda in Iran only in 2007 with a strong impetus of an evidence-based medicine movement with the bellow objectives: Institutionalization of evidence-based decision making in Ministry of Health, Creating an localization for structural HTA in Health system of Iran, Setting up training courses in order to educate capable manpower to full up the capacity of the universities, Establishment of a new field in HTA subject in medical universities for MSc and PhD degree, International communication about HTA through national website and possible participation in international Congress.Conclusion: HTA has been established in the healthcare system of Iran but what is needed is a clear political will to push forward the objectives of HTA in Iran. Similar to other countries, advance the regulation on the adoption of new health technologies to improve not only technical or allocate efficiency, but also health equity.

  1. Environmental assessment of digestate treatment technologies using LCA methodology. (United States)

    Vázquez-Rowe, Ian; Golkowska, Katarzyna; Lebuf, Viooltje; Vaneeckhaute, Céline; Michels, Evi; Meers, Erik; Benetto, Enrico; Koster, Daniel


    The production of biogas from energy crops, organic waste and manure has augmented considerably the amounts of digestate available in Flanders. This has pushed authorities to steadily introduce legislative changes to promote its use as a fertilising agent. There is limited arable land in Flanders, which entails that digestate has to compete with animal manure to be spread. This forces many anaerobic digestion plants to further treat digestate in such a way that it can either be exported or the nitrogen be removed. Nevertheless, the environmental impact of these treatment options is still widely unknown, as well as the influence of these impacts on the sustainability of Flemish anaerobic digestion plants in comparison to other regions where spreading of raw digestate is allowed. Despite important economic aspects that must be considered, the use of Life Cycle Assessment (LCA) is suggested in this study to identify the environmental impacts of spreading digestate directly as compared to four different treatment technologies. Results suggest relevant environmental gains when the digestate mix is treated using the examined conversion technologies prior to spreading, although important trade-offs between impact categories were observed and discussed. The promising results of digestate conversion technologies suggest that further LCA analyses should be performed to delve into, for instance, the appropriateness to shift to nutrient recovery technologies rather than digestate conversion treatments.

  2. Stochastic Technology Choice Model for Consequential Life Cycle Assessment. (United States)

    Kätelhön, Arne; Bardow, André; Suh, Sangwon


    Discussions on Consequential Life Cycle Assessment (CLCA) have relied largely on partial or general equilibrium models. Such models are useful for integrating market effects into CLCA, but also have well-recognized limitations such as the poor granularity of the sectoral definition and the assumption of perfect oversight by all economic agents. Building on the Rectangular-Choice-of-Technology (RCOT) model, this study proposes a new modeling approach for CLCA, the Technology Choice Model (TCM). In this approach, the RCOT model is adapted for its use in CLCA and extended to incorporate parameter uncertainties and suboptimal decisions due to market imperfections and information asymmetry in a stochastic setting. In a case study on rice production, we demonstrate that the proposed approach allows modeling of complex production technology mixes and their expected environmental outcomes under uncertainty, at a high level of detail. Incorporating the effect of production constraints, uncertainty, and suboptimal decisions by economic agents significantly affects technology mixes and associated greenhouse gas (GHG) emissions of the system under study. The case study also shows the model's ability to determine both the average and marginal environmental impacts of a product in response to changes in the quantity of final demand.

  3. Information technologies for global resources management and environmental assessment

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, A.P.; Wang, Hua.


    Recent advances in computer and communications technologies offer unprecedented opportunities to develop sophisticated information resources management systems for global resources management and environment assessment in an efficient, effective, and systematic manner. In this paper, the emerging global energy and environmental issues are identified. Since satellite-based remote sensing systems are becoming increasingly available and produce massive data collections, the utilization of imaging processing techniques and their applications for regional and global resources management and environmental studies are described. Interoperability and interconnectivity among heterogeneous computer systems are major issues in designing a totally integrated, multimedia-based, information resources management system that operates in a networking environment. Discussions of the future technology trends are focused on a number of emerging information management technologies and communications standards which will aid in achieving seamless system integration and offer user-friendly operations. It can be foreseen that advances in computer and communications technologies, increasingly sophisticated image processing techniques and Geographical Information Systems (GIS), and the development of globally comprehensive data bases will bring global visualization'' onto multimedia desktop computers before the end of this decade.

  4. Information technologies for global resources management and environmental assessment

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, A.P.; Wang, Hua


    Recent advances in computer and communications technologies offer unprecedented opportunities to develop sophisticated information resources management systems for global resources management and environment assessment in an efficient, effective, and systematic manner. In this paper, the emerging global energy and environmental issues are identified. Since satellite-based remote sensing systems are becoming increasingly available and produce massive data collections, the utilization of imaging processing techniques and their applications for regional and global resources management and environmental studies are described. Interoperability and interconnectivity among heterogeneous computer systems are major issues in designing a totally integrated, multimedia-based, information resources management system that operates in a networking environment. Discussions of the future technology trends are focused on a number of emerging information management technologies and communications standards which will aid in achieving seamless system integration and offer user-friendly operations. It can be foreseen that advances in computer and communications technologies, increasingly sophisticated image processing techniques and Geographical Information Systems (GIS), and the development of globally comprehensive data bases will bring ``global visualization`` onto multimedia desktop computers before the end of this decade.

  5. Evaluation of Excitation Function for 182Ta

    Institute of Scientific and Technical Information of China (English)


    <正>Present work concerns the evaluated neutron induced excitation function data for 182Ta, and mainly on (n, γ) reaction channel. The related experimental data were collected, analyzed and corrected for 182Ta

  6. A Framework for Assessment of Aviation Safety Technology Portfolios (United States)

    Jones, Sharon M.; Reveley, Mary S.


    The programs within NASA's Aeronautics Research Mission Directorate (ARMD) conduct research and development to improve the national air transportation system so that Americans can travel as safely as possible. NASA aviation safety systems analysis personnel support various levels of ARMD management in their fulfillment of system analysis and technology prioritization as defined in the agency's program and project requirements. This paper provides a framework for the assessment of aviation safety research and technology portfolios that includes metrics such as projected impact on current and future safety, technical development risk and implementation risk. The paper also contains methods for presenting portfolio analysis and aviation safety Bayesian Belief Network (BBN) output results to management using bubble charts and quantitative decision analysis techniques.

  7. Finding Qualitative Research Evidence for Health Technology Assessment. (United States)

    DeJean, Deirdre; Giacomini, Mita; Simeonov, Dorina; Smith, Andrea


    Health technology assessment (HTA) agencies increasingly use reviews of qualitative research as evidence for evaluating social, experiential, and ethical aspects of health technologies. We systematically searched three bibliographic databases (MEDLINE, CINAHL, and Social Science Citation Index [SSCI]) using published search filters or "hedges" and our hybrid filter to identify qualitative research studies pertaining to chronic obstructive pulmonary disease and early breast cancer. The search filters were compared in terms of sensitivity, specificity, and precision. Our screening by title and abstract revealed that qualitative research constituted only slightly more than 1% of all published research on each health topic. The performance of the published search filters varied greatly across topics and databases. Compared with existing search filters, our hybrid filter demonstrated a consistently high sensitivity across databases and topics, and minimized the resource-intensive process of sifting through false positives. We identify opportunities for qualitative health researchers to improve the uptake of qualitative research into evidence-informed policy making.

  8. Health technology assessment in Australia: a role for clinical registries? (United States)

    Scott, Anna Mae


    Objective Health technology assessment (HTA) is a process of assessing evidence to inform policy decisions about public subsidy of new drugs and medical procedures. Where evidence is uncertain but the technology itself is promising, funders may recommend funding on an interim basis. It is unknown whether evidence from clinical registries is used to resolve uncertainties identified in interim-funded decisions made by Australian HTA bodies. Therefore, the present study evaluated the role of evidence from clinical registries in resolving evidence uncertainties identified by the Medical Services Advisory Committee (MSAC).Methods All HTAs considered by MSAC between 1998 and 2015 were reviewed and assessments that recommended interim funding were identified. The MSAC website was searched to identify reassessments of these recommendations and sources of evidence used to resolve the uncertainties were identified.Results Of 173 HTA reports considered by MSAC, 17 (10%) contained an interim funding recommendation. Eight recommendations cited uncertainty around safety, 15 cited uncertainty around clinical effectiveness and 13 cited uncertainty around economics (cost-effectiveness and/or budget impact). Of the 17 interim funding recommendations, 11 (65%) have been reassessed. Only two reassessments relied on clinical registry evidence to resolve evidence gaps identified at the time of the interim funding recommendation.Conclusions Clinical registries are underused as a source of evidence for resolving uncertainties around promising new health technologies in Australia. An open dialogue between stakeholders on the role of registries in this context is needed.What is known about the topic? HTA is a process of assessing the evidence to inform policy decisions about public subsidy of new health technologies (e.g. pharmaceuticals, diagnostic tests, medical procedures). Where evidence is uncertain but the technology under evaluation is promising, funders may recommend the funding of

  9. The Health Technology Assessment of companion diagnostics: experience of NICE. (United States)

    Byron, Sarah K; Crabb, Nick; George, Elisabeth; Marlow, Mirella; Newland, Adrian


    Companion diagnostics are used to aid clinical decision making to identify patients who are most likely to respond to treatment. They are becoming increasingly important as more new pharmaceuticals receive licensed indications that require the use of a companion diagnostic to identify the appropriate patient subgroup for treatment. These pharmaceuticals have proven benefit in the treatment of some cancers and other diseases, and also have potential to precisely tailor treatments to the individual in the future. However, the increasing use of companion diagnostics could place a substantial burden on health system resources to provide potentially high volumes of testing. This situation, in part, has led policy makers and Health Technology Assessment (HTA) bodies to review the policies and methods used to make reimbursement decisions for pharmaceuticals requiring companion diagnostics. The assessment of a pharmaceutical alongside the companion diagnostic used in the clinical trials may be relatively straightforward, although there are a number of challenges associated with assessing pharmaceuticals where a range of alternative companion diagnostics are available for use in routine clinical practice. The UK HTA body, the National Institute for Health and Care Excellence (NICE), has developed policy for considering companion diagnostics using its Technology Appraisal and Diagnostics Assessment Programs. Some HTA bodies in other countries have also adapted their policies and methods to accommodate the assessment of companion diagnostics. Here, we provide insight into the HTA of companion diagnostics for reimbursement decisions and how the associated challenges are being addressed, in particular by NICE. See all articles in this CCR Focus section, "The Precision Medicine Conundrum: Approaches to Companion Diagnostic Co-development."

  10. Main: 1TA3 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1TA3 小麦 Bread Wheat Triticum aestivum Xylanase Inhibitor Protein I Precursor. Name=...479.1; -.|PDB; 1OM0; X-ray; A=31-304.|PDB; 1TA3; X-ray; A=-.|PDB; 1TE1; X-ray; A=...CGYPPAAHVGRALATGIFERAHVRTYESDKWCNQNLGWEGSWDKWTAAYPATRFYVGLTADDKSHQWVHPKNVYYGVAPVAQKKDNYGGIMLWDRYFDKQTNYSSLIKYYA wheat_1TA3.jpg ...

  11. Historical development of health technology assessment in Thailand. (United States)

    Teerawattananon, Yot; Tantivess, Sripen; Yothasamut, Jomkwan; Kingkaew, Pritaporn; Chaisiri, Kakanang


    This study aims to review the development of health technology assessment (HTA), including the socioeconomic context, outputs, and policy utilization in the Thai setting. This study was conducted through extensive document reviews including these published in both domestic and international literature. Evidence suggests that contextual elements of the health system, especially the country's economic status and health financing reforms, as well as their effects on government budgeting for medical and public health services, played an important role in the increasing needs and demands for HTA information among policy makers. In the midst of substantial economic growth during the years 1982 to 1996, several studies reported the rapid diffusion and poor distribution of health technologies, and inequitable access to high-cost technology in public and private hospitals. At the same time, economic analysis and its underpinning concept of efficiency were suggested by groups of scholars and health officials to guide national policy on the investment in health technology equipment. Related research and training programs were subsequently launched. However, none of these HTA units could be institutionalized into national bodies. From 1997 to 2005, an economic recession, followed by the introduction of a universal health coverage plan, triggered the demands for effective measures for cost containment and prioritization of health interventions. This made policy makers and researchers at the Ministry of Public Health (MOPH) pay increasing attention to economic appraisals, and several HTA programs were established in the Ministry. Despite the rising number of Thai health economic publications, a major problem at that period involved the poor quality of studies. Since 2006, economic recovery and demands from different interests to include expensive technologies in the public health benefit package have been crucial factors promoting the role of HTA in national policy decisions

  12. Technology assessment of applied techniques for exploitation of geothermal energy

    Energy Technology Data Exchange (ETDEWEB)


    Studies were made to elucidate the effects of technological development of natural steam and hot water on the general social and industrial environments. These were followed by studies of enhanced methods for the forecasting of these impacts. The studies included assessments of actual conditions and the preparation of regional models, ranging from rural to urban-fringe situations. The economic implications of geothermal development in various regional situations are discussed, and the models developed provide for the integration of new data and their extrapolation to as yet uncertain situations.

  13. Thinking Tools in Computer-Based Assessment: Technology Enhancements in Assessments for Learning (United States)

    Rosen, Yigal


    One of the greatest concerns in schools today is how teachers can bring together assessment and learning in a way that is meaningful for students' thinking skills, while focusing on content standards. Better understanding of how different types of technology based thinking tools can be used for improving classroom teaching and learning,…

  14. Available technology for indirect conversion of coal to methanol and gasoline: a technology and economics assessment. [Technology assessment and comparative evaluation of available processes

    Energy Technology Data Exchange (ETDEWEB)

    Wham, R. M.; Forrester, III, R. C.


    The objective of the work was to review and assess the present state of the art of indirect liquid fuels synthesis, with particular emphasis to be placed upon those processes which produce methanol suitable for use as fuel. Following this review, four conceptual designs for indirect conversion of a Western subbituminous coal to methanol and gasoline were prepared. Capital and operating costs for each of the four cases were then estimated. This information was used to calculate the required product selling prices under a base case set of financial ground rules. Results of the methanol production technology assessment and economic assessments of four coal conversion plants are presented.

  15. Waiting for Disasters: A Risk Reduction Assessment of Technological Disasters (United States)

    Rovins, Jane; Winningham, Sam


    This session provides a risk reduction/mitigation assessment of natural hazards causation of technological disasters and possible solution. People use technology in an attempt to not only control their environment but nature itself in order to make them feel safe and productive. Most strategies for managing hazards followed a traditional planning model i.e. study the problem, identify and implement a solution, and move on to the next problem. This approach is often viewed as static model and risk reduction is more of an upward, positive, linear trend. However, technological disasters do not allow risk reduction action to neatly fit this upward, positive, linear trend with actual or potential threats to the environment and society. There are different types of technological disasters, including industrial accidents; pipeline ruptures; accidents at power, water and heat supply systems and other lines of communication; sudden collapse of buildings and mines; air crashes; shipwrecks; automobile and railway accidents to name a few. Natural factors can play an essential role in triggering or magnifying technological disasters. They can result from the direct destruction of given technical objects by a hazardous natural process such as the destruction of an atomic power plant or chemical plant due to an earthquake. Other examples would include the destruction of communications or infrastructure systems by heavy snowfalls, strong winds, avalanches. Events in the past ten years clearly demonstrate that natural disasters and the technological disasters that accompany them are not problems that can be solved in isolation and risk reduction can play an important part. Risk reduction was designed to head off the continuing rising financial and structural tolls from disasters. All Hazard Risk Reduction planning was supposed to include not only natural, but technological, and human-made disasters as well. The subsequent disaster risk reduction (DRR) indicators were to provide the

  16. Offline Chinese handwriting recognition :an assessment of current technology

    Institute of Scientific and Technical Information of China (English)

    Sargur N.Srihari; Xuanshen Yang; Gregory R.Ball


    Offline Chinese handwriting recognition (OCHR)is a typically difficult pattern recognition problem.Many authors have presented various approaches to recognizing its different aspects.We present a survey and an assessment of relevant papers appearing in recent publications of relevant conferences and journals,including those appearing in ICDAR,SDIUT,IWFHR,ICPR,PAMI,PR,PRL,SPIE-DRR,and IJDAR.The methods are assessed in the sense that we document their technical approaches,strengths,and weaknesses,as well as the data sets on which they were reportedly tested and on which results were generated.We also identify a list of technology gaps with respect to Chinese handwriting recognition and identify technical approaches that show promise in these areas as well as identify the leading researchers for the applicable topics,discussing difficulties associated with any given approach.

  17. Health Technology Assessment of Magnetic Resonance Imaging in Shanxi Province

    Institute of Scientific and Technical Information of China (English)

    Yueze Liu; Jianwen Cao; Zuxun Lu


    Assess the current status of MRI in Shanxi province by health technology assessment method to provide suggestion and guidelines for future government decisions on the procurement and installation of new high-tech medical equipments. All of the 21 hospitals installed MRIs were surveyed.The results showed that 1 ) Diffusion of MRI is consistent with the economic development in different regional districts and hospital levels in Shanxi province. 2) There are better monetary returns of MRI in higher level hospitals than lower level hospitals. 3) Most MRIs in Shanxi province had been running at a loss, and the first class tertiary level hospitals had been making profit from providing MRI services to patients. 4) Better cost-benefit accorded with higher hospital level, more patients serviced etc. 5 ) The biggest investment risk is the initial purchase and installation of MRI. 6) Positive rates and veracity of MRI diagnosis were higher. 7) MRI is a safe equipment.

  18. Simulation Technology Laboratory Building 970 hazards assessment document

    Energy Technology Data Exchange (ETDEWEB)

    Wood, C.L.; Starr, M.D.


    The Department of Energy Order 5500.3A requires facility-specific hazards assessments be prepared, maintained, and used for emergency planning purposes. This hazards assessment document describes the chemical and radiological hazards associated with the Simulation Technology Laboratory, Building 970. The entire inventory was screened according to the potential airborne impact to onsite and offsite individuals. The air dispersion model, ALOHA, estimated pollutant concentrations downwind from the source of a release, taking into consideration the toxicological and physical characteristics of the release site, the atmospheric conditions, and the circumstances of the release. The greatest distances at which a postulated facility event will produce consequences exceeding the ERPG-2 and Early Severe Health Effects thresholds are 78 and 46 meters, respectively. The highest emergency classification is a Site Area Emergency. The Emergency Planning Zone is 100 meters.

  19. Radiation safety assessment and development of environmental radiation monitoring technology

    CERN Document Server

    Choi, B H; Kim, S G


    The Periodic Safety Review(PSR) of the existing nuclear power plants is required every ten years according to the recently revised atomic energy acts. The PSR of Kori unit 1 and Wolsong unit 1 that have been operating more than ten years is ongoing to comply the regulations. This research project started to develop the techniques necessary for the PSR. The project developed the following four techniques at the first stage for the environmental assessment of the existing plants. 1) Establishment of the assessment technology for contamination and accumulation trends of radionuclides, 2) alarm point setting of environmental radiation monitoring system, 3) Development of Radiation Safety Evaluation Factor for Korean NPP, and 4) the evaluation of radiation monitoring system performance and set-up of alarm/warn set point. A dynamic compartment model to derive a relationship between the release rates of gas phase radionuclides and the concentrations in the environmental samples. The model was validated by comparing ...

  20. Assessment of the awareness and management of sleep apnea syndrome in acromegaly. The COM.E.TA (Comorbidities Evaluation and Treatment in Acromegaly) Italian Study Group. (United States)

    De Menis, E; Giustina, A; Colao, A; Degli Uberti, E; Ghigo, E; Minuto, F; Bogazzi, F; Drigo, R; Cattaneo, A; Aimaretti, G


    In 2007 the Italian COM.E.T.A. (COMorbidities Evaluation and Treatment in Acromegaly) study group started to assess the application in a clinical setting of the Versailles criteria for management of acromegaly complications by a first questionnaire focusing on cardiovascular co-morbidities. A further questionnaire on sleep apnea syndrome (SAS) was delivered by the COM.E.T.A. study group to 107 endocrine centers in Italy. The results of our survey suggest that SAS is a well-known comorbidity even if its estimated prevalence is lower than in the literature. Polysomnography is the preferred tool for diagnosis. Control of SAS is considered relevant both for quality of life and co-morbidities. Continuous positive airway pressure is the cornerstone of therapy, but patients' acceptance may be critical. Control of GH/IGF-I secretion is important to improve SAS. Management of SAS requires cooperation between specialists.

  1. A scientific assessment of a new technology orbital telescope (United States)


    As part of a program designed to test the Alpha chemical laser weapons system in space, the Ballistic Missile Defense Organization (BMDO) developed components of an agile, lightweight, 4-meter telescope, equipped with an advanced active-optics system. BMDO had proposed to make space available in the telescope's focal plane for instrumentation optimized for scientific applications in astrophysics and planetary astronomy for a potential flight mission. Such a flight mission could be undertaken if new or additional sponsorship can be found. Despite this uncertainty, BMDO requested assistance in defining the instrumentation and other design aspects necessary to enhance the scientific value of a pointing and tracking mission. In response to this request, the Space Studies Board established the Task Group on BMDO New Technology Orbital Observatory (TGBNTOO) and charged it to: (1) provide instrumentation, data management, and science-operations advice to BMDO to optimize the scientific value of a 4-meter mission; and (2) support a space studies board assessment of the relative scientific merit of the program. This report deals with the first of these tasks, assisting the Advanced Technology Demonstrator's (ATD's) program scientific potential. Given the potential scientific aspects of the 4-meter telescope, this project is referred to as the New Technology Orbital Telescope (NTOT), or as the ATD/NTOT, to emphasize its dual-use character. The task group's basic conclusion is that the ATD/NTOT mission does have the potential for contributing in a major way to astronomical goals.

  2. Why ethics should be part of health technology assessment. (United States)

    Hofmann, Bjørn Morten


    From the heydays of HTA in the 1970s, it has been argued that ethics should be a part of HTA. Despite more than 30 years with repeated intentions, only few HTA reports include ethical analysis, and there is little agreement on methods for integrating ethics. This poses the question of why it is so important to integrate ethics in HTA? The article analyzes ten arguments for making ethics part of HTA. The validity of the arguments depend on what we mean by "integrating," "ethics," and "HTA." Some of the counterarguments explain why it has taken so long to integrate ethics in HTA and why there are so many ethical approaches. Nevertheless, some of the arguments for making ethics part of HTA appear to be compelling. Health care is a moral endeavor, and the vast potential of technology poses complex moral challenges. A thorough assessment of technology would include reflection on these moral aspects. Ethics provides such a moral reflection. Health technology is a way to improve the life of human individuals. This involves questions of what "the good life" is, and hence ethical issues. Trying to ignore such questions may inflict with the moral foundation of health care: to help people. Additionally, HTA is an evaluation, and as such also a reflection on values. Hence, there is a profound affinity between HTA and ethics. Accordingly, ethics cannot be "integrated" in HTA as ethics is already a constitutive part of HTA. However, ethics can be acknowledged and emphasized.

  3. Mediating states in 180Ta


    Alexa, Petr


    Possible theoretical electromagnetic paths between the ground state and the isomeric state at 75.3 keV in 180Ta are discussed in the framework of the two-quasiparticle-plus-phonon model and the standard axially-symmetric rotor model including Coriolis mixing. Experimental transition rates from the isomeric state to the ground state via observed mediating states are compared to the theoretical ones.

  4. Technology-Enhanced Formative Assessment: A Research-Based Pedagogy for Teaching Science with Classroom Response Technology (United States)

    Beatty, Ian D.; Gerace, William J.


    "Classroom response systems" (CRSs) are a promising instructional technology, but most literature on CRS use fails to distinguish between technology and pedagogy, to define and justify a pedagogical perspective, or to discriminate between pedagogies. "Technology-enhanced formative assessment" (TEFA) is our pedagogy for CRS-based science…

  5. Evaluation of Policy and Research Interventions in Science and Technology: Consequence Assessment of Regulatory and Technology Transfer Programs (United States)

    Dias, Mary Beatrice


    This research contributes to efforts in assessment studies related to science and technology interventions. The work presented in this thesis focuses on understanding the effects of policies that influence science and technology interventions, and determining the impact of science and technology interventions themselves. Chapter 1 explores how…

  6. A short history of health technology assessment in Germany. (United States)

    Perleth, Matthias; Gibis, Bernhard; Göhlen, Britta


    To provide an overview of the development of health technology assessment (HTA) in Germany since the 1990s. Analysis of key documents (e.g. literature, laws, and other official documentation) and personal experiences. Health technology assessment (HTA) entered the political agenda in Germany only in the mid-1990s, basically as the result of a top-down approach toward more efficiency in health care, but with a strong impetus of an evidence-based medicine movement. Accordingly, HTA became part of several healthcare reform laws since 1997, which led to the establishment of the Federal Joint Committee (G-BA) and the Institute for Quality and Efficiency in Health Care (IQWiG) in 2004. This tandem construction aims at using evidence in decision-making processes for coverage and other decisions. These developments have led to a considerable impact of HTA in Germany. In addition, a broad spectrum of activities at universities and in other organizations, such as the German Institute for Medical Documentation and Information (DIMDI), can be observed that contribute to both teaching and research in HTA. German researchers in the field of HTA are actively involved in international projects, such as EUNetHTA, and contribute to scientific conferences and journals.

  7. Meat Quality Assessment by Electronic Nose (Machine Olfaction Technology

    Directory of Open Access Journals (Sweden)

    Sundar Balasubramanian


    Full Text Available Over the last twenty years, newly developed chemical sensor systems (so called “electronic noses” have made odor analyses possible. These systems involve various types of electronic chemical gas sensors with partial specificity, as well as suitable statistical methods enabling the recognition of complex odors. As commercial instruments have become available, a substantial increase in research into the application of electronic noses in the evaluation of volatile compounds in food, cosmetic and other items of everyday life is observed. At present, the commercial gas sensor technologies comprise metal oxide semiconductors, metal oxide semiconductor field effect transistors, organic conducting polymers, and piezoelectric crystal sensors. Further sensors based on fibreoptic, electrochemical and bi-metal principles are still in the developmental stage. Statistical analysis techniques range from simple graphical evaluation to multivariate analysis such as artificial neural network and radial basis function. The introduction of electronic noses into the area of food is envisaged for quality control, process monitoring, freshness evaluation, shelf-life investigation and authenticity assessment. Considerable work has already been carried out on meat, grains, coffee, mushrooms, cheese, sugar, fish, beer and other beverages, as well as on the odor quality evaluation of food packaging material. This paper describes the applications of these systems for meat quality assessment, where fast detection methods are essential for appropriate product management. The results suggest the possibility of using this new technology in meat handling.

  8. Differences among formulary submission guidelines: implications for health technology assessment. (United States)

    Mauskopf, Josephine; Walter, Jeffrey; Birt, Julie; Bowman, Lee; Copley-Merriman, Catherine; Drummond, Michael


    This article provides a detailed understanding of the differences in selected formulary submission guidelines supplied by various health technology assessment (HTA) agencies and indicates how these differences can impact the evidence base used to populate the HTA. Detailed summaries of the recommended methods for evidence generation, organized by topic areas relevant for clinical and economic data, for twelve countries in Europe, North America, and Australia where HTA processes are well developed were prepared. Using these summaries, we provide examples of the likely impact these differences in recommended methods could have on the evidence base used to evaluate new health technologies. Areas where recommendations differed included methodologies for systematic literature reviews (e.g., preferred databases and study designs for inclusion); selection of appropriate comparators; guidance on critical appraisal and synthesis of clinical evidence; appropriate sources for health value measures, resource use, and cost data; and approaches to uncertainty analyses. Performing literature searches that capture all relevant studies and then creating subsets of the literature based on a listing of country-specific requirements could allow for direct comparison of the evidence bases associated with the different guidelines. If the formulary submission guidelines were followed as written, different (although overlapping) bodies of evidence likely would be generated for each country, which could contribute to disparate assessments and recommendations. This comparison of the formulary submission guidelines could contribute to an understanding of why clinical and reimbursement decisions vary across countries.

  9. Technology and Economic Assessment of Innovative Field Drainage Technologies in Denmark

    DEFF Research Database (Denmark)

    Gachango, Florence Gathoni

    Intensive agricultural production in most parts of the world especially in the more developed countries continues to mount pressure on water resources thereby threatening the quality of life in the aquatic ecosystems. With stringent standards such as those stipulated in the European Union Water...... proposed as appropriate solutions to this problem in the Danish context. The feasibility of these technologies with regards to their cost-effectiveness in nutrient mitigation, farmers’ adoption behavior, and environmental policy implementation is assessed in this thesis. The thesis comprises of four papers...... based on survey and case-farms data and utilizes a mix of quantitative and qualitative methods to investigate: i) the farmers’ perception of water quality and their adoption behavior with respect to voluntary nutrient reduction technologies, ii) the farmers willingness to adopt constructed wetland...

  10. Virtues, ecological momentary assessment/intervention and smartphone technology. (United States)

    Runyan, Jason D; Steinke, Ellen G


    Virtues, broadly understood as stable and robust dispositions for certain responses across morally relevant situations, have been a growing topic of interest in psychology. A central topic of discussion has been whether studies showing that situations can strongly influence our responses provide evidence against the existence of virtues (as a kind of stable and robust disposition). In this review, we examine reasons for thinking that the prevailing methods for examining situational influences are limited in their ability to test dispositional stability and robustness; or, then, whether virtues exist. We make the case that these limitations can be addressed by aggregating repeated, cross-situational assessments of environmental, psychological and physiological variables within everyday life-a form of assessment often called ecological momentary assessment (EMA, or experience sampling). We, then, examine how advances in smartphone application (app) technology, and their mass adoption, make these mobile devices an unprecedented vehicle for EMA and, thus, the psychological study of virtue. We, additionally, examine how smartphones might be used for virtue development by promoting changes in thought and behavior within daily life; a technique often called ecological momentary intervention (EMI). While EMA/I have become widely employed since the 1980s for the purposes of understanding and promoting change amongst clinical populations, few EMA/I studies have been devoted to understanding or promoting virtues within non-clinical populations. Further, most EMA/I studies have relied on journaling, PDAs, phone calls and/or text messaging systems. We explore how smartphone app technology provides a means of making EMA a more robust psychological method, EMI a more robust way of promoting positive change, and, as a result, opens up new possibilities for studying and promoting virtues.

  11. Virtues, Ecological Momentary Assessment/Intervention and Smartphone Technology

    Directory of Open Access Journals (Sweden)

    Jason D Runyan


    Full Text Available Virtues, generally understood as stable and robust dispositions for certain responses across morally relevant situations, have been a growing topic of interest in psychology. A central topic of discussion has been whether the existence of virtues (as a kind of stable and robust disposition is called into question by studies showing that, to a significant degree, an individual’s situation can influence their responses. In this review, we examine reasons for thinking that these kinds of situational studies are limited in their ability to test dispositional stability and robustness; or, then, whether virtues exist. We make the case that these limitations can be addressed by aggregating repeated, cross-situational assessments of environmental, psychological and physiological variables within everyday life—a form of assessment often called ecological momentary assessment (EMA, or experience sampling. We, then, examine how advances in smartphone application (app technology, and their mass adoption, make these mobile devices an unprecedented vehicle for EMA and, thus, the psychological study of virtue. We, additionally, examine how smartphones might be used for virtue development by promoting changes in thought and behavior within daily life; a technique often called ecological momentary intervention (EMI. While EMA/I have become widely employed since the 1980s for the purposes of understanding and promoting change amongst clinical populations, few EMA/I studies have been devoted to understanding or promoting virtues within non-clinical populations. Further, most EMA/I studies have relied on journaling, PDAs, phone calls and/or text messaging systems. We explore how smartphone app technology provides a means of making EMA a more robust psychological method, EMI a more robust way of promoting positive change, and, as a result, opens up new possibilities for studying and promoting virtues.

  12. Cost, Time, and Risk Assessment of Different Wave Energy Converter Technology Development Trajectories: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Jochem W [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Laird, Daniel [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Costello, Ronan [Wave Venture; Roberts, Jesse [Sandia National Laboratories; Bull, Diana [Sandia National Laboratories; Babarit, Aurelien [Ecole Centrale de Nantes; Nielsen, Kim [Ramboll; Ferreira, Claudio Bittencourt [DNV-GL; Kennedy, Ben [Wave Venture


    This paper presents a comparative assessment of three fundamentally different wave energy converter technology development trajectories. The three technology development trajectories are expressed and visualised as a function of technology readiness levels and technology performance levels. The assessment shows that development trajectories that initially prioritize technology readiness over technology performance are likely to require twice the development time, consume a threefold of the development cost, and are prone to a risk of technical or commercial failure of one order of magnitude higher than those development trajectories that initially prioritize technology performance over technology readiness.

  13. Assessment vs. appraisal of ethical aspects of health technology assessment: can the distinction be upheld? (United States)

    Sandman, Lars; Heintz, Emelie


    An essential component of health technology assessment (HTA) is the assessment of ethical aspects. In some healthcare contexts, tasks are strictly relegated to different expert groups: the HTA-agencies are limited to assessment of the technology and other actors within the health care sector are responsible for appraisal and recommendations. Ethical aspects of health technologies are considered with reference to values or norms in such a way that may be prescriptive, or offer guidance as to how to act or relate to the issue in question. Given this internal prescriptivity, the distinction between assessment and appraisal seems difficult to uphold, unless the scrutiny stops short of a full ethical analysis of the technology. In the present article we analyse the distinction between assessment and appraisal, using as an example ethical aspects of implementation of GPS-bracelets for people with dementia. It is concluded that for HTA-agencies with a strictly delineated assessment role, the question of how to deal with the internal prescriptivity of ethics may be confusing. A full ethical analysis might result in a definite conclusion as to whether the technology in question is ethically acceptable or not, thereby limiting choices for decision-makers, who are required to uphold certain ethical values and norms. At the same time, depending on the exact nature of such a conclusion, different action strategies can be supported. A positive appraisal within HTA could result in a decision on mandatory implementation, or funding of the technology, thereby making it available to patients, or decisions to allow and even encourage the use of the technology (even if someone else will have to fund it). A neutral appraisal, giving no definite answer as to whether implementation is recommended or not, could result in a laissez-faire attitude towards the technology. A negative appraisal could result in a decision to discourage or even prohibit implementation. This paper presents an

  14. Assessment vs. appraisal of ethical aspects of health technology assessment: can the distinction be upheld?

    Directory of Open Access Journals (Sweden)

    Sandman, Lars


    Full Text Available [english] An essential component of health technology assessment (HTA is the assessment of ethical aspects. In some healthcare contexts, tasks are strictly relegated to different expert groups: the HTA-agencies are limited to assessment of the technology and other actors within the health care sector are responsible for appraisal and recommendations. Ethical aspects of health technologies are considered with reference to values or norms in such a way that may be prescriptive, or offer guidance as to how to act or relate to the issue in question. Given this internal prescriptivity, the distinction between assessment and appraisal seems difficult to uphold, unless the scrutiny stops short of a full ethical analysis of the technology. In the present article we analyse the distinction between assessment and appraisal, using as an example ethical aspects of implementation of GPS-bracelets for people with dementia. It is concluded that for HTA-agencies with a strictly delineated assessment role, the question of how to deal with the internal prescriptivity of ethics may be confusing. A full ethical analysis might result in a definite conclusion as to whether the technology in question is ethically acceptable or not, thereby limiting choices for decision-makers, who are required to uphold certain ethical values and norms. At the same time, depending on the exact nature of such a conclusion, different action strategies can be supported. A positive appraisal within HTA could result in a decision on implementation, or of the technology, thereby making it available to patients, or decisions to and even the use of the technology (even if someone else will have to fund it. A neutral appraisal, giving no definite answer as to whether implementation is recommended or not, could result in a towards the technology. A negative appraisal could result in a decision to or even implementation. This paper presents an overview of the implications of different outcomes

  15. Scenario drafting to anticipate future developments in technology assessment

    Directory of Open Access Journals (Sweden)

    Retèl Valesca P


    Full Text Available Abstract Background Health Technology Assessment (HTA information, and in particular cost-effectiveness data is needed to guide decisions, preferably already in early stages of technological development. However, at that moment there is usually a high degree of uncertainty, because evidence is limited and different development paths are still possible. We developed a multi-parameter framework to assess dynamic aspects of a technology -still in development-, by means of scenario drafting to determine the effects, costs and cost-effectiveness of possible future diffusion patterns. Secondly, we explored the value of this method on the case of the clinical implementation of the 70-gene signature for breast cancer, a gene expression profile for selecting patients who will benefit most from chemotherapy. Methods To incorporate process-uncertainty, ten possible scenarios regarding the introduction of the 70-gene signature were drafted with European experts. Out of 5 most likely scenarios, 3 drivers of diffusion (non-compliance, technical failure, and uptake were quantitatively integrated in a decision-analytical model. For these scenarios, the cost-effectiveness of the 70-gene signature expressed in Incremental Cost-Effectiveness Ratios (ICERs was compared to clinical guidelines, calculated from the past (2005 until the future (2020. Results In 2005 the ICER was €1,9 million/quality-adjusted-life-year (QALY, meaning that the 70-gene signature was not yet cost-effective compared to the current clinical guideline. The ICER for the 70-gene signature improved over time with a range of €1,9 million to €26,145 in 2010 and €1,9 million to €11,123/QALY in 2020 depending on the separate scenario used. From 2010, the 70-gene signature should be cost-effective, based on the combined scenario. The uptake-scenario had strongest influence on the cost-effectiveness. Conclusions When optimal diffusion of a technology is sought, incorporating process

  16. Magnetic property and interface structure of Ta/NiO/NiFe/Ta

    Institute of Scientific and Technical Information of China (English)


    Ta/NiO/NiFe/Ta multilayers, utilizing Ta as buffer layer, were prepared by rf reactive and dc magnetron sputtering. The exchange coupling field between NiO and NiFe reached a maximum value of 9.6×103 A/m at a NiO film thickness of 50 nm. The composition and chemical states at interface region of Ta/NiO/Ta were studied by using the X-ray photoelectron spectroscopy (XPS) and peak decomp- osition technique. The results show that there is an "inter- mixing layer" at the Ta/NiO (and NiO/Ta) interface due to a thermodynamically favorable reaction 2Ta + 5NiO = 5Ni + Ta2O5. This interface reaction has a great effect on exchange coupling. The thickness of Ni+NiO estimated by XPS depth- profiles is about 8-10 nm.

  17. Development of Seismic Safety Assessment Technology for Containment Structure

    Energy Technology Data Exchange (ETDEWEB)

    Jang, J.B.; Suh, Y.P.; Lee, J.R. [Korea Electric Power Research Institute, Taejon (Korea)


    This final report is made based on the research results of seismic analysis and seismic margin assessment field, carried out during 3rd stage ('01.4.1{approx}'02.3.31) under financial support of MOST(Ministry of Science and Technology). The objective of this research is to develop the soil - structure interaction analysis technique with high reliability, the main research subjects, performed during 3rd stage are as follows. 1) Preparation of user's guide manual for SSI analysis with high accuracy. 2) Sensitivity analysis of effective shear strain and seismic input motion. 3) Database construction of Hualien earthquake recorded data. (author). 21 refs., 27 figs., 2 tabs.


    Directory of Open Access Journals (Sweden)

    Cristiano Fragassa


    Full Text Available A modern tire merges up to 300 different chemical elements, both organic and inorganic, natural and synthetic. During manufacturing, various processes are present such as mixing, calendering and extrusion, forming dozens of individual parts. Then, moulding and vulcanization inside special moulds provides the tire its final shape. Since the surface quality of moulds strongly affects the quality of tire, mould cleaning is a fundamental aspect of the whole tire production and cleaning techniques are in continuous development. This investigation proposes a global technology assessment of tire mould cleaning systems including uncommon solutions as multi-axis robots for cleaning on board by laser or dry ice, or ultrasonic cleaning which use cavitation. A specific attention is also focused on the industry adoption of spring-vents in moulds and how they are influencing the development the quality of final products.

  19. Development of Seismic Safety Assessment Technology for Containment Structure

    Energy Technology Data Exchange (ETDEWEB)

    Jang, J.B.; Suh, Y.P.; Lee, J.R. [Korea Electric Power Research Institute, Taejon (Korea)


    This final report is made based on the research results of seismic analysis and seismic margin assessment field, carried out during 3rd stage ('01.4.1{approx}'02.3.31) under financial support of MOST(Ministry of Science and Technology). The objective of this research is to develop the soil - structure interaction analysis technique with high reliability, the main research subjects, performed during 3rd stage are as follows. 1) Preparation of user's guide manual for SSI analysis with high accuracy. 2) Sensitivity analysis of effective shear strain and seismic input motion. 3) Database construction of Hualien earthquake recorded data. (author). 21 refs., 27 figs., 2 tabs.

  20. ECASTAR: Energy conservation. An assessment of systems, technologies and requirements (United States)


    A methodology was presented for a systems approach to energy conservation actions and their potentials and impacts in the United States. Constraints affecting the approach were ranked, and the most important ones are the present economic and technical conditions. The following unresolved issues were identified: consumptive lifestyles vs. conservation ethic, environmental standards vs. energy conservation, capital availability, decentralization and vertical integration vs. centralization, fuel rich regions vs. fuel poor regions, supply vs. end use conservation, life cycle costing vs. initial cost, mandatory savings vs. voluntary savings, labor intensive vs. capital intensive, price control vs. free market. The following recommendations were made: provide action/impact assessment, establish regional energy centers, improve technology articulation with government, design total energy systems, utilize existing systems approach expertise.

  1. Multipurpose Panel Display Device Investigation. [technology assessment and product development (United States)

    Sliwa, R.


    A multipurpose panel was developed to provide a flexible control and a LED display panel with easily changeable nomenclature for use in applications where panel space is limited, but where a number of similar subsystems must be controlled, or where basic panel nomenclature and functions must be changed rapidly, as in the case of between mission changes of space shuttle payloads. In the first application, panel area limitations are overcome by time sharing a central control panel among several subsystems. In the latter case, entire control panel changes are effected by simply replacing a memory module, thereby reducing the extent of installation and checkout procedures between missions. Several types of control technologies (other than LED's) which show potential in meeting criteria for overcoming limitations of the panel are assessed.

  2. Environmental assessment for the Processing and Environmental Technology Laboratory (PETL)

    Energy Technology Data Exchange (ETDEWEB)



    The U.S. Department of Energy (DOE) has prepared an environmental assessment (EA) on the proposed Processing and Environmental Technology Laboratory (PETC) at Sandia National Laboratories/New Mexico (SNL/NM). This facility is needed to integrate, consolidate, and enhance the materials science and materials process research and development (R&D) currently in progress at SNL/NM. Based on the analyses in the EA, DOE has determined that the proposed action is not a major Federal action significantly affecting the quality of the human environment within the meaning of the National Environmental Policy Act (NEPA) of 1969. Therefore, an environmental impact statement is not required, and DOE is issuing this Finding of No Significant Impact (FONSI).

  3. Health technology assessment implementation: the politics of ethics. (United States)

    Callahan, Daniel


    Using a 2009 American debate on a federal public health recommendation on mammography screening for women under the age of 50 as a case study, it is argued that public acceptance of health technology assessment (HTA) depends on the ethical acceptability of its recommendations. At the same time, that acceptability cannot be separated from the politics and values of the health care system of which it is part. In the United States, those values display a sharp ideological split between a conservative individual-based ethic and a liberal community-oriented ethic. A clash of this kind cannot be solved by invocation of ethical principles when it is those principles themselves that are in conflict. Inevitably HTA acceptance is threatened by this conflict as is the fate of health care reform.

  4. Indexes system of technological condition assessment of economic branches (United States)

    Chuvashova, M. N.; Avramchikova, N. T.; Antamoshkin, A. N.


    The increased level of innovative production process, connected with the current trends, points out the necessity of economic diversification of the whole national economy as well as regional economies in order to increase competitiveness and stable development. Russian regional economies are characterized with local directive of development and innovative processes have evident local vector. Intensive development of Siberian regional economies, which depends on oil and mining industries, considerably falls behind the world indicators according to the GRP output per head. To improve the quality of economic space the authors have suggested a new scientific approach, which allows qualitative assessment inside the economic space of resource-based regions, based on principles of high technological modes development inside economic branches taking into account density, regular enterprise distribution and connectivity of commercial organizations as well as secures innovative development of regional economy and its competitiveness. In this context it is necessary to develop a modern system of indexes, characterizing the structure of economic branches in accordance with present technological modes and at the same time the dynamics of appropriate structural shifts in regional economies of this type.

  5. Japanese technology assessment: Computer science, opto- and microelectronics mechatronics, biotechnology

    Energy Technology Data Exchange (ETDEWEB)

    Brandin, D.; Wieder, H.; Spicer, W.; Nevins, J.; Oxender, D.


    The series studies Japanese research and development in four high-technology areas - computer science, opto and microelectronics, mechatronics (a term created by the Japanese to describe the union of mechanical and electronic engineering to produce the next generation of machines, robots, and the like), and biotechnology. The evaluations were conducted by panels of U.S. scientists - chosen from academia, government, and industry - actively involved in research in areas of expertise. The studies were prepared for the purpose of aiding the U.S. response to Japan's technological challenge. The main focus of the assessments is on the current status and long-term direction and emphasis of Japanese research and development. Other aspects covered include evolution of the state of the art; identification of Japanese researchers, R and D organizations, and resources; and comparative U.S. efforts. The general time frame of the studies corresponds to future industrial applications and potential commercial impacts spanning approximately the next two decades.

  6. Flightdeck Automation Problems (FLAP) Model for Safety Technology Portfolio Assessment (United States)

    Ancel, Ersin; Shih, Ann T.


    NASA's Aviation Safety Program (AvSP) develops and advances methodologies and technologies to improve air transportation safety. The Safety Analysis and Integration Team (SAIT) conducts a safety technology portfolio assessment (PA) to analyze the program content, to examine the benefits and risks of products with respect to program goals, and to support programmatic decision making. The PA process includes systematic identification of current and future safety risks as well as tracking several quantitative and qualitative metrics to ensure the program goals are addressing prominent safety risks accurately and effectively. One of the metrics within the PA process involves using quantitative aviation safety models to gauge the impact of the safety products. This paper demonstrates the role of aviation safety modeling by providing model outputs and evaluating a sample of portfolio elements using the Flightdeck Automation Problems (FLAP) model. The model enables not only ranking of the quantitative relative risk reduction impact of all portfolio elements, but also highlighting the areas with high potential impact via sensitivity and gap analyses in support of the program office. Although the model outputs are preliminary and products are notional, the process shown in this paper is essential to a comprehensive PA of NASA's safety products in the current program and future programs/projects.

  7. Life cycle impact assessment of various waste conversion technologies. (United States)

    Khoo, Hsien H


    Advanced thermal treatment technologies utilizing pyrolysis or gasification, as well as a combined approach, are introduced as sustainable methods to treat wastes in Singapore. Eight different technologies are evaluated: pyrolysis-gasification of MSW; pyrolysis of MSW; thermal cracking gasification of granulated MSW; combined pyrolysis, gasification and oxidation of MSW; steam gasification of wood; circulating fluidized bed (CFB) gasification of organic wastes; gasification of RDF; and the gasification of tyres. Life cycle assessment is carried out to determine the environmental impacts of the various waste conversion systems including global warming potential, acidification potential, terrestrial eutrophication and ozone photochemical formation. The normalization and weighting results, calculated according to Singapore national emission inventories, showed that the two highest impacts are from thermal cracking gasification of granulated MSW and the gasification of RDF; and the least are from the steam gasification of wood and the pyrolysis-gasification of MSW. A simplified life cycle cost comparison showed that the two most costs-effective waste conversion systems are the CFB gasification of organic waste and the combined pyrolysis, gasification and oxidation of MSW. The least favorable - highest environmental impact as well as highest costs - are the thermal cracking gasification of granulated MSW and the gasification of tyres.

  8. Enhancing Teachers' Technological Knowledge and Assessment Practices to Enhance Student Learning in Technology: A Two-year Classroom Study (United States)

    Moreland, Judy; Jones, Alister; Northover, Ann


    This paper reports on a two-year classroom investigation of primary school (Years 1-8) technology education. The first year of the project explored emerging classroom practices in technology. In the second year intervention strategies were developed to enhance teaching, learning and assessment practices. Findings from the first year revealed that assessment was often seen in terms of social and managerial aspects, such as teamwork, turn taking and co-operative skills, rather than procedural and conceptual technological aspects. Existing formative interactions with students distorted the learning away from the procedural and conceptual aspects of the subject. The second year explored the development of teachers' technological knowledge in order to enhance formative assessment practices in technology, to inform classroom practice in technology, and to enhance student learning. Intervention strategies were designed to enhance the development of procedural, conceptual, societal and technical aspects of technology for teachers and students. The results from this intervention were very positive. This paper highlights the importance of developing teacher expertise pertaining to broad concepts of technology, detailed concepts in different technological areas and general pedagogical knowledge. The findings from this research therefore have implications for thinking about teaching, learning and assessment in technology.

  9. Health Technology Assessment and vaccine: new needs and opportunities?

    Directory of Open Access Journals (Sweden)

    Giuseppe La Torre


    Full Text Available Health Technology Assessment (HTA can represent an innovative and effective approach to supply decisionmakers with a valid instrument to improve the allocation of resources in the field of vaccines. We proposed a HTA approach for considering the introduction of a new vaccine that could potentially have a great impact on the population’s health, using as an example the vaccine against Human Papilloma Virus (HPV. This approach could be of great interest when the decision making process involves choices regarding new vaccines. We developed a HTA approach for assessing all of the aspects involved in the introduction of vaccines against HPV in Italy, considering the following issues: - epidemiological evaluation of HPV infection and related pathologies through the consultation of data banks and the scientific literature; - evaluation of health care resources utilisation by people suffering from the infection/ related diseases, through the consultation of hospital archives; - systematic review and meta-analysis of randomised clinical trials on HPV vaccination effectiveness and safety; - mathematical modelling and economic evaluation of the vaccination using a cost-effectiveness analysis; - evaluation of the impact of vaccination on the Health System [organisational aspects, vaccine surveillance, relationship between different decisional levels (national, regional]; - analysis of the ethical, social (acceptability, availability, accessibility, information and legislative aspects of vaccination. A HTA report on the new vaccine could represent an new important tool to support the choice of decision makers in order to better inform the allocation of economic resources and maximize healthcare services, since it takes into account not only the burden and the epidemiology of the disease, and the economic evaluation of different scenarios, but also the social, legal and bioethical aspects. For HTA to support the introduction of new technologies, and new

  10. Comparative evaluation by lifecycle and risk assessment of agrobiological and technological routes of production

    NARCIS (Netherlands)

    Moll, H.C.; Schoot Uiterkamp, A.J.M.


    The application of lifecycle and risk assessment methodologies for environmental assessment of agricultural products is growing and produces interesting results. This allows comparisons between agricultural and technological routes of production. An evaluation of such assessments provides increased

  11. Biogas upgrading technologies:Energetic analysis and environmental impact assessment

    Institute of Scientific and Technical Information of China (English)

    Yajing Xu; Ying Huang; Bin Wu; Xiangping Zhang; Suojiang Zhang


    Biogas upgrading for removing CO2 and other trace components from raw biogas is a necessary step before the biogas to be used as a vehicle fuel or supplied to the natural gas grid. In this work, three technologies for biogas upgrading, i.e., pressured water scrubbing (PWS), monoethanolamine aqueous scrubbing (MAS) and ionic liquid scrubbing (ILS), are studied and assessed in terms of their energy consumption and environmental impacts with the process simulation and green degree method. A non-random-two-liquid and Henry's law property method for a CO2 separation system with ionic liquid 1-butyl-3-methylimidazolium bis(trifluoromethylsulfonyl)imide ([bmim][Tf2N]) is established and verified with experimental data. The assessment results indicate that the specific energy consumption of ILS and PWS is almost the same and much less than that of MAS. High purity CO2 product can be obtained by MAS and ILS methods, whereas no pure CO2 is recovered with the PWS. For the environmental aspect, ILS has the highest green degree production value, while MAS and PWS produce serious environmental impacts.

  12. Integrating ethics in health technology assessment: many ways to Rome. (United States)

    Hofmann, Björn; Oortwijn, Wija; Bakke Lysdahl, Kristin; Refolo, Pietro; Sacchini, Dario; van der Wilt, Gert Jan; Gerhardus, Ansgar


    The aim of this study was to identify and discuss appropriate approaches to integrate ethical inquiry in health technology assessment (HTA). The key question is how ethics can be integrated in HTA. This is addressed in two steps: by investigating what it means to integrate ethics in HTA, and by assessing how suitable the various methods in ethics are to be integrated in HTA according to these meanings of integration. In the first step, we found that integrating ethics can mean that ethics is (a) subsumed under or (b) combined with other parts of the HTA process; that it can be (c) coordinated with other parts; or that (d) ethics actively interacts and changes other parts of the HTA process. For the second step, we found that the various methods in ethics have different merits with respect to the four conceptions of integration in HTA. Traditional approaches in moral philosophy tend to be most suited to be subsumed or combined, while processual approaches being close to the HTA or implementation process appear to be most suited to coordinated and interactive types of integration. The article provides a guide for choosing the ethics approach that appears most appropriate for the goals and process of a particular HTA.

  13. Assessing the Role of Technology Adoption in China's Growth Performance

    DEFF Research Database (Denmark)

    Wirz, Nadja

    to what extent these productivity increases can be explained by technology-adoption theory. In less developed countries, the key element behind technological progress is technology adoption, the process of copying technological knowledge invented throughout the world. To uncover a measure of China...

  14. Developing an Instrument for Assessing Students' Concepts of the Nature of Technology (United States)

    Liou, Pey-Yan


    Background: The nature of technology has been rarely discussed despite the fact that technology plays an essential role in modern society. It is important to discuss students' concepts of the nature of technology, and further to advance their technological literacy and adaptation to modern society. There is a need to assess high school students'…

  15. Technology assessment in Australia : the case for a formal agency to improve advice to policy makers

    NARCIS (Netherlands)

    Russell, A. Wendy; Vanclay, Frank M.; Salisbury, Janet G.; Aslin, Heather J.

    The pace and reach of technological change has led to calls for better technology policy and governance to improve social outcomes. Technology assessment can provide information and processes to improve technology policy. Having conducted a review of international best practice, we established a set

  16. Electrodeposited ultrafine TaOx/CB catalysts for PEFC cathode application: Their oxygen reduction reaction kinetics

    KAUST Repository

    Seo, Jeongsuk


    Ultrafine TaOx nanoparticles were electrodeposited on carbon black (CB) powder in a nonaqueous Ta complex solution at room temperature, and the resultant TaOx/CB catalysts were assessed as oxygen reduction reaction (ORR) electrocatalysts for polymer electrolyte fuel cell (PEFC) cathodes. The Ta electrodeposition process was scaled up using a newly designed working electrode containing a CB dense layer, without introducing any binder such as the ionomer Nafion in the electrode for electrodeposition. The electrodeposited TaOx/CB powders were removed from the deposition electrode and subsequent H2 treatment at varying temperatures between 523 and 1073 K was attempted to increase the ORR performance. The TaOx/CB samples were characterized by SEM, STEM, XPS, and EELS measurements. XPS and EELS results indicated the reduced nature of the Ta species caused by the high-temperature treatment in H2, while STEM images clearly revealed that the TaOx particles aggregated as the treatment temperature increased. When the TaOx/CB catalyst, which was treated at 873 K for 2 h, was deposited on a glassy carbon substrate with Nafion ionomer, it resulted in the highest activity among the samples investigated, giving an onset potential of 0.95 VRHE at -2 μA cm-2 in a 0.1 M H2SO4 solution. Moreover, the long-term stability test with 10,000 cycles of the voltammetry only led to a 6% loss in the ORR currents, demonstrating the high stability of the TaOx/CB catalysts. Kinetic analysis by R(R)DE indicated that the four-electron transfer pathway in the ORR process was dominant for this TaOx/CB catalyst, and Tafel plots showed a slope corresponding to a one-electron reaction for the rate-determining step.

  17. 78 FR 28627 - TA-W-80,340; TA-W-80,340A; TA-W-80,340B (United States)


    ... Employment and Training Administration TA-W-80,340; TA-W-80,340A; TA-W-80,340B] Bush Industries, Inc., Mason... (TA-W-80,340) and Bush Industries, Inc., Allen Street Facility, Jamestown, New York (TA-W- 80,340A... the subject firm's Erie, Pennsylvania facility. The amended notice applicable to TA-W-80,340 is...

  18. Psychometric evaluation of a new assessment of the ability to manage technology in everyday life. (United States)

    Malinowsky, Camilla; Nygård, Louise; Kottorp, Anders


    Technology increasingly influences the everyday lives of most people, and the ability to manage technology can be seen as a prerequisite for participation in everyday occupations. However, knowledge of the ability and skills required for management of technology is sparse. This study aimed to validate a new observation-based assessment, the Management of Everyday Technology Assessment (META). The META has been developed to assess the ability to manage technology in everyday life. A sample of 116 older adults with and without cognitive impairment were observed and interviewed by the use of the META when managing their everyday technology at home. The results indicate that the META demonstrates acceptable person response validity and technology goodness-of-fit. Additionally, the META can separate individuals with higher ability from individuals with lower ability to manage everyday technology. The META can be seen as a complement to existing ADL assessment techniques and is planned to be used in both research and practice.

  19. 78 FR 49287 - Environmental Assessment for Potential Lease Issuance and Marine Hydrokinetic Technology Testing... (United States)


    ... well as identification of important environmental issues associated with data collection and technology... Bureau of Ocean Energy Management Environmental Assessment for Potential Lease Issuance and Marine Hydrokinetic Technology Testing Offshore Florida AGENCY: Bureau of Ocean Energy Management (BOEM),...

  20. Assessment of Gari Processing Technologies in Oja-Iya Area of ...

    African Journals Online (AJOL)

    Assessment of Gari Processing Technologies in Oja-Iya Area of Ilorin Metropolis. ... Journal of Agricultural Research and Development ... Large scale gari processing was largely unsuccessful in the area because of lack of modern technology, ...

  1. Thermodynamic and mechanical stabilities of tantalum nitride Ta2N3

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, Chao [Los Alamos National Laboratory; Lin, Zhijun [Los Alamos National Laboratory; Zhao, Yusheng [Los Alamos National Laboratory


    We perform first-principles density functional calculations on a newly discovered tantalum nitride with an orthorhombic U{sub 2}S{sub 3} structure to assess its thermodynamic and mechanical stabilities. Our random search unveils a tetragonal Ta{sub 2}N{sub 3} structure that is energetically more favorable than an orthorhombic Ta{sub 2}N{sub 3} at zero pressure. We predict that the tetragonal Ta{sub 2}N{sub 3} transforms into the orthorhombic phase above a relatively low pressure of 7.7 GPa. Single-crystal elastic constant calculations reveal that orthorhombic Ta{sub 2}N{sub 3} is mechanically unstable because of a negative c{sub 66}. Our calculations suggest that minor oxygen substitution for nitrogen plays an important role in stabilizing the orthorhombic Ta{sub 2}N{sub 3} structure.

  2. CRED REA Coral Population Parameters at Ta'u, American Samoa, 2004 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 2 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 9 sites at Ta'u in American Samoa...

  3. CRED REA Coral Population Parameters at Ta'u Island, American Samoa in 2008 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 2 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 9 sites around Ta'u Island in...

  4. CRED REA Fish Team Stationary Point Count Surveys at Ta'u, American Samoa, 2006 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Stationary Point Counts at 4 stations at each survey site were surveyed as part of Rapid Ecological Assessments (REA) conducted at 9 sites around Ta'u in the...

  5. CRED REA Fish Team Belt Transect Survey at Ta'u, 2004 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 3 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 9 sites at Ta'u Islands in...

  6. CRED REA Fish Team Stationary Point Count Surveys at Ta'u, 2004 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Stationary Point Counts at 4 stations at each survey site were surveyed as part of Rapid Ecological Assessments conducted at 9 sites at Ta'u, Island in American...

  7. CRED REA Coral Population Paramaters at Ta'u, American Samoa, 2006 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 1 or 2 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 9 sites at Ta'u Island in...

  8. CRED REA Fish Team Belt Transect Survey at Ta'u, American Samoa, 2006 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Belt transects along 3 consecutively-placed, 25m transect lines were surveyed as part of Rapid Ecological Assessments conducted at 9 sites at Ta'u in the American...

  9. Why Portfolio Assessment is Introduced to Inner Mongolia University of Science and Technology

    Institute of Scientific and Technical Information of China (English)



    The concept of portfolio assessment derived from the field of fine arts. It has been proven an effective learning and assessment tool. In Inner Mongolia University of Science and Technology, the traditional assessment is still used. After analysing the benefits and disadvantages, the author is eager to introduce it to Inner Mongolia University of Science and Technology. The problems are also predicted.

  10. 1st International Ocean Technology Congress on EEZ Resources : Technology Assessment

    CERN Document Server

    Champ, Michael


    Today western nations consume annually only a small percentage of their resources from the sea, despite the proclamation of Exclusive Economic Zones (EEZ) by many. In contrast, most Pacific Basin Countries obtain more than a quarter of their annual needs from the ocean. Determination of greater rewards from the development of marine resources is markedly inhibited by the limited technical abilities available to locate and assess them. Knowledge of Exclusive Economic Zone resources is schematic and generalised, and a detailed understanding of the geology and processes relating to the economic use of the seafloor is both fragmentary and very basic. Technology for mapping the mineral resources of continental shelves and ocean areas, except in active offshore hydrocarbon provinces, has been largely developed in pursuit of scientific objectives and competence to rapidly appraise economic potential is limited. Similarly, the capability to characterise and evaluate the other resources of the seas is rudimentary. The...

  11. Quadrennial Technology Review 2015: Technology Assessments--Marine and Hydrokinetic Power

    Energy Technology Data Exchange (ETDEWEB)

    Sam Baldwin, Gilbert Bindewald, Austin Brown, Charles Chen, Kerry Cheung, Corrie Clark, Joe Cresko,


    Marine and hydrokinetic (MHK) technologies convert the energy of waves, tides, and river and ocean currents into electricity. With more than 50% of the U.S. population living within 50 miles of the nation’s coasts, MHK technologies hold significant potential to supply renewable electricity to consumers in coastal load centers, particularly in the near term in areas with high costs of electricity and longer term in high resource areas in close proximity to major coastal load centers. MHK resource assessments identify a total U.S. technical resource potential of approximately 1250–1850 terawatt-hours (TWh) of generation per year from ocean wave, ocean current, ocean tidal, and river current energy. Of this, the U.S. continental technical resource potential is approximately 500–750 TWh/year. For context, roughly 90,000 homes can be powered by 1 TWh of electricity generation each year. A cost-effective MHK industry could provide a substantial amount of electricity for the nation owing in large part to its unique advantages as a source of energy, including its vast resource potential, its close proximity to major coastal load centers, and its long-term predictability and near-term forecastability.

  12. An Interim Report on NASA's Draft Space Technology Roadmaps (United States)


    NASA has developed a set of 14 draft roadmaps to guide the development of space technologies under the leadership of the NASA Office of the Chief Technologist (OCT). Each of these roadmaps focuses on a particular technology area (TA). The roadmaps are intended to foster the development of advanced technologies and concepts that address NASA's needs and contribute to other aerospace and national needs. OCT requested that the National Research Council conduct a study to review the draft roadmaps, gather and assess relevant community input, and make recommendations and suggest priorities to inform NASA's decisions as it finalizes its roadmaps. The statement of task states that "based on the results of the community input and its own deliberations, the steering committee will prepare a brief interim report that addresses high-level issues associated with the roadmaps, such as the advisability of modifying the number or technical focus of the draft NASA roadmaps." This interim report, which does not include formal recommendations, addresses that one element of the study charge. NASA requested this interim report so that it would have the opportunity to make an early start in modifying the draft roadmaps based on feedback from the panels and steering committee. The final report will address all other tasks in the statement of task. In particular, the final report will include a prioritization of technologies, will describe in detail the prioritization process and criteria, and will include specific recommendations on a variety of topics, including many of the topics mentioned in this interim report. In developing both this interim report and the final report to come, the steering committee draws on the work of six study panels organized by technical area, loosely following the organization of the 14 roadmaps, as follows: A Panel 1: Propulsion and Power TA01 Launch Propulsion Systems TA02 In-Space Propulsion Technologies TA03 Space Power and Energy Storage Systems TA13

  13. Large Artery Stiffness Assessment Using SphygmoCor Technology (United States)

    Butlin, Mark; Qasem, Ahmad


    Large artery stiffness assessment has been an integral part of the SphygmoCor technology since 1998. Aortic stiffness is approximated with non-invasive measurement of carotid-femoral pulse wave velocity, with improvements made with time to make the assessment procedure quicker and more user independent. Also standard in the devices is the ability to reliably calculate the central aortic waveform shape from a peripheral pressure waveform from either the brachial or radial artery. This waveform contains much information beyond peak and trough (systolic and diastolic pressure). Relative waveform features such as the augmentation index, wave reflection magnitude, reflection time index, and subendocardial viability ratio are parameters that are influenced by the stiffness of systemic arteries. This article briefly describes these parameters related to large artery stiffness and provides reference to validation and repeatability studies relative to the clinical use of the SphygmoCor devices. It is beyond the scope to review here the 424 original research articles that have employed SphygmoCor devices in measuring arterial stiffness. Instead, the method of measurement across the devices is described, including tonometry, volumetric displacement through cuff placement around limbs, and ambulatory monitoring. Key population and subpopulation studies are cited where the average stiffness parameter progression with age and gender, as measured by SphygmoCor devices, is quantified in the healthy and general population. Finally, with reference to guidelines from working groups on arterial stiffness and hypertension, the clinical utility of large artery stiffness measurement is discussed in the context of the arterial stiffness parameters provided by the SphygmoCor systems. PMID:28229053

  14. An Empirical Assessment of Science Teachers' Intentions toward Technology Integration (United States)

    Wu, Weishen; Chang, Huey-Por; Guo, Chorng-Jee


    Building upon three theoretical paradigms (technology acceptance model, social cognitive theory, and task-technology fit), the present study aims to investigate the relationship among intrinsic and extrinsic factors influencing science teachers' intentions toward teaching with information technology (IT). A sample of 226 middle school science…

  15. Assessing Pre-Service Teachers' Information and Communication Technologies Knowledge (United States)

    Kovalik, Cindy; Kuo, Chia-Ling; Karpinski, Aryn


    The impact of a redesigned educational technology course on preservice teachers' knowledge and skills with regard to information and communications technology as defined by ISTE's National Educational Technology Standards for Teachers (NETS-T) was investigated in this study. Two changes were made to the course: (1) a commercially available…

  16. Assessing Pre-Service Teachers' Information and Communication Technologies Knowledge (United States)

    Kovalik, Cindy; Kuo, Chia-Ling; Karpinski, Aryn


    The impact of a redesigned educational technology course on preservice teachers' knowledge and skills with regard to information and communications technology as defined by ISTE's National Educational Technology Standards for Teachers (NETS-T) was investigated in this study. Two changes were made to the course: (1) a commercially available…

  17. 1:1 Technology and Computerized State Assessments (United States)

    Medlin, Shane A.


    American students in the 21st century are growing up with Internet accessible technology available at their fingertips. Considering this and the continued pressure to compete in a global society, The United States' Department of Education's National Education Technology Plan (NETP) (2010) calls for educators to leverage technology in order to…

  18. [The Health Technology Assessment Engine of the Academic Hospital of Udine: first appraisal]. (United States)

    Vidale, Claudia


    The Health Technology Assessment Engine (HTAE) of the Academic Hospital of Udine aggregates about one hundred of health technology assessment websites. It was born thanks to Google technology in 2008 and after about four years of testing it became public for everybody from the Homepage of the Italian Society of Health Technology Assessment (SIHTA). In this paper the first results obtained with this resource are reported. The role of the scientific librarian is examined not only as a support specialist in bibliographic search but also as a creative expert in managing new technologies for the community.

  19. [Health research and health technology assessment in Chile]. (United States)

    Espinoza, Manuel Antonio; Cabieses, Báltica; Paraje, Guillermo


    Health research is considered an essential element for the improvement of population health and it has been recommended that a share of the national health budget should be allocated to develop this field. Chile has undertaken efforts in the last decades in order to improve the governmental structure created to promote the development of health research, which has increased human resources and funding opportunities. On the other hand, the sustained economic growth of Chile in the last decades suggests that the health expenditure will maintain its increasing trend in the following years. This additional funding could be used to improve coverage of current activities performed in the health system, but also to address the incorporation of new strategies. More recently, health technology assessment (HTA) has been proposed as a process to support decisions about allocation of resources based on scientific evidence. This paper examines the relationship between the development of health research and the HTA process. First, it presents a brief diagnosis of the situation of health research in Chile. Second, it reviews the conceptual basis and the methods that account for the relationship between a HTA process and the development of health research. In particular, it emphasizes the relevance of identifying information gaps where funding additional research can be considered a good use of public resources. Finally, it discusses the challenges and possible courses of action that Chile could take in order to guarantee the continuous improvement of an articulated structure for health research and HTA.

  20. [Citizen participation in the context of health technology assessment]. (United States)

    Freile-Gutiérrez, Berenice


    Citizen participation is important in all economic sectors of the democratic world, as it is also in the field of health. This is due to the significant value of life and therefore enjoying this in a healthy condition. This paper seeks to provide an overview of public participation in the context of Health Technology Assessments (HTA), covering from conceptualization to practical experiences. Within the existing literature, the definitions and methodological aspects of the topic discussed are reviewed, as well as how citizen participation in HTA agencies is manifested, presenting barriers as well as enablers for public involvement. In the Chilean case, where there are no public participation experiences in the context of HTA, a review of these initiatives in the health care sector is performed. In light with the studies examined, it is concluded that there is much to advance in the concreteness of citizen participation in HTA's agencies; efforts at institutional level as well as from community organizations are needed. This review can be useful as an antecedent for countries that are considering incorporating HTA in the future.

  1. Interview: Health technology assessment in Asia: an emerging trend. (United States)

    Yang, Bong-min


    Bong-min Yang, PhD (in economics), is Professor and former Dean of the School of Public Health at the Seoul National University, South Korea. Professor Yang has led research and written many papers in health economics and healthcare systems in Korea and Asia. His recent research and publications focus on the field of economic evaluation and outcomes research. He played a key role in the introduction of a formal health technology assessment system within Korean healthcare. He is currently serving as Executive Director, Institute of Health and Environment, Seoul National University. In addition to his research and publications, Professor Yang is Associate Editor for Journal of Comparative Effectiveness Research, is co-editor-in-chief for Value in Health Regional Issues, and is currently chair of the Management Advisory Board of Value in Health and a member of the editorial board of the Journal of Medical Economics. He has been a policy consultant to China, Japan, Indonesia, Hong Kong, Malaysia, Taiwan, Thailand and India. He has also worked as a short-term consultant at the WHO, ADB, UNDP and the World Bank. For the Korean government, he served as Chairperson of the Health Insurance Reform Committee, and Chairperson of the Drug Pricing and Reimbursement Committee. He is currently serving as Chair of the International Society of Pharmacoeconomics and Outcomes Research-Asia Consortium, and a member of the Board of Directors of the International Society of Pharmacoeconomics and Outcomes Research.

  2. Subgroup analyses of clinical effectiveness to support health technology assessments. (United States)

    Paget, Marie-Ange; Chuang-Stein, Christy; Fletcher, Christine; Reid, Carol


    Subgroup analysis is an integral part of access and reimbursement dossiers, in particular health technology assessment (HTA), and their HTA recommendations are often limited to subpopulations. HTA recommendations for subpopulations are not always clear and without controversies. In this paper, we review several HTA guidelines regarding subgroup analyses. We describe good statistical principles for subgroup analyses of clinical effectiveness to support HTAs and include case examples where HTA recommendations were given to subpopulations only. Unlike regulatory submissions, pharmaceutical statisticians in most companies have had limited involvement in the planning, design and preparation of HTA/payers submissions. We hope to change this by highlighting how pharmaceutical statisticians should contribute to payers' submissions. This includes early engagement in reimbursement strategy discussions to influence the design, analysis and interpretation of phase III randomized clinical trials as well as meta-analyses/network meta-analyses. The focus on this paper is on subgroup analyses relating to clinical effectiveness as we believe this is the first key step of statistical involvement and influence in the preparation of HTA and reimbursement submissions.

  3. Reimbursement of pharmaceuticals: reference pricing versus health technology assessment. (United States)

    Drummond, Michael; Jönsson, Bengt; Rutten, Frans; Stargardt, Tom


    Reference pricing and health technology assessment are policies commonly applied in order to obtain more value for money from pharmaceuticals. This study focussed on decisions about the initial price and reimbursement status of innovative drugs and discussed the consequences for market access and cost. Four countries were studied: Germany, The Netherlands, Sweden and the United Kingdom. These countries have operated one, or both, of the two policies at certain points in time, sometimes in parallel. Drugs in four groups were considered: cholesterol-lowering agents, insulin analogues, biologic drugs for rheumatoid arthritis and "atypical" drugs for schizophrenia. Compared with HTA, reference pricing is a relatively blunt instrument for obtaining value for money from pharmaceuticals. Thus, its role in making reimbursement decisions should be limited to drugs which are therapeutically equivalent. HTA is a superior strategy for obtaining value for money because it addresses not only price but also the appropriate indications for the use of the drug and the relation between additional value and additional costs. However, given the relatively higher costs of conducting HTAs, the most efficient approach might be a combination of both policies.

  4. Use of wearable technology for performance assessment: a validation study. (United States)

    Papi, Enrica; Osei-Kuffour, Denise; Chen, Yen-Ming A; McGregor, Alison H


    The prevalence of osteoarthritis is increasing globally but current compliance with rehabilitation remains poor. This study explores whether wearable sensors can be used to provide objective measures of performance with a view to using them as motivators to aid compliance to osteoarthritis rehabilitation. More specifically, the use of a novel attachable wearable sensor integrated into clothing and inertial measurement units located in two different positions, at the waist and thigh pocket, was investigated. Fourteen healthy volunteers were asked to complete exercises adapted from a knee osteoarthritis rehabilitation programme whilst wearing the three sensors including five times sit-to-stand test, treadmill walking at slow, preferred and fast speeds. The performances of the three sensors were validated against a motion capture system and an instrumented treadmill. The systems showed a high correlation (r(2) > 0.7) and agreement (mean difference range: -0.02-0.03 m, 0.005-0.68 s) with gold standards. The novel attachable wearable sensor was able to monitor exercise tasks as well as the inertial measurement units (ICC > 0.95). Results also suggested that a functional placement (e.g., situated in a pocket) is a valid position for performance monitoring. This study shows the potential use of wearable technologies for assessing subject performance during exercise and suggests functional solutions to enhance acceptance.

  5. Assessment of conducting polymer applications in power equipment technology

    Energy Technology Data Exchange (ETDEWEB)

    Schoch, K.F. Jr.; Bennett, A.I.; Burghardt, R.R.; Cookson, A.H.; Kennedy, W.N.; Oommen, T.V.; Saunders, H.E.; Smith, J.D.B.; Voshall, R.E. (Westinghouse Electric Corp., Pittsburgh, PA (USA)); Fort, E.M. (Westinghouse Electric Corp., Orlando, FL (USA)); Robbins, B. (Reynolds Metals Co., Richmond, VA (USA))


    This report describes for the first time the state-of-the-art in conducting polymer technology specifically relating to electric power apparatus for transmission, distribution and generation. Thirty-two new applications in power equipment are proposed and assessed. The areas of the proposed applications include solid dielectric cable, oil-filled cable, capacitors, transformers, rotating machines, bushings, surge supressors, vacuum interrupters, gas-insulated equipment, and miscellaneous applications. The best applications will result in improved reliability and efficiency, design innovations, and simpler manufacturing procedures by taking advantage of the particular characteristics of conducting polymers. These characteristics include good control of conductivity over a range of 10{sup {minus}8} to 10{sup 3} S/cm, compatibility with organic compounds, simple preparation and development of anisotropic conductivity by polymer orientation. The proposed applications were evaluated according to technical impact, probability of success, economic impact, and time frame for implementation. The state-of-the-art of conducting polymers is also reviewed and areas requiring further research for these applications are discussed. Because of substantial recent progress is developing more practical conducting polymer materials, now is an excellent time to pursue the additional research needed. 37 refs., 16 figs., 15 tabs.

  6. Assessment of basic research needs for greenhouse gas control technologies

    Energy Technology Data Exchange (ETDEWEB)

    Benson, S.M.; Chandler, W.; Edmonds, J.; Houghton, J.; Levine, M.; Bates, L.; Chum, H.; Dooley, J.; Grether, D.; Logan, J.; Wiltsee, G.; Wright, L.


    This paper is an outgrowth of an effort undertaken by the Department of Energy's Office of Energy Research to assess the fundamental research needs to support a national program in carbon management. Five topics were identified as areas where carbon management strategies and technologies might be developed: (1) capture of carbon dioxide, decarbonization strategies, and carbon dioxide disposal and utilization; (2) hydrogen development and fuel cells; (3) enhancement of the natural carbon cycle; (4) biomass production and utilization; and (5) improvement of the efficiency of energy production, conversion, and utilization. Within each of these general areas, experts came together to identify targets of opportunity for fundamental research likely to lead to the development of mid- to long-term solutions for stabilizing or decreasing carbon dioxide and other greenhouse gases in the atmosphere. Basic research to support the options outlined above are far reaching-from understanding natural global processes such as the ocean and terrestrial carbon cycles to development of new materials and concepts for chemical separation. Examples of fundamental research needs are described in this paper.

  7. Evaluation of pressure sensing concepts: A technology assessment

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, R.L.; Thacker, L.H.


    Advanced distributed control systems for electric power plants will require more accurate and reliable pressure gauges than those now installed. Future developments in power plant control systems are expected to use digital/optical networks rather than the analog/electric data transmission used in existing plants. Many pressure transmitters now installed use oil filling to separate process fluids from the gauge mechanism and are subject to insidious failures when the oil leaks. Testing and maintenance of pressure channels occupy a disproportionately large amount of effort to restore their accuracy and verify their operability. These and similar concerns have prompted an assessment of a broad spectrum of sensor technologies to aid in selecting the most likely candidates for adaptation to power plant applications. Ten representative conventional and thirty innovational pressure sensors are described and compared. Particular emphasis is focused on two categories: Silicon-integrated pressure sensors and fiber-optic sensors, and both of these categories are discussed in detail. Additional attractive concepts include variable reluctance gauges and resonant structure gauges that may not require oil buffering from the process fluid.

  8. Technology assessment in Non-PTA countries: an overview of recent developments in Europe


    Boavida, Nuno; António B. Moniz


    Paper based on the text to be published in Moniz, A.B. and Okuwada, K. (2016), Technology Assessment in Japan and Europe, Karlsruhe, KIT Scientific Publishing This work aims to describe the latest developments in European countries or regions that lack a structure to develop Parliamentary Technology Assessment activities (named non-PTA). They are countries or regions where parliamentary-oriented technology assessment activities have not yet resulted in a formal structure, but where these a...

  9. Technology and Economic Assessment of Innovative Field Drainage Technologies in Denmark

    DEFF Research Database (Denmark)

    Gachango, Florence Gathoni

    technologies, and their willingness and extent of trading-off the existing farm management nutrient reduction measures with constructed wetland technology, iii) the cost-effectiveness of surface flow constructed wetlands, and iv) the strategies of incorporating the filter technologies into policy measures....... Overall, the findings in this thesis indicate a potential for integration of the filter technologies into nutrient reduction measures....

  10. TA-55 and Sigma Overview

    Energy Technology Data Exchange (ETDEWEB)

    Spearing, Dane Robert [Los Alamos National Lab. (LANL), Los Alamos, NM (United States). Safeguards Science and Technology Group (NEN-1)


    These are slides from a facility overview presentation for visiting agencies to Los Alamos National Laboratory (LANL). The TA-55 Plutonium Facility (PF-4) is discussed in detail. PF-4 is a unique resource for US plutonium programs. The basic design is flexible and has adapted to changing national needs. It is a robust facility with strong safety and security implementation. It supports a variety of national programs. It will continue for many years into the future. Sigma is then discussed in detail, which handles everything from hydrogen to uranium. It has been in long term service to the Nation (nearly 60 years). It has a flexible authorization basis to handle almost the entire periodic table. It has a wide breadth of prototyping and characterization capabilities. It has integrated program and line management.

  11. Assessment and evaluation of technologies for environmental restoration. Progress report

    Energy Technology Data Exchange (ETDEWEB)

    Uzochukwu, G.A.


    Nuclear and commercial non-nuclear technologies that have the potential of meeting the environmental restoration objectives of the Department of Energy are being evaluated. A detailed comparison of innovative technologies available will be performed to determine the safest and most economical technology for meeting these objectives. Information derived from this effort will be matched with the multi-objective of the environmental restoration effort to ensure that the best, most economical, and the safest technologies are used in decision making at USDOE-SRS. Technology-related variables will be developed and the resulting data formatted and computerized for multimedia systems. The multimedia system will be made available to technology developers and evaluators to ensure that the safest and most economical technologies are developed for use at SRS and other DOE sites.

  12. Assessment and evaluation of technologies for environmental restoration. Progress report

    Energy Technology Data Exchange (ETDEWEB)

    Uzochukwu, G. A. [North Carolina A and T State Univ., Greensboro, NC (United States)


    Nuclear and commercial non-nuclear technologies that have the potential of meeting the environmental restoration objectives of the Department of Energy are being evaluated. A detailed comparison of innovative technologies available will be performed to determine the safest and most economical technology for meeting these objectives. Information derived from this effort will be matched with the multi-objective of the environmental restoration effort to ensure that the best, most economical, and the safest technologies are used in decision making at USDOE-SRS. Technology-related variables will be developed and the resulting data formatted and computerized for multimedia systems. The multimedia system will be made available to technology developers and evaluators to ensure that the safest and most economical technologies are developed for use at SRS and other DOE sites.

  13. Health technology assessment in the Balkans: opportunities for a balanced drug assessment system. (United States)

    Dankó, Dávid; Petrova, Guenka


    Countries in the Balkan region use pharmaco-economic data for decisions about the inclusion of new pharmaceuticals into their positive drug lists, but no predefined frameworks are used and resources for health technology assessment (HTA) are limited. The goal of this analysis is to investigate into possible development directions for the HTA system in the region, and provide some practical recommendations for a sustainable model. For this purpose, the main factors currently influencing HTA in Balkan countries are briefly presented, and possible development strategies are compared. A resource-saving balanced assessment approach is proposed. It is aligned with available resources and capabilities, and helps access to new pharmaceuticals while ensuring the transparency of decision-making processes and the stability of the pharmaceutical budget.

  14. Decision Gate Process for Assessment of a NASA Technology Development Portfolio (United States)

    Kohli, Rajiv; Fishman, Julianna L.; Hyatt, Mark J.


    The NASA Dust Management Project (DMP) was established to provide technologies (to Technology Readiness Level (TRL) 6) required to address adverse effects of lunar dust to humans and to exploration systems and equipment, to reduce life cycle cost and risk, and to increase the probability of sustainable and successful lunar missions. The technology portfolio of DMP consisted of different categories of technologies whose final product was either a technology solution in itself, or one that contributes toward a dust mitigation strategy for a particular application. A Decision Gate Process (DGP) was developed to assess and validate the achievement and priority of the dust mitigation technologies as the technologies progress through the development cycle. The DGP was part of continuous technology assessment and was a critical element of DMP risk management. At the core of the process were technology-specific criteria developed to measure the success of each DMP technology in attaining the technology readiness levels assigned to each decision gate. The DGP accounts for both categories of technologies and qualifies the technology progression from technology development tasks to application areas. The process provided opportunities to validate performance, as well as to identify non-performance in time to adjust resources and direction. This paper describes the overall philosophy of the DGP and the methodology for implementation for DMP, and describes the method for defining the technology evaluation criteria. The process is illustrated by example of an application to a specific DMP technology.

  15. Propulsion Technology Assessment: Science & Enabling Technologies to Explore the Interstellar Medium (United States)

    Hopkins, Randall C.; Thomas, Herbert D.; Wiegmann, Bruce M.; Heaton, Andrew F.; Johnson, Les; Baysinger, Michael F.; Beers, Benjamin R.


    As part of a larger effort led by the Keck Institute for Space Studies at the California Institute of Technology, the Advanced Concepts Office at NASA's George C. Marshall Space Flight Center conducted a study to assess what low-thrust advanced propulsion system candidates, existing and near term, could deliver a small, Voyager-like satellite to our solar system's heliopause, approximately 100 AU from the center of the sun, within 10 years and within a 2025 to 2035 launch window. The advanced propulsion system trade study consisted of three candidates, including a Magnetically Shielded Miniature (MaSMi) Hall thruster, a solar sail and an electric sail. Two aerial densities, and thus characteristic accelerations, 0.426 mm/s2 and 0.664 mm/s2, were analyzed for the solar sail option in order understand the impact of near and long term development of this technology. Similarly, two characteristic accelerations, 1 mm/s2 and 2 mm/s2, were also analyzed for the electric sail option in addition to tether quantities of 10 and 20, respectively, and individual tether length of 20 km. A second analysis was conducted to determine what existing solid rocket motor kick stage(s) would be required to provide additional thrust at various points in the trajectory, assuming an earth departure characteristic energy capability provided by a Space Launch System (SLS) Block 1B vehicle architecture carrying an 8.4 meter payload fairing. Two trajectory profiles were considered, including an escape trajectory using a Jupiter gravity assist (E-Ju), and an escape trajectory first performing a Jupiter gravity assist followed by an Oberth maneuver around the sun and an optional Saturn gravity assist (E-Ju-Su-Sa). The Oberth maneuver would need to be performed very close to the sun, wherein this study assumed a perihelion distance of approximately 11 solar radii, or 0.05 AU, away from the surface. The heat shield technology required to perform this type of ambitious maneuver was assumed to be

  16. Propulsion Technology Assessment: Science and Enabling Technologies to Explore the Interstellar Medium (United States)

    Hopkins, Randall C.; Thomas, Herbert D.; Wiegmann, Bruce M.; Heaton, Andrew F.; Johnson, Les; Baysinger, Michael F.; Beers, Benjamin R.


    Led by the Keck Institute for Space Studies at the California Institute of Technology, the Advanced Concepts Office at NASA's George C. Marshall Space Flight Center conducted a study to assess what low-thrust advanced propulsion system candidates, existing and near term, could deliver a small, Voyager-like satellite to our solar system's heliopause, approximately 100 AU from the center of the sun, within 10 years and within a 2025-2035 launch window. The advanced propulsion system trade study consisted of three candidates, including a Magnetically Shielded Miniature (MaSMi) Hall thruster, a solar sail and an electric sail. Two aerial densities, and thus characteristic accelerations, 0.426 mm/sq s and 0.664 mm/sq s were analyzed for the solar sail option in order understand the impact of near and long term development of this technology. Similarly, two characteristic accelerations, 1 mm/s2 and 2 mm/sq s, were also analyzed for the electric sail option in addition to tether quantities of 10 and 20, respectively, and individual tether length of 20 km. A second analysis was conducted to determine what existing solid rocket motor kick stage(s) would be required to provide additional thrust at various points in the trajectory, assuming an earth departure characteristic energy capability provided by a Space Launch System (SLS) Block 1B vehicle architecture carrying an 8.4 meter payload fairing. Two trajectory profiles were considered, including an escape trajectory using a Jupiter gravity assist (E-Ju), and an escape trajectory first performing a Jupiter gravity assist followed by an Oberth maneuver around the sun and an optional Saturn gravity assist (E-Ju-Su-Sa). The Oberth maneuver would need to be performed very close to the sun, wherein this study assumed a perihelion distance of approximately 11 solar radii, or 0.05 AU, away from the surface. The heat shield technology required to perform this type of ambitious maneuver was assumed to be similar to that of NASA

  17. Propulsion Technology Assessment: Science and Enabling Technologies to Explore the Interstellar Medium (United States)

    Hopkins, Randall C.; Thomas, Herbert D.; Wiegmann, Bruce M.; Heaton, Andrew F.; Johnson, Les; Baysinger, Michael F.; Beers, Benjamin R.


    As part of a larger effort led by the Keck Institute for Space Studies at the California Institute of Technology, the Advanced Concepts Office at NASA’s George C. Marshall Space Flight Center conducted a study to assess what low-thrust advanced propulsion system candidates, existing and near term, could deliver a small, Voyager-like satellite to our solar system’s heliopause, approximately 100 AU from the center of the sun, within 10 years and within a 2025 to 2035 launch window. The advanced propulsion system trade study consisted of three candidates, including a Magnetically Shielded Miniature (MaSMi) Hall thruster, a solar sail and an electric sail. Two aerial densities, and thus characteristic accelerations, 0.426 mm/s(exp 2) and 0.664 mm/s(exp 2), were analyzed for the solar sail option in order understand the impact of near and long term development of this technology. Similarly, two characteristic accelerations, 1 mm/s(exp 2) and 2 mm/s(exp 2), were also analyzed for the electric sail option in addition to tether quantities of 10 and 20, respectively, and individual tether length of 20 km. A second analysis was conducted to determine what existing solid rocket motor kick stage(s) would be required to provide additional thrust at various points in the trajectory, assuming an earth departure characteristic energy capability provided by a Space Launch System (SLS) Block 1B vehicle architecture carrying an 8.4 meter payload fairing. Two trajectory profiles were considered, including an escape trajectory using a Jupiter gravity assist (E-Ju), and an escape trajectory first performing a Jupiter gravity assist followed by an Oberth maneuver around the sun and an optional Saturn gravity assist (E-Ju-Su-Sa). The Oberth maneuver would need to be performed very close to the sun, wherein this study assumed a perihelion distance of approximately 11 solar radii, or 0.05 AU, away from the surface. The heat shield technology required to perform this type of ambitious

  18. Assessing the Role of Technology Adoption in China's Growth Performance

    DEFF Research Database (Denmark)

    Wirz, Nadja

    China has experienced a period of tremendous economic growth in recent years. In an attempt to explain this development, several existing growth-accounting studies reveal that impressively high rates of productivity growth have been at the heart of China's performance. This study investigates...... to what extent these productivity increases can be explained by technology-adoption theory. In less developed countries, the key element behind technological progress is technology adoption, the process of copying technological knowledge invented throughout the world. To uncover a measure of China...

  19. Stoichiometry behavior of TaN, TaCN and TaC thin films produced by magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Vargas, M. [Centro de Nanociencia y Nanotecnología, Universidad Nacional Autónoma de México, A.P. 2681, C.P. 22860, Ensenada, B.C. (Mexico); Castillo, H.A. [Centro de Enseñanza Técnica y Superior, CETYS Universidad, Campus Tijuana, Tijuana, B.C. (Mexico); Restrepo-Parra, E., E-mail: [Universidad Nacional de Colombia Sede Medellín Colombia, Facultad de Minas, Manizales (Colombia); De La Cruz, W. [Centro de Nanociencia y Nanotecnología, Universidad Nacional Autónoma de México, A.P. 2681, C.P. 22860, Ensenada, B.C. (Mexico)


    Thin films were synthesized in a magnetron sputtering system using a target of Ta with 99.99% purity and silicon substrates (1 1 1). The gases used for the film growth were (Ar + N{sub 2}), (Ar + CH{sub 4} + N{sub 2}) and (Ar + CH{sub 4}) mixtures for TaN, TaCN and TaC, respectively. The substrate temperature increased from room temperature to 500 °C. The chemical composition and bonding configuration were examined using X-ray photoelectron spectroscopy (XPS), revealing Ta-N, Ta-C-N, Ta-C and C-C bonds. Moreover, the crystallographic structure was analyzed using X-ray diffraction (XRD), indicating the presence of (1 1 1) and (2 0 0) planes belonging to a face-centered cubic structure. The stoichiometry variation dependence on the CH{sub 4} and N{sub 2} flow was analyzed, and the influence of the substrate temperature on the coatings was investigated. Finally, scanning electron microscopy (SEM) was used to determine the evolution on the grain formation in the coatings as the substrate temperature increased.

  20. Involving patient in the early stages of health technology assessment (HTA): a study protocol


    Gagnon, Marie-Pierre; Candas, Bernard; Desmartis, Marie; Gagnon, Johanne; Roche, Daniel La; Rhainds, Marc; Coulombe, Martin; Dipankui, Mylène Tantchou; Légaré, France


    Background Public and patient involvement in the different stages of the health technology assessment (HTA) process is increasingly encouraged. The selection of topics for assessment, which includes identifying and prioritizing HTA questions, is a constant challenge for HTA agencies because the number of technologies requiring an assessment exceeds the resources available. Public and patient involvement in these early stages of HTA could make assessments more relevant and acceptable to them. ...

  1. Assessing the performance and longevity of Nb, Pt, Ta, Ti, Zr, and ZrO₂-sputtered Havar foils for the high-power production of reactive [18F]F by proton irradiation of [18O]H2O. (United States)

    Gagnon, K; Wilson, J S; Sant, E; Backhouse, C J; McQuarrie, S A


    As water-soluble ionic contaminants, which arise following proton irradiation of [18O]H2O have been associated with decreased [18F]FDG yields, the minimization of these contaminants is an asset in improving the [18F]F reactivity. To this end, we have previously demonstrated that the use of Nb-sputtered Havar foils results in decreased radionuclidic and chemical impurities in proton irradiated [18O]H2O, improved [18F]FDG yields, and improved [18F]FDG yield consistency when compared with non-sputtered Havar. Resulting from the highly reactive chemical microenvironment within the target however, this niobium layer is observed to degrade over time. To find a material that displays increased longevity with regards to maintaining high [18F]F reactivity, this project extensively investigated and compared Havar foils sputtered with Nb, Pt, Ta, Ti, Zr and ZrO₂. Of the materials investigated, the results of this study suggest that Ta-sputtered Havar foil is the preferred choice. For similar integrated currents (~1,000,000 μA min), when comparing the Ta-sputtered Havar with Nb-sputtered Havar we observed: (i) greater than an order of magnitude decrease in radionuclidic impurities, (ii) a 6.4 percent increase (p=0.0025) in the average TracerLab MX [18F]FDG yield, and (iii) an overall improvement in the FDG yield consistency. Excellent performance of the Ta-sputtered foil was maintained throughout its ~1,500,000 μA min lifetime.

  2. Issues for reuse of gloveboxes at LANL TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Cadwallader, L.C.; Pinson, P.A.; Miller, C.F.


    This report is a summary of issues that face plutonium glovebox designers and users at the Los Alamos National Laboratory (LANL) Technical Area 55 (TA-55). Characterizing the issues is a step in the task of enhancing the next generation glovebox design to minimize waste streams while providing the other design functions. This report gives an initial assessment of eight important design and operation issues that can benefit from waste minimization.

  3. Issues for reuse of gloveboxes at LANL TA-55

    Energy Technology Data Exchange (ETDEWEB)

    Cadwallader, L.C.; Pinson, P.A.; Miller, C.F.


    This report is a summary of issues that face plutonium glovebox designers and users at the Los Alamos National Laboratory (LANL) Technical Area 55 (TA-55). Characterizing the issues is a step in the task of enhancing the next generation glovebox design to minimize waste streams while providing the other design functions. This report gives an initial assessment of eight important design and operation issues that can benefit from waste minimization.

  4. Trust, technology affordances and feedback in peer assessments in MOOCs

    DEFF Research Database (Denmark)

    Ringtved, Ulla Lunde; Milligan, Sandra


    The preliminary findings in the automated peer assessments in the assessment framework in a MOOC are discussed here. We discuss whether,the assessment frame work underpins pedagogical approaches including feedback and collaboration between the participants. The empirical foundation is research...... on data from a recent MOOC from Melbourne University titled “Teaching and assessing 21st century skills”....

  5. Trust, technology affordances and feedback in peer assessments in MOOCs

    DEFF Research Database (Denmark)

    Ringtved, Ulla Lunde; Milligan, Sandra


    The preliminary findings in the automated peer assessments in the assessment framework in a MOOC are discussed here. We discuss whether,the assessment frame work underpins pedagogical approaches including feedback and collaboration between the participants. The empirical foundation is research...... on data from a recent MOOC from Melbourne University titled “Teaching and assessing 21st century skills”....

  6. Effects of thickness and annealing condition on magnetic properties and thermal stabilities of Ta/Nd/NdFeB/Nd/Ta sandwiched films (United States)

    Liu, Wen-Feng; Zhang, Min-Gang; Zhang, Ke-Wei; Zhang, Hai-Jie; Xu, Xiao-Hong; Chai, Yue-Sheng


    Ta/Nd/NdFeB/Nd/Ta sandwiched films are deposited by magnetron sputtering on Si (100) substrates, and subsequently annealed in vacuum at different temperatures for different time. It is found that both the thickness of NdFeB and Nd layer and the annealing condition can affect the magnetic properties of Ta/Nd/NdFeB/Nd/Ta films. Interestingly, the thickness and annealing temperature show the relevant behaviors that can affect the magnetic properties of the film. The high coercivity of 24.1 kOe (1 Oe = 79.5775 A/m) and remanence ratio (remanent magnetization/saturation magnetization) of 0.94 can be obtained in a Ta/Nd(250 nm)/NdFeB(600 nm)/Nd(250 nm)/Ta film annealed for 3 min at 1023 K. In addition, the thermal stability of the film is also linked to the thickness of NdFeB and Nd layer and the annealing temperature as well. The excellent thermal stability can be achieved in a Ta/Nd(250 nm)/NdFeB(600 nm)/Nd(250 nm)/Ta film annealed at 1023 K. Program supported by the National Natural Science Foundation of China (Grant No. 51305290), the Higher Education Technical Innovation Project of Shanxi Province, China (Grant No. 2013133), the Fund Program for the Scientific Activities of Selected Returned Overseas Professionals of Shanxi Province, China (Grant No. 2015003), and the Program for the Key Team of Scientific and Technological Innovation of Shanxi Province, China (Grant No. 2013131009).

  7. Natural hazards and technological risk in Russia: the relation assessment

    Directory of Open Access Journals (Sweden)

    E. Petrova


    Full Text Available Almost every natural disaster is accompanied by some sort of technological one. A number of studies also show a correlation between technological disasters and various global processes such as solar disturbances, geophysical field variation etc. In this study we attempted to ascertain and codify the relationship between different types of technological disasters and natural hazards. Two types of natural hazards were found, based on their genesis, distribution in time, and impact pattern on the technosphere. Solar and geomagnetic disturbances generally affect technological risk through the failure of automatic machinery and the reduction of operator reliability. They increase the probability of transport accidents, fires, and catastrophic toxic emissions. These types of technological disasters are widely prevalent throughout Russia and in all federal regions. Geological, climatic, hydrological, and other natural hazardous processes increase technological risk through direct mechanical impacts. Their occurrence in space and time depends on the character of the natural process and the specific regional environment. The total number and proportion of technological disasters in federal regions results mainly from the concentration of industrial units and their type, as well as the local natural and social environment. Temporal changes in the number of technological disasters of different groups depend on the prevailing type of natural processes.

  8. Assessing personal disposition of individuals towards technology adoption

    Directory of Open Access Journals (Sweden)

    Irbha Magotra


    Full Text Available The present study has attempted to explore personal disposition of individuals towards technology adoption through the development of an index named as Technology Adoption Index. For developing the index, exploratory factor analysis approach has been employed on the sample of 1201 responses collected from the residents of 12 different cities in India. Accordingly, the results of the index have indicated significant role of seven personal traits, namely, optimism, innovativeness, self-efficacy, risk taking propensity, habit, social influence and psychological resilience while manifesting personal disposition of individuals towards technology adoption, i.e., the technology adoption propensity of the individuals. Further, an attempt has also been made to explore the socio-economic characteristics of the individuals possessing distinct level of personal disposition towards technology adoption. Accordingly, the results have unveiled that the personal disposition of the individuals towards technology adoption increases with enhancement in their income and qualification but decreases with enhancement in their age. As a measurement tool, Technology Adoption Index can be used as ready-recknor by practitioners for the identification of technology adoption propensity of the individuals. This will facilitate organizations in developing and designing new products and services which can be readily accepted by the individuals.

  9. Validating the Technology Proficiency Self-Assessment Questionnaire for 21st Century Learning (TPSA C-21) (United States)

    Christensen, Rhonda; Knezek, Gerald


    Accurately measuring levels of technology proficiency in current and future classroom teachers are an important first step toward enhancing comfort level and confidence in integrating technology into the educational environment. The original Technology Proficiency Self-Assessment (TPSA) survey has maintained respectable psychometric properties for…

  10. Assistive Technology Approaches for Large-Scale Assessment: Perceptions of Teachers of Students with Visual Impairments (United States)

    Johnstone, Christopher; Thurlow, Martha; Altman, Jason; Timmons, Joe; Kato, Kentaro


    Assistive technology approaches to aid students with visual impairments are becoming commonplace in schools. These approaches, however, present challenges for assessment because students' level of access to different technologies may vary by school district and state. To better understand what assistive technology tools are used in reading…

  11. Validating the Technology Proficiency Self-Assessment Questionnaire for 21st Century Learning (TPSA C-21) (United States)

    Christensen, Rhonda; Knezek, Gerald


    Accurately measuring levels of technology proficiency in current and future classroom teachers are an important first step toward enhancing comfort level and confidence in integrating technology into the educational environment. The original Technology Proficiency Self-Assessment (TPSA) survey has maintained respectable psychometric properties for…

  12. Assessing security technology's impact: old tools for new problems. (United States)

    Kreissl, Reinhard


    The general idea developed in this paper from a sociological perspective is that some of the foundational categories on which the debate about privacy, security and technology rests are blurring. This process is a consequence of a blurring of physical and digital worlds. In order to define limits for legitimate use of intrusive digital technologies, one has to refer to binary distinctions such as private versus public, human versus technical, security versus insecurity to draw differences determining limits for the use of surveillance technologies. These distinctions developed in the physical world and are rooted in a cultural understanding of pre-digital culture. Attempts to capture the problems emerging with the implementation of security technologies using legal reasoning encounter a number of problems since law is by definition oriented backwards, adapting new developments to existing traditions, whereas the intrusion of new technologies in the physical world produces changes and creates fundamentally new problems.

  13. Global Assessment of Hydrogen Technologies - Task 1 Report Technology Evaluation of Hydrogen Light Duty Vehicles

    Energy Technology Data Exchange (ETDEWEB)

    Fouad, Fouad H.; Peters, Robert W.; Sisiopiku, Virginia P.; Sullivan Andrew J.; Rousseau, Aymeric


    This task analyzes the candidate hydrogen-fueled vehicles for near-term use in the Southeastern U.S. The purpose of this work is to assess their potential in terms of efficiency and performance. This report compares conventional, hybrid electric vehicles (HEV) with gasoline and hydrogen-fueled internal combustion engines (ICEs) as well as fuel cell and fuel cell hybrids from a technology as well as fuel economy point of view. All the vehicles have been simulated using the Powertrain System Analysis Toolkit (PSAT). First, some background information is provided on recent American automotive market trends and consequences. Moreover, available options are presented for introducing cleaner and more economical vehicles in the market in the future. In this study, analysis of various candidate hydrogen-fueled vehicles is performed using PSAT and, thus, a brief description of PSAT features and capabilities are provided. Detailed information on the simulation analysis performed is also offered, including methodology assumptions, fuel economic results, and conclusions from the findings.

  14. What Can You Learn in Three Minutes? Critical Reflection on an Assessment Task that Embeds Technology (United States)

    Brown, Natalie Ruth


    Purpose: The purpose of this paper is to critically examine an assessment task, undertaken by pre-service science teachers, that integrates the use of technology (in this case digital video-recorders and video-editing software) whilst scaffolding skill development. The embedding of technology into the assessment task is purposeful, aiming to…

  15. Vocal Sight-Reading Assessment: Technological Advances, Student Perceptions, and Instructional Implications (United States)

    Henry, Michele


    This study investigated choral singers' comfort level using computer technology for vocal sight-reading assessment. High school choral singers (N = 138) attending a summer music camp completed a computer-based sight-reading assessment and accompanying pre- and posttest surveys on their musical backgrounds and perceptions about technology. A large…

  16. Stop looking up the ladder: analyzing the impact of participatory technology assessment from a network perspective

    NARCIS (Netherlands)

    Loeber, A.; Griessler, E.; Versteeg, W.


    Alongside the gradual increase in use of participatory technology assessment (PTA), a tool to democratize decision-making on controversial technologies, a growing body of literature on how to assess the impact of PTA has developed. A distinction can be made between two generations of impact assessme

  17. Study design for concurrent development, assessment, and implementation of new diagnostic imaging technology

    NARCIS (Netherlands)

    M.G.M. Hunink (Myriam); G.P. Krestin (Gabriel)


    textabstractWith current constraints on health care resources and emphasis on value for money, new diagnostic imaging technologies must be assessed and their value demonstrated. The state of the art in the field of diagnostic imaging technology assessment advocates a hierarchical

  18. The Impact of the Technology Used in Formative Assessment: The Case of Spelling (United States)

    Vásquez, Andrea; Nussbaum, Miguel; Sciarresi, Enzo; Martínez, Tomás; Barahona, Camila; Strasser, Katherine


    This study demonstrates how the technology used to assist formative assessment in spelling can have an impact on learning. Formative assessment represents a set of student-centered practices, the results of which are not always optimal. Furthermore, different technologies are better suited to certain tasks than to others. The study follows a…

  19. The Impact of the Technology Used in Formative Assessment: The Case of Spelling (United States)

    Vásquez, Andrea; Nussbaum, Miguel; Sciarresi, Enzo; Martínez, Tomás; Barahona, Camila; Strasser, Katherine


    This study demonstrates how the technology used to assist formative assessment in spelling can have an impact on learning. Formative assessment represents a set of student-centered practices, the results of which are not always optimal. Furthermore, different technologies are better suited to certain tasks than to others. The study follows a…

  20. ECITE: A Testbed for Assessment of Technology Interoperability and Integration wiht Architecture Components (United States)

    Graves, S. J.; Keiser, K.; Law, E.; Yang, C. P.; Djorgovski, S. G.


    ECITE (EarthCube Integration and Testing Environment) is providing both cloud-based computational testing resources and an Assessment Framework for Technology Interoperability and Integration. NSF's EarthCube program is funding the development of cyberinfrastructure building block components as technologies to address Earth science research problems. These EarthCube building blocks need to support integration and interoperability objectives to work towards a coherent cyberinfrastructure architecture for the program. ECITE is being developed to provide capabilities to test and assess the interoperability and integration across funded EarthCube technology projects. EarthCube defined criteria for interoperability and integration are applied to use cases coordinating science problems with technology solutions. The Assessment Framework facilitates planning, execution and documentation of the technology assessments for review by the EarthCube community. This presentation will describe the components of ECITE and examine the methodology of cross walking between science and technology use cases.

  1. Bridges between science, society and policy technology assessment : methods and impacts

    CERN Document Server

    Ladikas, Miltos


    This book summarises the results of the project TAMI (Technology Assessment in Europe; between Method and Impact). This was a two-year project that brought together the main institutes of technology assessment in Europe, both parliamentary and non-parliamentary. TAMI created a structured dialogue between technology assessment experts and policymakers on current methodologies and their impact on policymaking. The TAMI team explored and assessed the whole spectrum of methodologies from the "classical" to the "interactive/participatory" and "communicative," identified good practices in project implementation and set the stage for impact evaluation based on objective criteria. Finally this report offers a series of policy recommendations based on the findings of the project. Science, Society and Policy, are three areas that technology assessment functions within and works for; this book is an attempt to improve the interaction amongst them for a more socially and economically sustainable Science and Technology p...

  2. Uncertainties related to the identification of the marginal energy technology in consequential life cycle assessments

    DEFF Research Database (Denmark)

    Mathiesen, B.V.; Münster, Marie; Fruergaard, Thilde


    When performing life cycle assessment (LCA) assumptions regarding the energy use are often decisive for the outcome. In this paper, current approaches of identifying marginal electricity and heat technologies for consequential LCAs are challenged. The identification of marginal energy technologies...... is examined from three angles: The marginal electricity technology is identified in Danish historical and potential future energy systems. The methods of identifying and using marginal electricity and heat technologies in key LCA studies are analysed. Finally, the differences in applying energy system...

  3. Assessing Expectations: Towards a Toolbox for an Ethics of Emerging Technologies. (United States)

    Lucivero, Federica; Swierstra, Tsjalling; Boenink, Marianne


    In recent years, several authors have argued that the desirability of novel technologies should be assessed early, when they are still emerging. Such an ethical assessment of emerging technologies is by definition focused on an elusive object. Usually promises, expectations, and visions of the technology are taken as a starting point. As Nordmann and Rip have pointed out in a recent article, however, ethicists should not take for granted the plausibility of such expectations and visions. In this paper, we explore how the quality of expectations on emerging technologies might be assessed when engaging in a reflection on the desirability of emerging technologies. We propose that an assessment of expectations' plausibility should focus on statements on technological feasibility, societal usability, and desirability of the expected technology. Whereas the feasibility statement and, to a lesser extent, the usability statements are frequently quite futuristic, the claims on desirability, by contrast, often display a conservative stance towards the future. Assessing the quality of expectations and visions on behalf of emerging technologies requires, then, a careful and well-directed use of both skepticism and imagination. We conclude with a brief overview of the tools and methods ethicists could use to assess claims made on behalf of emerging technologies and improve the ethical reflection on them.

  4. Some implications of the technology assessment function for the effective public decision-making process (United States)

    Mayo, L. H.


    A preliminary provisional assessment of the prospects for the establishment of an adequate technology assessment function and the implications of the assessment function for the public decision process are presented. Effects of the technology assessment function on each phase of the public decision process and briefly explored. Significant implications during the next decade are projected with respect to the following phases: invention and development of alternative means (technological configurations); evaluation, selection and promotion of preferred courses of action; and modification of statutory scheme or social action program as an outcome of continuing monitoring and appraisal.

  5. An Assessment of Petroleum Technology Development Fund (Ptdf ...

    African Journals Online (AJOL)

    Journal Home > Vol 5 (2008) > ... The importance of indigenous technological training and skill development in ... of providing scholarships, bursaries, training or education in petroleum in any of the higher institutions in Nigeria and abroad.

  6. Technology Assessment of Dust Suppression Techniques Applied During Structural Demolition

    Energy Technology Data Exchange (ETDEWEB)

    Boudreaux, J.F.; Ebadian, M.A.; Williams, P.T.; Dua, S.K.


    Hanford, Fernald, Savannah River, and other sites are currently reviewing technologies that can be implemented to demolish buildings in a cost-effective manner. In order to demolish a structure properly and, at the same time, minimize the amount of dust generated from a given technology, an evaluation must be conducted to choose the most appropriate dust suppression technology given site-specific conditions. Thus, the purpose of this research, which was carried out at the Hemispheric Center for Environmental Technology (HCET) at Florida International University, was to conduct an experimental study of dust aerosol abatement (dust suppression) methods as applied to nuclear D and D. This experimental study targeted the problem of dust suppression during the demolition of nuclear facilities. The resulting data were employed to assist in the development of mathematical correlations that can be applied to predict dust generation during structural demolition.

  7. Red Team Operations to Assess Information Technology Vulnerabilities

    NARCIS (Netherlands)

    Veltman, M.; Parker, R.L.


    All Information and Communication Technology (ICT) systems have vulnerabilities. Weaknesses in these systems are introduced either during the specification, implementation or operational phase. Leaving aside these introduced vulnerabilities are intentional or unintentional, the fact remains that the

  8. Technology Needs Assessment in the Home Garden Systems

    Directory of Open Access Journals (Sweden)

    Allan Thomas


    Full Text Available The study was conducted in the four districts of Kerala covering a sample size of 208 homegardens using multi-stage stratified random sampling technique representing the three major agro climatic zones viz. lowland (problem zone, highland and midland. The primary objective of the study was to identify the technology needs of the homegarden farmers. Maximum technology need was reported for unexploited and under exploited horticultural tree crops which was on par with fruit tree crops (mango and jack and followed by beverage crops. Processing, value addition and storage requirements were immediate technology needs of the homegarden farmers. Drainage and soil amendment technologies were reported to be important for Alappuzha homegarden farmers.

  9. Prediction technologies for assessment of climate change impacts (United States)

    Temperatures, precipitation, and weather patterns are changing, in response to increasing carbon dioxide in the atmosphere. With these relatively rapid changes, existing soil erosion prediction technologies that rely upon climate stationarity are potentially becoming less reliable. This is especiall...


    Sustainable technology is driven by economic competitiveness, government policies and public pressure. The claim of inherent cleanliness for biotechnology is too simplistic. Each application of biotechnology must be evaluated for suitable characteristics of sustainability. The ...

  11. A Conceptual Decision Methodology for High Technology Transfer Assessment. (United States)


    review and provide input within given time periods on selected technologies. The basic industrial export control mechanism continues to be centered in...Department of Commerce is the center of the export control system, it is by no means predominate in the control of all exports. True, it is a key...Department of State endorsed the venture as, "in the national interest." The technology was promised during the Nixon- Pompidou Summit in the Azores. Without

  12. NASA Langley Systems Analysis & Concepts Directorate Technology Assessment/Portfolio Analysis (United States)

    Cavanaugh, Stephen; Chytka, Trina; Arcara, Phil; Jones, Sharon; Stanley, Doug; Wilhite, Alan W.


    Systems analysis develops and documents candidate mission and architectures, associated system concepts, enabling capabilities and investment strategies to achieve NASA s strategic objectives. The technology assessment process connects the mission and architectures to the investment strategies. In order to successfully implement a technology assessment, there is a need to collect, manipulate, analyze, document, and disseminate technology-related information. Information must be collected and organized on the wide variety of potentially applicable technologies, including: previous research results, key technical parameters and characteristics, technology readiness levels, relationships to other technologies, costs, and potential barriers and risks. This information must be manipulated to facilitate planning and documentation. An assessment is included of the programmatic and technical risks associated with each technology task as well as potential risk mitigation plans. Risks are assessed and tracked in terms of likelihood of the risk occurring and consequences of the risk if it does occur. The risk assessments take into account cost, schedule, and technical risk dimensions. Assessment data must be simplified for presentation to decision makers. The Systems Analysis and Concepts Directorate (SACD) at NASA Langley Research Center has a wealth of experience in performing Technology Assessment and Portfolio Analysis as this has been a business line since 1978.

  13. Assessment of Technologies for Noncryogenic Hybrid Electric Propulsion (United States)

    Dever, Timothy P.; Duffy, Kirsten P.; Provenza, Andrew J.; Loyselle, Patricia L.; Choi, Benjamin B.; Morrison, Carlos R.; Lowe, Angela M.


    The Subsonic Fixed Wing Project of NASA's Fundamental Aeronautics Program is researching aircraft propulsion technologies that will lower noise, emissions, and fuel burn. One promising technology is noncryogenic electric propulsion, which could be either hybrid electric propulsion or turboelectric propulsion. Reducing dependence on the turbine engine would certainly reduce emissions. However, the weight of the electricmotor- related components that would have to be added would adversely impact the benefits of the smaller turbine engine. Therefore, research needs to be done to improve component efficiencies and reduce component weights. This study projects technology improvements expected in the next 15 and 30 years, including motor-related technologies, power electronics, and energy-storage-related technologies. Motor efficiency and power density could be increased through the use of better conductors, insulators, magnets, bearings, structural materials, and thermal management. Energy storage could be accomplished through batteries, flywheels, or supercapacitors, all of which expect significant energy density growth over the next few decades. A first-order approximation of the cumulative effect of each technology improvement shows that motor power density could be improved from 3 hp/lb, the state of the art, to 8 hp/lb in 15 years and 16 hp/lb in 30 years.

  14. Development of the public information and communication technology assessment tool. (United States)

    Ripat, Jacquie; Watzke, James; Birch, Gary


    Public information and communication technologies, such as information kiosks, automated banking machines and ticket dispensers, allow people to access services in a convenient and timely manner. However, the development of these technologies has occurred largely without consideration of access by people with disabilities. Inaccessible technical features make operation of a public technology difficult and barriers in the environment create navigational challenges, limiting the opportunity of people with disabilities to use these devices and access the services they provide. This paper describes the development of a tool that individuals, disability advocacy groups, business owners, healthcare providers, and urban planners can use to evaluate the accessibility of public technologies and the surrounding environment. Evaluation results can then be used to develop recommendations and advocate for technical and environmental changes to improve access. Tool development consisted of a review of the literature and key Canadian Standards Association documents, task analysis, and consultation with accessibility experts. Studies of content validity, tool usability, inter-rater and test-retest reliability were conducted in sites across Canada. Accessibility experts verified the content validity of the tool. The current version of the tool has incorporated the findings of a usability study. Initial testing indicated excellent agreement for inter-rater and test-retest reliability scores. Social exclusion can arise when public technologies are not accessible. This newly developed instrument provides detailed information that can be used to advocate for more accessible and inclusive public information and communication technologies.

  15. A model for technology assessment and commercialization for innovative disruptive technologies

    Energy Technology Data Exchange (ETDEWEB)



    Disruptive technologies are scientific discoveries that break through the usual product technology capabilities and provide a basis for a new competitive paradigm as described by Anderson and Tushman [1990], Tushman and Rosenkopf [1992], and Bower and Christensen [1995]. Discontinuous innovations are products/processes/services that provide exponential improvements in the value received by the customer much in the same vein as Walsh [1996], Lynn, Morone and Paulson [1996], and Veryzer [1998]. For more on definitions of disruptive technologies and discontinuous innovations, see Walsh and Linton [1999] who provide a number of definitions for disruptive technologies and discontinuous innovations. Disruptive technologies and discontinuous innovations present a unique challenge and opportunity for R and D organizations seeking to build their commercialization efforts and to reinvent the corporation. These technologies do not have a proven path from scientific discovery to mass production and therefore require novel approaches. These critically important technologies are the wellspring of wealth creation and new competency generation but are not readily accepted by the corporate community. They are alternatively embraced and eschewed by the commercial community. They are finally accepted when the technology has already affected the industry or when the technological horse has already flown out of the hanger. Many firms, especially larger firms, seem reluctant to familiarize themselves with these technologies quickly. The trend seems to be that these firms prefer to react to a proven disruptive technology that has changed the product market paradigm. If true, then there is cause for concern. This paper will review the literature on disruptive technologies presenting a model of the progression from scientific idea to mass production for disruptive technologies contrasted to the more copious incremental technologies. The paper will then describe Sandia National Laboratories

  16. The Contribution of Health Technology Assessment, Health Needs Assessment, and Health Impact Assessment to the Assessment and Translation of Technologies in the Field of Public Health Genomics

    NARCIS (Netherlands)

    Rosenköttera, N.; Vondeling, H.; Blancquaert, I.; Mekel, O.C.L.; Kristensen, F.B.; Brand, A.


    The European Union has named genomics as one of the promising research fields for the development of new health technologies. Major concerns with regard to these fields are, on the one hand, the rather slow and limited translation of new knowledge and, on the other hand, missing insights into the im

  17. Emergent technologies against the background of everyday life: Discursive psychology as a technology assessment tool

    NARCIS (Netherlands)

    Veen, M.; Gremmen, H.G.J.; Molder, te H.F.M.; Woerkum, van C.M.J.


    To understand prospective users’ reactions to emergent technologies, it is crucial to examine the interactional contexts within which these reactions take place as people’s reactions are shaped by issues that are not necessarily related to science or technology. These issues are often overshadowed

  18. Emergent technologies against the background of everyday life: Discursive psychology as a technology assessment tool.

    NARCIS (Netherlands)

    van der Veen, M.; Gremmen, B.; te Molder, Hedwig Frederica Maria; van Woerkum, C.


    To understand prospective users’ reactions to emergent technologies, it is crucial to examine the interactional contexts within which these reactions take place as people’s reactions are shaped by issues that are not necessarily related to science or technology. These issues are often overshadowed

  19. Nanostructured Ti-Ta thin films synthesized by combinatorial glancing angle sputter deposition. (United States)

    Motemani, Yahya; Khare, Chinmay; Savan, Alan; Hans, Michael; Paulsen, Alexander; Frenzel, Jan; Somsen, Christoph; Mücklich, Frank; Eggeler, Gunther; Ludwig, Alfred


    -patterning and a combinatorial materials library fabrication strategy offer a promising technological approach for investigating Ti-Ta thin films for a range of applications. The proposed approaches can be similarly implemented for other materials systems which can benefit from the formation of a nanocolumnar morphology.

  20. Nanostructured Ti-Ta thin films synthesized by combinatorial glancing angle sputter deposition (United States)

    Motemani, Yahya; Khare, Chinmay; Savan, Alan; Hans, Michael; Paulsen, Alexander; Frenzel, Jan; Somsen, Christoph; Mücklich, Frank; Eggeler, Gunther; Ludwig, Alfred


    combinatorial materials library fabrication strategy offer a promising technological approach for investigating Ti-Ta thin films for a range of applications. The proposed approaches can be similarly implemented for other materials systems which can benefit from the formation of a nanocolumnar morphology.

  1. Assessing nano cellulose developments using science and technology indicators

    Energy Technology Data Exchange (ETDEWEB)

    Milanez, Douglas Henrique; Amaral, Roniberto Morato do; Faria, Leandro Innocentini Lopes de; Gregolin, Jose Angelo Rodrigues, E-mail: [Universidade Federal de Sao Carlos (UFSCar), SP (Brazil). Nucleo de Informacao Tecnologica em Materiais. Dept. de Engenharia de Materiais


    This research aims to examine scientific and technological trends of developments in nano cellulose based on scientometric and patent indicators obtained from the Science Citation Index and Derwent Innovations Index in 2001-2010. The overall nano cellulose activity indicators were compared to nanotechnology and other selected nano materials. Scientific and technological future developments in nano cellulose were forecasted using extrapolation growth curves and the main countries were also mapped. The results showed that nano cellulose publications and patent documents have increased rapidly over the last five years with an average growth rate higher than that of nanotechnology and fullerene. The USA, Japan, France, Sweden and Finland all played a significant role in nano cellulose development and the extrapolation growth curves suggested that nano cellulose scientific and technological activities are still emerging. Finally, the evidence from this study recommends monitoring nano cellulose S and T advances in the coming years. (author)

  2. Assessing nanocellulose developments using science and technology indicators

    Directory of Open Access Journals (Sweden)

    Douglas Henrique Milanez


    Full Text Available This research aims to examine scientific and technological trends of developments in nanocellulose based on scientometric and patent indicators obtained from the Science Citation Index and Derwent Innovations Index in 2001-2010. The overall nanocellulose activity indicators were compared to nanotechnology and other selected nanomaterials. Scientific and technological future developments in nanocellulose were forecasted using extrapolation growth curves and the main countries were also mapped. The results showed that nanocellulose publications and patent documents have increased rapidly over the last five years with an average growth rate higher than that of nanotechnology and fullerene. The USA, Japan, France, Sweden and Finland all played a significant role in nanocellulose development and the extrapolation growth curves suggested that nanocellulose scientific and technological activities are still emerging. Finally, the evidence from this study recommends monitoring nanocellulose S&T advances in the coming years.

  3. Assessing Rare Metal Availability Challenges for Solar Energy Technologies

    Directory of Open Access Journals (Sweden)

    Leena Grandell


    Full Text Available Solar energy is commonly seen as a future energy source with significant potential. Ruthenium, gallium, indium and several other rare elements are common and vital components of many solar energy technologies, including dye-sensitized solar cells, CIGS cells and various artificial photosynthesis approaches. This study surveys solar energy technologies and their reliance on rare metals such as indium, gallium, and ruthenium. Several of these rare materials do not occur as primary ores, and are found as byproducts associated with primary base metal ores. This will have an impact on future production trends and the availability for various applications. In addition, the geological reserves of many vital metals are scarce and severely limit the potential of certain solar energy technologies. It is the conclusion of this study that certain solar energy concepts are unrealistic in terms of achieving TW scales.

  4. RECOVERY ACT - Methods for Decision under Technological Change Uncertainty and Risk Assessment for Integrated Assessment of Climate Change

    Energy Technology Data Exchange (ETDEWEB)

    Webster, Mort D. [Pennsylvania State Univ., University Park, PA (United States). Dept. of Energy and Mineral Engineering


    This report presents the final outcomes and products of the project as performed both at the Massachusetts Institute of Technology and subsequently at Pennsylvania State University. The research project can be divided into three main components: methodology development for decision-making under uncertainty, improving the resolution of the electricity sector to improve integrated assessment, and application of these methods to integrated assessment.

  5. RECOVERY ACT - Methods for Decision under Technological Change Uncertainty and Risk Assessment for Integrated Assessment of Climate Change

    Energy Technology Data Exchange (ETDEWEB)

    Webster, Mort David [MIT


    This report presents the final outcomes and products of the project as performed at the Massachusetts Institute of Technology. The research project consists of three main components: methodology development for decision-making under uncertainty, improving the resolution of the electricity sector to improve integrated assessment, and application of these methods to integrated assessment. Results in each area is described in the report.

  6. Developing an instrument for assessing students' concepts of the nature of technology (United States)

    Liou, Pey-Yan


    Background:The nature of technology has been rarely discussed despite the fact that technology plays an essential role in modern society. It is important to discuss students' concepts of the nature of technology, and further to advance their technological literacy and adaptation to modern society. There is a need to assess high school students' concepts of the nature of technology. Purpose:This study aims to engage in discourse on students' concepts of the nature of technology based on a proposed theoretical framework. Moreover, another goal is to develop an instrument for measuring students' concepts of the nature of technology. Sample:Four hundred and fifty-five high school students' perceptions of technology were qualitatively analyzed. Furthermore, 530 students' responses to a newly developed questionnaire were quantitatively analyzed in the final test. Design and method:First, content analysis was utilized to discuss and categorize students' statements regarding technology and its related issues. The Student Concepts of the Nature of Technology Questionnaire was developed based on the proposed theoretical framework and was supported by the students' qualitative data. Finally, exploratory factor analysis and reliability analysis were applied to determine the structure of the items and the internal consistency of each scale. Results:Through a process of instrument development, the Student Concepts of the Nature of Technology Questionnaire was shown to be a valid and reliable tool for measuring students' concepts of the nature of technology. This newly developed questionnaire is composed of 29 items in six scales, namely 'technology as artifacts,' 'technology as an innovation change,' 'the current role of technology in society,' 'technology as a double-edged sword,' 'technology as a science-based form,' and 'history of technology.' Conclusions:The Student Concepts of the Nature of Technology Questionnaire has been confirmed as a reasonably valid and reliable

  7. Anisotropic properties of TaS2

    Institute of Scientific and Technical Information of China (English)

    Qiao Yan-Bin; Li Yan-Ling; Zhong Guo-Hua; Zeng Zhi; Qin Xiao-Ying


    The anisotropic properties of 1T- and 2H-TaS2 are investigated by the density functional theory within the framework of full-potential linearized augmented plane wave method. The band structures of 1T- and 2H-TaS2 exhibit anisotropic properties and the calculated electronic specific-heat coefficient γ of 2H-TaS2 accords well with the existing experimental value. The anisotropic frequency-dependent dielectric functions including the effect of the Drude term are analysed, where the εxx(ω) spectra corresponding to the electric field E perpendicular to the z axis show excellent agreement with the measured results except for the ε1xx(ω) of 1T-TaS2 below the energy level of 2.6 eV which is due to the lack of the enough CDW information for reference in our calculation. Furthermore, based on the values of optical effective mass ratio P of 1T and 2H phases it is found that the anisotropy in 2H-TaS2 is stronger than that in 1T-TaS2.

  8. Connected Classroom Technology Facilitates Multiple Components of Formative Assessment Practice (United States)

    Shirley, Melissa L.; Irving, Karen E.


    Formative assessment has been demonstrated to result in increased student achievement across a variety of educational contexts. When using formative assessment strategies, teachers engage students in instructional tasks that allow the teacher to uncover levels of student understanding so that the teacher may change instruction accordingly. Tools…

  9. Objective assessment of speech and audio quality - Technology and applications

    NARCIS (Netherlands)

    Rix, A.W.; Beerends, J.G.; Kim, D.-S.; Kroon, P.; Ghitza, O.


    In the past few years, objective quality assessment models have become increasingly used for assessing or monitoring speech and audio quality. By measuring perceived quality on an easily-understood subjective scale, such as listening quality (excellent, good, fair, poor, bad), these methods provide

  10. Improving Formative Assessment Practice with Educational Information Technology

    Directory of Open Access Journals (Sweden)

    Terry Vendlinski


    Full Text Available This paper describes a web-based assessment design tool, the ADDS, that provides teachers both a structure and the resources required to develop and use quality assessments. The tool is applicable across subject domains. The heart of the ADDS is an assessment design workspace that allows teachers to decide the attributes of an assessment, as well as the context and type of responses the students will generate, as part of their assessment design process. While the tool is very flexible and allows the above steps to be done in any order (or skipped entirely, our goal was to streamline and scaffold the process for teachers by organizing all the materials for them in one place and to provide resources they could use or reuse to create assessments for their students. The tool allows teachers to deliver the assessments to their students either online or on paper. Initial results from our first teacher study suggest that teachers who used the tool developed assessments that were more cognitively demanding of students and addressed the "big ideas" rather than disassociated facts of a domain.

  11. Environmental Decision Making and Information Technology: Issues Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Barg, S.; Fletcher, T.; Mechling, J.; Tonn, B.; Turner, R.


    This report presents a summary of the Information Technology and Environmental Decision Making Workshop that was held at Harvard University, October 1-3, 1998. Over sixty participants from across the US took part in discussions that focused on the current practice of using information technology to support environmental decision making and on future considerations of information technology development, information policies, and data quality issues in this area. Current practice is focusing on geographic information systems and visualization tools, Internet applications, and data warehousing. In addition, numerous organizations are developing environmental enterprise systems to integrate environmental information resources. Plaguing these efforts are issues of data quality (and public trust), system design, and organizational change. In the future, much effort needs to focus on building community-based environmental decision-making systems and processes, which will be a challenge given that exactly what needs to be developed is largely unknown and that environmental decision making in this arena has been characterized by a high level of conflict. Experimentation and evaluation are needed to contribute to efficient and effective learning about how best to use information technology to improve environmental decision making.

  12. Assessing the Gap: The MBA and Information Technology Management Knowledge (United States)

    Murphy, John B.


    One of the most prevalent themes for managers in nearly all industries is the impact of Information Technology on the organization's value chain. Direct and indirect IT costs comprise a significant portion of operating expenses for most businesses and constitute an estimated 50% of all capital expenditures. Understanding whether and to what…

  13. Attitude Assessment in Science and Technology. Occasional Paper. (United States)

    Page, R. L.; And Others

    This paper, intended as an introduction to attitude scale construction, outlines the theory behind attitude measurement and describes the Thurstone and Likert methods of attitude scale construction. The methodology is illustrated with examples from the construction of a scale the authors developed to measure attitudes to technology and industry.…

  14. Future of health technology assessment studies in gene and cell ...

    African Journals Online (AJOL)



    Jul 18, 2007 ... The application of new knowledge and technological change is a key driver of the achievements in policy decisions in health ... extension of human life, reduction of pain, disease risk .... of uncertainty, (ii) the transferring of results of evaluations between .... up R&D companies are benefitting especially at the.

  15. Wood products biomass gasification: technological and economic assessment

    Energy Technology Data Exchange (ETDEWEB)

    Bonino, G.; Scarzella, L.

    In this paper, a design lay-out is presented for the gasification of wood products biomass. Regarding this alternative energy form, the paper discusses historical aspects and recent technological developments made by Italian industry. The design, construction, performance, efficiency, present and future applications of a twin-feeding system are described.

  16. An Assessment of Advanced Manufacturing Technologies Implementation in Manufacturing Enterprises

    Directory of Open Access Journals (Sweden)

    Ghulam Yasin Shaikh


    Full Text Available The implementation of AMTs (Advanced Manufacturing Technologies has always been the high interest and core issue for the manufacturing enterprises to get rapid production for global market place. The developed countries have achieved its competitive advantage by implementing this unique model of technologies with full range of systems. In developing countries, the implementation of such technologies is not much common due to so many reasons, (political, social, economical and technical but entrepreneurs of growing economies are contemplating to reshape long term strategy to adopt Computer systems oriented technologies in their manufacturing companies to meet the growing needs of their indigenous market on one hand and to make a place in the international market on the other. Although, very few manufacturing organization do meet the global market requirements. But there is still lot of efforts to be taken for world class competition. An attempt has been made in this paper to develop a conceptual model taking in to account the three parameters such as, Direct, Indirect and Administrative AMTs. This research work further attempts to present an empirical data analysis conducted in the manufacturing enterprises in province of Sindh, Pakistan. The overall indigenous progress of manufacturing enterprises as according to the data collected from 60 companies reveals that the AMTs systems are partially understood and practiced that is also one of the cause towards slow progress of national exchequer.

  17. Assessing Space Exploration Technology Requirements as a First Step Towards Ensuring Technology Readiness for International Cooperation in Space Exploration (United States)

    Laurini, Kathleen C.; Hufenbach, Bernhard; Satoh, Maoki; Piedboeuf, Jean-Claude; Neumann, Benjamin


    Advancing critical and enhancing technologies is considered essential to enabling sustainable and affordable human space exploration. Critical technologies are those that enable a certain class of mission, such as technologies necessary for safe landing on the Martian surface, advanced propulsion, and closed loop life support. Others enhance the mission by leading to a greater satisfaction of mission objectives or increased probability of mission success. Advanced technologies are needed to reduce mass and cost. Many space agencies have studied exploration mission architectures and scenarios with the resulting lists of critical and enhancing technologies being very similar. With this in mind, and with the recognition that human space exploration will only be enabled by agencies working together to address these challenges, interested agencies participating in the International Space Exploration Coordination Group (ISECG) have agreed to perform a technology assessment as an important step in exploring cooperation opportunities for future exploration mission scenarios. "The Global Exploration Strategy: The Framework for Coordination" was developed by fourteen space agencies and released in May 2007. Since the fall of 2008, several International Space Exploration Coordination Group (ISECG) participating space agencies have been studying concepts for human exploration of the moon. They have identified technologies considered critical and enhancing of sustainable space exploration. Technologies such as in-situ resource utilization, advanced power generation/energy storage systems, reliable dust resistant mobility systems, and closed loop life support systems are important examples. Similarly, agencies such as NASA, ESA, and Russia have studied Mars exploration missions and identified critical technologies. They recognize that human and robotic precursor missions to destinations such as LEO, moon, and near earth objects provide opportunities to demonstrate the

  18. Assessing Space Exploration Technology Requirements as a First Step Towards Ensuring Technology Readiness for International Cooperation in Space Exploration (United States)

    Laurini, Kathleen C.; Hufenbach, Bernhard; Satoh, Maoki; Piedboeuf, Jean-Claude; Neumann, Benjamin


    Advancing critical and enhancing technologies is considered essential to enabling sustainable and affordable human space exploration. Critical technologies are those that enable a certain class of mission, such as technologies necessary for safe landing on the Martian surface, advanced propulsion, and closed loop life support. Others enhance the mission by leading to a greater satisfaction of mission objectives or increased probability of mission success. Advanced technologies are needed to reduce mass and cost. Many space agencies have studied exploration mission architectures and scenarios with the resulting lists of critical and enhancing technologies being very similar. With this in mind, and with the recognition that human space exploration will only be enabled by agencies working together to address these challenges, interested agencies participating in the International Space Exploration Coordination Group (ISECG) have agreed to perform a technology assessment as an important step in exploring cooperation opportunities for future exploration mission scenarios. "The Global Exploration Strategy: The Framework for Coordination" was developed by fourteen space agencies and released in May 2007. Since the fall of 2008, several International Space Exploration Coordination Group (ISECG) participating space agencies have been studying concepts for human exploration of the moon. They have identified technologies considered critical and enhancing of sustainable space exploration. Technologies such as in-situ resource utilization, advanced power generation/energy storage systems, reliable dust resistant mobility systems, and closed loop life support systems are important examples. Similarly, agencies such as NASA, ESA, and Russia have studied Mars exploration missions and identified critical technologies. They recognize that human and robotic precursor missions to destinations such as LEO, moon, and near earth objects provide opportunities to demonstrate the

  19. The Development of Technology for Higher Education Institution's Administrative Personnel Assessment (United States)

    Bakhtina, Olga Yurevna; Kirillov, Andrey Vladimirovich; Matyash, Sergey Askoldovich; Urzha, Olga Aleksandrovna


    The main approaches for development of assessment technology of higher education institution's administrative personnel are considered in this article. Alongside with it the following is defined: purposes, formation principles, indicators and criteria of the assessment system, rating scale, the procedure and order of assessment process of higher…

  20. Vehicle Technologies and Fuel Cell Technologies Program: Prospective Benefits Assessment Report for Fiscal Year 2016

    Energy Technology Data Exchange (ETDEWEB)

    Stephens, T. S. [Argonne National Lab. (ANL), Argonne, IL (United States); Taylor, C. H. [TA Engineering, Inc., Catonsville, MD (United States); Moore, J. S. [TA Engineering, Inc., Catonsville, MD (United States); Ward, J. [United States Department of Energy, Washington, DC (United States). Office of Energy Efficiency and Renewable Energy


    Under a diverse set of programs, the Vehicle Technologies and Fuel Cell Technologies offices of DOE’s Office of Energy Efficiency and Renewable Energy invest in research, development, demonstration, and deployment of advanced vehicle, hydrogen production, delivery and storage, and fuel cell technologies. This report estimates the benefits of successfully developing and deploying these technologies (a “Program Success” case) relative to a base case (the “No Program” case). The Program Success case represents the future with completely successful deployment of Vehicle Technologies Office (VTO) and Fuel Cell Technologies Office (FCTO) technologies. The No Program case represents a future in which there is no contribution after FY 2016 by the VTO or FCTO to these technologies. The benefits of advanced vehicle, hydrogen production, delivery and storage, and fuel cell technologies were estimated on the basis of differences in fuel use, primary energy use, and greenhouse gas (GHG) emissions from light-, medium- and heavy-duty vehicles, including energy and emissions from fuel production, between the base case and the Program Success case. Improvements in fuel economy of various vehicle types, growth in the stock of fuel cell vehicles and other advanced technology vehicles, and decreased GHG intensity of hydrogen production and delivery in the Program Success case over the No Program case were projected to result in savings in petroleum use and GHG emissions. Benefits were disaggregated by individual program technology areas, which included the FCTO program and the VTO subprograms of batteries and electric drives; advanced combustion engines; fuels and lubricants; materials (for reduction in vehicle mass, or “lightweighting”); and, for medium- and heavy-duty vehicles, reduction in rolling and aerodynamic resistance. Projections for the Program Success case indicate that by 2035, the average fuel economy of on-road, light-duty vehicle stock could be 47% to 76

  1. Use of comparative assessment framework for comparison of geological nuclear waste and CO2 disposal technologies

    Energy Technology Data Exchange (ETDEWEB)

    Streimikiene, Dalia


    Comparative assessment of few future energy and climate change mitigation options for Lithuania in 2020 performed indicated that nuclear and combined cycle gas turbine technologies are very similar energy options in terms of costs taking into account GHG emission reduction costs. Comparative assessment of these energy options requires evaluation of the potentials and costs for geological CO2 and nuclear waste storage as the main uncertainties in comparative assessment of electricity generation technologies are related with these back-end technologies. The paper analyses the main characteristics of possible geological storage of CO2 and NW options in Lithuania.

  2. How to make participatory technology assessment in agriculture more 'participatory'

    DEFF Research Database (Denmark)

    Tavella, Elena


    This paper suggests a framework, based on Critical Systems Heuristics (CSH), to guide the organisation and management of expert-facilitated and participatory processes that allow for stakeholders' different interests, concerns, and values to be included in the assessment and policy making of GM...... plants. The framework is particularly useful for stakeholders, such as governments, foundations, and researchers, who attempt to facilitate inclusive and democratic processes to assess GM plants. The use of the framework is illustrated by evaluating the report from a citizen jury carried out to assess...

  3. Emergent technologies against the background of everyday life: discursive psychology as a technology assessment tool. (United States)

    Veen, M; Gremmen, B; te Molder, H; van Woerkum, C


    To understand prospective users' reactions to emergent technologies, it is crucial to examine the interactional contexts within which these reactions take place as people's reactions are shaped by issues that are not necessarily related to science or technology. These issues are often overshadowed or remain blind spots when descriptions or scenarios of proposed technologies are thematized as being the core objects of reference. We therefore recommend also studying prospective users' everyday-life practices in their own right, and in naturalistic settings. Insight into the social actions people accomplish in their everyday talk, such as establishing a particular identity, can help innovators translate prospective users' concerns into relevant technology characteristics. We propose discursive psychology as an analytic tool to do this and show its merit with a few illustrative examples.

  4. STAR 21, Technology Forecast Assessments. Strategic Technologies for the Army of the Twenty-First Century (United States)


    technology, power conditioning includes prime power from homopolar generators, compulsators , and alternators combined with capacitors, batteries, and pulse...positions where they cease to make design contributions. Working relationships with suppliers are changing from strictly buyer /seller to partnerships

  5. Assessment of control technology for stationary sources. Volume II: control technology data tables. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Minicucci, D.; Herther, M.; Babb, L.; Kuby, W.


    This report, the Control Technology Data Tables, is the second volume of the three-volume final report for the contract. It presents in tabular format, qualitative descriptions of control options for the various sources and quantitative information on control technology cost, efficiency, reliability, energy consumption, other environmental impacts and application status. Also included is a code list which classifies the stationary sources examined by industry, process, and emission source.

  6. Assessing the Applicability of 3D Holographic Technology as an Enhanced Technology for Distance Learning

    Directory of Open Access Journals (Sweden)

    Pradeep Kalansooriya


    Full Text Available Distance learning has provided an excellent platform for students in geographically remote locations while enabling them to learn at their own pace and convenience. A number of technologies are currently being utilized to conceptualize, design, enhance and foster distance learning. Teleconferences, electronic field trips, podcasts, webinars, video conferencing and online courses are among such technologies used in providing distance learning opportunities. However limitations in those existing technologies have affected to the increase of distance learners dropout rates. As an attempt to overcome the limitations in the currently adopted distance learning practices, the study aims to utilize 3D Hologram Technology (3DHT in the Engineering discipline. 3D hologram facilitates live and life size 3D telepresence that can interact with remote audiences. A survey had been conducted, using Delphi Technique to gather data from the experts in the field to evaluate the potential of 3DHT over existing technologies. Results of the survey suggested that 3DHT as a good distance learning technology and have the potential of overcoming existing limitations. Lack of infrastructure, High initial cost of infrastructure and Lack of technical know how are the main encounters identified by the experts in the sample. It is expected to develop a classroom environment with 3DHT and to evaluate its effectiveness for the distance learning in the next stage of the study.

  7. The Effect of Government Actions on Environmental Technology Innovation: Applications to the Integrated Assessment of Carbon Sequestration Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Rubin, E. S.; Hounshell, D. A.; Yeh, S.; Taylor, M.; Schrattenholzer, L.; Riahi, K.; Barreto, L.; Rao, S.


    This project seeks to improve the ability of integrated assessment models (IA) to incorporate changes in technology, especially environmental technologies, cost and performance over time. In this report, we present results of research that examines past experience in controlling other major power plant emissions that might serve as a reasonable guide to future rates of technological progress in carbon capture and sequestration (CCS) systems. In particular, we focus on U.S. and worldwide experience with sulfur dioxide (SO{sub 2}) and nitrogen oxide (NO{sub x}) control technologies over the past 30 years, and derive empirical learning rates for these technologies. The patterns of technology innovation are captured by our analysis of patent activities and trends of cost reduction over time. Overall, we found learning rates of 11% for the capital costs of flue gas desulfurization (FGD) system for SO{sub 2} control, and 13% for selective catalytic reduction (SCR) systems for NO{sub x} control. We explore the key factors responsible for the observed trends, especially the development of regulatory policies for SO{sub 2} and NO{sub x} control, and their implications for environmental control technology innovation.

  8. GIS Technology: Resource and Habitability Assessment Tool Project (United States)

    National Aeronautics and Space Administration — This is a one-year project to apply a GIS analysis tool to new orbital data for lunar resource assessment and martian habitability identification.  We used...

  9. Technologically-advanced assessment of upper-limb spasticity

    DEFF Research Database (Denmark)

    Posteraro, Federico; Crea, Simona; Mazzoleni, Stefano


    post stroke patients. METHODS: A new robotic device able to automatically assess upper-limb spasticity during passive and active mobilization has been developed. The elbow spasticity of five post stroke patients has been assessed by using the new device and by means of the Modified Ashworth Scale (MAS......BACKGROUND: Spasticity is a muscle disorder associated with upper motor neuron syndrome occurring in neurological disorders, such as stroke, multiple sclerosis, spinal cord injury and others. It influences the patient's rehabilitation, interfering with function, limiting independence, causing pain......). After the first assessment, subjects were treated with botulin toxin injections, and then underwent 10 sessions of robotic treatments. After the treatment, subjects spasticity was assessed by using the robotic device and the MAS score. RESULTS: In four out of five patients, the botulin toxin injection...

  10. An assessment of nondestructive testing technologies for chemical weapons monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, T.T.


    The US Department of Energy (DOE), with the US Army Chemical Research, Development and Engineering Center (CRDEC) under the sponsorship of the Defense Nuclear Agency (DNA), completed testing of Nondestructive Evaluation (NDE) technology on live agent systems. The tests were conducted at Tooele Army Depot during August 1992. The Nondestructive Evaluation systems were tested for potential use in verifying chemical treaty requirements. Five technologies, two neutron and three acoustic, were developed at DOE laboratories. Two systems from the United Kingdom (one neutron and one acoustic) were also included in the field trials. All systems tested showed the ability to distinguish among the VX, GB, and Mustard. Three of the systems (two acoustic and one neutron) were used by On-Site Inspection Agency (OSIA) personnel.

  11. Technology-driven dietary assessment: a software developer's perspective. (United States)

    Buday, R; Tapia, R; Maze, G R


    Dietary researchers need new software to improve nutrition data collection and analysis, although the creation of information technology is difficult. Software development projects may be unsuccessful as a result of an inadequate understanding of needs, management problems, technology barriers or legal hurdles. Cost over-runs and schedule delays are common. Barriers facing scientific researchers developing software include workflow, cost, schedule and team issues. Different methods of software development and the role that intellectual property rights play are discussed. A dietary researcher must carefully consider multiple issues to maximise the likelihood of success when creating new software. © 2012 The Authors. Journal of Human Nutrition and Dietetics © 2012 The British Dietetic Association Ltd.

  12. Technology Assessment for Large Vertical-Lift Transport Tiltrotors (United States)

    Germanowski, Peter J.; Stille, Brandon L.; Strauss, Michael P.


    The technical community has identified rotor efficiency as a critical enabling technology for large vertical-lift transport (LVLT) rotorcraft. The size and performance of LVLT aircraft will be far beyond current aircraft capabilities, enabling a transformational change in cargo transport effectiveness. Two candidate approaches for achieving high efficiency were considered for LVLT applications: a variable-diameter tiltrotor (VDTR) and a variable-speed tiltrotor (VSTR); the former utilizes variable-rotor geometry and the latter utilizes variable-rotor speed. Conceptual aircraft designs were synthesized for the VDTR and VSTR and compared to a conventional tiltrotor (CTR). The aircraft were optimized to a common objective function and bounded by a set of physical- and requirements-driven constraints. The resulting aircraft were compared for weight, size, performance, handling qualities, and other attributes. These comparisons established a measure of the relative merits of the variable-diameter and -speed rotor systems as enabling technologies for LVLT capability.

  13. Characterization and wear properties of nanoscaled TiN/TaN multilayer coatings

    Institute of Scientific and Technical Information of China (English)

    AN Jian; ZHANG Qing-yu


    The structural, morphological, mechanical and tribological characterization of nanoscaled multilayer TiN/TaN coatings deposited by magnetron sputtering technology were investigated by low angle X-ray diffractometry, high angle X-ray diffractometry, atomic force microscopy, microhardness, pin-on-disc testing and 3-D surface profiler. The results show that the TiN/TaN coatings exhibit good modulation period and sharp interface between TiN and TaN layers. In mutilayered TiN/TaN coatings, TiN layers have cubic structure, but hexagonal structure emerged among TaN layers besides cubic structure as modulation period is beyond 8.5 nm. The microhardness is affected by modulation period and the maximum hardness value of 31.5 GPa appears at a modulation period of 8.5 nm. The coefficient of friction is high and the wear resistance is improved for TiN/TaN coatings compared with those of TiN coating; the wear mechanism exhibits predominantly ploughing, material transfer and localized spallation.

  14. Final Environmental Assessment for Hypersonic Technology Vehicle 2 Flight Tests (United States)


    Up to four lithium ion and lithium thionyl chloride batteries , each weighing between 1 and 40 lb (0.5 and 18.5 kg) Propulsion Approximately 3 lb...Record HCl Hydrogen Chloride HTV Hypersonic Technology Vehicle ICBM Intercontinental Ballistic Missile INRMP Integrated Natural Resources Management...dual flight termination receivers, radar transponder, batteries , and harnesses. Onboard transmitter (radio frequency) power output varies from 10 to

  15. Environmental Assessment for Hypersonic Technology Vehicle 2 Flight Tests (United States)


    Up to four lithium ion and lithium thionyl chloride batteries , each weighing between 1 and 40 lb (0.5 and 18.5 kg) Propulsion Approximately 3 lb...Record HCl Hydrogen Chloride HTV Hypersonic Technology Vehicle ICBM Intercontinental Ballistic Missile INRMP Integrated Natural Resources Management...dual flight termination receivers, radar transponder, batteries , and harnesses. Onboard transmitter (radio frequency) power output varies from 10 to

  16. Socioeconomic Impact Assessment: Communications Industry. Phase III. Technology Forecast. (United States)


    follows: stagflation, balanced growth, rapid growth. That is, it requires less time to move from ideation to market introduction under a rapid growth...consider the relative relationship among the socio-economic scenarios. The assertions of import include: 1. The period between ideation and market ... introduction for a technology is influenced by the socio-economic scenario. It is likely that the time requirement, i.e. innovation lag, will be ordered as



    Paola Cardamone; Valeria Pupo; Fernanda Ricotta


    This paper analyses the influence of universities on Italian firms’ probability to innovate. Using firm-level data, we focus on institutionalised technology transfer (TT) activities in universities, namely spin-offs, patents and research contracts. Results show that TT activities play a significant role in the probability to innovate by Italian manufacturing firms located in the same province as the university. Nevertheless, the effect is not uniform: the contribution of university TT activit...

  18. Valuing Virtual Worlds: The Role of Categorization in Technology Assessment


    Nardon, Luciara; Aten, Kathryn


    Virtual worlds offer great potential for supporting the collaborative work of geographically distributed teams. However, reports indicate the existence of substantial barriers to the acceptance and use of virtual worlds in business settings. In this paper, we explore how individuals' interpretations of virtual worlds influence their judgments of the value of the technology. We conducted a qualitative analysis set in the context of a large computer and software company that was in the process ...

  19. An Assessment of the Importance of Technologies to Military Capabilities. (United States)


    Utility Analysis ( MAUA ), is employed in studies requiring the quantification of complex alternatives that have values on a large number of alternatives...potential to enhance Soviet ICBM development programs pertaining to reentry vehicle heat shields and nose tips, and to bombs, bomblets, and rockets. MAUA ...the technology. A MAUA model is hierarchical in nature, starting with the specified top-level factor for which an overall score is desired. This

  20. Transportation Electrification Beyond Light Duty: Technology and Market Assessment

    Energy Technology Data Exchange (ETDEWEB)

    Birky, Alicia K. [Energetics Inc., Oak Ridge, TN (United States); Laughlin, Michael [Energetics Inc., Oak Ridge, TN (United States); Tartaglia, Katie [Energetics Inc., Oak Ridge, TN (United States); Price, Rebecca [Energetics Inc., Oak Ridge, TN (United States); Lin, Zhenhong [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)


    This is the final progress report for Lightwave Photonics, Inc. (LPI) Phase I DOE SBIR program entitled “High performance green light emitters on lattice-matched metal templates for advanced networking applications.” The main goal of this SBIR project is to develop and commercialize a fast hyperemission light emitting diode (HE-LED) by utilizing LPI’s proprietary grown-epitaxial metal-mirror (GEMM) technology, for use in plastic optical fiber (POF) communications.

  1. On Assessing the Robustness of Structural Health Monitoring Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Stull, Christopher J. [Los Alamos National Laboratory; Hemez, Francois M. [Los Alamos National Laboratory; Farrar, Charles R. [Los Alamos National Laboratory


    As Structural Health Monitoring (SHM) continues to gain popularity, both as an area of research and as a tool for use in industrial applications, the number of technologies associated with SHM will also continue to grow. As a result, the engineer tasked with developing a SHM system is faced with myriad hardware and software technologies from which to choose, often adopting an ad hoc qualitative approach based on physical intuition or past experience to making such decisions. This paper offers a framework that aims to provide the engineer with a quantitative approach for choosing from among a suite of candidate SHM technologies. The framework is outlined for the general case, where a supervised learning approach to SHM is adopted, and the presentation will focus on applying the framework to two commonly encountered problems: (1) selection of damage-sensitive features and (2) selection of a damage classifier. The data employed for these problems will be drawn from a study that examined the feasibility of applying SHM to the RAPid Telescopes for Optical Response observatory network.

  2. Applying information and communications technologies to collect health data from remote settings: a systematic assessment of current technologies. (United States)

    Ashar, Raj; Lewis, Sheri; Blazes, David L; Chretien, J P


    Modern information and communications technologies (ICTs) are now so feature-rich and widely available that they can be used to "capture," or collect and transmit, health data from remote settings. Electronic data capture can reduce the time necessary to notify public health authorities, and provide important baseline information. A number of electronic health data capture systems based on specific ICTs have been developed for remote areas. We expand on that body of work by defining and applying an assessment process to characterize ICTs for remote-area health data capture. The process is based on technical criteria, and assesses the feasibility and effectiveness of specific technologies according to the resources and constraints of a given setting. Our characterization of current ICTs compares different system architectures for remote-area health data capture systems. Ultimately, we believe that our criteria-based assessment process will remain useful for characterizing future ICTs.

  3. In Situ Remediation Integrated Program, Evaluation and assessment of containment technology

    Energy Technology Data Exchange (ETDEWEB)

    Gerber, M.A.; Fayer, M.J.


    The In Situ Remediation Integrated Program (ISRIP) was established by the US Department of Energy (DOE) to advance the state-of-the art of innovative in situ remediation technologies to the point of demonstration and to broaden the applicability of these technologies to the widely varying site remediation requirements throughout the DOE complex. This program complements similar ongoing integrated demonstration programs being conducted at several DOE sites. The ISRIP has been conducting baseline assessments on in situ technologies to support program planning. Pacific Northwest Laboratory conducted an assessment and evaluation of subsurface containment barrier technology in support of ISRIP`s Containment Technology Subprogram. This report summarizes the results of that activity and provides a recommendation for priortizing areas in which additional research and development is needed to advance the technology to the point of demonstration in support of DOE`s site restoration activities.

  4. Alcohol Assessment Among College Students Using Wireless Mobile Technology* (United States)

    Bernhardt, Jay M.; Usdan, Stuart; Mays, Darren; Martin, Ryan; Cremeens, Jennifer; Arriola, Kimberly Jacob


    Objective: This study used a two-group randomized design to assess the validity of measuring self-reported alcohol consumption among college students using the Handheld Assisted Network Diary (HAND), a daily diary assessment administered using wireless mobile devices. Method: A convenience sample of college students was recruited at a large, public university in the southeastern United States and randomized into two groups. A randomly assigned group of 86 students completed the daily HAND assessment during the 30-day study and a Timeline Followback (TLFB) at 30-day follow-up. A randomly assigned group of 82 students completed the paper-and-pencil Daily Social Diary (DSD) over the same study period. Data from the daily HAND assessment were compared with the TLFB completed at follow-up by participants who completed the HAND using 95% limits of agreement analysis. Furthermore, individual growth models were used to examine differences between the HAND and DSD by comparing the total drinks, drinking days, and drinks per drinking day captured by the two assessments over the study period. Results: Results suggest that the HAND captured similar levels of alcohol use compared with the TLFB completed at follow-up by the same participants. In addition, comparisons of the two study groups suggest that, controlling for baseline alcohol use and demographics, the HAND assessment captured similar levels of total drinks, drinking days, and drinks per drinking day as the paper-and-pencil DSD. Conclusions: The study findings support the validity of wireless mobile devices as a daily assessment of alcohol use among college students. PMID:19737502

  5. Systems dynamics modelling to assess the sustainability of renewable energy technologies in developing countries

    CSIR Research Space (South Africa)

    Brent, AC


    Full Text Available supply, and the related cost implications, for water supply; concentrated solar thermal technology options are currently considered. In this paper a systems dynamics approach is used to assess the sustainability of these types of renewable energy...

  6. A review of the use of information and communication technologies for dietary assessment

    NARCIS (Netherlands)

    Ngo, J.; Engelen, A.; Molag, M.L.; Roesle, J.; Serra-Majem, L.


    Presently used dietary-assessment methods often present difficulties for researchers and respondents, and misreporting errors are common. Methods using information and communication technologies (ICT) may improve quality and accuracy. The present paper presents a systematic literature review describ

  7. A review of the use of information and communication technologies for dietary assessment

    NARCIS (Netherlands)

    Ngo, J.; Engelen, A.; Molag, M.L.; Roesle, J.; Serra-Majem, L.


    Presently used dietary-assessment methods often present difficulties for researchers and respondents, and misreporting errors are common. Methods using information and communication technologies (ICT) may improve quality and accuracy. The present paper presents a systematic literature review

  8. A Methodology for Assessing and Ranking Ballistic Missile Defense Technologies Using a System Performance Index (United States)


    suggestions, and guidance concerning the technology assessment process. References 1. Using ACEIT for Total Ownership Cost Modeling and Analysis...2001 World Population Data Sheet, Population Reference Bureau, Washington, DC List of Acronyms ACEIT – Automated Cost Estimating Integrated

  9. Shadow Mode Assessment Using Realistic Technologies for the National Airspace (SMART NAS) (United States)

    Kopardekar, Parimal H.


    Develop a simulation and modeling capability that includes: (a) Assessment of multiple parallel universes, (b) Accepts data feeds, (c) Allows for live virtual constructive distribute environment, (d) Enables integrated examinations of concepts, algorithms, technologies and National Airspace System (NAS) architectures.

  10. GIS-technologies for integrated assessment of the productive mining areas

    Energy Technology Data Exchange (ETDEWEB)

    Zamaraev, R.Y.; Oparin, V.N.; Popov, S.E.; Potapov, V.P.; Pyastunovich,O.L. [Russian Academy of Sciences, Kemerovo (Russian Federation)


    The paper describes the bases of a new application of GIS-technologies for integrated assessment and comparison of the productive mining areas, involving a wide range of mining and technological factors, considering mineral properties, mineral occurrence conditions and geographical advantages of a mineral deposit location. The model capabilities are exemplified by a comparison of technological characteristics of coals, transportation and power supply infrastructure of the productive mining areas at the Kuznetsk Coal Basin.

  11. The 181Ta Nuclear Quadrupole Interaction in the Charge Density Wave Phases of 1T-TaS2 (United States)

    Ganal, P.; Butz, T.; Lerf, A.; Naito, M.; Nishihara, H.


    With a high resolution time differential perturbed angular correlation spectrometer we investigated the nuclear quadrupole interaction of Ta in 1T-TaS2 . The results obtained for the commensurate charge density wave phase lead to a revised assignment of the previously observed 181Ta NQR resonances. Differences in the intracluster architecture of the 13-atom Star of David cluster between 1T-TaS2 and 1T-TaSe2 could be responsible for the metal to semiconductor transition which occurs in lT-TaS2 but not in lT-TaSe2 .

  12. Review and assessments of potential environmental, health and safety impacts of MHD technology. Final draft

    Energy Technology Data Exchange (ETDEWEB)


    The purpose of this document is to develop an environmental, health and safety (EH and S) assessment and begin a site - specific assessment of these and socio - economic impacts for the magnetohydrodynamics program of the United States Department of Energy. This assessment includes detailed scientific and technical information on the specific EH and S issues mentioned in the MHD Environmental Development Plan. A review of current literature on impact-related subjects is also included. This document addresses the coal-fired, open-cycle MHD technology and reviews and assesses potential EH and S impacts resulting from operation of commercially-installed technology.

  13. Writing Assessment and the Revolution in Digital Texts and Technologies. Language & Literacy Series (United States)

    Neal, Michael


    Writing and the teaching of writing is changing at a rapid pace. How can educators understand writing assessment "as" and "with" technology in the 21st-century classroom? Michael Neal contends that new technologies are neither the problem nor the solution. Instead, educators need to tap into digital resources only inasmuch as they promote writing…

  14. Assessing Community Informatics: A Review of Methodological Approaches for Evaluating Community Networks and Community Technology Centers. (United States)

    O'Neil, Dara


    Analyzes the emerging community informatics evaluation literature to develop an understanding of the indicators used to gauge project impacts in community networks and community technology centers. The study finds that community networks and community technology center assessments fall into five key areas: strong democracy; social capital;…

  15. Real-Time Assessment of Problem-Solving of Physics Students Using Computer-Based Technology (United States)

    Gok, Tolga


    The change in students' problem solving ability in upper-level course through the application of a technological interactive environment--Tablet PC running InkSurvey--was investigated in present study. Tablet PC/InkSurvey interactive technology allowing the instructor to receive real-time formative assessment as the class works through the problem…

  16. Information and Communications Technology (ICT) in Nigeria Educational Assessment System--Emerging Challenges (United States)

    Aworanti, Olatunde Awotokun


    This paper examines Information and Communications Technology (ICT) in Nigeria educational assessment system with its emerging challenges. This is inevitable following the globalisation trend which has brought drastic changes in the world of technology. The essence of the paper is to describe the present status of ICT in the Nigeria educational…

  17. Technology Use in Rwandan Secondary Schools: An Assessment of Teachers' Attitudes towards Geographic Information Systems (GIS) (United States)

    Akinyemi, Felicia O.


    Technology use is evident in all spheres of human endeavour. Focusing on technology use in education, this paper examines teachers' attitudes towards geographic information system (GIS). An assessment was made of GIS teachers in Rwandan secondary schools. Key areas covered include how GIS is implemented in schools, teachers' attitudes and…

  18. Assessing Pre-Service Science Teachers' Technological Pedagogical Content Knowledge (TPACK) through Observations and Lesson Plans (United States)

    Canbazoglu Bilici, Sedef; Guzey, S. Selcen; Yamak, Havva


    Background: Technological pedagogical content knowledge (TPACK) is critical for effective teaching with technology. However, generally science teacher education programs do not help pre-service teachers develop TPACK. Purpose: The purpose of this study was to assess pre-service science teachers' TPACK over a semester-long Science Methods. Sample:…

  19. A Technology Assessment of Personal Computers. Vol. III: Personal Computer Impacts and Policy Issues. (United States)

    Nilles, Jack M.; And Others

    A technology assessment of personal computers was conducted to study both the socially desirable and undesirable impacts of this new technology in three main areas: education, employment, and international trade. Information gleaned from this study was then used to generate suggestions for public policy options which could influence these impacts.…

  20. Using a Student-Centered Model for Assessing Preservice Teachers' Use of Technology in Student Teaching (United States)

    Pratt, David; Stevenson, Heidi J.


    This article describes a student-centered assessment model used at a large university to encourage preservice teachers' use of technology in the K-12 classroom. This model allows preservice teachers to have discretion over the content, form, and time period in which they complete technology proficiencies. More specifically, this article describes…

  1. Field Demonstration of Electro-Scan Defect Location Technology for Condition Assessment of Wastewater Collection Systems (United States)

    The purpose of the field demonstration program is to gather technically reliable cost and performance information on selected condition assessment technologies under defined field conditions. The selected technologies include zoom camera, electro-scan (FELL-41), and a multi-sens...

  2. Problem structuring in health technology assessment : an argumentative approach to increase its usefulness

    NARCIS (Netherlands)

    Moret-Hartman, Margriet


    This thesis addresses the problem of the limited impact of Health Technology Assessment (HTA) research on health policy and clinical practice. HTA is a type of policy research that aims to provide information concerning medical technologies in order to support health care decision making. Although,

  3. A Comparative Study on Emerging Electric Vehicle Technology Assessments

    Energy Technology Data Exchange (ETDEWEB)

    Ford, Jonathan [Sentech, Inc.; Khowailed, Gannate [Sentech, Inc.; Blackburn, Julia [Sentech, Inc.; Sikes, Karen [Sentech, Inc.


    Numerous organizations have published reports in recent years that investigate the ever changing world of electric vehicle (EV) technologies and their potential effects on society. Specifically, projections have been made on greenhouse gas (GHG) emissions associated with these vehicles and how they compare to conventional vehicles or hybrid electric vehicles (HEVs). Similar projections have been made on the volumes of oil that these vehicles can displace by consuming large amounts of grid electricity instead of petroleum-based fuels. Finally, the projected rate that these new vehicle fleets will enter the market varies significantly among organizations. New ideas, technologies, and possibilities are introduced often, and projected values are likely to be refined as industry announcements continue to be made. As a result, over time, a multitude of projections for GHG emissions, oil displacement, and market penetration associated with various EV technologies has resulted in a wide range of possible future outcomes. This leaves the reader with two key questions: (1) Why does such a collective range in projected values exist in these reports? (2) What assumptions have the greatest impact on the outcomes presented in these reports? Since it is impractical for an average reader to review and interpret all the various vehicle technology reports published to date, Sentech Inc. and the Oak Ridge National Laboratory have conducted a comparative study to make these interpretations. The primary objective of this comparative study is to present a snapshot of all major projections made on GHG emissions, oil displacement, or market penetration rates of EV technologies. From the extensive data found in relevant publications, the key assumptions that drive each report's analysis are identified and 'apples-to-apples' comparisons between all major report conclusions are attempted. The general approach that was taken in this comparative study is comprised of six primary

  4. A Comparative Study on Emerging Electric Vehicle Technology Assessments

    Energy Technology Data Exchange (ETDEWEB)

    Ford, Jonathan [Sentech, Inc.; Khowailed, Gannate [Sentech, Inc.; Blackburn, Julia [Sentech, Inc.; Sikes, Karen [Sentech, Inc.


    Numerous organizations have published reports in recent years that investigate the ever changing world of electric vehicle (EV) technologies and their potential effects on society. Specifically, projections have been made on greenhouse gas (GHG) emissions associated with these vehicles and how they compare to conventional vehicles or hybrid electric vehicles (HEVs). Similar projections have been made on the volumes of oil that these vehicles can displace by consuming large amounts of grid electricity instead of petroleum-based fuels. Finally, the projected rate that these new vehicle fleets will enter the market varies significantly among organizations. New ideas, technologies, and possibilities are introduced often, and projected values are likely to be refined as industry announcements continue to be made. As a result, over time, a multitude of projections for GHG emissions, oil displacement, and market penetration associated with various EV technologies has resulted in a wide range of possible future outcomes. This leaves the reader with two key questions: (1) Why does such a collective range in projected values exist in these reports? (2) What assumptions have the greatest impact on the outcomes presented in these reports? Since it is impractical for an average reader to review and interpret all the various vehicle technology reports published to date, Sentech Inc. and the Oak Ridge National Laboratory have conducted a comparative study to make these interpretations. The primary objective of this comparative study is to present a snapshot of all major projections made on GHG emissions, oil displacement, or market penetration rates of EV technologies. From the extensive data found in relevant publications, the key assumptions that drive each report's analysis are identified and 'apples-to-apples' comparisons between all major report conclusions are attempted. The general approach that was taken in this comparative study is comprised of six primary

  5. Ta thickness-dependent perpendicular magnetic anisotropy features in Ta/CoFeB/MgO/W free layer stacks

    Energy Technology Data Exchange (ETDEWEB)

    Yang, SeungMo; Lee, JaBin; An, GwangGuk [Novel Functional Materials and Devices Lab, The Research Institute for Natural Science, Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of); Kim, JaeHong [Division of Nano-Scale Semiconductor Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Chung, WooSeong [Nano Quantum Electronics Lab, Department of Electronics and Computer Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of); Hong, JinPyo, E-mail: [Novel Functional Materials and Devices Lab, The Research Institute for Natural Science, Department of Physics, Hanyang University, Seoul 133-791 (Korea, Republic of); Division of Nano-Scale Semiconductor Engineering, Hanyang University, Seoul 133-791 (Korea, Republic of)


    We describe Ta underlayer thickness influence on thermal stability of perpendicular magnetic anisotropy in Ta/CoFeB/MgO/W stacks. It is believed that thermal stability based on Ta underlay is associated with thermally-activated Ta atom diffusion during annealing. The difference in Ta thickness-dependent diffusion behaviors was confirmed with X-ray photoelectron spectroscopy analysis. Along with a feasible Ta thickness model, our observations suggest that an appropriate seed layer choice is needed for high temperature annealing stability, a critical issue in the memory industry. - Highlights: • We observed changes in the diffusion behavior with regard to Ta seed layer thickness. • It was observed that a thinner Ta seed layer induced more annealing-stable features. • However, ultra-thin (0.75 nm) Ta shows unstable characteristics about the annealing process. • It was possibly due to a rugged interface of the Ta layer by the island growth process.

  6. The use of technology in a model of formative assessment

    Directory of Open Access Journals (Sweden)

    Alfonsa García López


    Full Text Available This work describes a formative assessment model for the Mathematical Analysis course taken by engineering students. It includes online questionnaires with feedback, a portfolio with weekly assignments, exams involving the use of mathematical software and a project to be completed in small groups of two or three students. The model has been perfected since 2009, and during the 2014-15 academic year the creation of a pilot online learning community was added. Based on Google+, it has been used for a peer assessment experiment involving student projects, among other uses.

  7. DNAPLs at DOE sites: Background and assessment of characterization technologies

    Energy Technology Data Exchange (ETDEWEB)

    Junk, G.A.; Haas, W.J. Jr.


    The Characterization, Monitoring, and Sensor Technology Integrated Program (CMST-IP) within the Office of Technology Development (OTD) has responsibility for identification, evaluation, and delivery of technologies needed for the work of the Department of Energy`s Office of Environmental Restoration and Waste Management. This report addresses part of that responsibility by providing summary information on DNAPL site characterization. A dense nonaqueous phase liquid (DNAPL) is a source of contamination that can persist in the subsurface for decades before dissipating completely into the vapor phase and groundwater. The DNAPL chemicals of particular concern to the DOE are chlorinated volatile organic compounds (Cl VOCS) such as carbon tetrachloride (CCl{sub 4}), trichloroethylene (TCE), and perchloroethylene (PCE). These Cl VOCs were used in multiple ton quantities at DOE sites and were often released to the subsurface. The predicted fate of released Cl VOC liquid is downward movement through the soil under the force of gravity. As it moves, some of the Cl VOC liquid becomes trapped in the soil pores as residual saturation. The liquid also moves rapidly downward if small fractures are present. This migration continues until an impermeable or semi-permeable layer is encountered. Then lateral movement or spreading occurs. The downward and lateral migration in the subsurface leads to DNAPL pools, lenses, and residual saturation that can cause long-term contamination of groundwater at levels well above drinking water standards. Although Cl VOCs have been detected as dissolved components in the groundwater and as vapor in the soil gas at several DOE sites, direct evidence of their presence as DNAPL is sparse and no measurements of the amounts of DNAPL present within a given volume of subsurface have been made. Consequently, unresolved DNAPL issues exist at DOE sites.

  8. Information and Communication Technology (ICT Literacy: Integration and Assessment in Higher Education

    Directory of Open Access Journals (Sweden)

    Irvin R. Katz


    Full Text Available Despite coming of age with the Internet and other technology, many college students lack the information and communication technology (ICT literacy skills—--locating, evaluating, and communicating information—--necessary to navigate and use the overabundance of information available today. This paper presents a study of the validity of a simulations-based assessment of ICT literacy skills. Our overall goals for the assessment are to support ICT literacy instructional initiatives at colleges and universities.

  9. Early stage health technology assessment (HTA) of biomedical devices: the MATCH experience


    Pecchia, Leandro; Craven, Michael P


    Early stage Health Technology Assessment (HTA) of biomedical devices requires different methods than those usually employed for pharmaceuticals. This paper reviews widely used methods for HTA, discusses their limits for early stage evaluation of biomedical devices and presents two methods for early stage HTA being developed in the Multidisciplinary Assessment of Technology Centre for Healthcare (MATCH) project: Analytic Hierarchy Process (AHP) to elicit user needs; and early stage economic ev...

  10. Early Stage Health Technology Assessment for Precision Biomarkers in Oral Health and Systems Medicine


    Steuten, Lotte M.G.


    Health technology assessment (HTA) is a crucial science that influences the responsible and evidence-based transition of new discoveries from laboratory to applications in the clinic and society. HTA has recently moved “upstream” so as to assess technologies from their onset at their discovery, design, or planning phase. Biomarker research is relatively recent in oral health, but growing rapidly with investments made to advance dentistry and oral health and importantly, to build effective bri...

  11. Early stage health technology assessment (HTA) of biomedical devices: the MATCH experience


    Pecchia, Leandro; Craven, Michael P


    Early stage Health Technology Assessment (HTA) of biomedical devices requires different methods than those usually employed for pharmaceuticals. This paper reviews widely used methods for HTA, discusses their limits for early stage evaluation of biomedical devices and presents two methods for early stage HTA being developed in the Multidisciplinary Assessment of Technology Centre for Healthcare (MATCH) project: Analytic Hierarchy Process (AHP) to elicit user needs; and early stage economic e...





    This paper intends to assess the technological process of obtaining drinking water at Targu-Mures water treatment plant. The assessment was performed before changing the technological process and four months were chosen to be analized during 2008: January, April, July and October for its efficiency analysis on treatment steps. Mures River is the water source for the water treatment plant, being characterized by unsteady flow and quality parameters with possible important variability in a very...

  13. Range of technology choices in life cycle assessment of environmental treatment technologies

    DEFF Research Database (Denmark)

    Henriksen, Trine; Astrup, Thomas Fruergaard; Damgaard, Anders

    of specification of the technological and geographical coverage of the study. For example, for global warming potential, the global maximum value is 2.6 times larger than the global minimum value and, for human toxicity, carcinogenic, the global maximum value is 45 times larger than the global minimum value......Limited data availability and local differences of environmental treatment technologies lead to the use of sub-optimal data and choices of single datasets, where multiple data choices may be representative. The use of data not representing the entire coverage of an LCA study can cause a bias....... This conclusions was described in a step-wise approach for representative data choices and modelling. The outcomes shed light on the potential spread caused by discrete data choices in the modelling of environmental treatment technologies....

  14. Technology Assessment of Doe's 55-we Stirling Technology Demonstrator Convector (TDC) (United States)

    Furlong, Richard; Shaltens, Richard


    The Department of Energy (DOE), Germantown, Maryland and the NASA Glenn Research Center (GRC), Cleveland, Ohio are developing a Stirling Convertor for an advanced radioisotope power system as a potential power source for spacecraft on-board electric power for NASA deep space science missions. The Stirling Convertor is being evaluated as an alternative high efficiency power source to replace Radioisotope Thermoelectric Generators (RTGs). Stirling Technology Company (STC), Kennewick, Washington, is developing the highly efficient, long life 55-We free-piston Stirling Convertor known as the Technology Demonstrator Convertor (TDC) under contract to DOE. GRC provides Stirling technology expertise under a Space Act Agreement with the DOE. Lockheed Martin Astronautics (LMA), Valley Forge, Pennsylvania is the current power system integrator for the Advanced Radioisotope Power System (ARPS) Project for the DOE. JPL is responsible for the Outer Planets/Solar Probe Project for NASA.

  15. Ethically sound technology? Guidelines for interactive ethical assessment of personal health monitoring. (United States)

    Palm, Elin; Nordgren, Anders; Verweij, Marcel; Collste, Göran


    Novel care-technologies possess a transformational potential. Future care and support may be provided via monitoring technologies such as smart devices, sensors, actors (robots) and Information and Communication Technologies. Such technologies enable care provision outside traditional care institutions, for instance in the homes of patients. Health monitoring may become "personalized" i.e. tailored to the needs of individual care recipients' but may also alter relations between care providers and care recipents, shape and form the care environment and influence values central to health-care. Starting out from a social constructivist theory of technology, an interactive ethical assessment-model is offered. The suggested model supplements a traditional analysis based on normative ethical theory (top-down approach) with interviews including relevant stakeholders (a bottom-up approach). This method has been piloted by small-scale interviews encircling stakeholder perspectives on three emerging technologies: (1) Careousel, a smart medicine-management device, (2) Robot Giraff, an interactive and mobile communication-device and (3) I-Care, a care-software that combines alarm and register system. By incorporating stakeholder perspectives into the analysis, the interactive ethical assessment model provides a richer understanding of the impact of PHM-technologies on ethical values than a traditional top-down model. If the assessment is conducted before the technology has reached the market - preferably in close interaction with developers and users - ethically sound technologies may be obtained.

  16. Executive summary. Western oil shale developmet: a technology assessment

    Energy Technology Data Exchange (ETDEWEB)


    The objectives are to review shale oil technologies as a means of supplying domestically produced fuels within environmental, social, economic, and legal/institutional constraints; using available data, analyses, and experienced judgment, to examine the major points of uncertainty regarding potential impacts of oil shale development; to resolve issues where data and analyses are compelling or where conclusions can be reached on judgmental grounds; to specify issues which cannot be resolved on the bases of the data, analyses, and experienced judgment currently available; and when appropriate and feasible, to suggest ways for the removal of existing uncertainties that stand in the way of resolving outstanding issues.

  17. Spin polarization effect for molecule Ta2

    Institute of Scientific and Technical Information of China (English)

    Xie An-Dong


    Density functional theory (DFT) (B3p86) has been used to optimize the structure of the molecule Taa- The result shows that the ground state of molecule Ta,2 is a 7- multiple state and its electronic configuration is 7∑+u which shows the spin polarization effect for molecule Ta2 of transition metal elements for the first time. Meanwhile, spin pollution has not been found because the wavefunction of the ground state does not mix with those of higher states. So, the fact that the ground state of molecule Ta2 is a 7-multiple state indicates a spin polarization effect of molecule Ta2 of the transition metal elements, i.e. there exist 6 parallel spin electrons and the non-conjugated electrons are greatest in number. These electrons occupy different space orbitals so that the energy of molecule Ta2 is minimized. It can be concluded that the effect of parallel spin of the molecule Ta2 is larger than the effect of the conjugated molecule, which is obviously related to the effect of d-electron delocalization. In addition, the Murrell-Sorbie potential functions with parameters for the ground state 7∑+u and other states of the molecule Ta2 are derived. The dissociation energy De, equilibrium bond length Re and vibration frequency ωe for the ground state of molecule Ta2 are 4.5513eV, 0.2433nm and 173.06cm-1, respectively. Its force constants f2,f3 and f4 are 1.5965×l02aJ·nm-2,-6.4722×l03aJ·nm-3 and 29.4851×04aJ·nm-4, respectively. Other spectroscopic data ωe χe, Be and αe for the ground state of Ta2 are 0.2078cm-1, 0.0315cm-1 and 0.7858×104 cm-1, respectively.

  18. Algorithm for automatic forced spirometry quality assessment: technological developments. (United States)

    Melia, Umberto; Burgos, Felip; Vallverdú, Montserrat; Velickovski, Filip; Lluch-Ariet, Magí; Roca, Josep; Caminal, Pere


    We hypothesized that the implementation of automatic real-time assessment of quality of forced spirometry (FS) may significantly enhance the potential for extensive deployment of a FS program in the community. Recent studies have demonstrated that the application of quality criteria defined by the ATS/ERS (American Thoracic Society/European Respiratory Society) in commercially available equipment with automatic quality assessment can be markedly improved. To this end, an algorithm for assessing quality of FS automatically was reported. The current research describes the mathematical developments of the algorithm. An innovative analysis of the shape of the spirometric curve, adding 23 new metrics to the traditional 4 recommended by ATS/ERS, was done. The algorithm was created through a two-step iterative process including: (1) an initial version using the standard FS curves recommended by the ATS; and, (2) a refined version using curves from patients. In each of these steps the results were assessed against one expert's opinion. Finally, an independent set of FS curves from 291 patients was used for validation purposes. The novel mathematical approach to characterize the FS curves led to appropriate FS classification with high specificity (95%) and sensitivity (96%). The results constitute the basis for a successful transfer of FS testing to non-specialized professionals in the community.

  19. Algorithm for automatic forced spirometry quality assessment: technological developments.

    Directory of Open Access Journals (Sweden)

    Umberto Melia

    Full Text Available We hypothesized that the implementation of automatic real-time assessment of quality of forced spirometry (FS may significantly enhance the potential for extensive deployment of a FS program in the community. Recent studies have demonstrated that the application of quality criteria defined by the ATS/ERS (American Thoracic Society/European Respiratory Society in commercially available equipment with automatic quality assessment can be markedly improved. To this end, an algorithm for assessing quality of FS automatically was reported. The current research describes the mathematical developments of the algorithm. An innovative analysis of the shape of the spirometric curve, adding 23 new metrics to the traditional 4 recommended by ATS/ERS, was done. The algorithm was created through a two-step iterative process including: (1 an initial version using the standard FS curves recommended by the ATS; and, (2 a refined version using curves from patients. In each of these steps the results were assessed against one expert's opinion. Finally, an independent set of FS curves from 291 patients was used for validation purposes. The novel mathematical approach to characterize the FS curves led to appropriate FS classification with high specificity (95% and sensitivity (96%. The results constitute the basis for a successful transfer of FS testing to non-specialized professionals in the community.

  20. Technology-Enhanced Formative Assessment of Plant Identification (United States)

    Conejo, Ricardo; Garcia-Viñas, Juan Ignacio; Gastón, Aitor; Barros, Beatriz


    Developing plant identification skills is an important part of the curriculum of any botany course in higher education. Frequent practice with dried and fresh plants is necessary to recognize the diversity of forms, states, and details that a species can present. We have developed a web-based assessment system for mobile devices that is able to pose appropriate questions according to the location of the student. A student's location can be obtained using the device position or by scanning a QR code attached to a dried plant sheet in a herbarium or to a fresh plant in an arboretum. The assessment questions are complemented with elaborated feedback that, according to the students' responses, provides indications of possible mistakes and correct answers. Three experiments were designed to measure the effectiveness of the formative assessment using dried and fresh plants. Three questionnaires were used to evaluate the system performance from the students' perspective. The results clearly indicate that formative assessment is objectively effective compared to traditional methods and that the students' attitudes towards the system were very positive.